4NQFA

Crystal structure of hepn domain protein
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
b'LSPADALRVAEDHFLRHMPDARDFADVAKYLVAKGNLHLAAFNLHQAVETAYNCYLLTLTNYSPASHNMKFLRGLSEGRDRRLIDIWPRDRQRFTTWYNIMNEAYVKARYSKRFEVSEEALTWLQERTAELHKLVETLCREHIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleotidyltransferase
publication title Dimerization of VirD2 Binding Protein Is Essential for Agrobacterium Induced Tumor Formation in Plants
pubmed doi rcsb
source organism Agrobacterium fabrum
molecule tags Transferase
total genus 51
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4nqfA00
2KK1A 3C8GD 1KTMA 1PV3A 1K40A 2JX0A 2YWAA 3L8JA 1OW6A 4R32A 2L6FA 4XEVA 1O3UA 5F28E 4EBJA 1UFBA 3K7DA 1ZZPA 3MFNA 3JZ0A 1K04A 3GM2A 3S9OA 1WOLA 1WWPA 2L6GA 1JOGA 3BRJA 1WTYA 3GM3A 2JPUA 4NQFA 3RQFA 3L8IA 2L6HA 1K05A 3RQEA 3U0CA 3C8GA 1QVXA 3C18A 4XEFA 3O10A 3GM1A 3U3FA 1KNYA 3AJMA 1OW8A 1OW7A 1V4AA 3C8GB 3RQGA 4EBKA 4XEKA 3TULA 3B71A 2HSBA 2PBEA 2Q00A 3JYYA 2LK4A
chains in the Genus database with same CATH superfamily
3GEEA 3AGTA 4DVYP 1KTMA 5TJ5E 3TJ5A 1V55C 1RKEB 2J9VA 3NDBB 1O3UA 4MNDA 3GWLA 3RIPA 2IXNA 1F1MA 2CYDA 5FCLA 3MBGA 3HLZA 4JE9A 1E83A 2IXPA 2ZXPA 3LS1A 5L3QA 4Q5SF 4LLCA 1T6UA 3DXJF 2NUTB 3RF3A 2AVKA 1ORSC 3S29A 1YYXA 4IB4A 2W9YA 3BEHA 3QMKA 1RMVA 3C18A 1Z5ZA 4I44A 2LCHA 5DQZA 3TOMA 3HNJA 2XLMA 4OIPF 2J7PD 3O10A 3U9MA 4OIRF 2Q9AA 5BQHA 2HS5A 4LLEA 2B0HA 3A11A 4QI2A 3PMRA 3B0VC 1A7EA 3A9CA 2DB4A 2OJED 1VYKA 4IWBA 4Z9IA 2PBEA 1OCCC 2PX3A 2A0UA 5EGYA 1A41A 2GAQA 2JD3A 1K40A 2YWAA 1SF8A 1Z3IX 2FAPB 1M2VA 4O6MA 4AL0A 2H7VC 2VC9A 2OCCC 4JVSA 4Q7CA 3WAQA 2CCYA 5A6AA 2HV7A 3FOOA 5L0GA 4P9TA 5AC4A 3LESA 3UGOA 2WZLA 3I4UA 1YA7O 4KBLA 2R7SA 1CGOA 1ZYRF 4LDRA 3TD7A 1OXKA 3PDMP 4OIOF 1S7ZA 2Y3GA 1QLEC 2IXMA 1ORJA 4JURI 2CDQA 2KSFA 3KPHA 1NFOA 1QSPA 4OIQF 4MVUA 1A7DA 3VAYA 3DE8A 5HSWA 3J06A 3EFOB 4NCQA 2X51A 3ASOC 3HNLA 3WHNA 2CNWD 2KYHA 4HEAJ 2AWYA 4WGZA 4BJ1A 2VCCA 1PCXA 2D4UA 3GORA 2L9JA 1MNDA 2LSEA 3W8HA 4C3BA 4BJ6C 2Q00A 2WZGA 4CJGA 1R4TA 3M79A 1TQGA 4NY3A 1LS4A 2GDCA 3ABLC 4QI0A 4ONSA 3ABMC 3MFNA 4MVZA 4PJLA 4PJNA 4YL0A 3U3BA 1NU9C 3I5QA 3FDQA 2NSFA 4U5EE 1APCA 4U5BE 2OG2A 3IHUA 4MW3A 1MMDA 3TQOA 3EGDB 3V5XA 3W8IA 4BJTA 5L0JA 1B68A 1BR4A 1AVOB 2EIMC 2KNHA 3M4CA 1T01A 4K0DA 2J9UA 2KJGA 4JTCB 2XS8A 3S28A 1J8YF 1E85A 2YZSA 2KW3C 3NMKA 1D0ZA 3AG2C 2QUPA 3GWNA 1OW7A 1OW8A 3PCVA 2ETSA 4G78A 4U5FE 3SYNA 2Y39A 3JT1A 1TFOB 4LERA 2ZXRA 1WGWA 1E2XA 2BE5F 2R7QA 4PR9A 3ZC4A 4BJ5A 2YL3A 1I4ZA 4ZLCA 3L8JA 2I15A 2P7VA 2XSEA 2HJMA 3FAJA 2HFIA 2HSQA 3LJBA 3MYIA 1R5ID 5KYXA 3Q7LA 1NFNA 1LI7A 5T3WA 2DYSC 3B0PA 4U5HA 2NUPA 3L34A 1Z6AA 2EIJC 2FGYA 2L81A 1TFKB 3EZIA 2P0NA 4IRUA 3JRMO 4OINF 1Q0MA 2J45A 4WABA 4U9EA 4ZLDA 3SXKA 2QLAA 4K7BA 3EGXA 3O6XA 4JJGA 3RYLA 3EG9A 3SXZA 3ZTMA 5L0CA 3K6BA 5KYWA 5EK0A 1G4US 2L7AA 2YEVA 2AWCA 4EKWA 3LEOA 1WASA 4N6HA 2EINC 4N4WA 4XQ1A 1ZU4A 3T9OA 3ZVRA 2R03A 4BPMA 1L3PA 1ZU5A 4L6RA 4PFOA 4YT5A 5KYUA 1DOVA 2XLVA 1WN0A 3KH2A 3S0XA 3G50A 3EZHA 1OR3A 1N1CA 3IQ5A 2R25A 1XZQA 4NTFA 2R7OA 4NTBA 1OCRC 1KU2A 2LK4A 2YL0A 3TOLA 2OQMA 1MMAA 2PNOA 2YQYA 4RD9A 3U8VA 1T5OA 5L3VA 4CIPA 1C03A 1RKCA 5JLIA 1NSGB 3AOUA 3JZ0A 3RVZA 2WL8A 1IW7F 2XL6A 2Y3HA 3BRJA 4UDVA 2VCBA 3K66A 1AEPA 3HJCA 2WZFA 1K05A 3CAXA 3CEXA 3RQEA 1QZXA 1HW1A 2GWWA 3V7OA 1HE9A 1I5NA 256BA 4IARA 4CSAC 3H65A 1YJGA 2LIGA 3UR3C 3EQLF 2MWQA 2WVQA 2AU5A 2YVKA 3UMHA 5HV9A 3SP1A 2VASA 1JAFA 3RH3A 3G4XA 4G7OF 1MNEA 1T9KA 2LFFA 1U89A 4MS2A 1RKEA 4LDKA 5T1DB 3DM5A 5F5FA 2EPLX 3ATPA 1EQ1A 3FMSA 1M2OA 2KK1A 1H9GA 2DYRC 4D4NA 3QVYA 4WGYA 1C02A 1GQAA 4IJJA 1OKKA 4U5GA 1LKXA 1OW6A 2Z15A 4KI2A 1YDIA 3OEOA 4CDYA 4YT4A 3M15A 1LE4A 1BR2A 2M4EA 5E3AA 5B1BC 4K1OA 3B29A 2NUTA 3U2MA 5AC5A 4G7HF 1Y4CA 3NMJA 2HKVA 1FTSA 4CS8C 1OQCA 1YARO 3R2PA 3RQFA 3JSEO 2JPUA 2VCAA 4CS9A 5L0FA 2L6HA 4CS8A 3ZQVA 2P1AA 3ABKC 2EPMX 2LFDA 2ZXOA 5A6JA 3F47A 3RW0A 4Z9JA 5JT4A 2RD9A 3GM1A 1Q0FA 2IOQA 3AJMA 3ITFA 3ZG1A 4BG0A 4EBKA 1VYIA 1OR2A 3FOPA 3IQCA 3B0UX 3ECSA 1YVIA 3EJNA 4M63A 3UGPA 1Q0KA 2EPKX 1PV3A 1S05A 2LP4A 4JZAA 2YRFA 3DI5A 2Q4FA 3M1CB 4MVQA 1C17M 1M6TA 1VLTA 4A2NB 2EILC 2Q3TA 2HMQA 4MVMA 4C7OA 2J9WA 1JOGA 1WTYA 4BJ6A 2OEVA 3EFOA 1ST6A 4Z9HA 3E9VA 5DLJA 2V3CC 1DOWA 1QVXA 3NYJA 4XPYA 1NU7D 3K1IC 3IPMO 4MVSA 5JS5A 4C7OB 2R7VA 3V5ZA 4JIOA 1OCOC 4BEMJ 1TWHA 1HMDA 2A68F 3DM9B 5KYYB 2YLGA 2R7WA 2KGOA 4O6NA 5DS5A 1GGQA 4DVZA 1YZCA 3L1MA 3L8IA 4J7TA 5D91A 1ZW3A 3T6JA 4HE8D 1H7IA 2J46A 2J7PA 3S27A 4EBJA 4R32A 1YA9A 3FAPB 3HTKC 4B6IA 2BC5A 1A0BA 3IQ6A 3EGDA 1ZZPA 3K7DA 4O79A 3AG3C 3KKBA 1VLSA 3SXMA 4P6IC 2V26A 3C63A 2B0JA 1EA8A 3DE9A 5COFA 2PFDA 2VH3A 2MHRA 2GA0A 3K33A 1HW2A 1Q0DA 4H54A 2XLWA 2M64A 2QTVA 2XXAB 4O6YA 1MMNA 1NLXA 3GEIA 4OD4A 4J30B 1FMWA 2CW0F 1CGNA 1M56C 1KNYA 5D92A 3U3FA 1FFTC 3U8PA 2IYLD 1YZAA 5A6KA 5KYNA 2TMVP 1JPNA 4FX5A 3TULA 2XLHA 3M4BA 3WG7C 4AE4B 3N0TA 4X0RA 1JMWA 3DZAA 4KC9A 4YT2A 4W8KA 4C3DA 3Q7GA 5BQGA 3C8GD 1UG7A 1ZW2A 1TWGA 1Y6DA 3C62A 3EPVA 3EHMA 5GPGB 1M57C 1TR2A 4O7GA 2A0BA 3C7JA 4XPWA 4EHPA 2Y3DA 3LUTB 1QQ3A 4JCHA 3AG4C 1LIHA 3KL4A 4P9FA 5E3CA 1BZ4A 2R7UA 2ZPAA 2G62A 3PHF2 5L0DA 1VB5A 4CJOA 1V74B 4FESA 4NTAA 2XL4A 4J32B 4MVOA 1L7CA 4PJJA 2G3VA 5JRAA 1TKNA 1T6IA 1LVKA 3GODA 3HNIA 1V4AA 3POVA 1Z63A 5COGA 3UMKA 3HKKA 3JRTA 2DGJA 3CQZA 4U5DE 4CDVA 5K0IA 5JVEA 3UMIA 2WB7A 1FAPB 1Z23A 1A7VA 2OOCA 1V54C 4CSAA 2R7RA 4ULWA 1HE1A 2OU6A 4E7SA 2GFHA 4KNWA 3W2WA 1JRAA 3KYJA 2W4BA 3NKDA 4WJ0A 3NYMA 3RVYA 4E0HA 4JW1A 3JCUQ 1RXQA 3NMIA 2J0WA 3GM2A 2J9BA 3JSZA 2R7TA 4FWVA 4JTAB 3OWTA 3W2VA 1U0BB 3DWWA 2OKUA 4KNVA 4AL1A 4Q4ZF 5BUOA 5IY5C 5EHHA 5BQIA 4DRHB 1CPRA 2XM4A 3NYLA 4MQ9F 2IM8A 3W4YA 2NSGA 4U9DA 1NG1A 2HZ8A 3TK0A 5F5HA 2XLEA 2QY9A 2A69F 3C8GB 3WODF 3Q6NA 5A6BA 1RJ9B 1U6HA 2R02A 3LLKA 3KYIA 3NKEA 1FFHA 4U5CE 1QPUA 5T3TA 3QW0A 3K1HA 1OXBA 3EH1A 4YJWA 3DKAA 2MYSA 1E86A 2WVOA 5JP7A 4XTKA 4YL3A 5AGFA 4HFFB 2L6GA 4NC3A 2ICWG 3QZCA 1AUEA 2R05A 3NG1A 4YL1A 3AGUA 2P61A 1D0YA 3FXHA 3T6GB 1RCPA 2YHSA 4IGGA 5DS6A 3U0CA 1T6QA 1GM5A 2IBFA 4MW8A 2A1DD 3AQCA 2NPUA 4MTOA 3V5YA 4E0IA 4XLPF 4J7YA 1WATA 3NRHA 5L0HA 2H7BA 1XWJA 3U5SA 3QW1A 4XEKA 4PK4A 4GYTA 2XM0A 3O55A 4CX9A 1G5ZA 1ORYA 5JSLA 2QNLA 3K1IA 1H6GA 1ZHZA 3FVYA 4IAQA 2CGEA 1G8XA 1OCZC 4DOZA 4MVRA 4G0HA 5CI9A 4MTGA 1FNTc 2HV6A 1FMVA 3QTHA 1D1AA 3GM3A 3L0IA 3T4RA 3RKOF 4CIHA 4E17A 4N06A 5E2QA 2YKZA 4DBQA 1CPQA 5KYYA 4JC7A 1QKRA 3ZDLA 1E84A 4DBRA 2UUIA 3E70C 4YN0B 4DJ9A 3VRCA 2D5RB 3AQBA 3CZ6A 5DS4A 3N24A 1NBBA 2J0XA 1HY5A 1LI5A 3S84A 2L6FA 1BDJB 4JKVA 5L0IA 5DQTA 1W2WA 2LQGA 3ZSUA 4EUKB 3DJUB 4ULVA 4HFKB 1K04A 3CSKA 4PFPA 2C03A 1D1BA 2C04A 1M2VB 1WWPA 3C8ZA 3G4ZA 4JRZA 4F4BA 2XXAA 1FR0A 1JR8A 2RSEB 1O5HA 2XLOA 1ZHXA 1YLMA 3SNHA 4RBNA 4AE4A 3VF0A 1EI7A 3MX3A 1GS9A 1LPEA 2Y3BA 1SZIA 4LACB 4CDAA 3DMDA 4CS7A 1SYQA 3B9QA 1G4WR 3IEEA 2VB6A 4GQHA 2XS1A 4GEHA 4LDQA 3RFYA 4AX2A 4DXWA 3KMIA 2EIKC 4E18A 5COMA 1TWAA 3QVZA 1LS1A 2F22A 3GANA 3JYYA 3ASNC 2A6HF 3VYWA 2P6VA 2JX0A 3H2VA 4IAOA 2EPNA 2HJ3A 3DAFA 4XEVA 5F28E 1SR2A 2IXOA 1I4YA 1YAUO 2LD6A 2H8AA 3LAYA 3DJNB 2CNWA 1BR1A 2XLDA 3MLGA 3S9OA 2ZD9A 1WOLA 5B1AC 3GEHA 4I1MA 1VTMP 5B3SC 4DRIB 3JTLO 4D4XA 2YLDA 1YYJA 4XLNF 3T6BA 1XZPA 4H4KC 2W45A 1IZMA 1Z7Qc 3DAGA 3HNKA 4W8PA 2KQ9A 4MTFA 4XPXA 2R9RB 3U2LA 4E7ZA 1D0XA 2Q9BA 3RQGA 4CBEA 4CS9C 1ZHWA 3ZQYA 3EHNA 4FAPB 1CGME 2NG1A 4YT8A 2ZXWC 1O87A 2OEXA 1PD0A 2WVNA 1MMGA 4QDLA 1EKYA 2ASRA 1VK5A 4AK9A 3AG1C 1Q0GA 2BL2A 2W4MA 3ZWIA 1NZEA 4PACA 1ZVZA 3R7CA 4YK5A 5FZTA 4I3MA 4DRJB 5A6BD 4JEAA 2O9XA 4EWCA 2E87A 2PP4A 1D1CA 4G7ZF 1J8MF 2HMZA 2XL8A 1VMAA 1HMOA 3H2UA 4ER9A 5KYXB 2NUPB 3C8GA 4ANJA 4BJ5C 1LM3B 1RJ9A 3DD7A 3SZRA 3OA1A 4C3EA 5JUAA 3Q6MA 1OKKD 3UNGC 3JYHA 3EGXB 3EG9B 4JEBA 5KYWB 4A4AA 3LS0A 5DVWA 3O39A 2YL7A 3X1OA 4PJMA 2H7OA 3B71A 2PX0A 2QE9A 1MQVA 2HUJA 5KYUB 3LLIA 3N2ZB 3I5PA 3VM6A 5A69A 3ZTZA 3MYFA 4RDAA 2YL1A 5E33A 3F46A 4EBBA 3EH2A 2OJQA 2Y69C 1UFBA 2FFHA 4JTDB 1TWCA 4YWQA 4OD5A 2UUHA 2X0CA 2R7XA 2G3KA 1LE2A 4JCZA 2Q7RA 2Q9CA 3LEVA 3LNMB 2YLIA 4NQFA 1ZHYA 2EPOA 2J8WA 5CIVA 4N6CA 3SEOA 2AP3A 3U9JA 4XEFA 2DI3A 4EIYA 2PF4E 1JPJA 3ZIBA 2A6EF 2KC3A 2XRHA 3LNRA 4I1OB 3S90A 5B3IA 1PD1A 1VOMA 3IQTA 1BBHA 3SXYA 1SMYF 3US6A 2HSBA 1ZHTA 3FHDA 3TJ6A 5CI8A 4XWJA 3X2QC 4JJFA 1H9TA 2I8BA 4BEJA
chains in the Genus database with same CATH topology
2KK1A 3C8GD 1KTMA 1PV3A 1K40A 2JX0A 2YWAA 3L8JA 1OW6A 4R32A 2L6FA 4XEVA 1O3UA 5F28E 4EBJA 1UFBA 3K7DA 1ZZPA 3MFNA 3JZ0A 1K04A 3GM2A 3S9OA 1WOLA 1WWPA 2L6GA 1JOGA 3BRJA 1WTYA 3GM3A 2JPUA 4NQFA 3RQFA 3L8IA 2L6HA 1K05A 3RQEA 3U0CA 3C8GA 1QVXA 3C18A 4XEFA 3O10A 3GM1A 3U3FA 1KNYA 3AJMA 1OW8A 1OW7A 1V4AA 3C8GB 3RQGA 4EBKA 4XEKA 3TULA 3B71A 2HSBA 2PBEA 2Q00A 3JYYA 2LK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK1 A;  3C8G D;  1KTM A;  1PV3 A;  1K40 A;  2JX0 A;  2YWA A;  3L8J A;  1OW6 A;  4R32 A;  2L6F A;  4XEV A;  1O3U A;  5F28 E;  4EBJ A;  1UFB A;  3K7D A;  1ZZP A;  3MFN A;  3JZ0 A;  1K04 A;  3GM2 A;  3S9O A;  1WOL A;  1WWP A;  2L6G A;  1JOG A;  3BRJ A;  1WTY A;  3GM3 A;  2JPU A;  4NQF A;  3RQF A;  3L8I A;  2L6H A;  1K05 A;  3RQE A;  3U0C A;  3C8G A;  1QVX A;  3C18 A;  4XEF A;  3O10 A;  3GM1 A;  3U3F A;  1KNY A;  3AJM A;  1OW8 A;  1OW7 A;  1V4A A;  3C8G B;  3RQG A;  4EBK A;  4XEK A;  3TUL A;  3B71 A;  2HSB A;  2PBE A;  2Q00 A;  3JYY A;  2LK4 A; 
#chains in the Genus database with same CATH topology
 3GEE A;  3AGT A;  4DVY P;  1KTM A;  5TJ5 E;  3TJ5 A;  1V55 C;  1RKE B;  2J9V A;  3NDB B;  1O3U A;  4MND A;  3GWL A;  3RIP A;  2IXN A;  1F1M A;  2CYD A;  5FCL A;  3MBG A;  3HLZ A;  4JE9 A;  1E83 A;  2IXP A;  2ZXP A;  3LS1 A;  5L3Q A;  4Q5S F;  4LLC A;  1T6U A;  3DXJ F;  2NUT B;  3RF3 A;  2AVK A;  1ORS C;  3S29 A;  1YYX A;  4IB4 A;  2W9Y A;  3BEH A;  3QMK A;  1RMV A;  3C18 A;  1Z5Z A;  4I44 A;  2LCH A;  5DQZ A;  3TOM A;  3HNJ A;  2XLM A;  4OIP F;  2J7P D;  3O10 A;  3U9M A;  4OIR F;  2Q9A A;  5BQH A;  2HS5 A;  4LLE A;  2B0H A;  3A11 A;  4QI2 A;  3PMR A;  3B0V C;  1A7E A;  3A9C A;  2DB4 A;  2OJE D;  1VYK A;  4IWB A;  4Z9I A;  2PBE A;  1OCC C;  2PX3 A;  2A0U A;  5EGY A;  1A41 A;  2GAQ A;  2JD3 A;  1K40 A;  2YWA A;  1SF8 A;  1Z3I X;  2FAP B;  1M2V A;  4O6M A;  4AL0 A;  2H7V C;  2VC9 A;  2OCC C;  4JVS A;  4Q7C A;  3WAQ A;  2CCY A;  5A6A A;  2HV7 A;  3FOO A;  5L0G A;  4P9T A;  5AC4 A;  3LES A;  3UGO A;  2WZL A;  3I4U A;  1YA7 O;  4KBL A;  2R7S A;  1CGO A;  1ZYR F;  4LDR A;  3TD7 A;  1OXK A;  3PDM P;  4OIO F;  1S7Z A;  2Y3G A;  1QLE C;  2IXM A;  1ORJ A;  4JUR I;  2CDQ A;  2KSF A;  3KPH A;  1NFO A;  1QSP A;  4OIQ F;  4MVU A;  1A7D A;  3VAY A;  3DE8 A;  5HSW A;  3J06 A;  3EFO B;  4NCQ A;  2X51 A;  3ASO C;  3HNL A;  3WHN A;  2CNW D;  2KYH A;  4HEA J;  2AWY A;  4WGZ A;  4BJ1 A;  2VCC A;  1PCX A;  2D4U A;  3GOR A;  2L9J A;  1MND A;  2LSE A;  3W8H A;  4C3B A;  4BJ6 C;  2Q00 A;  2WZG A;  4CJG A;  1R4T A;  3M79 A;  1TQG A;  4NY3 A;  1LS4 A;  2GDC A;  3ABL C;  4QI0 A;  4ONS A;  3ABM C;  3MFN A;  4MVZ A;  4PJL A;  4PJN A;  4YL0 A;  3U3B A;  1NU9 C;  3I5Q A;  3FDQ A;  2NSF A;  4U5E E;  1APC A;  4U5B E;  2OG2 A;  3IHU A;  4MW3 A;  1MMD A;  3TQO A;  3EGD B;  3V5X A;  3W8I A;  4BJT A;  5L0J A;  1B68 A;  1BR4 A;  1AVO B;  2EIM C;  2KNH A;  3M4C A;  1T01 A;  4K0D A;  2J9U A;  2KJG A;  4JTC B;  2XS8 A;  3S28 A;  1J8Y F;  1E85 A;  2YZS A;  2KW3 C;  3NMK A;  1D0Z A;  3AG2 C;  2QUP A;  3GWN A;  1OW7 A;  1OW8 A;  3PCV A;  2ETS A;  4G78 A;  4U5F E;  3SYN A;  2Y39 A;  3JT1 A;  1TFO B;  4LER A;  2ZXR A;  1WGW A;  1E2X A;  2BE5 F;  2R7Q A;  4PR9 A;  3ZC4 A;  4BJ5 A;  2YL3 A;  1I4Z A;  4ZLC A;  3L8J A;  2I15 A;  2P7V A;  2XSE A;  2HJM A;  3FAJ A;  2HFI A;  2HSQ A;  3LJB A;  3MYI A;  1R5I D;  5KYX A;  3Q7L A;  1NFN A;  1LI7 A;  5T3W A;  2DYS C;  3B0P A;  4U5H A;  2NUP A;  3L34 A;  1Z6A A;  2EIJ C;  2FGY A;  2L81 A;  1TFK B;  3EZI A;  2P0N A;  4IRU A;  3JRM O;  4OIN F;  1Q0M A;  2J45 A;  4WAB A;  4U9E A;  4ZLD A;  3SXK A;  2QLA A;  4K7B A;  3EGX A;  3O6X A;  4JJG A;  3RYL A;  3EG9 A;  3SXZ A;  3ZTM A;  5L0C A;  3K6B A;  5KYW A;  5EK0 A;  1G4U S;  2L7A A;  2YEV A;  2AWC A;  4EKW A;  3LEO A;  1WAS A;  4N6H A;  2EIN C;  4N4W A;  4XQ1 A;  1ZU4 A;  3T9O A;  3ZVR A;  2R03 A;  4BPM A;  1L3P A;  1ZU5 A;  4L6R A;  4PFO A;  4YT5 A;  5KYU A;  1DOV A;  2XLV A;  1WN0 A;  3KH2 A;  3S0X A;  3G50 A;  3EZH A;  1OR3 A;  1N1C A;  3IQ5 A;  2R25 A;  1XZQ A;  4NTF A;  2R7O A;  4NTB A;  1OCR C;  1KU2 A;  2LK4 A;  2YL0 A;  3TOL A;  2OQM A;  1MMA A;  2PNO A;  2YQY A;  4RD9 A;  3U8V A;  1T5O A;  5L3V A;  4CIP A;  1C03 A;  1RKC A;  5JLI A;  1NSG B;  3AOU A;  3JZ0 A;  3RVZ A;  2WL8 A;  1IW7 F;  2XL6 A;  2Y3H A;  3BRJ A;  4UDV A;  2VCB A;  3K66 A;  1AEP A;  3HJC A;  2WZF A;  1K05 A;  3CAX A;  3CEX A;  3RQE A;  1QZX A;  1HW1 A;  2GWW A;  3V7O A;  1HE9 A;  1I5N A;  256B A;  4IAR A;  4CSA C;  3H65 A;  1YJG A;  2LIG A;  3UR3 C;  3EQL F;  2MWQ A;  2WVQ A;  2AU5 A;  2YVK A;  3UMH A;  5HV9 A;  3SP1 A;  2VAS A;  1JAF A;  3RH3 A;  3G4X A;  4G7O F;  1MNE A;  1T9K A;  2LFF A;  1U89 A;  4MS2 A;  1RKE A;  4LDK A;  5T1D B;  3DM5 A;  5F5F A;  2EPL X;  3ATP A;  1EQ1 A;  3FMS A;  1M2O A;  2KK1 A;  1H9G A;  2DYR C;  4D4N A;  3QVY A;  4WGY A;  1C02 A;  1GQA A;  4IJJ A;  1OKK A;  4U5G A;  1LKX A;  1OW6 A;  2Z15 A;  4KI2 A;  1YDI A;  3OEO A;  4CDY A;  4YT4 A;  3M15 A;  1LE4 A;  1BR2 A;  2M4E A;  5E3A A;  5B1B C;  4K1O A;  3B29 A;  2NUT A;  3U2M A;  5AC5 A;  4G7H F;  1Y4C A;  3NMJ A;  2HKV A;  1FTS A;  4CS8 C;  1OQC A;  1YAR O;  3R2P A;  3RQF A;  3JSE O;  2JPU A;  2VCA A;  4CS9 A;  5L0F A;  2L6H A;  4CS8 A;  3ZQV A;  2P1A A;  3ABK C;  2EPM X;  2LFD A;  2ZXO A;  5A6J A;  3F47 A;  3RW0 A;  4Z9J A;  5JT4 A;  2RD9 A;  3GM1 A;  1Q0F A;  2IOQ A;  3AJM A;  3ITF A;  3ZG1 A;  4BG0 A;  4EBK A;  1VYI A;  1OR2 A;  3FOP A;  3IQC A;  3B0U X;  3ECS A;  1YVI A;  3EJN A;  4M63 A;  3UGP A;  1Q0K A;  2EPK X;  1PV3 A;  1S05 A;  2LP4 A;  4JZA A;  2YRF A;  3DI5 A;  2Q4F A;  3M1C B;  4MVQ A;  1C17 M;  1M6T A;  1VLT A;  4A2N B;  2EIL C;  2Q3T A;  2HMQ A;  4MVM A;  4C7O A;  2J9W A;  1JOG A;  1WTY A;  4BJ6 A;  2OEV A;  3EFO A;  1ST6 A;  4Z9H A;  3E9V A;  5DLJ A;  2V3C C;  1DOW A;  1QVX A;  3NYJ A;  4XPY A;  1NU7 D;  3K1I C;  3IPM O;  4MVS A;  5JS5 A;  4C7O B;  2R7V A;  3V5Z A;  4JIO A;  1OCO C;  4BEM J;  1TWH A;  1HMD A;  2A68 F;  3DM9 B;  5KYY B;  2YLG A;  2R7W A;  2KGO A;  4O6N A;  5DS5 A;  1GGQ A;  4DVZ A;  1YZC A;  3L1M A;  3L8I A;  4J7T A;  5D91 A;  1ZW3 A;  3T6J A;  4HE8 D;  1H7I A;  2J46 A;  2J7P A;  3S27 A;  4EBJ A;  4R32 A;  1YA9 A;  3FAP B;  3HTK C;  4B6I A;  2BC5 A;  1A0B A;  3IQ6 A;  3EGD A;  1ZZP A;  3K7D A;  4O79 A;  3AG3 C;  3KKB A;  1VLS A;  3SXM A;  4P6I C;  2V26 A;  3C63 A;  2B0J A;  1EA8 A;  3DE9 A;  5COF A;  2PFD A;  2VH3 A;  2MHR A;  2GA0 A;  3K33 A;  1HW2 A;  1Q0D A;  4H54 A;  2XLW A;  2M64 A;  2QTV A;  2XXA B;  4O6Y A;  1MMN A;  1NLX A;  3GEI A;  4OD4 A;  4J30 B;  1FMW A;  2CW0 F;  1CGN A;  1M56 C;  1KNY A;  5D92 A;  3U3F A;  1FFT C;  3U8P A;  2IYL D;  1YZA A;  5A6K A;  5KYN A;  2TMV P;  1JPN A;  4FX5 A;  3TUL A;  2XLH A;  3M4B A;  3WG7 C;  4AE4 B;  3N0T A;  4X0R A;  1JMW A;  3DZA A;  4KC9 A;  4YT2 A;  4W8K A;  4C3D A;  3Q7G A;  5BQG A;  3C8G D;  1UG7 A;  1ZW2 A;  1TWG A;  1Y6D A;  3C62 A;  3EPV A;  3EHM A;  5GPG B;  1M57 C;  1TR2 A;  4O7G A;  2A0B A;  3C7J A;  4XPW A;  4EHP A;  2Y3D A;  3LUT B;  1QQ3 A;  4JCH A;  3AG4 C;  1LIH A;  3KL4 A;  4P9F A;  5E3C A;  1BZ4 A;  2R7U A;  2ZPA A;  2G62 A;  3PHF 2;  5L0D A;  1VB5 A;  4CJO A;  1V74 B;  4FES A;  4NTA A;  2XL4 A;  4J32 B;  4MVO A;  1L7C A;  4PJJ A;  2G3V A;  5JRA A;  1TKN A;  1T6I A;  1LVK A;  3GOD A;  3HNI A;  1V4A A;  3POV A;  1Z63 A;  5COG A;  3UMK A;  3HKK A;  3JRT A;  2DGJ A;  3CQZ A;  4U5D E;  4CDV A;  5K0I A;  5JVE A;  3UMI A;  2WB7 A;  1FAP B;  1Z23 A;  1A7V A;  2OOC A;  1V54 C;  4CSA A;  2R7R A;  4ULW A;  1HE1 A;  2OU6 A;  4E7S A;  2GFH A;  4KNW A;  3W2W A;  1JRA A;  3KYJ A;  2W4B A;  3NKD A;  4WJ0 A;  3NYM A;  3RVY A;  4E0H A;  4JW1 A;  3JCU Q;  1RXQ A;  3NMI A;  2J0W A;  3GM2 A;  2J9B A;  3JSZ A;  2R7T A;  4FWV A;  4JTA B;  3OWT A;  3W2V A;  1U0B B;  3DWW A;  2OKU A;  4KNV A;  4AL1 A;  4Q4Z F;  5BUO A;  5IY5 C;  5EHH A;  5BQI A;  4DRH B;  1CPR A;  2XM4 A;  3NYL A;  4MQ9 F;  2IM8 A;  3W4Y A;  2NSG A;  4U9D A;  1NG1 A;  2HZ8 A;  3TK0 A;  5F5H A;  2XLE A;  2QY9 A;  2A69 F;  3C8G B;  3WOD F;  3Q6N A;  5A6B A;  1RJ9 B;  1U6H A;  2R02 A;  3LLK A;  3KYI A;  3NKE A;  1FFH A;  4U5C E;  1QPU A;  5T3T A;  3QW0 A;  3K1H A;  1OXB A;  3EH1 A;  4YJW A;  3DKA A;  2MYS A;  1E86 A;  2WVO A;  5JP7 A;  4XTK A;  4YL3 A;  5AGF A;  4HFF B;  2L6G A;  4NC3 A;  2ICW G;  3QZC A;  1AUE A;  2R05 A;  3NG1 A;  4YL1 A;  3AGU A;  2P61 A;  1D0Y A;  3FXH A;  3T6G B;  1RCP A;  2YHS A;  4IGG A;  5DS6 A;  3U0C A;  1T6Q A;  1GM5 A;  2IBF A;  4MW8 A;  2A1D D;  3AQC A;  2NPU A;  4MTO A;  3V5Y A;  4E0I A;  4XLP F;  4J7Y A;  1WAT A;  3NRH A;  5L0H A;  2H7B A;  1XWJ A;  3U5S A;  3QW1 A;  4XEK A;  4PK4 A;  4GYT A;  2XM0 A;  3O55 A;  4CX9 A;  1G5Z A;  1ORY A;  5JSL A;  2QNL A;  3K1I A;  1H6G A;  1ZHZ A;  3FVY A;  4IAQ A;  2CGE A;  1G8X A;  1OCZ C;  4DOZ A;  4MVR A;  4G0H A;  5CI9 A;  4MTG A;  1FNT c;  2HV6 A;  1FMV A;  3QTH A;  1D1A A;  3GM3 A;  3L0I A;  3T4R A;  3RKO F;  4CIH A;  4E17 A;  4N06 A;  5E2Q A;  2YKZ A;  4DBQ A;  1CPQ A;  5KYY A;  4JC7 A;  1QKR A;  3ZDL A;  1E84 A;  4DBR A;  2UUI A;  3E70 C;  4YN0 B;  4DJ9 A;  3VRC A;  2D5R B;  3AQB A;  3CZ6 A;  5DS4 A;  3N24 A;  1NBB A;  2J0X A;  1HY5 A;  1LI5 A;  3S84 A;  2L6F A;  1BDJ B;  4JKV A;  5L0I A;  5DQT A;  1W2W A;  2LQG A;  3ZSU A;  4EUK B;  3DJU B;  4ULV A;  4HFK B;  1K04 A;  3CSK A;  4PFP A;  2C03 A;  1D1B A;  2C04 A;  1M2V B;  1WWP A;  3C8Z A;  3G4Z A;  4JRZ A;  4F4B A;  2XXA A;  1FR0 A;  1JR8 A;  2RSE B;  1O5H A;  2XLO A;  1ZHX A;  1YLM A;  3SNH A;  4RBN A;  4AE4 A;  3VF0 A;  1EI7 A;  3MX3 A;  1GS9 A;  1LPE A;  2Y3B A;  1SZI A;  4LAC B;  4CDA A;  3DMD A;  4CS7 A;  1SYQ A;  3B9Q A;  1G4W R;  3IEE A;  2VB6 A;  4GQH A;  2XS1 A;  4GEH A;  4LDQ A;  3RFY A;  4AX2 A;  4DXW A;  3KMI A;  2EIK C;  4E18 A;  5COM A;  1TWA A;  3QVZ A;  1LS1 A;  2F22 A;  3GAN A;  3JYY A;  3ASN C;  2A6H F;  3VYW A;  2P6V A;  2JX0 A;  3H2V A;  4IAO A;  2EPN A;  2HJ3 A;  3DAF A;  4XEV A;  5F28 E;  1SR2 A;  2IXO A;  1I4Y A;  1YAU O;  2LD6 A;  2H8A A;  3LAY A;  3DJN B;  2CNW A;  1BR1 A;  2XLD A;  3MLG A;  3S9O A;  2ZD9 A;  1WOL A;  5B1A C;  3GEH A;  4I1M A;  1VTM P;  5B3S C;  4DRI B;  3JTL O;  4D4X A;  2YLD A;  1YYJ A;  4XLN F;  3T6B A;  1XZP A;  4H4K C;  2W45 A;  1IZM A;  1Z7Q c;  3DAG A;  3HNK A;  4W8P A;  2KQ9 A;  4MTF A;  4XPX A;  2R9R B;  3U2L A;  4E7Z A;  1D0X A;  2Q9B A;  3RQG A;  4CBE A;  4CS9 C;  1ZHW A;  3ZQY A;  3EHN A;  4FAP B;  1CGM E;  2NG1 A;  4YT8 A;  2ZXW C;  1O87 A;  2OEX A;  1PD0 A;  2WVN A;  1MMG A;  4QDL A;  1EKY A;  2ASR A;  1VK5 A;  4AK9 A;  3AG1 C;  1Q0G A;  2BL2 A;  2W4M A;  3ZWI A;  1NZE A;  4PAC A;  1ZVZ A;  3R7C A;  4YK5 A;  5FZT A;  4I3M A;  4DRJ B;  5A6B D;  4JEA A;  2O9X A;  4EWC A;  2E87 A;  2PP4 A;  1D1C A;  4G7Z F;  1J8M F;  2HMZ A;  2XL8 A;  1VMA A;  1HMO A;  3H2U A;  4ER9 A;  5KYX B;  2NUP B;  3C8G A;  4ANJ A;  4BJ5 C;  1LM3 B;  1RJ9 A;  3DD7 A;  3SZR A;  3OA1 A;  4C3E A;  5JUA A;  3Q6M A;  1OKK D;  3UNG C;  3JYH A;  3EGX B;  3EG9 B;  4JEB A;  5KYW B;  4A4A A;  3LS0 A;  5DVW A;  3O39 A;  2YL7 A;  3X1O A;  4PJM A;  2H7O A;  3B71 A;  2PX0 A;  2QE9 A;  1MQV A;  2HUJ A;  5KYU B;  3LLI A;  3N2Z B;  3I5P A;  3VM6 A;  5A69 A;  3ZTZ A;  3MYF A;  4RDA A;  2YL1 A;  5E33 A;  3F46 A;  4EBB A;  3EH2 A;  2OJQ A;  2Y69 C;  1UFB A;  2FFH A;  4JTD B;  1TWC A;  4YWQ A;  4OD5 A;  2UUH A;  2X0C A;  2R7X A;  2G3K A;  1LE2 A;  4JCZ A;  2Q7R A;  2Q9C A;  3LEV A;  3LNM B;  2YLI A;  4NQF A;  1ZHY A;  2EPO A;  2J8W A;  5CIV A;  4N6C A;  3SEO A;  2AP3 A;  3U9J A;  4XEF A;  2DI3 A;  4EIY A;  2PF4 E;  1JPJ A;  3ZIB A;  2A6E F;  2KC3 A;  2XRH A;  3LNR A;  4I1O B;  3S90 A;  5B3I A;  1PD1 A;  1VOM A;  3IQT A;  1BBH A;  3SXY A;  1SMY F;  3US6 A;  2HSB A;  1ZHT A;  3FHD A;  3TJ6 A;  5CI8 A;  4XWJ A;  3X2Q C;  4JJF A;  1H9T A;  2I8B A;  4BEJ A; 
#chains in the Genus database with same CATH homology
 2KK1 A;  3C8G D;  1KTM A;  1PV3 A;  1K40 A;  2JX0 A;  2YWA A;  3L8J A;  1OW6 A;  4R32 A;  2L6F A;  4XEV A;  1O3U A;  5F28 E;  4EBJ A;  1UFB A;  3K7D A;  1ZZP A;  3MFN A;  3JZ0 A;  1K04 A;  3GM2 A;  3S9O A;  1WOL A;  1WWP A;  2L6G A;  1JOG A;  3BRJ A;  1WTY A;  3GM3 A;  2JPU A;  4NQF A;  3RQF A;  3L8I A;  2L6H A;  1K05 A;  3RQE A;  3U0C A;  3C8G A;  1QVX A;  3C18 A;  4XEF A;  3O10 A;  3GM1 A;  3U3F A;  1KNY A;  3AJM A;  1OW8 A;  1OW7 A;  1V4A A;  3C8G B;  3RQG A;  4EBK A;  4XEK A;  3TUL A;  3B71 A;  2HSB A;  2PBE A;  2Q00 A;  3JYY A;  2LK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...