4NQFA

Crystal structure of hepn domain protein
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
LSPADALRVAEDHFLRHMPDARDFADVAKYLVAKGNLHLAAFNLHQAVETAYNCYLLTLTNYSPASHNMKFLRGLSEGRDRRLIDIWPRDRQRFTTWYNIMNEAYVKARYSKRFEVSEEALTWLQERTAELHKLVETLCREHIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dimerization of VirD2 Binding Protein Is Essential for Agrobacterium Induced Tumor Formation in Plants
pubmed doi rcsb
source organism Agrobacterium fabrum
molecule tags Transferase
molecule keywords Nucleotidyltransferase
total genus 51
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4nqfA00
3O10A 5F28E 1QVXA 1ZZPA 2HSBA 3RQEA 1KTMA 3B71A 1K05A 1WWPA 3C8GD 1K40A 3GM3A 1OW7A 3AJMA 2L6HA 3C8GB 1UFBA 3RQFA 3RQGA 4XEFA 4EBKA 1JOGA 1PV3A 1V4AA 2JX0A 4EBJA 2Q00A 3JZ0A 1KNYA 3K7DA 1WTYA 4XEVA 3BRJA 4NQFA 2KK1A 2PBEA 3MFNA 3U3FA 2L6FA 2LK4A 1OW6A 3GM1A 3U0CA 1K04A 3C18A 3L8JA 3L8IA 1WOLA 4R32A 2L6GA 3JYYA 1OW8A 4XEKA 3S9OA 3TULA 3C8GA 1O3UA 2YWAA 3GM2A 2JPUA
chains in the Genus database with same CATH superfamily
5KYYA 2WZGA 2XLHA 4U5BE 4CDAA 3ECSA 2DI3A 1Q0MA 1R4TA 2QNLA 3JSEO 4B6IA 4CJOA 1I4ZA 1NZEA 5D92A 1E84A 3C8GB 1T6IA 2J45A 2L6HA 2XLEA 3U3BA 4IWBA 2NSFA 4C7OA 3PDMP 4I1OB 4PJLA 1TWGA 3FVYA 3O55A 3IQ5A 1OCCC 4M63A 4X0RA 3TD7A 3U8PA 5A6JA 4JZAA 4XTKA 256BA 3K66A 2IBFA 3MFNA 3ABKC 2KGOA 2KJGA 3EFOA 3X2QC 2J7PA 2OOCA 4IJJA 3VRCA 3W4YA 1VTMP 1TWHA 2KC3A 4WGYA 2GA0A 3EPVA 3RFYA 3BEHA 1N1CA 4N4WA 4AE4B 2LIGA 4LLCA 1G4WR 4G0HA 4QI0A 1RKEA 2HV6A 3IQCA 3O39A 2JPUA 4DBRA 3O10A 1Z6AA 2R7VA 3K1HA 4OIRF 2R03A 1Z7Qc 1D1CA 3EGXB 3GORA 3KYIA 2H7OA 1MMGA 2CNWD 2Y3DA 5CI9A 1AEPA 2J46A 4RBNA 3K1IA 1SYQA 3QVZA 4U5DE 1V4AA 4XWJA 4EBJA 5L0JA 1Z5ZA 4A4AA 4AK9A 1NFOA 1QQ3A 5TJ5E 3AGUA 3JT1A 3VM6A 1GQAA 1PCXA 1U6HA 2XLOA 3C63A 3EG9B 5AGFA 4IB4A 3S90A 2R7SA 4OIOF 4U5HA 3FXHA 2DGJA 3G4ZA 2I15A 3LUTB 3Q6MA 3AOUA 1EA8A 1OKKA 1OR2A 1OR3A 3U0CA 3IHUA 5L0HA 3NMIA 3JRTA 4JURI 3LNRA 1Z63A 1B68A 1OKKD 4XPXA 4F4BA 4J7YA 5JLIA 3GEIA 4RDAA 5AC5A 2OCCC 1ZHXA 2ICWG 3PMRA 4W8KA 4MVUA 3SXKA 1GGQA 4IRUA 4YL3A 5KYYB 4CS9C 4PR9A 2X0CA 2JX0A 3S84A 4IAOA 4CS8A 2OQMA 4JCHA 1A7VA 3CAXA 3E70C 4XPWA 4Z9IA 4EHPA 1UG7A 4BPMA 2FGYA 4NTAA 3U3FA 5E2QA 2XXAA 2BE5F 2D4UA 4DBQA 1ORYA 4KBLA 3S27A 5F5FA 1Q0KA 5EK0A 5BQHA 1K04A 3L34A 5FCLA 3DM5A 3QMKA 3WG7C 4CIHA 3UGOA 2P61A 3SXZA 4NCQA 3TK0A 2O9XA 2MWQA 3U8VA 3C8GA 3T6BA 1VK5A 4P6IC 1IW7F 1M2VA 3GM2A 3B0UX 4JEAA 4BJ5C 2P7VA 4PACA 5L3VA 2E87A 3A11A 2AP3A 3FHDA 5JS5A 1C17M 5HSWA 3DWWA 1MNEA 3FAPB 2XXAB 1KU2A 3EQLF 4XQ1A 3LNMB 3E9VA 2G62A 3T6JA 3BRJA 1LI7A 2C04A 1YZAA 1ZVZA 4JIOA 2EIKC 4XLPF 1OCRC 2IOQA 4BJ6A 2H7BA 4FESA 2IXOA 1DOVA 2DYRC 1PD0A 2NUTB 1FMVA 1AUEA 1V54C 1MMDA 1TR2A 1XZQA 1YARO 1E83A 1HE9A 1PD1A 3NG1A 3TJ5A 4Z9HA 4FAPB 2VCBA 4XPYA 4MTFA 3CEXA 2W4MA 4WABA 4BJ6C 1JRAA 1E85A 1HW2A 3SP1A 1QLEC 1ZYRF 2HFIA 3CSKA 2OKUA 4PK4A 1YYXA 1VYIA 4A2NB 3HNKA 1ST6A 1ZHWA 1CGNA 2EIJC 2PP4A 1XZPA 3EH1A 1MMNA 1VMAA 3AG1C 4U5GA 3T4RA 4DRJB 1WN0A 1UFBA 1BR1A 1NG1A 4JE9A 2CGEA 2YL1A 2GAQA 4BJTA 2EILC 2UUHA 5AC4A 2GDCA 2WZLA 1HMOA 3M15A 4G7OF 5JT4A 1LIHA 1Y6DA 3DAGA 1QZXA 3DD7A 2R7OA 4IARA 2PNOA 3K1IC 4MTGA 1S05A 2YEVA 2HJ3A 3S29A 3V5YA 4BEMJ 4E0IA 4HE8D 2OG2A 5GPGB 1SR2A 1T6UA 2XLWA 3HNLA 3FMSA 2VCCA 4R32A 4CDYA 4CSAA 1APCA 1VYKA 2X51A 4NTFA 4ONSA 1ZHZA 2J9VA 2NPUA 3C62A 1LS1A 1ZHTA 2L81A 3F47A 1M56C 2FFHA 2YVKA 1LM3B 4LLEA 3UMIA 3SZRA 4LDQA 3EJNA 3QTHA 4JW1A 2HUJA 1I4YA 1ZU4A 3LEOA 5B3SC 5L0FA 2YRFA 5L3QA 4HFFB 1ZW2A 3L1MA 2G3KA 2R7QA 4OD4A 4JC7A 1M6TA 1VOMA 3FDQA 3RIPA 5L0GA 4O6MA 4JJGA 4ER9A 4CBEA 4G7ZF 2ASRA 2KK1A 4IGGA 3SEOA 2YLGA 3SYNA 2OEXA 3GEHA 2YLIA 3LESA 4H54A 2XLVA 4O6YA 3W2VA 3LAYA 4CS7A 3N24A 2W9YA 4MVOA 4JTCB 2Q7RA 1T6QA 3V7OA 3FOOA 4D4NA 3JTLO 2BL2A 3GWLA 4BJ5A 2YL0A 1ORJA 3M1CB 1Q0FA 3QZCA 2J0WA 2QE9A 1O3UA 1O87A 3HNJA 3ZVRA 2IYLD 4JRZA 4JVSA 4MNDA 3IPMO 1ZW3A 3GM3A 2L9JA 3H2VA 1T5OA 2XLMA 4P9TA 1RKCA 1J8YF 3IEEA 4DRHB 2Q00A 1TQGA 3T6GB 4DVZA 4AL1A 2P0NA 3ZSUA 3UR3C 4NQFA 4AL0A 1W2WA 2EIMC 3TJ6A 5COGA 4MTOA 4MVZA 4PJNA 1MMAA 1OW6A 2KYHA 2NUPB 4E7ZA 2Y39A 3C18A 4OINF 5T3WA 1Y4CA 4DRIB 3TOMA 4KNVA 4KC9A 3U2LA 1YYJA 3H65A 3NMKA 2ZXRA 1LPEA 3EG9A 3EHNA 3M4CA 1AVOB 3B0PA 1K05A 4IAQA 5D91A 2Q3TA 3RYLA 5A6BA 2FAPB 4W8PA 2KQ9A 3AJMA 5L0IA 4ULVA 3G50A 3RQGA 3O6XA 4JKVA 2HKVA 5L0CA 4UDVA 1I5NA 1TFKB 2PX3A 4OD5A 4YT5A 1FMWA 1JPNA 2C03A 4J30B 4XEVA 4XLNF 2R7TA 2PF4E 4CS8C 1C02A 2AWYA 2Q9AA 2B0JA 2CW0F 3J06A 2VCAA 3U9MA 3DJUB 1ZU5A 3NDBB 1T9KA 1YA7O 1OXKA 5COFA 3V5ZA 2Y3HA 1G8XA 4U9DA 1OW8A 1TKNA 2EPKX 2OJED 1VLSA 2HS5A 4FX5A 4PFOA 2WB7A 3OWTA 2W4BA 5L0DA 4E7SA 2CYDA 3RVZA 4AE4A 3JRMO 3U5SA 5E3CA 1S7ZA 5EGYA 2GFHA 1H9TA 2Q4FA 3EZHA 4WJ0A 1BR4A 2NG1A 2YQYA 3OEOA 4NC3A 1NLXA 2IXNA 4K7BA 5DQZA 3NYLA 2VASA 1J8MF 4DOZA 1R5ID 2NSGA 4PJJA 1TWAA 4YT4A 2A69F 2H8AA 1YDIA 3S0XA 1U0BB 2ZPAA 2L7AA 1YZCA 3C7JA 4EIYA 3MYIA 1M2OA 1ZHYA 1GM5A 4G78A 2YL3A 3EZIA 3K6BA 4I44A 4ANJA 3DKAA 3EGXA 4DVYP 1LE4A 1SF8A 1U89A 1D0XA 2M64A 3US6A 2J8WA 2PFDA 1LI5A 1H6GA 2A0BA 1YLMA 2NUTA 3S28A 4DXWA 1OXBA 2WL8A 3UMHA 5KYWA 4CIPA 1E86A 2XL6A 5E33A 1GS9A 3HKKA 1WWPA 2OJQA 2MHRA 3C8GD 3RKOF 1K40A 4CX9A 1OW7A 2A68F 3RQFA 3G4XA 4P9FA 2IM8A 3EFOB 4MW3A 4C3BA 4YWQA 3ZWIA 4RD9A 5B1BC 3ASNC 4J7TA 4C3DA 3DE9A 3POVA 4Q5SF 1NFNA 3NYMA 3MX3A 3QW0A 4CSAC 1RMVA 3DE8A 4U5CE 3LEVA 4U5FE 4Q4ZF 3KYJA 1YA9A 4GYTA 3V5XA 2CDQA 2OEVA 5IY5C 1NU7D 1WGWA 2Y3GA 1G4US 1WOLA 2QTVA 1FFTC 1Z3IX 3L8IA 4GEHA 3ZDLA 5A69A 1G5ZA 3N0TA 5DS6A 3I5PA 1EKYA 2CCYA 3OA1A 3S9OA 4LDRA 3B0VC 2HZ8A 3KPHA 4NY3A 2ZXOA 3NKEA 1HE1A 4ULWA 3ZTZA 5JUAA 3NRHA 3R2PA 4AX2A 3AG2C 3ZQVA 1JAFA 1F1MA 4FWVA 3W8IA 1Z23A 2Y3BA 1YVIA 2P1AA 3IQTA 3SXYA 4D4XA 1MQVA 3M4BA 3KMIA 2I8BA 3QVYA 4QI2A 4CS9A 5CI8A 3TQOA 1VB5A 3DAFA 2XM4A 3GANA 2BC5A 2LK4A 1D0YA 1FTSA 3H2UA 4YJWA 2YKZA 1ORSC 3AG4C 3GM1A 1A7DA 3VF0A 4E17A 1JMWA 1L3PA 2YLDA 3LS1A 4O79A 2EPNA 3R7CA 2LFFA 4NTBA 4PFPA 5B1AC 3TULA 2A6HF 4E18A 5HV9A 2J9UA 3UMKA 5FZTA 3K33A 5F28E 3WAQA 1ZZPA 2WVQA 3FAJA 1RJ9B 3SXMA 3NYJA 5KYUA 5DS5A 5JSLA 3TOLA 2DYSC 2J0XA 1PV3A 4XEFA 2R25A 4U5EE 1QSPA 4MVMA 1OCZC 3JZ0A 5A6BD 1BDJB 1KNYA 3Q7GA 1WTYA 4PJMA 1HY5A 2A0UA 4LDKA 1FAPB 1LE2A 5EHHA 1OCOC 2XS8A 4JCZA 2Q9BA 2ZXPA 1D1AA 2KSFA 2J9WA 2V26A 3AQBA 4N06A 4EWCA 1WATA 4CJGA 5E3AA 2VB6A 2R9RB 2PX0A 2YHSA 3LJBA 5BUOA 3A9CA 1O5HA 2A1DD 1JR8A 1FFHA 2XL8A 2YL7A 2ZD9A 3F46A 4BG0A 2RSEB 4BEJA 3DMDA 2XSEA 2HSBA 1IZMA 3B29A 3MLGA 2EINC 1FNTc 4MVRA 5A6KA 2AU5A 2D5RB 3RH3A 1JPJA 3LLIA 3VAYA 5KYNA 5COMA 5DS4A 2IXPA 3NMJA 3U2MA 5CIVA 3Q6NA 3ZTMA 3FOPA 1H7IA 4U9EA 2AVKA 2NUPA 1A7EA 2PBEA 2LCHA 4C7OB 2ETSA 4HEAJ 4H4KC 4LERA 3W8HA 2XLDA 2OU6A 5A6AA 3DZAA 3RVYA 4I1MA 4GQHA 1TWCA 1BR2A 1T01A 2WVOA 3NKDA 2R02A 1M57C 2R05A 3DI5A 4L6RA 3JYYA 3GODA 3RF3A 2IXMA 4MQ9F 1EI7A 1SZIA 1VLTA 1LVKA 1YJGA 1XWJA 1BZ4A 3CQZA 4KNWA 4EKWA 1BBHA 4O6NA 5BQIA 1RKEB 4E0HA 5K0IA 4K0DA 3ZC4A 2HMQA 3EGDB 1CPRA 1M2VB 3ASOC 3IQ6A 4YL0A 4OIQF 1MNDA 2V3CC 2LSEA 2EPOA 3ATPA 4EBBA 4CDVA 1JOGA 2AWCA 1HMDA 3I5QA 3LLKA 1EQ1A 2KW3C 3ABMC 2Q9CA 3KKBA 2Y69C 1DOWA 3ITFA 4G7HF 2H7VC 1OQCA 2LQGA 4QDLA 1E2XA 5JRAA 3ZQYA 3DJNB 3RW0A 1CGME 2R7RA 3I4UA 4JEBA 3JCUQ 2R7WA 4N6HA 3B9QA 1LS4A 1H9GA 2A6EF 3KL4A 5KYXA 1RCPA 1RJ9A 2GWWA 1NSGB 3MYFA 2DB4A 1Q0DA 2L6GA 5F5HA 4MVQA 1TFOB 1KTMA 2QY9A 3UNGC 1HW1A 2G3VA 2HV7A 5DVWA 4JTAB 1V74B 3HLZA 3WHNA 2YZSA 1RXQA 3RQEA 3WODF 3GWNA 3M79A 4Z9JA 1WASA 4EBKA 5KYUB 4KI2A 1SMYF 3L0IA 2QLAA 3W2WA 3U9JA 4C3EA 2XL4A 3VYWA 1L7CA 2P6VA 5JP7A 5KYXB 3C8ZA 3JSZA 5T1DB 3KH2A 4ZLDA 2EPMX 2UUIA 1D1BA 4LACB 1FR0A 4JJFA 3ZIBA 4MS2A 2LD6A 3GEEA 3ABLC 3EH2A 2VC9A 4WGZA 5DLJA 3UGPA 2TMVP 4I3MA 1LKXA 2R7XA 4JTDB 4O7GA 2Z15A 5BQGA 2J7PD 3EHMA 1D0ZA 4XEKA 2KNHA 2ZXWC 3ZG1A 5JVEA 2XS1A 2YWAA 2F22A 2W45A 3HTKC 3SNHA 3LS0A 4OIPF 1QVXA 4YT8A 1QPUA 4HFKB 5B3IA 3B71A 2LP4A 1A0BA 2MYSA 3MBGA 4EUKB 2RD9A 3PCVA 2M4EA 4J32B 4BJ1A 1Q0GA 3X1OA 3QW1A 2B0HA 3AQCA 3EGDA 2XRHA 2CNWA 3K7DA 1A41A 4YN0B 3N2ZB 4MVSA 1V55C 2EPLX 2HMZA 3HNIA 3JYHA 1CGOA 2QUPA 4N6CA 4YL1A 2HJMA 4ZLCA 3CZ6A 1QKRA 1NU9C 3AGTA 2L6FA 1C03A 1CPQA 4DJ9A 3PHF2 2JD3A 4MW8A 3HJCA 3L8JA 2WVNA 2J9BA 3Q7LA 2XM0A 3DXJF 4K1OA 4Q7CA 2LFDA 4YT2A 2R7UA 2HSQA 1NBBA 1YAUO 3AG3C 5KYWB 5DQTA 5T3TA 3T9OA 3DM9B 2WZFA 2VH3A 4YK5A
chains in the Genus database with same CATH topology
3O10A 5F28E 1QVXA 1ZZPA 2HSBA 3RQEA 1KTMA 3B71A 1K05A 1WWPA 3C8GD 1K40A 3GM3A 1OW7A 3AJMA 2L6HA 3C8GB 1UFBA 3RQFA 3RQGA 4XEFA 4EBKA 1JOGA 1PV3A 1V4AA 2JX0A 4EBJA 2Q00A 3JZ0A 1KNYA 3K7DA 1WTYA 4XEVA 3BRJA 4NQFA 2KK1A 2PBEA 3MFNA 3U3FA 2L6FA 2LK4A 1OW6A 3GM1A 3U0CA 1K04A 3C18A 3L8JA 3L8IA 1WOLA 4R32A 2L6GA 3JYYA 1OW8A 4XEKA 3S9OA 3TULA 3C8GA 1O3UA 2YWAA 3GM2A 2JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O10 A;  5F28 E;  1QVX A;  1ZZP A;  2HSB A;  3RQE A;  1KTM A;  3B71 A;  1K05 A;  1WWP A;  3C8G D;  1K40 A;  3GM3 A;  1OW7 A;  3AJM A;  2L6H A;  3C8G B;  1UFB A;  3RQF A;  3RQG A;  4XEF A;  4EBK A;  1JOG A;  1PV3 A;  1V4A A;  2JX0 A;  4EBJ A;  2Q00 A;  3JZ0 A;  1KNY A;  3K7D A;  1WTY A;  4XEV A;  3BRJ A;  4NQF A;  2KK1 A;  2PBE A;  3MFN A;  3U3F A;  2L6F A;  2LK4 A;  1OW6 A;  3GM1 A;  3U0C A;  1K04 A;  3C18 A;  3L8J A;  3L8I A;  1WOL A;  4R32 A;  2L6G A;  3JYY A;  1OW8 A;  4XEK A;  3S9O A;  3TUL A;  3C8G A;  1O3U A;  2YWA A;  3GM2 A;  2JPU A; 
#chains in the Genus database with same CATH topology
 5KYY A;  2WZG A;  2XLH A;  4U5B E;  4CDA A;  3ECS A;  2DI3 A;  1Q0M A;  1R4T A;  2QNL A;  3JSE O;  4B6I A;  4CJO A;  1I4Z A;  1NZE A;  5D92 A;  1E84 A;  3C8G B;  1T6I A;  2J45 A;  2L6H A;  2XLE A;  3U3B A;  4IWB A;  2NSF A;  4C7O A;  3PDM P;  4I1O B;  4PJL A;  1TWG A;  3FVY A;  3O55 A;  3IQ5 A;  1OCC C;  4M63 A;  4X0R A;  3TD7 A;  3U8P A;  5A6J A;  4JZA A;  4XTK A;  256B A;  3K66 A;  2IBF A;  3MFN A;  3ABK C;  2KGO A;  2KJG A;  3EFO A;  3X2Q C;  2J7P A;  2OOC A;  4IJJ A;  3VRC A;  3W4Y A;  1VTM P;  1TWH A;  2KC3 A;  4WGY A;  2GA0 A;  3EPV A;  3RFY A;  3BEH A;  1N1C A;  4N4W A;  4AE4 B;  2LIG A;  4LLC A;  1G4W R;  4G0H A;  4QI0 A;  1RKE A;  2HV6 A;  3IQC A;  3O39 A;  2JPU A;  4DBR A;  3O10 A;  1Z6A A;  2R7V A;  3K1H A;  4OIR F;  2R03 A;  1Z7Q c;  1D1C A;  3EGX B;  3GOR A;  3KYI A;  2H7O A;  1MMG A;  2CNW D;  2Y3D A;  5CI9 A;  1AEP A;  2J46 A;  4RBN A;  3K1I A;  1SYQ A;  3QVZ A;  4U5D E;  1V4A A;  4XWJ A;  4EBJ A;  5L0J A;  1Z5Z A;  4A4A A;  4AK9 A;  1NFO A;  1QQ3 A;  5TJ5 E;  3AGU A;  3JT1 A;  3VM6 A;  1GQA A;  1PCX A;  1U6H A;  2XLO A;  3C63 A;  3EG9 B;  5AGF A;  4IB4 A;  3S90 A;  2R7S A;  4OIO F;  4U5H A;  3FXH A;  2DGJ A;  3G4Z A;  2I15 A;  3LUT B;  3Q6M A;  3AOU A;  1EA8 A;  1OKK A;  1OR2 A;  1OR3 A;  3U0C A;  3IHU A;  5L0H A;  3NMI A;  3JRT A;  4JUR I;  3LNR A;  1Z63 A;  1B68 A;  1OKK D;  4XPX A;  4F4B A;  4J7Y A;  5JLI A;  3GEI A;  4RDA A;  5AC5 A;  2OCC C;  1ZHX A;  2ICW G;  3PMR A;  4W8K A;  4MVU A;  3SXK A;  1GGQ A;  4IRU A;  4YL3 A;  5KYY B;  4CS9 C;  4PR9 A;  2X0C A;  2JX0 A;  3S84 A;  4IAO A;  4CS8 A;  2OQM A;  4JCH A;  1A7V A;  3CAX A;  3E70 C;  4XPW A;  4Z9I A;  4EHP A;  1UG7 A;  4BPM A;  2FGY A;  4NTA A;  3U3F A;  5E2Q A;  2XXA A;  2BE5 F;  2D4U A;  4DBQ A;  1ORY A;  4KBL A;  3S27 A;  5F5F A;  1Q0K A;  5EK0 A;  5BQH A;  1K04 A;  3L34 A;  5FCL A;  3DM5 A;  3QMK A;  3WG7 C;  4CIH A;  3UGO A;  2P61 A;  3SXZ A;  4NCQ A;  3TK0 A;  2O9X A;  2MWQ A;  3U8V A;  3C8G A;  3T6B A;  1VK5 A;  4P6I C;  1IW7 F;  1M2V A;  3GM2 A;  3B0U X;  4JEA A;  4BJ5 C;  2P7V A;  4PAC A;  5L3V A;  2E87 A;  3A11 A;  2AP3 A;  3FHD A;  5JS5 A;  1C17 M;  5HSW A;  3DWW A;  1MNE A;  3FAP B;  2XXA B;  1KU2 A;  3EQL F;  4XQ1 A;  3LNM B;  3E9V A;  2G62 A;  3T6J A;  3BRJ A;  1LI7 A;  2C04 A;  1YZA A;  1ZVZ A;  4JIO A;  2EIK C;  4XLP F;  1OCR C;  2IOQ A;  4BJ6 A;  2H7B A;  4FES A;  2IXO A;  1DOV A;  2DYR C;  1PD0 A;  2NUT B;  1FMV A;  1AUE A;  1V54 C;  1MMD A;  1TR2 A;  1XZQ A;  1YAR O;  1E83 A;  1HE9 A;  1PD1 A;  3NG1 A;  3TJ5 A;  4Z9H A;  4FAP B;  2VCB A;  4XPY A;  4MTF A;  3CEX A;  2W4M A;  4WAB A;  4BJ6 C;  1JRA A;  1E85 A;  1HW2 A;  3SP1 A;  1QLE C;  1ZYR F;  2HFI A;  3CSK A;  2OKU A;  4PK4 A;  1YYX A;  1VYI A;  4A2N B;  3HNK A;  1ST6 A;  1ZHW A;  1CGN A;  2EIJ C;  2PP4 A;  1XZP A;  3EH1 A;  1MMN A;  1VMA A;  3AG1 C;  4U5G A;  3T4R A;  4DRJ B;  1WN0 A;  1UFB A;  1BR1 A;  1NG1 A;  4JE9 A;  2CGE A;  2YL1 A;  2GAQ A;  4BJT A;  2EIL C;  2UUH A;  5AC4 A;  2GDC A;  2WZL A;  1HMO A;  3M15 A;  4G7O F;  5JT4 A;  1LIH A;  1Y6D A;  3DAG A;  1QZX A;  3DD7 A;  2R7O A;  4IAR A;  2PNO A;  3K1I C;  4MTG A;  1S05 A;  2YEV A;  2HJ3 A;  3S29 A;  3V5Y A;  4BEM J;  4E0I A;  4HE8 D;  2OG2 A;  5GPG B;  1SR2 A;  1T6U A;  2XLW A;  3HNL A;  3FMS A;  2VCC A;  4R32 A;  4CDY A;  4CSA A;  1APC A;  1VYK A;  2X51 A;  4NTF A;  4ONS A;  1ZHZ A;  2J9V A;  2NPU A;  3C62 A;  1LS1 A;  1ZHT A;  2L81 A;  3F47 A;  1M56 C;  2FFH A;  2YVK A;  1LM3 B;  4LLE A;  3UMI A;  3SZR A;  4LDQ A;  3EJN A;  3QTH A;  4JW1 A;  2HUJ A;  1I4Y A;  1ZU4 A;  3LEO A;  5B3S C;  5L0F A;  2YRF A;  5L3Q A;  4HFF B;  1ZW2 A;  3L1M A;  2G3K A;  2R7Q A;  4OD4 A;  4JC7 A;  1M6T A;  1VOM A;  3FDQ A;  3RIP A;  5L0G A;  4O6M A;  4JJG A;  4ER9 A;  4CBE A;  4G7Z F;  2ASR A;  2KK1 A;  4IGG A;  3SEO A;  2YLG A;  3SYN A;  2OEX A;  3GEH A;  2YLI A;  3LES A;  4H54 A;  2XLV A;  4O6Y A;  3W2V A;  3LAY A;  4CS7 A;  3N24 A;  2W9Y A;  4MVO A;  4JTC B;  2Q7R A;  1T6Q A;  3V7O A;  3FOO A;  4D4N A;  3JTL O;  2BL2 A;  3GWL A;  4BJ5 A;  2YL0 A;  1ORJ A;  3M1C B;  1Q0F A;  3QZC A;  2J0W A;  2QE9 A;  1O3U A;  1O87 A;  3HNJ A;  3ZVR A;  2IYL D;  4JRZ A;  4JVS A;  4MND A;  3IPM O;  1ZW3 A;  3GM3 A;  2L9J A;  3H2V A;  1T5O A;  2XLM A;  4P9T A;  1RKC A;  1J8Y F;  3IEE A;  4DRH B;  2Q00 A;  1TQG A;  3T6G B;  4DVZ A;  4AL1 A;  2P0N A;  3ZSU A;  3UR3 C;  4NQF A;  4AL0 A;  1W2W A;  2EIM C;  3TJ6 A;  5COG A;  4MTO A;  4MVZ A;  4PJN A;  1MMA A;  1OW6 A;  2KYH A;  2NUP B;  4E7Z A;  2Y39 A;  3C18 A;  4OIN F;  5T3W A;  1Y4C A;  4DRI B;  3TOM A;  4KNV A;  4KC9 A;  3U2L A;  1YYJ A;  3H65 A;  3NMK A;  2ZXR A;  1LPE A;  3EG9 A;  3EHN A;  3M4C A;  1AVO B;  3B0P A;  1K05 A;  4IAQ A;  5D91 A;  2Q3T A;  3RYL A;  5A6B A;  2FAP B;  4W8P A;  2KQ9 A;  3AJM A;  5L0I A;  4ULV A;  3G50 A;  3RQG A;  3O6X A;  4JKV A;  2HKV A;  5L0C A;  4UDV A;  1I5N A;  1TFK B;  2PX3 A;  4OD5 A;  4YT5 A;  1FMW A;  1JPN A;  2C03 A;  4J30 B;  4XEV A;  4XLN F;  2R7T A;  2PF4 E;  4CS8 C;  1C02 A;  2AWY A;  2Q9A A;  2B0J A;  2CW0 F;  3J06 A;  2VCA A;  3U9M A;  3DJU B;  1ZU5 A;  3NDB B;  1T9K A;  1YA7 O;  1OXK A;  5COF A;  3V5Z A;  2Y3H A;  1G8X A;  4U9D A;  1OW8 A;  1TKN A;  2EPK X;  2OJE D;  1VLS A;  2HS5 A;  4FX5 A;  4PFO A;  2WB7 A;  3OWT A;  2W4B A;  5L0D A;  4E7S A;  2CYD A;  3RVZ A;  4AE4 A;  3JRM O;  3U5S A;  5E3C A;  1S7Z A;  5EGY A;  2GFH A;  1H9T A;  2Q4F A;  3EZH A;  4WJ0 A;  1BR4 A;  2NG1 A;  2YQY A;  3OEO A;  4NC3 A;  1NLX A;  2IXN A;  4K7B A;  5DQZ A;  3NYL A;  2VAS A;  1J8M F;  4DOZ A;  1R5I D;  2NSG A;  4PJJ A;  1TWA A;  4YT4 A;  2A69 F;  2H8A A;  1YDI A;  3S0X A;  1U0B B;  2ZPA A;  2L7A A;  1YZC A;  3C7J A;  4EIY A;  3MYI A;  1M2O A;  1ZHY A;  1GM5 A;  4G78 A;  2YL3 A;  3EZI A;  3K6B A;  4I44 A;  4ANJ A;  3DKA A;  3EGX A;  4DVY P;  1LE4 A;  1SF8 A;  1U89 A;  1D0X A;  2M64 A;  3US6 A;  2J8W A;  2PFD A;  1LI5 A;  1H6G A;  2A0B A;  1YLM A;  2NUT A;  3S28 A;  4DXW A;  1OXB A;  2WL8 A;  3UMH A;  5KYW A;  4CIP A;  1E86 A;  2XL6 A;  5E33 A;  1GS9 A;  3HKK A;  1WWP A;  2OJQ A;  2MHR A;  3C8G D;  3RKO F;  1K40 A;  4CX9 A;  1OW7 A;  2A68 F;  3RQF A;  3G4X A;  4P9F A;  2IM8 A;  3EFO B;  4MW3 A;  4C3B A;  4YWQ A;  3ZWI A;  4RD9 A;  5B1B C;  3ASN C;  4J7T A;  4C3D A;  3DE9 A;  3POV A;  4Q5S F;  1NFN A;  3NYM A;  3MX3 A;  3QW0 A;  4CSA C;  1RMV A;  3DE8 A;  4U5C E;  3LEV A;  4U5F E;  4Q4Z F;  3KYJ A;  1YA9 A;  4GYT A;  3V5X A;  2CDQ A;  2OEV A;  5IY5 C;  1NU7 D;  1WGW A;  2Y3G A;  1G4U S;  1WOL A;  2QTV A;  1FFT C;  1Z3I X;  3L8I A;  4GEH A;  3ZDL A;  5A69 A;  1G5Z A;  3N0T A;  5DS6 A;  3I5P A;  1EKY A;  2CCY A;  3OA1 A;  3S9O A;  4LDR A;  3B0V C;  2HZ8 A;  3KPH A;  4NY3 A;  2ZXO A;  3NKE A;  1HE1 A;  4ULW A;  3ZTZ A;  5JUA A;  3NRH A;  3R2P A;  4AX2 A;  3AG2 C;  3ZQV A;  1JAF A;  1F1M A;  4FWV A;  3W8I A;  1Z23 A;  2Y3B A;  1YVI A;  2P1A A;  3IQT A;  3SXY A;  4D4X A;  1MQV A;  3M4B A;  3KMI A;  2I8B A;  3QVY A;  4QI2 A;  4CS9 A;  5CI8 A;  3TQO A;  1VB5 A;  3DAF A;  2XM4 A;  3GAN A;  2BC5 A;  2LK4 A;  1D0Y A;  1FTS A;  3H2U A;  4YJW A;  2YKZ A;  1ORS C;  3AG4 C;  3GM1 A;  1A7D A;  3VF0 A;  4E17 A;  1JMW A;  1L3P A;  2YLD A;  3LS1 A;  4O79 A;  2EPN A;  3R7C A;  2LFF A;  4NTB A;  4PFP A;  5B1A C;  3TUL A;  2A6H F;  4E18 A;  5HV9 A;  2J9U A;  3UMK A;  5FZT A;  3K33 A;  5F28 E;  3WAQ A;  1ZZP A;  2WVQ A;  3FAJ A;  1RJ9 B;  3SXM A;  3NYJ A;  5KYU A;  5DS5 A;  5JSL A;  3TOL A;  2DYS C;  2J0X A;  1PV3 A;  4XEF A;  2R25 A;  4U5E E;  1QSP A;  4MVM A;  1OCZ C;  3JZ0 A;  5A6B D;  1BDJ B;  1KNY A;  3Q7G A;  1WTY A;  4PJM A;  1HY5 A;  2A0U A;  4LDK A;  1FAP B;  1LE2 A;  5EHH A;  1OCO C;  2XS8 A;  4JCZ A;  2Q9B A;  2ZXP A;  1D1A A;  2KSF A;  2J9W A;  2V26 A;  3AQB A;  4N06 A;  4EWC A;  1WAT A;  4CJG A;  5E3A A;  2VB6 A;  2R9R B;  2PX0 A;  2YHS A;  3LJB A;  5BUO A;  3A9C A;  1O5H A;  2A1D D;  1JR8 A;  1FFH A;  2XL8 A;  2YL7 A;  2ZD9 A;  3F46 A;  4BG0 A;  2RSE B;  4BEJ A;  3DMD A;  2XSE A;  2HSB A;  1IZM A;  3B29 A;  3MLG A;  2EIN C;  1FNT c;  4MVR A;  5A6K A;  2AU5 A;  2D5R B;  3RH3 A;  1JPJ A;  3LLI A;  3VAY A;  5KYN A;  5COM A;  5DS4 A;  2IXP A;  3NMJ A;  3U2M A;  5CIV A;  3Q6N A;  3ZTM A;  3FOP A;  1H7I A;  4U9E A;  2AVK A;  2NUP A;  1A7E A;  2PBE A;  2LCH A;  4C7O B;  2ETS A;  4HEA J;  4H4K C;  4LER A;  3W8H A;  2XLD A;  2OU6 A;  5A6A A;  3DZA A;  3RVY A;  4I1M A;  4GQH A;  1TWC A;  1BR2 A;  1T01 A;  2WVO A;  3NKD A;  2R02 A;  1M57 C;  2R05 A;  3DI5 A;  4L6R A;  3JYY A;  3GOD A;  3RF3 A;  2IXM A;  4MQ9 F;  1EI7 A;  1SZI A;  1VLT A;  1LVK A;  1YJG A;  1XWJ A;  1BZ4 A;  3CQZ A;  4KNW A;  4EKW A;  1BBH A;  4O6N A;  5BQI A;  1RKE B;  4E0H A;  5K0I A;  4K0D A;  3ZC4 A;  2HMQ A;  3EGD B;  1CPR A;  1M2V B;  3ASO C;  3IQ6 A;  4YL0 A;  4OIQ F;  1MND A;  2V3C C;  2LSE A;  2EPO A;  3ATP A;  4EBB A;  4CDV A;  1JOG A;  2AWC A;  1HMD A;  3I5Q A;  3LLK A;  1EQ1 A;  2KW3 C;  3ABM C;  2Q9C A;  3KKB A;  2Y69 C;  1DOW A;  3ITF A;  4G7H F;  2H7V C;  1OQC A;  2LQG A;  4QDL A;  1E2X A;  5JRA A;  3ZQY A;  3DJN B;  3RW0 A;  1CGM E;  2R7R A;  3I4U A;  4JEB A;  3JCU Q;  2R7W A;  4N6H A;  3B9Q A;  1LS4 A;  1H9G A;  2A6E F;  3KL4 A;  5KYX A;  1RCP A;  1RJ9 A;  2GWW A;  1NSG B;  3MYF A;  2DB4 A;  1Q0D A;  2L6G A;  5F5H A;  4MVQ A;  1TFO B;  1KTM A;  2QY9 A;  3UNG C;  1HW1 A;  2G3V A;  2HV7 A;  5DVW A;  4JTA B;  1V74 B;  3HLZ A;  3WHN A;  2YZS A;  1RXQ A;  3RQE A;  3WOD F;  3GWN A;  3M79 A;  4Z9J A;  1WAS A;  4EBK A;  5KYU B;  4KI2 A;  1SMY F;  3L0I A;  2QLA A;  3W2W A;  3U9J A;  4C3E A;  2XL4 A;  3VYW A;  1L7C A;  2P6V A;  5JP7 A;  5KYX B;  3C8Z A;  3JSZ A;  5T1D B;  3KH2 A;  4ZLD A;  2EPM X;  2UUI A;  1D1B A;  4LAC B;  1FR0 A;  4JJF A;  3ZIB A;  4MS2 A;  2LD6 A;  3GEE A;  3ABL C;  3EH2 A;  2VC9 A;  4WGZ A;  5DLJ A;  3UGP A;  2TMV P;  4I3M A;  1LKX A;  2R7X A;  4JTD B;  4O7G A;  2Z15 A;  5BQG A;  2J7P D;  3EHM A;  1D0Z A;  4XEK A;  2KNH A;  2ZXW C;  3ZG1 A;  5JVE A;  2XS1 A;  2YWA A;  2F22 A;  2W45 A;  3HTK C;  3SNH A;  3LS0 A;  4OIP F;  1QVX A;  4YT8 A;  1QPU A;  4HFK B;  5B3I A;  3B71 A;  2LP4 A;  1A0B A;  2MYS A;  3MBG A;  4EUK B;  2RD9 A;  3PCV A;  2M4E A;  4J32 B;  4BJ1 A;  1Q0G A;  3X1O A;  3QW1 A;  2B0H A;  3AQC A;  3EGD A;  2XRH A;  2CNW A;  3K7D A;  1A41 A;  4YN0 B;  3N2Z B;  4MVS A;  1V55 C;  2EPL X;  2HMZ A;  3HNI A;  3JYH A;  1CGO A;  2QUP A;  4N6C A;  4YL1 A;  2HJM A;  4ZLC A;  3CZ6 A;  1QKR A;  1NU9 C;  3AGT A;  2L6F A;  1C03 A;  1CPQ A;  4DJ9 A;  3PHF 2;  2JD3 A;  4MW8 A;  3HJC A;  3L8J A;  2WVN A;  2J9B A;  3Q7L A;  2XM0 A;  3DXJ F;  4K1O A;  4Q7C A;  2LFD A;  4YT2 A;  2R7U A;  2HSQ A;  1NBB A;  1YAU O;  3AG3 C;  5KYW B;  5DQT A;  5T3T A;  3T9O A;  3DM9 B;  2WZF A;  2VH3 A;  4YK5 A; 
#chains in the Genus database with same CATH homology
 3O10 A;  5F28 E;  1QVX A;  1ZZP A;  2HSB A;  3RQE A;  1KTM A;  3B71 A;  1K05 A;  1WWP A;  3C8G D;  1K40 A;  3GM3 A;  1OW7 A;  3AJM A;  2L6H A;  3C8G B;  1UFB A;  3RQF A;  3RQG A;  4XEF A;  4EBK A;  1JOG A;  1PV3 A;  1V4A A;  2JX0 A;  4EBJ A;  2Q00 A;  3JZ0 A;  1KNY A;  3K7D A;  1WTY A;  4XEV A;  3BRJ A;  4NQF A;  2KK1 A;  2PBE A;  3MFN A;  3U3F A;  2L6F A;  2LK4 A;  1OW6 A;  3GM1 A;  3U0C A;  1K04 A;  3C18 A;  3L8J A;  3L8I A;  1WOL A;  4R32 A;  2L6G A;  3JYY A;  1OW8 A;  4XEK A;  3S9O A;  3TUL A;  3C8G A;  1O3U A;  2YWA A;  3GM2 A;  2JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...