4NQFA

Crystal structure of hepn domain protein
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
b'LSPADALRVAEDHFLRHMPDARDFADVAKYLVAKGNLHLAAFNLHQAVETAYNCYLLTLTNYSPASHNMKFLRGLSEGRDRRLIDIWPRDRQRFTTWYNIMNEAYVKARYSKRFEVSEEALTWLQERTAELHKLVETLCREHIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleotidyltransferase
molecule tags Transferase
source organism Agrobacterium fabrum
publication title Dimerization of VirD2 Binding Protein Is Essential for Agrobacterium Induced Tumor Formation in Plants
pubmed doi rcsb
total genus 51
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4nqfA00
3RQFA 1ZZPA 1QVXA 3O10A 1PV3A 3GM3A 3MFNA 3BRJA 1KTMA 3AJMA 3C8GD 2PBEA 1K05A 2KK1A 1WTYA 3S9OA 2L6FA 3C8GB 4XEFA 5F28E 1KNYA 1WWPA 2L6GA 2JX0A 1OW7A 2Q00A 3GM2A 1JOGA 3JYYA 4R32A 1OW6A 3TULA 2JPUA 3RQEA 3L8JA 3C18A 1K40A 4EBKA 1V4AA 2YWAA 3B71A 2LK4A 3GM1A 1WOLA 3L8IA 4XEVA 4XEKA 4NQFA 1K04A 1UFBA 4EBJA 1O3UA 2L6HA 3RQGA 3JZ0A 1OW8A 3U3FA 3U0CA 3K7DA 2HSBA 3C8GA
chains in the Genus database with same CATH superfamily
1L7CA 2J9VA 3T6JA 1TR2A 4AL1A 4D4XA 3JTLO 3ZIBA 4N6HA 1XZQA 2A6EF 5KYUA 4Q5SF 1Z63A 2QNLA 1SYQA 1G5ZA 2ETSA 2HV7A 4ZLCA 4OIQF 3GODA 1ZHTA 4BJ6A 1HY5A 3W2WA 2I15A 3HJCA 1NU7D 2V26A 3EGXA 3FOOA 3LJBA 1ZHYA 2JPUA 4LACB 4E0IA 1FTSA 1LVKA 1VOMA 2AWCA 2ZXOA 2LK4A 2AU5A 2F22A 3K33A 4PK4A 3I5QA 1RKEA 3EG9A 1WGWA 1J8MF 2IM8A 4P9TA 3W2VA 1FMWA 2BE5F 1H9GA 1OCOC 2GWWA 2LCHA 2BC5A 2HSBA 3HLZA 3M4CA 2P61A 5B1AC 4MVSA 2H7OA 4DRJB 1Z23A 1ZZPA 5A69A 5A6KA 4K1OA 2R05A 4CDYA 2B0JA 3CAXA 3HNJA 4CDAA 5F5FA 2NSGA 1HE1A 1Z7Qc 3AJMA 1JAFA 2NG1A 1K05A 1T9KA 2KK1A 1CPQA 2WZFA 4U9EA 2OKUA 3T4RA 4BPMA 4UDVA 3C8GB 3EG9B 2HKVA 3A11A 1A7VA 3G4ZA 1KNYA 2YEVA 4YT5A 3UMKA 1NBBA 5IY5C 1V54C 2GDCA 1EI7A 3ASOC 3U9MA 2W9YA 256BA 3GEHA 3B71A 2VB6A 4FESA 5L3VA 3SP1A 5DQZA 4CIHA 3TD7A 3Q7LA 3POVA 2Y3HA 1C02A 1M57C 3CEXA 3RVYA 5E3AA 2EPOA 1D0ZA 4MVRA 3EZHA 4J30B 4DXWA 2GA0A 2VCCA 5E2QA 2HFIA 4EHPA 1UG7A 4NTFA 5A6BD 2OJQA 2Y69C 3B9QA 4BEJA 3E70C 2CDQA 1VYIA 2EILC 1H9TA 5L0CA 1G4WR 2E87A 1LS1A 2XLHA 3GEEA 4MS2A 4ANJA 4QI0A 2XM0A 2Y3DA 3DMDA 4C3DA 2J45A 3GWLA 2R7UA 2WZGA 5JT4A 5JRAA 4RDAA 3TULA 4I1OB 5GPGB 4WGYA 1TFOB 2PNOA 3LLIA 1R4TA 5FCLA 4FX5A 1YYJA 2IXNA 1WOLA 1Z5ZA 2MYSA 2ZXPA 2L7AA 3B0UX 2XSEA 4PJMA 4AE4A 4EBJA 1Q0MA 2L6HA 3U3FA 1OW8A 2KJGA 2R7TA 2A69F 4OIPF 4M63A 4CS9C 1PD1A 3KKBA 2EIKC 4MW8A 3NYJA 3DXJF 2UUHA 4H4KC 3U5SA 4CS8A 3EH1A 3O10A 3IQ6A 2WZLA 2Q9BA 1TKNA 2J7PA 3M15A 1RJ9B 4AL0A 3M79A 1T01A 3Q7GA 1O5HA 1ZHZA 2NUPA 4G7HF 3KPHA 5B3SC 2ZXWC 2XXAA 1Q0FA 2IXOA 2VCAA 3LLKA 5F5HA 3N24A 3FOPA 2R7WA 2TMVP 4L6RA 3C62A 3C63A 4EWCA 1LI5A 4LDRA 1VTMP 2Q9AA 4U5DE 2A68F 1NLXA 1NU9C 1Y4CA 3HKKA 2KC3A 5KYYA 2LIGA 2UUIA 3VRCA 2C03A 4QDLA 5KYXA 1K04A 3A9CA 3AG1C 3EGDA 3KH2A 2Q7RA 5B1BC 2M64A 4XTKA 2YL7A 2OEXA 4DRIB 4BEMJ 4E0HA 2VCBA 3SXYA 1O87A 2I8BA 3IQTA 2XL8A 1WATA 5COFA 1QKRA 2MWQA 1MNEA 3L34A 5EGYA 2AVKA 4U5BE 1S7ZA 4AX2A 2R02A 3TJ6A 3EFOA 5D92A 2AWYA 1ZW2A 4NCQA 1E2XA 2J9UA 2WVNA 2XRHA 1FFTC 3HNKA 4H54A 5AC5A 1U6HA 3GM2A 3QW0A 4NC3A 4BG0A 1JRAA 4PJNA 3FAJA 4R32A 1RJ9A 3DJUB 5AC4A 2HJMA 3J06A 3VF0A 4G7ZF 2NUPB 4JE9A 3LEVA 3C18A 3CSKA 2NUTA 3TK0A 3QVYA 3L0IA 4U5GA 1I4YA 2ZPAA 2XM4A 3X1OA 3NKEA 4KNWA 3C8GA 2WL8A 3DWWA 1GGQA 1OR3A 3EGXB 4XLPF 2EIJC 2R7XA 1EKYA 2W45A 3MYFA 5A6JA 1WN0A 2RD9A 1SR2A 3G50A 1MNDA 3I5PA 4B6IA 2ASRA 3PMRA 3ZQVA 3MFNA 4PFOA 3FMSA 1GQAA 4AK9A 1HW2A 2RSEB 2R25A 4IRUA 3ABLC 3VM6A 4BJ6C 5HSWA 3DZAA 4DOZA 5CI9A 4CDVA 2JX0A 4JTCB 4PACA 1OW6A 4G78A 3JCUQ 1NG1A 3B0PA 4MTOA 4XLNF 3V5XA 5JVEA 2A1DD 2D4UA 2WVOA 4E7ZA 1N1CA 3MBGA 2IBFA 1V4AA 3AQBA 3JYHA 4XEVA 4EBBA 4O6MA 4NQFA 3ECSA 1QQ3A 4Z9IA 1AEPA 2A0UA 2ZXRA 4E18A 4CIPA 1OCCC 4F4BA 3I4UA 3RVZA 1D0YA 3HTKC 2VC9A 3U2LA 2HZ8A 3QVZA 5T3TA 2CGEA 1S05A 3S27A 3EZIA 3NG1A 1GS9A 1OXKA 1MMGA 2LSEA 1E84A 4IAQA 2R7QA 1RMVA 4LLEA 4PR9A 3GORA 2Y3GA 3GM3A 1TFKB 4JCHA 4MQ9F 4MVOA 2DI3A 2R9RB 4N6CA 3MLGA 4YWQA 2KNHA 3TJ5A 2A6HF 4U5HA 4YT2A 4IJJA 3HNLA 3WG7C 1H7IA 2D5RB 3ZWIA 3NMIA 3K6BA 5BQHA 4XEFA 2PX3A 2PP4A 1OR2A 2JD3A 3LESA 1V74B 2LFDA 1U89A 1JOGA 3NKDA 1B68A 4MVMA 1CGNA 5COMA 4CJGA 4DJ9A 1ZYRF 3B29A 4DBQA 3L8JA 5HV9A 5KYYB 1G8XA 3H2UA 1KU2A 3JRMO 1I4ZA 1XZPA 2ICWG 1ZHXA 3ZDLA 1YVIA 3ZVRA 3B0VC 1BR4A 3NDBB 1VB5A 5BQGA 4MTFA 3T9OA 4RBNA 4XPYA 3WODF 2YHSA 1D1AA 4ONSA 5DQTA 5KYWA 4WABA 2OOCA 2LD6A 1W2WA 3IPMO 3GWNA 2H8AA 4MVZA 1A41A 1OCZC 2P1AA 2QY9A 3DM9B 3BRJA 3ITFA 1MMDA 4MVQA 4BJ5A 4CS7A 1KTMA 3K1IC 1E85A 2HV6A 4NTBA 1WTYA 3S9OA 5L0GA 3Q6NA 2XS1A 3T6BA 2OU6A 2GFHA 2L6GA 2J0WA 3TOLA 3NYMA 3PDMP 1YAUO 2KGOA 1F1MA 3L1MA 3X2QC 4FAPB 4C7OA 3DE9A 2ZD9A 3FAPB 4PJJA 3DKAA 1SF8A 3DI5A 3DM5A 3Q6MA 4OD4A 4GEHA 4HE8D 2Y3BA 3WAQA 3JZ0A 3W4YA 3R2PA 1ZHWA 4EIYA 1NFNA 2P0NA 3RKOF 4JTAB 4MVUA 3CZ6A 4IAOA 3RIPA 1D0XA 3NYLA 1PD0A 4U5CE 3EH2A 4EUKB 3O6XA 1PCXA 2R03A 1WASA 1YZCA 1IZMA 2CNWA 3F47A 3NRHA 3OA1A 3SNHA 3UR3C 4JZAA 5KYWB 2Y39A 2AP3A 3RF3A 4KI2A 1HMDA 1M2OA 1RXQA 2P7VA 1YZAA 2Q00A 4XPXA 4CSAC 4HEAJ 3DE8A 2R7RA 2B0HA 2CYDA 5L3QA 2CW0F 1TWCA 3EHMA 3V5YA 4ER9A 4EBKA 5EHHA 1C17M 1SZIA 4JEAA 4XEKA 3H65A 1UFBA 5DVWA 4CS9A 2LFFA 3FVYA 4OIRF 4YL1A 2L81A 2XL4A 4IWBA 1EQ1A 5JSLA 1QVXA 4YK5A 2EPLX 2DYSC 2PX0A 2YKZA 3BEHA 3EJNA 1NFOA 3KL4A 4W8KA 5T1DB 4JW1A 1EA8A 3UMHA 5L0JA 3WHNA 2PBEA 3K1HA 3F46A 5DS4A 1NSGB 4U9DA 1ZW3A 3LEOA 3V7OA 3JYYA 3UGPA 4LDKA 4X0RA 2OEVA 3V5ZA 2HS5A 4A4AA 3S84A 3GEIA 3EPVA 2BL2A 4WGZA 1K40A 3UGOA 3C7JA 3K1IA 4HFKB 4HFFB 4KNVA 1T6UA 2YLGA 3NMJA 1OKKA 1SMYF 2YL3A 2V3CC 4Z9JA 2P6VA 3JSZA 2J9BA 3GANA 2DGJA 4N06A 1ZU4A 2G3VA 3S28A 4YT8A 1H6GA 5K0IA 1Q0DA 4JC7A 4MW3A 2EIMC 3ZQYA 3N2ZB 4A2NB 1M56C 3AGTA 1T5OA 3U2MA 4NTAA 2PF4E 5F28E 3E9VA 1R5ID 4N4WA 3OWTA 2XLEA 5DLJA 3RH3A 1XWJA 2OQMA 3KYIA 2NUTB 3LS1A 1VLSA 1QLEC 2X51A 3RQEA 3QW1A 3SXKA 1YA9A 3ASNC 1DOVA 3DD7A 1A0BA 3AQCA 3IQCA 4OINF 3RYLA 2YWAA 1OKKD 3VYWA 1CGOA 3OEOA 2J9WA 2KYHA 2XLMA 4JCZA 1CGME 1O3UA 3HNIA 1YDIA 2YRFA 2G3KA 2KSFA 4JVSA 4JKVA 1HE9A 1CPRA 4K7BA 4KBLA 5JUAA 4O6NA 1TWGA 4XWJA 3S0XA 5E3CA 4XPWA 5JP7A 4YL3A 4BJTA 2NPUA 5AGFA 1PV3A 1ST6A 2IXPA 1OXBA 4J7TA 3ABKC 1YA7O 3LUTB 3PCVA 4P9FA 1BZ4A 3U8VA 2EPKX 4Q4ZF 4RD9A 3M4BA 4OIOF 3ZTMA 2H7VC 4C7OB 1JMWA 1MMAA 5CI8A 1WWPA 1LI7A 1OQCA 2J8WA 4EKWA 4QI2A 1AVOB 2PFDA 2EINC 1M2VB 3H2VA 1L3PA 4Q7CA 4PFPA 4LERA 3R7CA 2HJ3A 3JRTA 3N0TA 1C03A 1LM3B 1VK5A 2YZSA 2EPNA 4CJOA 4U5FE 1LE2A 3W8HA 2CCYA 2W4MA 3RQGA 3LNMB 3UMIA 2L9JA 3AOUA 4YJWA 3TQOA 4C3BA 2XS8A 1Q0GA 1LIHA 2IYLD 3NMKA 1JPJA 2WVQA 3PHF2 1VMAA 3LAYA 4CSAA 1LPEA 2O9XA 1MQVA 1YYXA 1BBHA 1FMVA 1YARO 2H7BA 3DJNB 4YN0B 4DRHB 5JS5A 3S29A 4GYTA 3ZTZA 5A6BA 2R7SA 4I1MA 3EHNA 3KYJA 4IARA 1OW7A 4IGGA 4C3EA 4G7OF 2G62A 3UNGC 2YLDA 1QSPA 4YT4A 3AG2C 2WB7A 3ZG1A 5KYUB 3C8ZA 4CS8C 2Q3TA 2IXMA 3CQZA 3GM1A 3IEEA 3IHUA 5BUOA 3AGUA 3O55A 3S90A 4JJFA 3TOMA 2OCCC 5COGA 4O7GA 2J0XA 3U0CA 3SXMA 1NZEA 3KMIA 4Z9HA 2YVKA 4G0HA 2C04A 1FFHA 3RQFA 1FAPB 3QMKA 4MTGA 3SYNA 3RFYA 4E17A 3AG3C 2QTVA 3RW0A 3C8GD 3LS0A 3EQLF 3U9JA 3ATPA 3JSEO 2HMQA 2VH3A 2GAQA 2MHRA 5E33A 5JLIA 3FDQA 1LE4A 5DS6A 2XXAB 2W4BA 5L0IA 1E83A 4J7YA 5KYNA 1Y6DA 4IB4A 2YQYA 4GQHA 1IW7F 2M4EA 2XLVA 4JJGA 5L0FA 2FFHA 1JPNA 3DAFA 2XLOA 3G4XA 3L8IA 2YLIA 3LNRA 1M6TA 1LKXA 2XLWA 4LDQA 5L0DA 1AUEA 2DB4A 4BJ1A 4I44A 4DVZA 4PJLA 5D91A 3ZSUA 1TWHA 4JRZA 1E86A 2A0BA 2J7PD 1A7EA 2QUPA 3O39A 5EK0A 1BDJB 1J8YF 5KYXB 5BQIA 5DS5A 2XL6A 2LP4A 4ULVA 1TWAA 2EPMX 2KQ9A 1RCPA 2XLDA 2X0CA 4J32B 5FZTA 1OCRC 4JURI 3QZCA 1I5NA 1ORJA 3ZC4A 4KC9A 1HW1A 3FXHA 1APCA 3W8IA 1U0BB 3DAGA 1BR2A 4JTDB 4OD5A 4ZLDA 2QLAA 4O79A 1QPUA 1YLMA 2R7OA 3MYIA 5L0HA 1FNTc 2LQGA 4CX9A 1BR1A 1Z3IX 3U3BA 4DVYP 2IOQA 4W8PA 1ORYA 4LLCA 1V55C 1RKCA 5T3WA 4YL0A 4FWVA 1VLTA 3VAYA 3U8PA 4JEBA 2VASA 2R7VA 1DOWA 3SZRA 2QE9A 4U5EE 5CIVA 3K7DA 4NY3A 1ZU5A 2CNWD 3AG4C 1G4US 1T6QA 2HMZA 4E7SA 1Q0KA 4I3MA 4WJ0A 1TQGA 1LS4A 2NSFA 3SEOA 1T6IA 2HSQA 4CBEA 2YL0A 4O6YA 2Q9CA 4P6IC 1YJGA 1ZVZA 2L6FA 1D1BA 1ORSC 3IQ5A 3K66A 1QZXA 4DBRA 2FAPB 3EGDB 1RKEB 2Q4FA 1GM5A 2OG2A 4XQ1A 4MNDA 3JT1A 5TJ5E 2Z15A 3US6A 5B3IA 2YL1A 1HMOA 2HUJA 5A6AA 3MX3A 2KW3C 4JIOA 4ULWA 1A7DA 4BJ5C 2J46A 2DYRC 1VYKA 3ABMC 3T6GB 3FHDA 1D1CA 3M1CB 4K0DA 2FGYA 1M2VA 4D4NA 4AE4B 3QTHA 3SXZA 1MMNA 1Z6AA 3EFOB 1FR0A 2OJED 1JR8A
chains in the Genus database with same CATH topology
3RQFA 1ZZPA 1QVXA 3O10A 1PV3A 3GM3A 3MFNA 3BRJA 1KTMA 3AJMA 3C8GD 2PBEA 1K05A 2KK1A 1WTYA 3S9OA 2L6FA 3C8GB 4XEFA 5F28E 1KNYA 1WWPA 2L6GA 2JX0A 1OW7A 2Q00A 3GM2A 1JOGA 3JYYA 4R32A 1OW6A 3TULA 2JPUA 3RQEA 3L8JA 3C18A 1K40A 4EBKA 1V4AA 2YWAA 3B71A 2LK4A 3GM1A 1WOLA 3L8IA 4XEVA 4XEKA 4NQFA 1K04A 1UFBA 4EBJA 1O3UA 2L6HA 3RQGA 3JZ0A 1OW8A 3U3FA 3U0CA 3K7DA 2HSBA 3C8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQF A;  1ZZP A;  1QVX A;  3O10 A;  1PV3 A;  3GM3 A;  3MFN A;  3BRJ A;  1KTM A;  3AJM A;  3C8G D;  2PBE A;  1K05 A;  2KK1 A;  1WTY A;  3S9O A;  2L6F A;  3C8G B;  4XEF A;  5F28 E;  1KNY A;  1WWP A;  2L6G A;  2JX0 A;  1OW7 A;  2Q00 A;  3GM2 A;  1JOG A;  3JYY A;  4R32 A;  1OW6 A;  3TUL A;  2JPU A;  3RQE A;  3L8J A;  3C18 A;  1K40 A;  4EBK A;  1V4A A;  2YWA A;  3B71 A;  2LK4 A;  3GM1 A;  1WOL A;  3L8I A;  4XEV A;  4XEK A;  4NQF A;  1K04 A;  1UFB A;  4EBJ A;  1O3U A;  2L6H A;  3RQG A;  3JZ0 A;  1OW8 A;  3U3F A;  3U0C A;  3K7D A;  2HSB A;  3C8G A; 
#chains in the Genus database with same CATH topology
 1L7C A;  2J9V A;  3T6J A;  1TR2 A;  4AL1 A;  4D4X A;  3JTL O;  3ZIB A;  4N6H A;  1XZQ A;  2A6E F;  5KYU A;  4Q5S F;  1Z63 A;  2QNL A;  1SYQ A;  1G5Z A;  2ETS A;  2HV7 A;  4ZLC A;  4OIQ F;  3GOD A;  1ZHT A;  4BJ6 A;  1HY5 A;  3W2W A;  2I15 A;  3HJC A;  1NU7 D;  2V26 A;  3EGX A;  3FOO A;  3LJB A;  1ZHY A;  2JPU A;  4LAC B;  4E0I A;  1FTS A;  1LVK A;  1VOM A;  2AWC A;  2ZXO A;  2LK4 A;  2AU5 A;  2F22 A;  3K33 A;  4PK4 A;  3I5Q A;  1RKE A;  3EG9 A;  1WGW A;  1J8M F;  2IM8 A;  4P9T A;  3W2V A;  1FMW A;  2BE5 F;  1H9G A;  1OCO C;  2GWW A;  2LCH A;  2BC5 A;  2HSB A;  3HLZ A;  3M4C A;  2P61 A;  5B1A C;  4MVS A;  2H7O A;  4DRJ B;  1Z23 A;  1ZZP A;  5A69 A;  5A6K A;  4K1O A;  2R05 A;  4CDY A;  2B0J A;  3CAX A;  3HNJ A;  4CDA A;  5F5F A;  2NSG A;  1HE1 A;  1Z7Q c;  3AJM A;  1JAF A;  2NG1 A;  1K05 A;  1T9K A;  2KK1 A;  1CPQ A;  2WZF A;  4U9E A;  2OKU A;  3T4R A;  4BPM A;  4UDV A;  3C8G B;  3EG9 B;  2HKV A;  3A11 A;  1A7V A;  3G4Z A;  1KNY A;  2YEV A;  4YT5 A;  3UMK A;  1NBB A;  5IY5 C;  1V54 C;  2GDC A;  1EI7 A;  3ASO C;  3U9M A;  2W9Y A;  256B A;  3GEH A;  3B71 A;  2VB6 A;  4FES A;  5L3V A;  3SP1 A;  5DQZ A;  4CIH A;  3TD7 A;  3Q7L A;  3POV A;  2Y3H A;  1C02 A;  1M57 C;  3CEX A;  3RVY A;  5E3A A;  2EPO A;  1D0Z A;  4MVR A;  3EZH A;  4J30 B;  4DXW A;  2GA0 A;  2VCC A;  5E2Q A;  2HFI A;  4EHP A;  1UG7 A;  4NTF A;  5A6B D;  2OJQ A;  2Y69 C;  3B9Q A;  4BEJ A;  3E70 C;  2CDQ A;  1VYI A;  2EIL C;  1H9T A;  5L0C A;  1G4W R;  2E87 A;  1LS1 A;  2XLH A;  3GEE A;  4MS2 A;  4ANJ A;  4QI0 A;  2XM0 A;  2Y3D A;  3DMD A;  4C3D A;  2J45 A;  3GWL A;  2R7U A;  2WZG A;  5JT4 A;  5JRA A;  4RDA A;  3TUL A;  4I1O B;  5GPG B;  4WGY A;  1TFO B;  2PNO A;  3LLI A;  1R4T A;  5FCL A;  4FX5 A;  1YYJ A;  2IXN A;  1WOL A;  1Z5Z A;  2MYS A;  2ZXP A;  2L7A A;  3B0U X;  2XSE A;  4PJM A;  4AE4 A;  4EBJ A;  1Q0M A;  2L6H A;  3U3F A;  1OW8 A;  2KJG A;  2R7T A;  2A69 F;  4OIP F;  4M63 A;  4CS9 C;  1PD1 A;  3KKB A;  2EIK C;  4MW8 A;  3NYJ A;  3DXJ F;  2UUH A;  4H4K C;  3U5S A;  4CS8 A;  3EH1 A;  3O10 A;  3IQ6 A;  2WZL A;  2Q9B A;  1TKN A;  2J7P A;  3M15 A;  1RJ9 B;  4AL0 A;  3M79 A;  1T01 A;  3Q7G A;  1O5H A;  1ZHZ A;  2NUP A;  4G7H F;  3KPH A;  5B3S C;  2ZXW C;  2XXA A;  1Q0F A;  2IXO A;  2VCA A;  3LLK A;  5F5H A;  3N24 A;  3FOP A;  2R7W A;  2TMV P;  4L6R A;  3C62 A;  3C63 A;  4EWC A;  1LI5 A;  4LDR A;  1VTM P;  2Q9A A;  4U5D E;  2A68 F;  1NLX A;  1NU9 C;  1Y4C A;  3HKK A;  2KC3 A;  5KYY A;  2LIG A;  2UUI A;  3VRC A;  2C03 A;  4QDL A;  5KYX A;  1K04 A;  3A9C A;  3AG1 C;  3EGD A;  3KH2 A;  2Q7R A;  5B1B C;  2M64 A;  4XTK A;  2YL7 A;  2OEX A;  4DRI B;  4BEM J;  4E0H A;  2VCB A;  3SXY A;  1O87 A;  2I8B A;  3IQT A;  2XL8 A;  1WAT A;  5COF A;  1QKR A;  2MWQ A;  1MNE A;  3L34 A;  5EGY A;  2AVK A;  4U5B E;  1S7Z A;  4AX2 A;  2R02 A;  3TJ6 A;  3EFO A;  5D92 A;  2AWY A;  1ZW2 A;  4NCQ A;  1E2X A;  2J9U A;  2WVN A;  2XRH A;  1FFT C;  3HNK A;  4H54 A;  5AC5 A;  1U6H A;  3GM2 A;  3QW0 A;  4NC3 A;  4BG0 A;  1JRA A;  4PJN A;  3FAJ A;  4R32 A;  1RJ9 A;  3DJU B;  5AC4 A;  2HJM A;  3J06 A;  3VF0 A;  4G7Z F;  2NUP B;  4JE9 A;  3LEV A;  3C18 A;  3CSK A;  2NUT A;  3TK0 A;  3QVY A;  3L0I A;  4U5G A;  1I4Y A;  2ZPA A;  2XM4 A;  3X1O A;  3NKE A;  4KNW A;  3C8G A;  2WL8 A;  3DWW A;  1GGQ A;  1OR3 A;  3EGX B;  4XLP F;  2EIJ C;  2R7X A;  1EKY A;  2W45 A;  3MYF A;  5A6J A;  1WN0 A;  2RD9 A;  1SR2 A;  3G50 A;  1MND A;  3I5P A;  4B6I A;  2ASR A;  3PMR A;  3ZQV A;  3MFN A;  4PFO A;  3FMS A;  1GQA A;  4AK9 A;  1HW2 A;  2RSE B;  2R25 A;  4IRU A;  3ABL C;  3VM6 A;  4BJ6 C;  5HSW A;  3DZA A;  4DOZ A;  5CI9 A;  4CDV A;  2JX0 A;  4JTC B;  4PAC A;  1OW6 A;  4G78 A;  3JCU Q;  1NG1 A;  3B0P A;  4MTO A;  4XLN F;  3V5X A;  5JVE A;  2A1D D;  2D4U A;  2WVO A;  4E7Z A;  1N1C A;  3MBG A;  2IBF A;  1V4A A;  3AQB A;  3JYH A;  4XEV A;  4EBB A;  4O6M A;  4NQF A;  3ECS A;  1QQ3 A;  4Z9I A;  1AEP A;  2A0U A;  2ZXR A;  4E18 A;  4CIP A;  1OCC C;  4F4B A;  3I4U A;  3RVZ A;  1D0Y A;  3HTK C;  2VC9 A;  3U2L A;  2HZ8 A;  3QVZ A;  5T3T A;  2CGE A;  1S05 A;  3S27 A;  3EZI A;  3NG1 A;  1GS9 A;  1OXK A;  1MMG A;  2LSE A;  1E84 A;  4IAQ A;  2R7Q A;  1RMV A;  4LLE A;  4PR9 A;  3GOR A;  2Y3G A;  3GM3 A;  1TFK B;  4JCH A;  4MQ9 F;  4MVO A;  2DI3 A;  2R9R B;  4N6C A;  3MLG A;  4YWQ A;  2KNH A;  3TJ5 A;  2A6H F;  4U5H A;  4YT2 A;  4IJJ A;  3HNL A;  3WG7 C;  1H7I A;  2D5R B;  3ZWI A;  3NMI A;  3K6B A;  5BQH A;  4XEF A;  2PX3 A;  2PP4 A;  1OR2 A;  2JD3 A;  3LES A;  1V74 B;  2LFD A;  1U89 A;  1JOG A;  3NKD A;  1B68 A;  4MVM A;  1CGN A;  5COM A;  4CJG A;  4DJ9 A;  1ZYR F;  3B29 A;  4DBQ A;  3L8J A;  5HV9 A;  5KYY B;  1G8X A;  3H2U A;  1KU2 A;  3JRM O;  1I4Z A;  1XZP A;  2ICW G;  1ZHX A;  3ZDL A;  1YVI A;  3ZVR A;  3B0V C;  1BR4 A;  3NDB B;  1VB5 A;  5BQG A;  4MTF A;  3T9O A;  4RBN A;  4XPY A;  3WOD F;  2YHS A;  1D1A A;  4ONS A;  5DQT A;  5KYW A;  4WAB A;  2OOC A;  2LD6 A;  1W2W A;  3IPM O;  3GWN A;  2H8A A;  4MVZ A;  1A41 A;  1OCZ C;  2P1A A;  2QY9 A;  3DM9 B;  3BRJ A;  3ITF A;  1MMD A;  4MVQ A;  4BJ5 A;  4CS7 A;  1KTM A;  3K1I C;  1E85 A;  2HV6 A;  4NTB A;  1WTY A;  3S9O A;  5L0G A;  3Q6N A;  2XS1 A;  3T6B A;  2OU6 A;  2GFH A;  2L6G A;  2J0W A;  3TOL A;  3NYM A;  3PDM P;  1YAU O;  2KGO A;  1F1M A;  3L1M A;  3X2Q C;  4FAP B;  4C7O A;  3DE9 A;  2ZD9 A;  3FAP B;  4PJJ A;  3DKA A;  1SF8 A;  3DI5 A;  3DM5 A;  3Q6M A;  4OD4 A;  4GEH A;  4HE8 D;  2Y3B A;  3WAQ A;  3JZ0 A;  3W4Y A;  3R2P A;  1ZHW A;  4EIY A;  1NFN A;  2P0N A;  3RKO F;  4JTA B;  4MVU A;  3CZ6 A;  4IAO A;  3RIP A;  1D0X A;  3NYL A;  1PD0 A;  4U5C E;  3EH2 A;  4EUK B;  3O6X A;  1PCX A;  2R03 A;  1WAS A;  1YZC A;  1IZM A;  2CNW A;  3F47 A;  3NRH A;  3OA1 A;  3SNH A;  3UR3 C;  4JZA A;  5KYW B;  2Y39 A;  2AP3 A;  3RF3 A;  4KI2 A;  1HMD A;  1M2O A;  1RXQ A;  2P7V A;  1YZA A;  2Q00 A;  4XPX A;  4CSA C;  4HEA J;  3DE8 A;  2R7R A;  2B0H A;  2CYD A;  5L3Q A;  2CW0 F;  1TWC A;  3EHM A;  3V5Y A;  4ER9 A;  4EBK A;  5EHH A;  1C17 M;  1SZI A;  4JEA A;  4XEK A;  3H65 A;  1UFB A;  5DVW A;  4CS9 A;  2LFF A;  3FVY A;  4OIR F;  4YL1 A;  2L81 A;  2XL4 A;  4IWB A;  1EQ1 A;  5JSL A;  1QVX A;  4YK5 A;  2EPL X;  2DYS C;  2PX0 A;  2YKZ A;  3BEH A;  3EJN A;  1NFO A;  3KL4 A;  4W8K A;  5T1D B;  4JW1 A;  1EA8 A;  3UMH A;  5L0J A;  3WHN A;  2PBE A;  3K1H A;  3F46 A;  5DS4 A;  1NSG B;  4U9D A;  1ZW3 A;  3LEO A;  3V7O A;  3JYY A;  3UGP A;  4LDK A;  4X0R A;  2OEV A;  3V5Z A;  2HS5 A;  4A4A A;  3S84 A;  3GEI A;  3EPV A;  2BL2 A;  4WGZ A;  1K40 A;  3UGO A;  3C7J A;  3K1I A;  4HFK B;  4HFF B;  4KNV A;  1T6U A;  2YLG A;  3NMJ A;  1OKK A;  1SMY F;  2YL3 A;  2V3C C;  4Z9J A;  2P6V A;  3JSZ A;  2J9B A;  3GAN A;  2DGJ A;  4N06 A;  1ZU4 A;  2G3V A;  3S28 A;  4YT8 A;  1H6G A;  5K0I A;  1Q0D A;  4JC7 A;  4MW3 A;  2EIM C;  3ZQY A;  3N2Z B;  4A2N B;  1M56 C;  3AGT A;  1T5O A;  3U2M A;  4NTA A;  2PF4 E;  5F28 E;  3E9V A;  1R5I D;  4N4W A;  3OWT A;  2XLE A;  5DLJ A;  3RH3 A;  1XWJ A;  2OQM A;  3KYI A;  2NUT B;  3LS1 A;  1VLS A;  1QLE C;  2X51 A;  3RQE A;  3QW1 A;  3SXK A;  1YA9 A;  3ASN C;  1DOV A;  3DD7 A;  1A0B A;  3AQC A;  3IQC A;  4OIN F;  3RYL A;  2YWA A;  1OKK D;  3VYW A;  1CGO A;  3OEO A;  2J9W A;  2KYH A;  2XLM A;  4JCZ A;  1CGM E;  1O3U A;  3HNI A;  1YDI A;  2YRF A;  2G3K A;  2KSF A;  4JVS A;  4JKV A;  1HE9 A;  1CPR A;  4K7B A;  4KBL A;  5JUA A;  4O6N A;  1TWG A;  4XWJ A;  3S0X A;  5E3C A;  4XPW A;  5JP7 A;  4YL3 A;  4BJT A;  2NPU A;  5AGF A;  1PV3 A;  1ST6 A;  2IXP A;  1OXB A;  4J7T A;  3ABK C;  1YA7 O;  3LUT B;  3PCV A;  4P9F A;  1BZ4 A;  3U8V A;  2EPK X;  4Q4Z F;  4RD9 A;  3M4B A;  4OIO F;  3ZTM A;  2H7V C;  4C7O B;  1JMW A;  1MMA A;  5CI8 A;  1WWP A;  1LI7 A;  1OQC A;  2J8W A;  4EKW A;  4QI2 A;  1AVO B;  2PFD A;  2EIN C;  1M2V B;  3H2V A;  1L3P A;  4Q7C A;  4PFP A;  4LER A;  3R7C A;  2HJ3 A;  3JRT A;  3N0T A;  1C03 A;  1LM3 B;  1VK5 A;  2YZS A;  2EPN A;  4CJO A;  4U5F E;  1LE2 A;  3W8H A;  2CCY A;  2W4M A;  3RQG A;  3LNM B;  3UMI A;  2L9J A;  3AOU A;  4YJW A;  3TQO A;  4C3B A;  2XS8 A;  1Q0G A;  1LIH A;  2IYL D;  3NMK A;  1JPJ A;  2WVQ A;  3PHF 2;  1VMA A;  3LAY A;  4CSA A;  1LPE A;  2O9X A;  1MQV A;  1YYX A;  1BBH A;  1FMV A;  1YAR O;  2H7B A;  3DJN B;  4YN0 B;  4DRH B;  5JS5 A;  3S29 A;  4GYT A;  3ZTZ A;  5A6B A;  2R7S A;  4I1M A;  3EHN A;  3KYJ A;  4IAR A;  1OW7 A;  4IGG A;  4C3E A;  4G7O F;  2G62 A;  3UNG C;  2YLD A;  1QSP A;  4YT4 A;  3AG2 C;  2WB7 A;  3ZG1 A;  5KYU B;  3C8Z A;  4CS8 C;  2Q3T A;  2IXM A;  3CQZ A;  3GM1 A;  3IEE A;  3IHU A;  5BUO A;  3AGU A;  3O55 A;  3S90 A;  4JJF A;  3TOM A;  2OCC C;  5COG A;  4O7G A;  2J0X A;  3U0C A;  3SXM A;  1NZE A;  3KMI A;  4Z9H A;  2YVK A;  4G0H A;  2C04 A;  1FFH A;  3RQF A;  1FAP B;  3QMK A;  4MTG A;  3SYN A;  3RFY A;  4E17 A;  3AG3 C;  2QTV A;  3RW0 A;  3C8G D;  3LS0 A;  3EQL F;  3U9J A;  3ATP A;  3JSE O;  2HMQ A;  2VH3 A;  2GAQ A;  2MHR A;  5E33 A;  5JLI A;  3FDQ A;  1LE4 A;  5DS6 A;  2XXA B;  2W4B A;  5L0I A;  1E83 A;  4J7Y A;  5KYN A;  1Y6D A;  4IB4 A;  2YQY A;  4GQH A;  1IW7 F;  2M4E A;  2XLV A;  4JJG A;  5L0F A;  2FFH A;  1JPN A;  3DAF A;  2XLO A;  3G4X A;  3L8I A;  2YLI A;  3LNR A;  1M6T A;  1LKX A;  2XLW A;  4LDQ A;  5L0D A;  1AUE A;  2DB4 A;  4BJ1 A;  4I44 A;  4DVZ A;  4PJL A;  5D91 A;  3ZSU A;  1TWH A;  4JRZ A;  1E86 A;  2A0B A;  2J7P D;  1A7E A;  2QUP A;  3O39 A;  5EK0 A;  1BDJ B;  1J8Y F;  5KYX B;  5BQI A;  5DS5 A;  2XL6 A;  2LP4 A;  4ULV A;  1TWA A;  2EPM X;  2KQ9 A;  1RCP A;  2XLD A;  2X0C A;  4J32 B;  5FZT A;  1OCR C;  4JUR I;  3QZC A;  1I5N A;  1ORJ A;  3ZC4 A;  4KC9 A;  1HW1 A;  3FXH A;  1APC A;  3W8I A;  1U0B B;  3DAG A;  1BR2 A;  4JTD B;  4OD5 A;  4ZLD A;  2QLA A;  4O79 A;  1QPU A;  1YLM A;  2R7O A;  3MYI A;  5L0H A;  1FNT c;  2LQG A;  4CX9 A;  1BR1 A;  1Z3I X;  3U3B A;  4DVY P;  2IOQ A;  4W8P A;  1ORY A;  4LLC A;  1V55 C;  1RKC A;  5T3W A;  4YL0 A;  4FWV A;  1VLT A;  3VAY A;  3U8P A;  4JEB A;  2VAS A;  2R7V A;  1DOW A;  3SZR A;  2QE9 A;  4U5E E;  5CIV A;  3K7D A;  4NY3 A;  1ZU5 A;  2CNW D;  3AG4 C;  1G4U S;  1T6Q A;  2HMZ A;  4E7S A;  1Q0K A;  4I3M A;  4WJ0 A;  1TQG A;  1LS4 A;  2NSF A;  3SEO A;  1T6I A;  2HSQ A;  4CBE A;  2YL0 A;  4O6Y A;  2Q9C A;  4P6I C;  1YJG A;  1ZVZ A;  2L6F A;  1D1B A;  1ORS C;  3IQ5 A;  3K66 A;  1QZX A;  4DBR A;  2FAP B;  3EGD B;  1RKE B;  2Q4F A;  1GM5 A;  2OG2 A;  4XQ1 A;  4MND A;  3JT1 A;  5TJ5 E;  2Z15 A;  3US6 A;  5B3I A;  2YL1 A;  1HMO A;  2HUJ A;  5A6A A;  3MX3 A;  2KW3 C;  4JIO A;  4ULW A;  1A7D A;  4BJ5 C;  2J46 A;  2DYR C;  1VYK A;  3ABM C;  3T6G B;  3FHD A;  1D1C A;  3M1C B;  4K0D A;  2FGY A;  1M2V A;  4D4N A;  4AE4 B;  3QTH A;  3SXZ A;  1MMN A;  1Z6A A;  3EFO B;  1FR0 A;  2OJE D;  1JR8 A; 
#chains in the Genus database with same CATH homology
 3RQF A;  1ZZP A;  1QVX A;  3O10 A;  1PV3 A;  3GM3 A;  3MFN A;  3BRJ A;  1KTM A;  3AJM A;  3C8G D;  2PBE A;  1K05 A;  2KK1 A;  1WTY A;  3S9O A;  2L6F A;  3C8G B;  4XEF A;  5F28 E;  1KNY A;  1WWP A;  2L6G A;  2JX0 A;  1OW7 A;  2Q00 A;  3GM2 A;  1JOG A;  3JYY A;  4R32 A;  1OW6 A;  3TUL A;  2JPU A;  3RQE A;  3L8J A;  3C18 A;  1K40 A;  4EBK A;  1V4A A;  2YWA A;  3B71 A;  2LK4 A;  3GM1 A;  1WOL A;  3L8I A;  4XEV A;  4XEK A;  4NQF A;  1K04 A;  1UFB A;  4EBJ A;  1O3U A;  2L6H A;  3RQG A;  3JZ0 A;  1OW8 A;  3U3F A;  3U0C A;  3K7D A;  2HSB A;  3C8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...