4NQFA

Crystal structure of hepn domain protein
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
LSPADALRVAEDHFLRHMPDARDFADVAKYLVAKGNLHLAAFNLHQAVETAYNCYLLTLTNYSPASHNMKFLRGLSEGRDRRLIDIWPRDRQRFTTWYNIMNEAYVKARYSKRFEVSEEALTWLQERTAELHKLVETLCREHIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Nucleotidyltransferase
publication title Dimerization of VirD2 Binding Protein Is Essential for Agrobacterium Induced Tumor Formation in Plants
pubmed doi rcsb
source organism Agrobacterium fabrum
total genus 51
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4nqfA00
1K04A 3C8GB 3GM3A 3BRJA 1V4AA 1K05A 1WOLA 3AJMA 3MFNA 4XEVA 3S9OA 1O3UA 2JPUA 4NQFA 3B71A 3GM1A 3U0CA 2Q00A 1OW6A 3O10A 2L6FA 1QVXA 3JYYA 1PV3A 3RQGA 2JX0A 3GM2A 1WWPA 4XEKA 1OW7A 2L6HA 3RQFA 3U3FA 1ZZPA 3L8IA 4EBKA 1UFBA 1WTYA 3C8GA 2KK1A 1KNYA 2LK4A 2PBEA 2YWAA 2L6GA 1KTMA 1K40A 3TULA 3C8GD 2HSBA 1JOGA 4R32A 4EBJA 3L8JA 3C18A 1OW8A 3K7DA 3RQEA 5F28E 3JZ0A 4XEFA
chains in the Genus database with same CATH superfamily
1QQ3A 2PX3A 3S27A 2X0CA 2EIMC 1HE1A 4JURI 1LE2A 3M4BA 5B3SC 1MNDA 2ASRA 2FGYA 2YLDA 4NQFA 4DXWA 1HY5A 1TWCA 1I5NA 3UMHA 1E2XA 4O6NA 4N6CA 4WJ0A 4BPMA 3NMJA 2I15A 3JYYA 2PF4E 4BJ5C 4YWQA 2YL3A 2JX0A 3FXHA 3NRHA 3RH3A 4MQ9F 4CS9C 3SYNA 3W4YA 3ASOC 3G4ZA 3NYMA 4O7GA 1YARO 3GANA 2KYHA 1O87A 4O79A 3QTHA 4JJFA 5KYXA 1ORJA 3LLIA 5CI9A 3K33A 3MYFA 2R7WA 5A6AA 3U9MA 3SXMA 4JTAB 1ZU5A 1M56C 1NFOA 2P0NA 1JMWA 4GYTA 4YT4A 3ECSA 3TK0A 1NG1A 4CBEA 1JPJA 1OQCA 2Y69C 1D0XA 2BE5F 3E9VA 4C3BA 3DAGA 3HNJA 3PHF2 1Q0FA 3V5XA 1RXQA 2J45A 2HSQA 1ZHXA 2WZFA 2IXOA 2Y3BA 3IHUA 3PMRA 1YZAA 3DE9A 1LS4A 3NMKA 5CI8A 3ZSUA 2E87A 3OEOA 4OIOF 2J9VA 1TQGA 3DI5A 3IQ6A 2AWCA 4Z9JA 1J8MF 1BR1A 1D1CA 1EI7A 4I3MA 5COMA 2IBFA 4N4WA 3ZVRA 1SYQA 3C8ZA 1FTSA 1WTYA 3C8GA 2H7VC 1GM5A 3KPHA 5A6BA 1C17M 1TFKB 3R2PA 4EBJA 3C18A 1RCPA 3DJUB 5F28E 1LE4A 1W2WA 5JRAA 4MVUA 4CIPA 4EWCA 2Y3DA 4XQ1A 2WZLA 1D0YA 4FESA 5GPGB 3DWWA 1IZMA 2NUTA 1V54C 5EHHA 1EA8A 1ORYA 1ST6A 5L0HA 4NC3A 3PDMP 1OKKD 2VB6A 3H2VA 3NKEA 2EPOA 5E3CA 1EQ1A 4JTCB 2IYLD 3S28A 3LNMB 4XEKA 2WVNA 1ZW2A 3ZC4A 5L0CA 1D0ZA 4K7BA 2YQYA 3JSZA 1HMOA 3SXKA 2DYSC 5DS5A 1YA9A 4IJJA 2L9JA 4C7OB 4QI2A 2R7OA 4XPXA 4NCQA 2DGJA 3EGDB 4PJNA 1WGWA 1RKCA 1NFNA 1WATA 1L7CA 2XS8A 4AX2A 5L0JA 4U5BE 3SZRA 1OCRC 1U6HA 4C3DA 2OQMA 3LS0A 1K04A 3DZAA 3SXYA 4J7YA 1KU2A 1WOLA 4P9TA 5E2QA 2XLWA 2B0HA 4D4XA 2P1AA 3T9OA 2HJMA 3UGOA 1U0BB 4G7HF 3Q7GA 4K0DA 2VCCA 3B71A 3VAYA 5F5HA 2CYDA 4DBRA 2EIJC 3EGXA 1Y6DA 3KYJA 3DKAA 3OA1A 1TWGA 4MNDA 4YN0B 3AG2C 3ZG1A 2J7PA 3CAXA 4OIRF 4BEJA 4CJOA 4EUKB 5JT4A 2PNOA 2XM4A 1VLTA 3GEEA 4Q4ZF 1GGQA 5KYYA 3AG4C 5JSLA 3QVYA 1FNTc 3SXZA 4CSAA 1Z5ZA 2H7OA 3IQCA 3NG1A 4ANJA 2LK4A 4U5FE 2YL1A 4QI0A 5JLIA 1RKEB 1K40A 1NSGB 1FMWA 1ZHWA 4LLEA 4DRIB 4EIYA 4R32A 3IQ5A 2C04A 3ABKC 3LEVA 1NBBA 4BEMJ 4DRJB 1LIHA 1A0BA 3IEEA 3LNRA 4PK4A 4JIOA 2ZPAA 3AJMA 2D5RB 5KYUB 1S7ZA 1M2OA 3AQCA 4AK9A 4YJWA 4W8KA 4PFOA 1PCXA 3U8VA 4CS8A 2ZXRA 5HV9A 4ER9A 5L0GA 1LI5A 1QVXA 2CNWD 2NUPA 2Y3HA 4E18A 4Q5SF 2Z15A 1JRAA 5K0IA 1TKNA 2DYRC 2Q9CA 3U3FA 4RD9A 2Q3TA 4YK5A 4MVRA 2LFDA 3FOOA 3N24A 2HMZA 1ZVZA 2XS1A 2YL0A 3KL4A 5COFA 4NTBA 1NLXA 3DXJF 3JZ0A 5D91A 2RSEB 1A7EA 2R02A 2XSEA 4ZLDA 3K66A 3FOPA 3B0UX 2EPKX 1Q0DA 3EHMA 4XEVA 2YLIA 4IB4A 5F5FA 1YLMA 4DJ9A 4I1OB 3T6JA 3U2LA 5BUOA 4U9EA 4OIPF 3C63A 1FFHA 5KYNA 1GS9A 4CSAC 3LJBA 4KBLA 4PACA 3GM2A 4J32B 3ABLC 4U9DA 1JAFA 4JEAA 4OD4A 4KC9A 3RW0A 2Q7RA 4E7SA 4PR9A 4K1OA 5B1AC 3WG7C 2ZXWC 5E33A 1Z6AA 1JOGA 1OXBA 4XLPF 1WN0A 1MMAA 2Y3GA 3L0IA 3L8JA 3JT1A 3PCVA 1JPNA 3KYIA 4L6RA 1FAPB 3S84A 2Y39A 2OCCC 3GORA 1Q0KA 2OEXA 2OU6A 2W45A 3ATPA 3FAJA 5COGA 3WAQA 4CJGA 2L81A 3B0PA 4DVZA 5AC5A 1ZYRF 1LS1A 1ZU4A 2LQGA 4MVOA 3ZWIA 3HNKA 1C03A 3FHDA 4KNVA 5B1BC 2OKUA 1LI7A 2QNLA 1LKXA 1Y4CA 3ITFA 2VC9A 3QW1A 3F46A 4YL1A 3AGUA 3U2MA 3RKOF 1PV3A 5A6KA 2OOCA 2XL8A 5HSWA 1OCCC 2LD6A 3NMIA 2WL8A 3JRMO 3EQLF 3QVZA 4MTGA 2UUHA 5DLJA 3L8IA 1ORSC 1KNYA 2XXAB 1AVOB 2G3KA 2XRHA 4KNWA 4DVYP 1SZIA 4PJMA 1E85A 2A69F 2V3CC 1Z23A 3LS1A 2YLGA 4XPWA 1H6GA 2XLHA 4P9FA 3RVZA 4AE4A 4U5EE 4LDQA 5B3IA 1NU9C 2FAPB 4U5GA 1BR4A 2J46A 4JTDB 1I4ZA 4J7TA 3UR3C 2XXAA 3V5ZA 4F4BA 3M79A 3NYJA 1O3UA 1E86A 3POVA 3JSEO 3LESA 1YVIA 2YEVA 3HNLA 3I5PA 2R7QA 4XPYA 3TD7A 1VK5A 3T6BA 2VCBA 3DJNB 3JRTA 3EFOB 3ZDLA 3K1HA 1QSPA 3EG9A 4IGGA 3IQTA 3BEHA 3W8HA 1I4YA 4M63A 2A0UA 2NSGA 3VM6A 4EBKA 2PBEA 2LSEA 5KYUA 4CX9A 2OJQA 2A6EF 2WVOA 3FAPB 3NYLA 3K7DA 4BJ1A 4OINF 2F22A 4HE8D 1YJGA 1LPEA 2PX0A 2Q4FA 3MYIA 3TOMA 4IAQA 4JCHA 3V7OA 3ABMC 4AL1A 1R5ID 4DRHB 3DM9B 5BQHA 5JP7A 3TJ6A 4JW1A 3EPVA 1Z7Qc 3MX3A 1CGOA 5KYXB 1BZ4A 4N6HA 3DAFA 3U0CA 2YHSA 3O10A 4HEAJ 1OCZC 3EH2A 1H9GA 1Z63A 2VASA 1YDIA 2LFFA 4U5CE 3T4RA 3MBGA 4H54A 5CIVA 2L6HA 4AL0A 4G7ZF 5L0FA 1OCOC 4JCZA 3EH1A 3JCUQ 3ZQVA 4UDVA 3O6XA 2I8BA 2HZ8A 1CPRA 2KNHA 2QTVA 2EPNA 3GWLA 3HKKA 3LAYA 2W9YA 1VYKA 2OEVA 2DB4A 4YT8A 5FCLA 3RFYA 4JE9A 3SNHA 4MVZA 3U8PA 3G4XA 3ZQYA 3DMDA 1CGNA 1T6QA 2XLOA 1A41A 2HKVA 3C8GB 1G4US 3F47A 3H2UA 3M1CB 1E84A 3CSKA 4BG0A 5IY5C 5AC4A 5L0DA 1OKKA 1YYJA 2JPUA 2NSFA 3GM1A 3U9JA 1D1AA 1D1BA 3NKDA 4RDAA 5TJ5E 3MLGA 4JVSA 1VB5A 3C62A 5E3AA 5DS4A 1AUEA 2HV6A 3DD7A 2CW0F 2KC3A 2R9RB 3C7JA 1ZW3A 2GWWA 3JTLO 2H8AA 2CDQA 4XLNF 2KQ9A 4CS9A 1KTMA 2L6GA 4GQHA 4BJ6A 4E0HA 3Q6MA 2HSBA 3O39A 4X0RA 2KSFA 3IPMO 4JEBA 1T01A 2HFIA 1OXKA 3B9QA 2XLMA 1XZQA 3GWNA 2R03A 1VMAA 5DS6A 3BRJA 3TJ5A 1NU7D 1V4AA 3B0VC 2IXNA 4E17A 3TOLA 2R7UA 2LIGA 2HUJA 2VH3A 3R7CA 4CDAA 5A69A 1OW6A 2QE9A 4FWVA 3HNIA 4MVSA 1H7IA 2MHRA 2P61A 2Q9BA 1A7VA 3I5QA 4CDYA 4JC7A 4HFKB 1ZZPA 4O6MA 4WGZA 2R25A 3UGPA 2W4MA 4AE4B 1B68A 2CCYA 1QZXA 1V55C 3K6BA 2ZD9A 4RBNA 4FX5A 1O5HA 1YA7O 3T6GB 3C8GD 3TQOA 4A4AA 1QPUA 5A6BD 3QMKA 4E7ZA 3LLKA 2W4BA 1RJ9B 3RYLA 1MQVA 1ZHTA 3EFOA 4LERA 1YAUO 2HS5A 2P7VA 4G78A 1G8XA 2FFHA 1TFOB 3GM3A 2QLAA 5EK0A 1K05A 2J0XA 2R7XA 4CS8C 3GEHA 4YL0A 4EKWA 4J30B 1NZEA 4JRZA 1S05A 4MS2A 2JD3A 2CNWA 4C7OA 1QLEC 1TWHA 2Q00A 3DE8A 3S90A 3OWTA 3EGDA 4E0IA 4EBBA 2AP3A 2EIKC 2IXMA 3AG1C 1WWPA 3RQGA 3I4UA 3V5YA 4BJ6C 5KYWB 2XL4A 4LDRA 2C03A 1TR2A 3WHNA 3S29A 3UMKA 4B6IA 1UFBA 2IOQA 1RMVA 3W8IA 2B0JA 1MMNA 4ZLCA 3NDBB 2XL6A 2ICWG 1MMDA 4PFPA 3B29A 1F1MA 2NUPB 2WB7A 5JUAA 3S0XA 2EPMX 3EZHA 4MVQA 3SEOA 5L3QA 1MNEA 3KH2A 2AVKA 4XEFA 3RQEA 1DOVA 3W2WA 4FAPB 1J8YF 3K1IA 2HJ3A 2IM8A 2P6VA 4A2NB 2R7RA 2WVQA 3HJCA 1M57C 4U5DE 3ZIBA 1OR3A 2EINC 3S9OA 4HFFB 4LLCA 1M2VB 3N2ZB 2YL7A 1G4WR 2HMQA 2R05A 1RKEA 2BC5A 4PJJA 4KI2A 2X51A 3JYHA 4I1MA 1QKRA 2L6FA 1L3PA 2HV7A 3AG3C 3L1MA 4I44A 4JZAA 1MMGA 1VLSA 2A1DD 2J7PD 2PP4A 4NY3A 1PD0A 1T9KA 2XM0A 3CQZA 256BA 4IRUA 4O6YA 1IW7F 3LEOA 2WZGA 1T6IA 3VF0A 5AGFA 2H7BA 2OJED 2M4EA 3A11A 4YL3A 5DQTA 3FVYA 2J9WA 1C02A 5JVEA 4G7OF 3X1OA 5T3TA 1A7DA 2A6HF 2KW3C 1EKYA 4PJLA 1APCA 1SMYF 5DQZA 3UMIA 5A6JA 5EGYA 3CEXA 2Q9AA 3CZ6A 1V74B 1YZCA 4OD5A 2ZXOA 5T1DB 1VTMP 2OG2A 3M4CA 4WABA 5DVWA 2J9BA 4CS7A 3J06A 4Z9IA 2LP4A 2YRFA 1OR2A 2L7AA 1M6TA 3E70C 3TULA 3O55A 3QZCA 4MW3A 2GAQA 4IARA 5L0IA 2KGOA 3LUTB 2G3VA 4Q7CA 3EHNA 2A68F 3L34A 2YWAA 3RF3A 3US6A 3VRCA 4BJTA 1XWJA 2GDCA 3AOUA 3K1IC 2A0BA 1HE9A 3ZTZA 3H65A 1FR0A 1SR2A 1OW8A 1U89A 4U5HA 4XTKA 4WGYA 4EHPA 3VYWA 1N1CA 4XWJA 2EPLX 3EJNA 1CGME 2UUIA 4CIHA 2AU5A 2BL2A 2LCHA 3MFNA 5BQGA 4W8PA 2MYSA 1R4TA 2O9XA 4N06A 4G0HA 5FZTA 1H9TA 2EILC 4MW8A 3U3BA 2PFDA 2J9UA 5JS5A 1FFTC 2M64A 1PD1A 2NG1A 3AQBA 1E83A 1T5OA 1RJ9A 1TWAA 3KKBA 2KJGA 1OW7A 1WASA 4IWBA 1BBHA 1AEPA 4IAOA 3QW0A 4YT5A 3Q6NA 2NPUA 4BJ5A 1VYIA 3WODF 2NUTB 4CDVA 3DM5A 2KK1A 4DBQA 2MWQA 1HW1A 2XLDA 3AGTA 3GEIA 2AWYA 2GFHA 2QY9A 4NTFA 1HW2A 4H4KC 3FDQA 2V26A 1ZHZA 4MTFA 1BR2A 3EG9B 2ZXPA 4MTOA 1BDJB 1SF8A 2G62A 4ULWA 3X2QC 1GQAA 2YZSA 3N0TA 5L3VA 4C3EA 3M15A 5KYWA 2RD9A 4QDLA 1JR8A 1LVKA 3Q7LA 4D4NA 2R7TA 1DOWA 4Z9HA 2DI3A 4ONSA 4GEHA 3RIPA 4LDKA 4DOZA 4JJGA 1LM3B 1VOMA 2VCAA 3UNGC 1T6UA 3HLZA 4NTAA 4MVMA 2J0WA 3EZIA 3RVYA 4ULVA 3ZTMA 3GODA 1G5ZA 2D4UA 5T3WA 2CGEA 3RQFA 2QUPA 3A9CA 2R7VA 2ETSA 4P6IC 3SP1A 4YT2A 1YYXA 2J8WA 3KMIA 3HTKC 1CPQA 1FMVA 5D92A 1XZPA 1ZHYA 2XLEA 2YVKA 2IXPA 1M2VA 4LACB 3EGXB 1Q0GA 3ASNC 3G50A 2GA0A 3U5SA 1UG7A 4JKVA 1HMDA 4OIQF 3FMSA 2YKZA 1Z3IX 2TMVP 5KYYB 1Q0MA 5BQIA 2R7SA 2XLVA 3W2VA
chains in the Genus database with same CATH topology
1K04A 3C8GB 3GM3A 3BRJA 1V4AA 1K05A 1WOLA 3AJMA 3MFNA 4XEVA 3S9OA 1O3UA 2JPUA 4NQFA 3B71A 3GM1A 3U0CA 2Q00A 1OW6A 3O10A 2L6FA 1QVXA 3JYYA 1PV3A 3RQGA 2JX0A 3GM2A 1WWPA 4XEKA 1OW7A 2L6HA 3RQFA 3U3FA 1ZZPA 3L8IA 4EBKA 1UFBA 1WTYA 3C8GA 2KK1A 1KNYA 2LK4A 2PBEA 2YWAA 2L6GA 1KTMA 1K40A 3TULA 3C8GD 2HSBA 1JOGA 4R32A 4EBJA 3L8JA 3C18A 1OW8A 3K7DA 3RQEA 5F28E 3JZ0A 4XEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K04 A;  3C8G B;  3GM3 A;  3BRJ A;  1V4A A;  1K05 A;  1WOL A;  3AJM A;  3MFN A;  4XEV A;  3S9O A;  1O3U A;  2JPU A;  4NQF A;  3B71 A;  3GM1 A;  3U0C A;  2Q00 A;  1OW6 A;  3O10 A;  2L6F A;  1QVX A;  3JYY A;  1PV3 A;  3RQG A;  2JX0 A;  3GM2 A;  1WWP A;  4XEK A;  1OW7 A;  2L6H A;  3RQF A;  3U3F A;  1ZZP A;  3L8I A;  4EBK A;  1UFB A;  1WTY A;  3C8G A;  2KK1 A;  1KNY A;  2LK4 A;  2PBE A;  2YWA A;  2L6G A;  1KTM A;  1K40 A;  3TUL A;  3C8G D;  2HSB A;  1JOG A;  4R32 A;  4EBJ A;  3L8J A;  3C18 A;  1OW8 A;  3K7D A;  3RQE A;  5F28 E;  3JZ0 A;  4XEF A; 
#chains in the Genus database with same CATH topology
 1QQ3 A;  2PX3 A;  3S27 A;  2X0C A;  2EIM C;  1HE1 A;  4JUR I;  1LE2 A;  3M4B A;  5B3S C;  1MND A;  2ASR A;  2FGY A;  2YLD A;  4NQF A;  4DXW A;  1HY5 A;  1TWC A;  1I5N A;  3UMH A;  1E2X A;  4O6N A;  4N6C A;  4WJ0 A;  4BPM A;  3NMJ A;  2I15 A;  3JYY A;  2PF4 E;  4BJ5 C;  4YWQ A;  2YL3 A;  2JX0 A;  3FXH A;  3NRH A;  3RH3 A;  4MQ9 F;  4CS9 C;  3SYN A;  3W4Y A;  3ASO C;  3G4Z A;  3NYM A;  4O7G A;  1YAR O;  3GAN A;  2KYH A;  1O87 A;  4O79 A;  3QTH A;  4JJF A;  5KYX A;  1ORJ A;  3LLI A;  5CI9 A;  3K33 A;  3MYF A;  2R7W A;  5A6A A;  3U9M A;  3SXM A;  4JTA B;  1ZU5 A;  1M56 C;  1NFO A;  2P0N A;  1JMW A;  4GYT A;  4YT4 A;  3ECS A;  3TK0 A;  1NG1 A;  4CBE A;  1JPJ A;  1OQC A;  2Y69 C;  1D0X A;  2BE5 F;  3E9V A;  4C3B A;  3DAG A;  3HNJ A;  3PHF 2;  1Q0F A;  3V5X A;  1RXQ A;  2J45 A;  2HSQ A;  1ZHX A;  2WZF A;  2IXO A;  2Y3B A;  3IHU A;  3PMR A;  1YZA A;  3DE9 A;  1LS4 A;  3NMK A;  5CI8 A;  3ZSU A;  2E87 A;  3OEO A;  4OIO F;  2J9V A;  1TQG A;  3DI5 A;  3IQ6 A;  2AWC A;  4Z9J A;  1J8M F;  1BR1 A;  1D1C A;  1EI7 A;  4I3M A;  5COM A;  2IBF A;  4N4W A;  3ZVR A;  1SYQ A;  3C8Z A;  1FTS A;  1WTY A;  3C8G A;  2H7V C;  1GM5 A;  3KPH A;  5A6B A;  1C17 M;  1TFK B;  3R2P A;  4EBJ A;  3C18 A;  1RCP A;  3DJU B;  5F28 E;  1LE4 A;  1W2W A;  5JRA A;  4MVU A;  4CIP A;  4EWC A;  2Y3D A;  4XQ1 A;  2WZL A;  1D0Y A;  4FES A;  5GPG B;  3DWW A;  1IZM A;  2NUT A;  1V54 C;  5EHH A;  1EA8 A;  1ORY A;  1ST6 A;  5L0H A;  4NC3 A;  3PDM P;  1OKK D;  2VB6 A;  3H2V A;  3NKE A;  2EPO A;  5E3C A;  1EQ1 A;  4JTC B;  2IYL D;  3S28 A;  3LNM B;  4XEK A;  2WVN A;  1ZW2 A;  3ZC4 A;  5L0C A;  1D0Z A;  4K7B A;  2YQY A;  3JSZ A;  1HMO A;  3SXK A;  2DYS C;  5DS5 A;  1YA9 A;  4IJJ A;  2L9J A;  4C7O B;  4QI2 A;  2R7O A;  4XPX A;  4NCQ A;  2DGJ A;  3EGD B;  4PJN A;  1WGW A;  1RKC A;  1NFN A;  1WAT A;  1L7C A;  2XS8 A;  4AX2 A;  5L0J A;  4U5B E;  3SZR A;  1OCR C;  1U6H A;  4C3D A;  2OQM A;  3LS0 A;  1K04 A;  3DZA A;  3SXY A;  4J7Y A;  1KU2 A;  1WOL A;  4P9T A;  5E2Q A;  2XLW A;  2B0H A;  4D4X A;  2P1A A;  3T9O A;  2HJM A;  3UGO A;  1U0B B;  4G7H F;  3Q7G A;  4K0D A;  2VCC A;  3B71 A;  3VAY A;  5F5H A;  2CYD A;  4DBR A;  2EIJ C;  3EGX A;  1Y6D A;  3KYJ A;  3DKA A;  3OA1 A;  1TWG A;  4MND A;  4YN0 B;  3AG2 C;  3ZG1 A;  2J7P A;  3CAX A;  4OIR F;  4BEJ A;  4CJO A;  4EUK B;  5JT4 A;  2PNO A;  2XM4 A;  1VLT A;  3GEE A;  4Q4Z F;  1GGQ A;  5KYY A;  3AG4 C;  5JSL A;  3QVY A;  1FNT c;  3SXZ A;  4CSA A;  1Z5Z A;  2H7O A;  3IQC A;  3NG1 A;  4ANJ A;  2LK4 A;  4U5F E;  2YL1 A;  4QI0 A;  5JLI A;  1RKE B;  1K40 A;  1NSG B;  1FMW A;  1ZHW A;  4LLE A;  4DRI B;  4EIY A;  4R32 A;  3IQ5 A;  2C04 A;  3ABK C;  3LEV A;  1NBB A;  4BEM J;  4DRJ B;  1LIH A;  1A0B A;  3IEE A;  3LNR A;  4PK4 A;  4JIO A;  2ZPA A;  3AJM A;  2D5R B;  5KYU B;  1S7Z A;  1M2O A;  3AQC A;  4AK9 A;  4YJW A;  4W8K A;  4PFO A;  1PCX A;  3U8V A;  4CS8 A;  2ZXR A;  5HV9 A;  4ER9 A;  5L0G A;  1LI5 A;  1QVX A;  2CNW D;  2NUP A;  2Y3H A;  4E18 A;  4Q5S F;  2Z15 A;  1JRA A;  5K0I A;  1TKN A;  2DYR C;  2Q9C A;  3U3F A;  4RD9 A;  2Q3T A;  4YK5 A;  4MVR A;  2LFD A;  3FOO A;  3N24 A;  2HMZ A;  1ZVZ A;  2XS1 A;  2YL0 A;  3KL4 A;  5COF A;  4NTB A;  1NLX A;  3DXJ F;  3JZ0 A;  5D91 A;  2RSE B;  1A7E A;  2R02 A;  2XSE A;  4ZLD A;  3K66 A;  3FOP A;  3B0U X;  2EPK X;  1Q0D A;  3EHM A;  4XEV A;  2YLI A;  4IB4 A;  5F5F A;  1YLM A;  4DJ9 A;  4I1O B;  3T6J A;  3U2L A;  5BUO A;  4U9E A;  4OIP F;  3C63 A;  1FFH A;  5KYN A;  1GS9 A;  4CSA C;  3LJB A;  4KBL A;  4PAC A;  3GM2 A;  4J32 B;  3ABL C;  4U9D A;  1JAF A;  4JEA A;  4OD4 A;  4KC9 A;  3RW0 A;  2Q7R A;  4E7S A;  4PR9 A;  4K1O A;  5B1A C;  3WG7 C;  2ZXW C;  5E33 A;  1Z6A A;  1JOG A;  1OXB A;  4XLP F;  1WN0 A;  1MMA A;  2Y3G A;  3L0I A;  3L8J A;  3JT1 A;  3PCV A;  1JPN A;  3KYI A;  4L6R A;  1FAP B;  3S84 A;  2Y39 A;  2OCC C;  3GOR A;  1Q0K A;  2OEX A;  2OU6 A;  2W45 A;  3ATP A;  3FAJ A;  5COG A;  3WAQ A;  4CJG A;  2L81 A;  3B0P A;  4DVZ A;  5AC5 A;  1ZYR F;  1LS1 A;  1ZU4 A;  2LQG A;  4MVO A;  3ZWI A;  3HNK A;  1C03 A;  3FHD A;  4KNV A;  5B1B C;  2OKU A;  1LI7 A;  2QNL A;  1LKX A;  1Y4C A;  3ITF A;  2VC9 A;  3QW1 A;  3F46 A;  4YL1 A;  3AGU A;  3U2M A;  3RKO F;  1PV3 A;  5A6K A;  2OOC A;  2XL8 A;  5HSW A;  1OCC C;  2LD6 A;  3NMI A;  2WL8 A;  3JRM O;  3EQL F;  3QVZ A;  4MTG A;  2UUH A;  5DLJ A;  3L8I A;  1ORS C;  1KNY A;  2XXA B;  1AVO B;  2G3K A;  2XRH A;  4KNW A;  4DVY P;  1SZI A;  4PJM A;  1E85 A;  2A69 F;  2V3C C;  1Z23 A;  3LS1 A;  2YLG A;  4XPW A;  1H6G A;  2XLH A;  4P9F A;  3RVZ A;  4AE4 A;  4U5E E;  4LDQ A;  5B3I A;  1NU9 C;  2FAP B;  4U5G A;  1BR4 A;  2J46 A;  4JTD B;  1I4Z A;  4J7T A;  3UR3 C;  2XXA A;  3V5Z A;  4F4B A;  3M79 A;  3NYJ A;  1O3U A;  1E86 A;  3POV A;  3JSE O;  3LES A;  1YVI A;  2YEV A;  3HNL A;  3I5P A;  2R7Q A;  4XPY A;  3TD7 A;  1VK5 A;  3T6B A;  2VCB A;  3DJN B;  3JRT A;  3EFO B;  3ZDL A;  3K1H A;  1QSP A;  3EG9 A;  4IGG A;  3IQT A;  3BEH A;  3W8H A;  1I4Y A;  4M63 A;  2A0U A;  2NSG A;  3VM6 A;  4EBK A;  2PBE A;  2LSE A;  5KYU A;  4CX9 A;  2OJQ A;  2A6E F;  2WVO A;  3FAP B;  3NYL A;  3K7D A;  4BJ1 A;  4OIN F;  2F22 A;  4HE8 D;  1YJG A;  1LPE A;  2PX0 A;  2Q4F A;  3MYI A;  3TOM A;  4IAQ A;  4JCH A;  3V7O A;  3ABM C;  4AL1 A;  1R5I D;  4DRH B;  3DM9 B;  5BQH A;  5JP7 A;  3TJ6 A;  4JW1 A;  3EPV A;  1Z7Q c;  3MX3 A;  1CGO A;  5KYX B;  1BZ4 A;  4N6H A;  3DAF A;  3U0C A;  2YHS A;  3O10 A;  4HEA J;  1OCZ C;  3EH2 A;  1H9G A;  1Z63 A;  2VAS A;  1YDI A;  2LFF A;  4U5C E;  3T4R A;  3MBG A;  4H54 A;  5CIV A;  2L6H A;  4AL0 A;  4G7Z F;  5L0F A;  1OCO C;  4JCZ A;  3EH1 A;  3JCU Q;  3ZQV A;  4UDV A;  3O6X A;  2I8B A;  2HZ8 A;  1CPR A;  2KNH A;  2QTV A;  2EPN A;  3GWL A;  3HKK A;  3LAY A;  2W9Y A;  1VYK A;  2OEV A;  2DB4 A;  4YT8 A;  5FCL A;  3RFY A;  4JE9 A;  3SNH A;  4MVZ A;  3U8P A;  3G4X A;  3ZQY A;  3DMD A;  1CGN A;  1T6Q A;  2XLO A;  1A41 A;  2HKV A;  3C8G B;  1G4U S;  3F47 A;  3H2U A;  3M1C B;  1E84 A;  3CSK A;  4BG0 A;  5IY5 C;  5AC4 A;  5L0D A;  1OKK A;  1YYJ A;  2JPU A;  2NSF A;  3GM1 A;  3U9J A;  1D1A A;  1D1B A;  3NKD A;  4RDA A;  5TJ5 E;  3MLG A;  4JVS A;  1VB5 A;  3C62 A;  5E3A A;  5DS4 A;  1AUE A;  2HV6 A;  3DD7 A;  2CW0 F;  2KC3 A;  2R9R B;  3C7J A;  1ZW3 A;  2GWW A;  3JTL O;  2H8A A;  2CDQ A;  4XLN F;  2KQ9 A;  4CS9 A;  1KTM A;  2L6G A;  4GQH A;  4BJ6 A;  4E0H A;  3Q6M A;  2HSB A;  3O39 A;  4X0R A;  2KSF A;  3IPM O;  4JEB A;  1T01 A;  2HFI A;  1OXK A;  3B9Q A;  2XLM A;  1XZQ A;  3GWN A;  2R03 A;  1VMA A;  5DS6 A;  3BRJ A;  3TJ5 A;  1NU7 D;  1V4A A;  3B0V C;  2IXN A;  4E17 A;  3TOL A;  2R7U A;  2LIG A;  2HUJ A;  2VH3 A;  3R7C A;  4CDA A;  5A69 A;  1OW6 A;  2QE9 A;  4FWV A;  3HNI A;  4MVS A;  1H7I A;  2MHR A;  2P61 A;  2Q9B A;  1A7V A;  3I5Q A;  4CDY A;  4JC7 A;  4HFK B;  1ZZP A;  4O6M A;  4WGZ A;  2R25 A;  3UGP A;  2W4M A;  4AE4 B;  1B68 A;  2CCY A;  1QZX A;  1V55 C;  3K6B A;  2ZD9 A;  4RBN A;  4FX5 A;  1O5H A;  1YA7 O;  3T6G B;  3C8G D;  3TQO A;  4A4A A;  1QPU A;  5A6B D;  3QMK A;  4E7Z A;  3LLK A;  2W4B A;  1RJ9 B;  3RYL A;  1MQV A;  1ZHT A;  3EFO A;  4LER A;  1YAU O;  2HS5 A;  2P7V A;  4G78 A;  1G8X A;  2FFH A;  1TFO B;  3GM3 A;  2QLA A;  5EK0 A;  1K05 A;  2J0X A;  2R7X A;  4CS8 C;  3GEH A;  4YL0 A;  4EKW A;  4J30 B;  1NZE A;  4JRZ A;  1S05 A;  4MS2 A;  2JD3 A;  2CNW A;  4C7O A;  1QLE C;  1TWH A;  2Q00 A;  3DE8 A;  3S90 A;  3OWT A;  3EGD A;  4E0I A;  4EBB A;  2AP3 A;  2EIK C;  2IXM A;  3AG1 C;  1WWP A;  3RQG A;  3I4U A;  3V5Y A;  4BJ6 C;  5KYW B;  2XL4 A;  4LDR A;  2C03 A;  1TR2 A;  3WHN A;  3S29 A;  3UMK A;  4B6I A;  1UFB A;  2IOQ A;  1RMV A;  3W8I A;  2B0J A;  1MMN A;  4ZLC A;  3NDB B;  2XL6 A;  2ICW G;  1MMD A;  4PFP A;  3B29 A;  1F1M A;  2NUP B;  2WB7 A;  5JUA A;  3S0X A;  2EPM X;  3EZH A;  4MVQ A;  3SEO A;  5L3Q A;  1MNE A;  3KH2 A;  2AVK A;  4XEF A;  3RQE A;  1DOV A;  3W2W A;  4FAP B;  1J8Y F;  3K1I A;  2HJ3 A;  2IM8 A;  2P6V A;  4A2N B;  2R7R A;  2WVQ A;  3HJC A;  1M57 C;  4U5D E;  3ZIB A;  1OR3 A;  2EIN C;  3S9O A;  4HFF B;  4LLC A;  1M2V B;  3N2Z B;  2YL7 A;  1G4W R;  2HMQ A;  2R05 A;  1RKE A;  2BC5 A;  4PJJ A;  4KI2 A;  2X51 A;  3JYH A;  4I1M A;  1QKR A;  2L6F A;  1L3P A;  2HV7 A;  3AG3 C;  3L1M A;  4I44 A;  4JZA A;  1MMG A;  1VLS A;  2A1D D;  2J7P D;  2PP4 A;  4NY3 A;  1PD0 A;  1T9K A;  2XM0 A;  3CQZ A;  256B A;  4IRU A;  4O6Y A;  1IW7 F;  3LEO A;  2WZG A;  1T6I A;  3VF0 A;  5AGF A;  2H7B A;  2OJE D;  2M4E A;  3A11 A;  4YL3 A;  5DQT A;  3FVY A;  2J9W A;  1C02 A;  5JVE A;  4G7O F;  3X1O A;  5T3T A;  1A7D A;  2A6H F;  2KW3 C;  1EKY A;  4PJL A;  1APC A;  1SMY F;  5DQZ A;  3UMI A;  5A6J A;  5EGY A;  3CEX A;  2Q9A A;  3CZ6 A;  1V74 B;  1YZC A;  4OD5 A;  2ZXO A;  5T1D B;  1VTM P;  2OG2 A;  3M4C A;  4WAB A;  5DVW A;  2J9B A;  4CS7 A;  3J06 A;  4Z9I A;  2LP4 A;  2YRF A;  1OR2 A;  2L7A A;  1M6T A;  3E70 C;  3TUL A;  3O55 A;  3QZC A;  4MW3 A;  2GAQ A;  4IAR A;  5L0I A;  2KGO A;  3LUT B;  2G3V A;  4Q7C A;  3EHN A;  2A68 F;  3L34 A;  2YWA A;  3RF3 A;  3US6 A;  3VRC A;  4BJT A;  1XWJ A;  2GDC A;  3AOU A;  3K1I C;  2A0B A;  1HE9 A;  3ZTZ A;  3H65 A;  1FR0 A;  1SR2 A;  1OW8 A;  1U89 A;  4U5H A;  4XTK A;  4WGY A;  4EHP A;  3VYW A;  1N1C A;  4XWJ A;  2EPL X;  3EJN A;  1CGM E;  2UUI A;  4CIH A;  2AU5 A;  2BL2 A;  2LCH A;  3MFN A;  5BQG A;  4W8P A;  2MYS A;  1R4T A;  2O9X A;  4N06 A;  4G0H A;  5FZT A;  1H9T A;  2EIL C;  4MW8 A;  3U3B A;  2PFD A;  2J9U A;  5JS5 A;  1FFT C;  2M64 A;  1PD1 A;  2NG1 A;  3AQB A;  1E83 A;  1T5O A;  1RJ9 A;  1TWA A;  3KKB A;  2KJG A;  1OW7 A;  1WAS A;  4IWB A;  1BBH A;  1AEP A;  4IAO A;  3QW0 A;  4YT5 A;  3Q6N A;  2NPU A;  4BJ5 A;  1VYI A;  3WOD F;  2NUT B;  4CDV A;  3DM5 A;  2KK1 A;  4DBQ A;  2MWQ A;  1HW1 A;  2XLD A;  3AGT A;  3GEI A;  2AWY A;  2GFH A;  2QY9 A;  4NTF A;  1HW2 A;  4H4K C;  3FDQ A;  2V26 A;  1ZHZ A;  4MTF A;  1BR2 A;  3EG9 B;  2ZXP A;  4MTO A;  1BDJ B;  1SF8 A;  2G62 A;  4ULW A;  3X2Q C;  1GQA A;  2YZS A;  3N0T A;  5L3V A;  4C3E A;  3M15 A;  5KYW A;  2RD9 A;  4QDL A;  1JR8 A;  1LVK A;  3Q7L A;  4D4N A;  2R7T A;  1DOW A;  4Z9H A;  2DI3 A;  4ONS A;  4GEH A;  3RIP A;  4LDK A;  4DOZ A;  4JJG A;  1LM3 B;  1VOM A;  2VCA A;  3UNG C;  1T6U A;  3HLZ A;  4NTA A;  4MVM A;  2J0W A;  3EZI A;  3RVY A;  4ULV A;  3ZTM A;  3GOD A;  1G5Z A;  2D4U A;  5T3W A;  2CGE A;  3RQF A;  2QUP A;  3A9C A;  2R7V A;  2ETS A;  4P6I C;  3SP1 A;  4YT2 A;  1YYX A;  2J8W A;  3KMI A;  3HTK C;  1CPQ A;  1FMV A;  5D92 A;  1XZP A;  1ZHY A;  2XLE A;  2YVK A;  2IXP A;  1M2V A;  4LAC B;  3EGX B;  1Q0G A;  3ASN C;  3G50 A;  2GA0 A;  3U5S A;  1UG7 A;  4JKV A;  1HMD A;  4OIQ F;  3FMS A;  2YKZ A;  1Z3I X;  2TMV P;  5KYY B;  1Q0M A;  5BQI A;  2R7S A;  2XLV A;  3W2V A; 
#chains in the Genus database with same CATH homology
 1K04 A;  3C8G B;  3GM3 A;  3BRJ A;  1V4A A;  1K05 A;  1WOL A;  3AJM A;  3MFN A;  4XEV A;  3S9O A;  1O3U A;  2JPU A;  4NQF A;  3B71 A;  3GM1 A;  3U0C A;  2Q00 A;  1OW6 A;  3O10 A;  2L6F A;  1QVX A;  3JYY A;  1PV3 A;  3RQG A;  2JX0 A;  3GM2 A;  1WWP A;  4XEK A;  1OW7 A;  2L6H A;  3RQF A;  3U3F A;  1ZZP A;  3L8I A;  4EBK A;  1UFB A;  1WTY A;  3C8G A;  2KK1 A;  1KNY A;  2LK4 A;  2PBE A;  2YWA A;  2L6G A;  1KTM A;  1K40 A;  3TUL A;  3C8G D;  2HSB A;  1JOG A;  4R32 A;  4EBJ A;  3L8J A;  3C18 A;  1OW8 A;  3K7D A;  3RQE A;  5F28 E;  3JZ0 A;  4XEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...