4NQFA

Crystal structure of hepn domain protein
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
LSPADALRVAEDHFLRHMPDARDFADVAKYLVAKGNLHLAAFNLHQAVETAYNCYLLTLTNYSPASHNMKFLRGLSEGRDRRLIDIWPRDRQRFTTWYNIMNEAYVKARYSKRFEVSEEALTWLQERTAELHKLVETLCREHIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleotidyltransferase
publication title Dimerization of VirD2 Binding Protein Is Essential for Agrobacterium Induced Tumor Formation in Plants
pubmed doi rcsb
source organism Agrobacterium fabrum
molecule tags Transferase
total genus 51
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4nqfA00
3S9OA 1V4AA 4XEVA 4XEFA 3TULA 1QVXA 3B71A 3RQEA 4XEKA 3O10A 1ZZPA 3L8IA 3RQFA 1WOLA 2JX0A 3JZ0A 1O3UA 2KK1A 1WTYA 2HSBA 1OW6A 4NQFA 1K04A 1WWPA 3RQGA 1OW7A 2Q00A 3C8GD 2JPUA 5F28E 2L6FA 3GM1A 3U3FA 1K40A 2L6HA 2LK4A 3C18A 3K7DA 4EBKA 1JOGA 3C8GA 3JYYA 1K05A 3BRJA 1KNYA 1OW8A 3AJMA 3GM3A 3C8GB 2L6GA 2PBEA 1PV3A 3L8JA 4EBJA 1KTMA 2YWAA 3U0CA 3GM2A 1UFBA 3MFNA 4R32A
chains in the Genus database with same CATH superfamily
2ZXWC 5JRAA 4IAOA 5DLJA 4BJ5C 1CPQA 1XWJA 3PCVA 3TULA 3TD7A 3AQCA 2H7BA 4O7GA 3AG1C 4A2NB 3O10A 1RKCA 1IW7F 1MMDA 4G7HF 2XXAA 5L0CA 1WTYA 1E86A 3B9QA 3CQZA 1JAFA 1OW6A 2HV6A 2WVNA 2YEVA 3RKOF 1ORYA 2YQYA 3LLKA 4O6NA 3ZG1A 1BBHA 1L3PA 2QY9A 4J32B 1OCCC 4JVSA 1EKYA 5F28E 2WVOA 2A69F 3FOPA 4AE4A 2OU6A 2P61A 3C18A 3DI5A 1M2VB 2Y3HA 4AK9A 1V74B 2VASA 3ABKC 4Q5SF 1WATA 3ZSUA 4B6IA 1TWCA 4HE8D 2OJED 2HV7A 2HUJA 3Q6MA 1UFBA 4PR9A 1OR3A 2LFFA 3ASOC 3K33A 4WGYA 3T4RA 1D0XA 2CDQA 5DS6A 4DOZA 3O6XA 4EBBA 5L0IA 4NTFA 3LEOA 4GEHA 2XSEA 4XEKA 1W2WA 4JW1A 4C7OB 2OCCC 2GA0A 4BJTA 1Z3IX 4H4KC 4ANJA 5A6JA 3EGXA 2R7TA 4Z9IA 5F5HA 5A6AA 3I5PA 4BPMA 3QW0A 3HNIA 1YA7O 4JEBA 2NUTB 3ZTMA 3S84A 4NTAA 3C8GA 1OXBA 3DXJF 3HJCA 3FAPB 2NSFA 3H65A 2ETSA 4JTCB 4PACA 4AE4B 3X2QC 5CIVA 2R7WA 4JIOA 1EA8A 1VLSA 256BA 2AVKA 3EH2A 5D92A 5JP7A 3L8JA 4DRIB 3LAYA 4YL1A 1OCOC 4OIQF 4LLEA 5FZTA 2PP4A 1HW2A 4MVUA 4U5HA 3ITFA 1H6GA 2L81A 4LACB 3JT1A 2JX0A 1RKEA 4IJJA 3SXMA 3GODA 1Y6DA 2XLDA 2LP4A 1LE4A 1HMDA 2BE5F 2MWQA 3LLIA 4J7YA 1OW7A 3EQLF 5COFA 1LKXA 3RH3A 1FFTC 2R7OA 2ZXOA 3DJUB 2QLAA 3HNLA 1OKKD 2HS5A 3EGXB 1GQAA 1Z23A 1ZW3A 1NBBA 2UUHA 1DOWA 2X51A 4MW8A 1HE1A 2HMZA 4WABA 3V5XA 1G4US 3DM5A 3U9JA 2V3CC 4U9DA 4YJWA 1T6QA 3JSEO 3B0UX 5E33A 1Y4CA 4KBLA 3AJMA 2HZ8A 2YKZA 1MMAA 4YN0B 3G4ZA 3EH1A 4YWQA 2WB7A 1UG7A 2VH3A 1Q0DA 4C3DA 3W8HA 1I4YA 4G78A 3LJBA 5L0DA 4CJGA 4E7SA 2R7XA 4FX5A 2CNWA 2LQGA 2R03A 2P0NA 2XL6A 3RIPA 4OIPF 2KGOA 4E18A 4D4XA 1Q0MA 1ZHYA 3U2LA 2KQ9A 1SZIA 3MYFA 2EPOA 2YHSA 2YVKA 4XTKA 1APCA 1I4ZA 1LS1A 2A6HF 2AU5A 2XLVA 2YRFA 4NTBA 2IXPA 4U9EA 4W8PA 4BEJA 2ZXPA 1YJGA 4ONSA 2OKUA 3UR3C 4YK5A 3C8ZA 4EKWA 3B0PA 3ZC4A 1HE9A 3MYIA 5T1DB 3RVYA 2XS8A 1BDJB 1U6HA 4N6HA 3SP1A 2D5RB 2YL3A 1CPRA 3H2UA 3TQOA 1FAPB 1TFOB 1D1BA 4U5BE 2CCYA 2FGYA 3LEVA 4YT2A 3ZIBA 1V4AA 4XEVA 2WVQA 5KYXB 5DS5A 4YL3A 2E87A 2HKVA 3GWNA 1YYXA 3JZ0A 1NG1A 1OQCA 2CGEA 2VCAA 3LESA 5JSLA 3V5ZA 3GEEA 3F47A 1U0BB 2PFDA 1TWHA 2R25A 3DM9B 5EHHA 3S0XA 3QZCA 5T3TA 1M2VA 1QPUA 3T6JA 3TOLA 3FXHA 1Q0GA 2I8BA 2J7PD 2Q9CA 3K66A 3LUTB 2EPMX 4L6RA 1NLXA 1YYJA 2HMQA 2F22A 1OR2A 4F4BA 3UMHA 1KTMA 2PBEA 3RYLA 3J06A 2A68F 3U3BA 5KYWB 4ER9A 2YL7A 1MMGA 4U5CE 4C7OA 3G50A 2C04A 1RJ9B 4WJ0A 4CS9A 1AEPA 4P6IC 4OINF 4RBNA 1VYKA 1TR2A 3U9MA 3ZDLA 1DOVA 3U8VA 2G3KA 2J9WA 1ORSC 4IAQA 3AGTA 2CYDA 3K1IA 4O6MA 2ICWG 2NUTA 4CSAA 1GS9A 3A9CA 1V54C 4JTAB 4ZLDA 3L34A 3NRHA 2PF4E 4Q4ZF 1NFNA 4EHPA 4AL0A 2XRHA 2W9YA 3H2VA 1MNDA 3BEHA 3K6BA 4YL0A 4CS8C 3FAJA 3AQBA 3VAYA 2WZGA 1OW8A 2KJGA 3W8IA 2XLMA 2W4MA 3GEIA 3T9OA 5A6KA 1G8XA 4XPXA 3EGDB 2J9VA 2WZLA 5KYUB 5COMA 2LD6A 3KH2A 3U8PA 4XLPF 4DVYP 3KMIA 5KYYB 2R7QA 3I5QA 4FAPB 2J0XA 2J45A 2OEXA 1HW1A 4LDKA 1BR2A 1FMVA 1Z6AA 2XLOA 2BC5A 1M57C 2QNLA 4U5GA 3S28A 3W4YA 1GM5A 2XM0A 2Q00A 4CIHA 3CAXA 3NMKA 5COGA 1EI7A 3NDBB 1R5ID 3C8GD 2G3VA 4DRHB 5AGFA 4CS9C 3C63A 3HLZA 4EIYA 5BUOA 1E83A 3AOUA 4O6YA 5K0IA 2LSEA 3QVZA 2XLHA 1GGQA 3V5YA 2Y69C 3LNMB 4KI2A 2X0CA 2EIMC 3K1IC 3E9VA 1KNYA 4MVMA 4FWVA 4NCQA 4JTDB 5CI8A 5A69A 4AX2A 4U5EE 1M2OA 1PD1A 2OG2A 1D1AA 4CDYA 2A0BA 4MVOA 2YLGA 1LI7A 1Q0KA 3RFYA 3JSZA 3GWLA 3ABMC 2M64A 2HSQA 3ABLC 4MNDA 5A6BD 3IQ5A 5L0GA 3EHNA 1SR2A 3IPMO 3KYJA 1YZCA 2YL0A 4ZLCA 4PJMA 1E2XA 1MNEA 4RDAA 1PCXA 1QQ3A 2R7RA 4JURI 2KSFA 1LS4A 3R2PA 1SF8A 2GDCA 2JD3A 5DVWA 3TJ5A 1MQVA 3LS0A 2L7AA 2M4EA 3UMKA 1VYIA 3W2WA 1JMWA 3UMIA 2EPLX 1FMWA 1HY5A 2LK4A 4DBQA 1NFOA 3O55A 4G0HA 5B1BC 3V7OA 1ZU5A 2I15A 4LDQA 3KYIA 4XLNF 3DZAA 2KYHA 1I5NA 2H7VC 4K0DA 4MTFA 4DRJB 4WGZA 3T6BA 3SYNA 2PX0A 4MQ9F 4CBEA 5KYXA 1YDIA 2D4UA 2Y3DA 4PK4A 1A7DA 3NG1A 4XPYA 3WG7C 1XZQA 3W2VA 4GYTA 2IOQA 2P7VA 2B0JA 2MHRA 4IWBA 1FFHA 4QI0A 2HSBA 4JCHA 1K04A 3FHDA 4IRUA 3VF0A 1H9TA 2NUPB 2V26A 3VRCA 5JUAA 4YT5A 4QDLA 3S90A 2RD9A 2R05A 3N0TA 2JPUA 2YLIA 2L6FA 4M63A 3M4BA 4N4WA 3GEHA 5L3QA 3FVYA 4DBRA 1OCZC 2Y3GA 3DD7A 1ST6A 4K7BA 4MVRA 2A1DD 3GANA 3OWTA 4HFKB 4JKVA 2OOCA 1O5HA 4JE9A 3QTHA 5KYWA 1IZMA 2DI3A 4HFFB 1LPEA 2H8AA 3IQ6A 2UUIA 3EHMA 1WASA 3MFNA 3U0CA 1RJ9A 3S9OA 3X1OA 2HFIA 3AG2C 2PX3A 3S29A 1HMOA 1S05A 4I1OB 1NU9C 3QVYA 1QVXA 3ZWIA 2QUPA 2Q3TA 3Q7LA 1YARO 3VM6A 3SXZA 5DQZA 2WZFA 3NYLA 1BR1A 1NSGB 1ZZPA 2BL2A 2KNHA 3MLGA 1YLMA 2YZSA 3SXYA 1D1CA 3TJ6A 3ASNC 3FMSA 3PDMP 1N1CA 4CIPA 2GAQA 3AG3C 4MTOA 5EGYA 1ZHTA 2Y3BA 2IM8A 3I4UA 4PJLA 5F5FA 1QZXA 2IXNA 4MS2A 1ZHXA 5BQGA 1E84A 2LFDA 4I1MA 3B29A 3K7DA 3GORA 1B68A 3JYYA 1O87A 4BG0A 4CDAA 1K05A 2VCBA 1EQ1A 1H7IA 4LERA 3OEOA 3LS1A 3A11A 2VCCA 1PV3A 2J9BA 4KNWA 3EGDA 4NC3A 4OD5A 5KYUA 2YWAA 3KL4A 1T01A 3GM2A 1ZHZA 4ULVA 2J8WA 2LIGA 3DWWA 2EPKX 3HNJA 1T9KA 5JS5A 3U5SA 5KYYA 1C02A 4A4AA 3WODF 1WN0A 5L0JA 3SNHA 4OD4A 2OEVA 2QTVA 3G4XA 5AC5A 2VB6A 4D4NA 5FCLA 2J46A 1Q0FA 4W8KA 3JRMO 1A41A 1TKNA 2DGJA 3LNRA 3M79A 4DVZA 3K1HA 2AWYA 1LVKA 1QKRA 2KC3A 2KW3C 3PHF2 1KU2A 2H7OA 2XL8A 3N2ZB 3EFOB 4Z9JA 2IXMA 2GWWA 3EZIA 3ZQYA 5HSWA 1CGNA 3EPVA 2DYSC 3ATPA 2IXOA 3B0VC 3UNGC 1Z63A 4MVZA 1AVOB 2J7PA 4MVSA 2L6GA 5GPGB 3KKBA 4PJJA 5IY5C 1ZYRF 4HEAJ 2HJ3A 1PD0A 1A7EA 1YZAA 4YT4A 3POVA 4XEFA 5B3IA 5HV9A 3NMIA 4CDVA 2Q9BA 4EWCA 1D0YA 2EIJC 4J7TA 2AWCA 5L3VA 4CJOA 3RQFA 4OIOF 4E0HA 5BQHA 4PJNA 4U5FE 1WWPA 3RQGA 4DXWA 2P1AA 2HJMA 5T3WA 1G5ZA 3CEXA 2XM4A 3ZTZA 1ORJA 5BQIA 3U2MA 3HNKA 1LM3B 1K40A 2R7UA 2L6HA 4Z9HA 4BJ1A 3JRTA 2FFHA 2W45A 4GQHA 1JPJA 5JVEA 1LIHA 2Z15A 1Z5ZA 4JJGA 1Z7Qc 4DJ9A 1ZVZA 3SXKA 1M6TA 2EIKC 1JR8A 1QSPA 1YA9A 3HKKA 3NKEA 2WL8A 1S7ZA 4FESA 2NG1A 3SEOA 2TMVP 2IBFA 4CSAC 1TFKB 1AUEA 3IQCA 3IEEA 4JC7A 1QLEC 3QW1A 2J9UA 1TQGA 3NKDA 4C3EA 4EUKB 3DKAA 4MTGA 4E7ZA 4N06A 3UGPA 2NUPA 3RW0A 2GFHA 5E3AA 2XXAB 3SZRA 3NYJA 1LE2A 1M56C 3DE9A 3L1MA 4JJFA 4NY3A 5CI9A 2XLWA 2QE9A 5D91A 3EG9A 2ZPAA 3KPHA 1F1MA 3TK0A 4G7OF 3MX3A 4BEMJ 2VC9A 3AG4C 4XWJA 1R4TA 5DQTA 1VTMP 3WHNA 1YVIA 2OJQA 3GM3A 3O39A 2W4BA 2C03A 3RF3A 5B3SC 1OCRC 1T6UA 4JCZA 2NSGA 4MVQA 2B0HA 1VK5A 2CNWD 4OIRF 3IQTA 4BJ6A 1T6IA 4AL1A 3VYWA 4Q7CA 3CZ6A 1T5OA 1WGWA 1YAUO 1TWGA 2Q9AA 2XLEA 3T6GB 5A6BA 3L8IA 3F46A 5E3CA 4E17A 1O3UA 2KK1A 4IGGA 1RCPA 5TJ5E 3DAGA 5JT4A 1RXQA 4I3MA 4RD9A 4ULWA 1RMVA 4PFPA 1JPNA 2A0UA 1CGOA 2EPNA 2ZD9A 3NYMA 4P9FA 5E2QA 4KC9A 1A0BA 2NPUA 3JYHA 3ZVRA 5AC4A 2EILC 4MW3A 3R7CA 3DJNB 1OKKA 1C03A 1XZPA 3M15A 4K1OA 2A6EF 2P6VA 3EG9B 3Q6NA 3M4CA 2XL4A 2L9JA 4EBJA 3C8GB 1SMYF 3DMDA 4C3BA 3JTLO 4P9TA 1FNTc 4R32A 2CW0F 4KNVA 2J0WA 1H9GA 1MMNA 4IARA 2FAPB 3AGUA 1ZU4A 3B71A 4JEAA 4E0IA 1CGME 2ASRA 3EZHA 3M1CB 3PMRA 3C7JA 1D0ZA 1WOLA 1SYQA 2R9RB 4IB4A 1TWAA 1FR0A 3JCUQ 2DYRC 1NZEA 1RKEB 4BJ6C 1VOMA 1JRAA 5L0HA 3EFOA 1ZW2A 1ZHWA 2DB4A 2R7VA 3N24A 2R02A 1V55C 4LDRA 3GM1A 2Q4FA 4CX9A 5EK0A 4BJ5A 3DE8A 4CS7A 1E85A 1VMAA 1VB5A 2MYSA 3BRJA 4I44A 3DAFA 3C62A 1J8YF 5B1AC 3EJNA 1FTSA 4X0RA 2ZXRA 1J8MF 2O9XA 2OQMA 3MBGA 3OA1A 1OXKA 2Q7RA 3FDQA 4QI2A 4U5DE 1NU7D 3E70C 2PNOA 3TOMA 1U89A 3HTKC 5DS4A 1A7VA 3RQEA 2EINC 4J30B 4JZAA 4O79A 3NMJA 1G4WR 5L0FA 1BZ4A 2R7SA 1VLTA 1BR4A 2YLDA 4CS8A 4XQ1A 3RVZA 4NQFA 3FOOA 4YT8A 4N6CA 5JLIA 4H54A 3UGOA 2LCHA 3IHUA 3QMKA 5KYNA 4PFOA 3U3FA 3ECSA 1C17M 2RSEB 3WAQA 4EBKA 2Y39A 1JOGA 4XPWA 4UDVA 2IYLD 2G62A 1LI5A 2AP3A 3Q7GA 3ZQVA 2YL1A 4LLCA 2XS1A 3S27A 3US6A 3CSKA 3L0IA 4JRZA 4G7ZF 1L7CA
chains in the Genus database with same CATH topology
3S9OA 1V4AA 4XEVA 4XEFA 3TULA 1QVXA 3B71A 3RQEA 4XEKA 3O10A 1ZZPA 3L8IA 3RQFA 1WOLA 2JX0A 3JZ0A 1O3UA 2KK1A 1WTYA 2HSBA 1OW6A 4NQFA 1K04A 1WWPA 3RQGA 1OW7A 2Q00A 3C8GD 2JPUA 5F28E 2L6FA 3GM1A 3U3FA 1K40A 2L6HA 2LK4A 3C18A 3K7DA 4EBKA 1JOGA 3C8GA 3JYYA 1K05A 3BRJA 1KNYA 1OW8A 3AJMA 3GM3A 3C8GB 2L6GA 2PBEA 1PV3A 3L8JA 4EBJA 1KTMA 2YWAA 3U0CA 3GM2A 1UFBA 3MFNA 4R32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9O A;  1V4A A;  4XEV A;  4XEF A;  3TUL A;  1QVX A;  3B71 A;  3RQE A;  4XEK A;  3O10 A;  1ZZP A;  3L8I A;  3RQF A;  1WOL A;  2JX0 A;  3JZ0 A;  1O3U A;  2KK1 A;  1WTY A;  2HSB A;  1OW6 A;  4NQF A;  1K04 A;  1WWP A;  3RQG A;  1OW7 A;  2Q00 A;  3C8G D;  2JPU A;  5F28 E;  2L6F A;  3GM1 A;  3U3F A;  1K40 A;  2L6H A;  2LK4 A;  3C18 A;  3K7D A;  4EBK A;  1JOG A;  3C8G A;  3JYY A;  1K05 A;  3BRJ A;  1KNY A;  1OW8 A;  3AJM A;  3GM3 A;  3C8G B;  2L6G A;  2PBE A;  1PV3 A;  3L8J A;  4EBJ A;  1KTM A;  2YWA A;  3U0C A;  3GM2 A;  1UFB A;  3MFN A;  4R32 A; 
#chains in the Genus database with same CATH topology
 2ZXW C;  5JRA A;  4IAO A;  5DLJ A;  4BJ5 C;  1CPQ A;  1XWJ A;  3PCV A;  3TUL A;  3TD7 A;  3AQC A;  2H7B A;  4O7G A;  3AG1 C;  4A2N B;  3O10 A;  1RKC A;  1IW7 F;  1MMD A;  4G7H F;  2XXA A;  5L0C A;  1WTY A;  1E86 A;  3B9Q A;  3CQZ A;  1JAF A;  1OW6 A;  2HV6 A;  2WVN A;  2YEV A;  3RKO F;  1ORY A;  2YQY A;  3LLK A;  4O6N A;  3ZG1 A;  1BBH A;  1L3P A;  2QY9 A;  4J32 B;  1OCC C;  4JVS A;  1EKY A;  5F28 E;  2WVO A;  2A69 F;  3FOP A;  4AE4 A;  2OU6 A;  2P61 A;  3C18 A;  3DI5 A;  1M2V B;  2Y3H A;  4AK9 A;  1V74 B;  2VAS A;  3ABK C;  4Q5S F;  1WAT A;  3ZSU A;  4B6I A;  1TWC A;  4HE8 D;  2OJE D;  2HV7 A;  2HUJ A;  3Q6M A;  1UFB A;  4PR9 A;  1OR3 A;  2LFF A;  3ASO C;  3K33 A;  4WGY A;  3T4R A;  1D0X A;  2CDQ A;  5DS6 A;  4DOZ A;  3O6X A;  4EBB A;  5L0I A;  4NTF A;  3LEO A;  4GEH A;  2XSE A;  4XEK A;  1W2W A;  4JW1 A;  4C7O B;  2OCC C;  2GA0 A;  4BJT A;  1Z3I X;  4H4K C;  4ANJ A;  5A6J A;  3EGX A;  2R7T A;  4Z9I A;  5F5H A;  5A6A A;  3I5P A;  4BPM A;  3QW0 A;  3HNI A;  1YA7 O;  4JEB A;  2NUT B;  3ZTM A;  3S84 A;  4NTA A;  3C8G A;  1OXB A;  3DXJ F;  3HJC A;  3FAP B;  2NSF A;  3H65 A;  2ETS A;  4JTC B;  4PAC A;  4AE4 B;  3X2Q C;  5CIV A;  2R7W A;  4JIO A;  1EA8 A;  1VLS A;  256B A;  2AVK A;  3EH2 A;  5D92 A;  5JP7 A;  3L8J A;  4DRI B;  3LAY A;  4YL1 A;  1OCO C;  4OIQ F;  4LLE A;  5FZT A;  2PP4 A;  1HW2 A;  4MVU A;  4U5H A;  3ITF A;  1H6G A;  2L81 A;  4LAC B;  3JT1 A;  2JX0 A;  1RKE A;  4IJJ A;  3SXM A;  3GOD A;  1Y6D A;  2XLD A;  2LP4 A;  1LE4 A;  1HMD A;  2BE5 F;  2MWQ A;  3LLI A;  4J7Y A;  1OW7 A;  3EQL F;  5COF A;  1LKX A;  3RH3 A;  1FFT C;  2R7O A;  2ZXO A;  3DJU B;  2QLA A;  3HNL A;  1OKK D;  2HS5 A;  3EGX B;  1GQA A;  1Z23 A;  1ZW3 A;  1NBB A;  2UUH A;  1DOW A;  2X51 A;  4MW8 A;  1HE1 A;  2HMZ A;  4WAB A;  3V5X A;  1G4U S;  3DM5 A;  3U9J A;  2V3C C;  4U9D A;  4YJW A;  1T6Q A;  3JSE O;  3B0U X;  5E33 A;  1Y4C A;  4KBL A;  3AJM A;  2HZ8 A;  2YKZ A;  1MMA A;  4YN0 B;  3G4Z A;  3EH1 A;  4YWQ A;  2WB7 A;  1UG7 A;  2VH3 A;  1Q0D A;  4C3D A;  3W8H A;  1I4Y A;  4G78 A;  3LJB A;  5L0D A;  4CJG A;  4E7S A;  2R7X A;  4FX5 A;  2CNW A;  2LQG A;  2R03 A;  2P0N A;  2XL6 A;  3RIP A;  4OIP F;  2KGO A;  4E18 A;  4D4X A;  1Q0M A;  1ZHY A;  3U2L A;  2KQ9 A;  1SZI A;  3MYF A;  2EPO A;  2YHS A;  2YVK A;  4XTK A;  1APC A;  1I4Z A;  1LS1 A;  2A6H F;  2AU5 A;  2XLV A;  2YRF A;  4NTB A;  2IXP A;  4U9E A;  4W8P A;  4BEJ A;  2ZXP A;  1YJG A;  4ONS A;  2OKU A;  3UR3 C;  4YK5 A;  3C8Z A;  4EKW A;  3B0P A;  3ZC4 A;  1HE9 A;  3MYI A;  5T1D B;  3RVY A;  2XS8 A;  1BDJ B;  1U6H A;  4N6H A;  3SP1 A;  2D5R B;  2YL3 A;  1CPR A;  3H2U A;  3TQO A;  1FAP B;  1TFO B;  1D1B A;  4U5B E;  2CCY A;  2FGY A;  3LEV A;  4YT2 A;  3ZIB A;  1V4A A;  4XEV A;  2WVQ A;  5KYX B;  5DS5 A;  4YL3 A;  2E87 A;  2HKV A;  3GWN A;  1YYX A;  3JZ0 A;  1NG1 A;  1OQC A;  2CGE A;  2VCA A;  3LES A;  5JSL A;  3V5Z A;  3GEE A;  3F47 A;  1U0B B;  2PFD A;  1TWH A;  2R25 A;  3DM9 B;  5EHH A;  3S0X A;  3QZC A;  5T3T A;  1M2V A;  1QPU A;  3T6J A;  3TOL A;  3FXH A;  1Q0G A;  2I8B A;  2J7P D;  2Q9C A;  3K66 A;  3LUT B;  2EPM X;  4L6R A;  1NLX A;  1YYJ A;  2HMQ A;  2F22 A;  1OR2 A;  4F4B A;  3UMH A;  1KTM A;  2PBE A;  3RYL A;  3J06 A;  2A68 F;  3U3B A;  5KYW B;  4ER9 A;  2YL7 A;  1MMG A;  4U5C E;  4C7O A;  3G50 A;  2C04 A;  1RJ9 B;  4WJ0 A;  4CS9 A;  1AEP A;  4P6I C;  4OIN F;  4RBN A;  1VYK A;  1TR2 A;  3U9M A;  3ZDL A;  1DOV A;  3U8V A;  2G3K A;  2J9W A;  1ORS C;  4IAQ A;  3AGT A;  2CYD A;  3K1I A;  4O6M A;  2ICW G;  2NUT A;  4CSA A;  1GS9 A;  3A9C A;  1V54 C;  4JTA B;  4ZLD A;  3L34 A;  3NRH A;  2PF4 E;  4Q4Z F;  1NFN A;  4EHP A;  4AL0 A;  2XRH A;  2W9Y A;  3H2V A;  1MND A;  3BEH A;  3K6B A;  4YL0 A;  4CS8 C;  3FAJ A;  3AQB A;  3VAY A;  2WZG A;  1OW8 A;  2KJG A;  3W8I A;  2XLM A;  2W4M A;  3GEI A;  3T9O A;  5A6K A;  1G8X A;  4XPX A;  3EGD B;  2J9V A;  2WZL A;  5KYU B;  5COM A;  2LD6 A;  3KH2 A;  3U8P A;  4XLP F;  4DVY P;  3KMI A;  5KYY B;  2R7Q A;  3I5Q A;  4FAP B;  2J0X A;  2J45 A;  2OEX A;  1HW1 A;  4LDK A;  1BR2 A;  1FMV A;  1Z6A A;  2XLO A;  2BC5 A;  1M57 C;  2QNL A;  4U5G A;  3S28 A;  3W4Y A;  1GM5 A;  2XM0 A;  2Q00 A;  4CIH A;  3CAX A;  3NMK A;  5COG A;  1EI7 A;  3NDB B;  1R5I D;  3C8G D;  2G3V A;  4DRH B;  5AGF A;  4CS9 C;  3C63 A;  3HLZ A;  4EIY A;  5BUO A;  1E83 A;  3AOU A;  4O6Y A;  5K0I A;  2LSE A;  3QVZ A;  2XLH A;  1GGQ A;  3V5Y A;  2Y69 C;  3LNM B;  4KI2 A;  2X0C A;  2EIM C;  3K1I C;  3E9V A;  1KNY A;  4MVM A;  4FWV A;  4NCQ A;  4JTD B;  5CI8 A;  5A69 A;  4AX2 A;  4U5E E;  1M2O A;  1PD1 A;  2OG2 A;  1D1A A;  4CDY A;  2A0B A;  4MVO A;  2YLG A;  1LI7 A;  1Q0K A;  3RFY A;  3JSZ A;  3GWL A;  3ABM C;  2M64 A;  2HSQ A;  3ABL C;  4MND A;  5A6B D;  3IQ5 A;  5L0G A;  3EHN A;  1SR2 A;  3IPM O;  3KYJ A;  1YZC A;  2YL0 A;  4ZLC A;  4PJM A;  1E2X A;  1MNE A;  4RDA A;  1PCX A;  1QQ3 A;  2R7R A;  4JUR I;  2KSF A;  1LS4 A;  3R2P A;  1SF8 A;  2GDC A;  2JD3 A;  5DVW A;  3TJ5 A;  1MQV A;  3LS0 A;  2L7A A;  2M4E A;  3UMK A;  1VYI A;  3W2W A;  1JMW A;  3UMI A;  2EPL X;  1FMW A;  1HY5 A;  2LK4 A;  4DBQ A;  1NFO A;  3O55 A;  4G0H A;  5B1B C;  3V7O A;  1ZU5 A;  2I15 A;  4LDQ A;  3KYI A;  4XLN F;  3DZA A;  2KYH A;  1I5N A;  2H7V C;  4K0D A;  4MTF A;  4DRJ B;  4WGZ A;  3T6B A;  3SYN A;  2PX0 A;  4MQ9 F;  4CBE A;  5KYX A;  1YDI A;  2D4U A;  2Y3D A;  4PK4 A;  1A7D A;  3NG1 A;  4XPY A;  3WG7 C;  1XZQ A;  3W2V A;  4GYT A;  2IOQ A;  2P7V A;  2B0J A;  2MHR A;  4IWB A;  1FFH A;  4QI0 A;  2HSB A;  4JCH A;  1K04 A;  3FHD A;  4IRU A;  3VF0 A;  1H9T A;  2NUP B;  2V26 A;  3VRC A;  5JUA A;  4YT5 A;  4QDL A;  3S90 A;  2RD9 A;  2R05 A;  3N0T A;  2JPU A;  2YLI A;  2L6F A;  4M63 A;  3M4B A;  4N4W A;  3GEH A;  5L3Q A;  3FVY A;  4DBR A;  1OCZ C;  2Y3G A;  3DD7 A;  1ST6 A;  4K7B A;  4MVR A;  2A1D D;  3GAN A;  3OWT A;  4HFK B;  4JKV A;  2OOC A;  1O5H A;  4JE9 A;  3QTH A;  5KYW A;  1IZM A;  2DI3 A;  4HFF B;  1LPE A;  2H8A A;  3IQ6 A;  2UUI A;  3EHM A;  1WAS A;  3MFN A;  3U0C A;  1RJ9 A;  3S9O A;  3X1O A;  2HFI A;  3AG2 C;  2PX3 A;  3S29 A;  1HMO A;  1S05 A;  4I1O B;  1NU9 C;  3QVY A;  1QVX A;  3ZWI A;  2QUP A;  2Q3T A;  3Q7L A;  1YAR O;  3VM6 A;  3SXZ A;  5DQZ A;  2WZF A;  3NYL A;  1BR1 A;  1NSG B;  1ZZP A;  2BL2 A;  2KNH A;  3MLG A;  1YLM A;  2YZS A;  3SXY A;  1D1C A;  3TJ6 A;  3ASN C;  3FMS A;  3PDM P;  1N1C A;  4CIP A;  2GAQ A;  3AG3 C;  4MTO A;  5EGY A;  1ZHT A;  2Y3B A;  2IM8 A;  3I4U A;  4PJL A;  5F5F A;  1QZX A;  2IXN A;  4MS2 A;  1ZHX A;  5BQG A;  1E84 A;  2LFD A;  4I1M A;  3B29 A;  3K7D A;  3GOR A;  1B68 A;  3JYY A;  1O87 A;  4BG0 A;  4CDA A;  1K05 A;  2VCB A;  1EQ1 A;  1H7I A;  4LER A;  3OEO A;  3LS1 A;  3A11 A;  2VCC A;  1PV3 A;  2J9B A;  4KNW A;  3EGD A;  4NC3 A;  4OD5 A;  5KYU A;  2YWA A;  3KL4 A;  1T01 A;  3GM2 A;  1ZHZ A;  4ULV A;  2J8W A;  2LIG A;  3DWW A;  2EPK X;  3HNJ A;  1T9K A;  5JS5 A;  3U5S A;  5KYY A;  1C02 A;  4A4A A;  3WOD F;  1WN0 A;  5L0J A;  3SNH A;  4OD4 A;  2OEV A;  2QTV A;  3G4X A;  5AC5 A;  2VB6 A;  4D4N A;  5FCL A;  2J46 A;  1Q0F A;  4W8K A;  3JRM O;  1A41 A;  1TKN A;  2DGJ A;  3LNR A;  3M79 A;  4DVZ A;  3K1H A;  2AWY A;  1LVK A;  1QKR A;  2KC3 A;  2KW3 C;  3PHF 2;  1KU2 A;  2H7O A;  2XL8 A;  3N2Z B;  3EFO B;  4Z9J A;  2IXM A;  2GWW A;  3EZI A;  3ZQY A;  5HSW A;  1CGN A;  3EPV A;  2DYS C;  3ATP A;  2IXO A;  3B0V C;  3UNG C;  1Z63 A;  4MVZ A;  1AVO B;  2J7P A;  4MVS A;  2L6G A;  5GPG B;  3KKB A;  4PJJ A;  5IY5 C;  1ZYR F;  4HEA J;  2HJ3 A;  1PD0 A;  1A7E A;  1YZA A;  4YT4 A;  3POV A;  4XEF A;  5B3I A;  5HV9 A;  3NMI A;  4CDV A;  2Q9B A;  4EWC A;  1D0Y A;  2EIJ C;  4J7T A;  2AWC A;  5L3V A;  4CJO A;  3RQF A;  4OIO F;  4E0H A;  5BQH A;  4PJN A;  4U5F E;  1WWP A;  3RQG A;  4DXW A;  2P1A A;  2HJM A;  5T3W A;  1G5Z A;  3CEX A;  2XM4 A;  3ZTZ A;  1ORJ A;  5BQI A;  3U2M A;  3HNK A;  1LM3 B;  1K40 A;  2R7U A;  2L6H A;  4Z9H A;  4BJ1 A;  3JRT A;  2FFH A;  2W45 A;  4GQH A;  1JPJ A;  5JVE A;  1LIH A;  2Z15 A;  1Z5Z A;  4JJG A;  1Z7Q c;  4DJ9 A;  1ZVZ A;  3SXK A;  1M6T A;  2EIK C;  1JR8 A;  1QSP A;  1YA9 A;  3HKK A;  3NKE A;  2WL8 A;  1S7Z A;  4FES A;  2NG1 A;  3SEO A;  2TMV P;  2IBF A;  4CSA C;  1TFK B;  1AUE A;  3IQC A;  3IEE A;  4JC7 A;  1QLE C;  3QW1 A;  2J9U A;  1TQG A;  3NKD A;  4C3E A;  4EUK B;  3DKA A;  4MTG A;  4E7Z A;  4N06 A;  3UGP A;  2NUP A;  3RW0 A;  2GFH A;  5E3A A;  2XXA B;  3SZR A;  3NYJ A;  1LE2 A;  1M56 C;  3DE9 A;  3L1M A;  4JJF A;  4NY3 A;  5CI9 A;  2XLW A;  2QE9 A;  5D91 A;  3EG9 A;  2ZPA A;  3KPH A;  1F1M A;  3TK0 A;  4G7O F;  3MX3 A;  4BEM J;  2VC9 A;  3AG4 C;  4XWJ A;  1R4T A;  5DQT A;  1VTM P;  3WHN A;  1YVI A;  2OJQ A;  3GM3 A;  3O39 A;  2W4B A;  2C03 A;  3RF3 A;  5B3S C;  1OCR C;  1T6U A;  4JCZ A;  2NSG A;  4MVQ A;  2B0H A;  1VK5 A;  2CNW D;  4OIR F;  3IQT A;  4BJ6 A;  1T6I A;  4AL1 A;  3VYW A;  4Q7C A;  3CZ6 A;  1T5O A;  1WGW A;  1YAU O;  1TWG A;  2Q9A A;  2XLE A;  3T6G B;  5A6B A;  3L8I A;  3F46 A;  5E3C A;  4E17 A;  1O3U A;  2KK1 A;  4IGG A;  1RCP A;  5TJ5 E;  3DAG A;  5JT4 A;  1RXQ A;  4I3M A;  4RD9 A;  4ULW A;  1RMV A;  4PFP A;  1JPN A;  2A0U A;  1CGO A;  2EPN A;  2ZD9 A;  3NYM A;  4P9F A;  5E2Q A;  4KC9 A;  1A0B A;  2NPU A;  3JYH A;  3ZVR A;  5AC4 A;  2EIL C;  4MW3 A;  3R7C A;  3DJN B;  1OKK A;  1C03 A;  1XZP A;  3M15 A;  4K1O A;  2A6E F;  2P6V A;  3EG9 B;  3Q6N A;  3M4C A;  2XL4 A;  2L9J A;  4EBJ A;  3C8G B;  1SMY F;  3DMD A;  4C3B A;  3JTL O;  4P9T A;  1FNT c;  4R32 A;  2CW0 F;  4KNV A;  2J0W A;  1H9G A;  1MMN A;  4IAR A;  2FAP B;  3AGU A;  1ZU4 A;  3B71 A;  4JEA A;  4E0I A;  1CGM E;  2ASR A;  3EZH A;  3M1C B;  3PMR A;  3C7J A;  1D0Z A;  1WOL A;  1SYQ A;  2R9R B;  4IB4 A;  1TWA A;  1FR0 A;  3JCU Q;  2DYR C;  1NZE A;  1RKE B;  4BJ6 C;  1VOM A;  1JRA A;  5L0H A;  3EFO A;  1ZW2 A;  1ZHW A;  2DB4 A;  2R7V A;  3N24 A;  2R02 A;  1V55 C;  4LDR A;  3GM1 A;  2Q4F A;  4CX9 A;  5EK0 A;  4BJ5 A;  3DE8 A;  4CS7 A;  1E85 A;  1VMA A;  1VB5 A;  2MYS A;  3BRJ A;  4I44 A;  3DAF A;  3C62 A;  1J8Y F;  5B1A C;  3EJN A;  1FTS A;  4X0R A;  2ZXR A;  1J8M F;  2O9X A;  2OQM A;  3MBG A;  3OA1 A;  1OXK A;  2Q7R A;  3FDQ A;  4QI2 A;  4U5D E;  1NU7 D;  3E70 C;  2PNO A;  3TOM A;  1U89 A;  3HTK C;  5DS4 A;  1A7V A;  3RQE A;  2EIN C;  4J30 B;  4JZA A;  4O79 A;  3NMJ A;  1G4W R;  5L0F A;  1BZ4 A;  2R7S A;  1VLT A;  1BR4 A;  2YLD A;  4CS8 A;  4XQ1 A;  3RVZ A;  4NQF A;  3FOO A;  4YT8 A;  4N6C A;  5JLI A;  4H54 A;  3UGO A;  2LCH A;  3IHU A;  3QMK A;  5KYN A;  4PFO A;  3U3F A;  3ECS A;  1C17 M;  2RSE B;  3WAQ A;  4EBK A;  2Y39 A;  1JOG A;  4XPW A;  4UDV A;  2IYL D;  2G62 A;  1LI5 A;  2AP3 A;  3Q7G A;  3ZQV A;  2YL1 A;  4LLC A;  2XS1 A;  3S27 A;  3US6 A;  3CSK A;  3L0I A;  4JRZ A;  4G7Z F;  1L7C A; 
#chains in the Genus database with same CATH homology
 3S9O A;  1V4A A;  4XEV A;  4XEF A;  3TUL A;  1QVX A;  3B71 A;  3RQE A;  4XEK A;  3O10 A;  1ZZP A;  3L8I A;  3RQF A;  1WOL A;  2JX0 A;  3JZ0 A;  1O3U A;  2KK1 A;  1WTY A;  2HSB A;  1OW6 A;  4NQF A;  1K04 A;  1WWP A;  3RQG A;  1OW7 A;  2Q00 A;  3C8G D;  2JPU A;  5F28 E;  2L6F A;  3GM1 A;  3U3F A;  1K40 A;  2L6H A;  2LK4 A;  3C18 A;  3K7D A;  4EBK A;  1JOG A;  3C8G A;  3JYY A;  1K05 A;  3BRJ A;  1KNY A;  1OW8 A;  3AJM A;  3GM3 A;  3C8G B;  2L6G A;  2PBE A;  1PV3 A;  3L8J A;  4EBJ A;  1KTM A;  2YWA A;  3U0C A;  3GM2 A;  1UFB A;  3MFN A;  4R32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...