4YT4A

Iron guanylylpyridinol (fegp) cofactor-reconstituted hmdii from methanocaldococcus jannaschii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
345
structure length
345
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEHAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 131
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt4A01
2Q2WA 4E0BA 2PD4A 1PQUA 4FW8A 1HSOA 1WLYA 3QWHA 1U7HA 1ENOA 4PZEA 3WYBA 4CJXA 3Q9UA 1I24A 1XEAA 5IDQA 1DPGA 4ZVVA 3UH1A 2DM6A 2GZ2A 5JDIA 2ZB8A 4ZU3A 4DIOA 1IHXA 1MC4A 5KVQA 1EDZA 4CODB 1K0UA 1PSDA 1YB1A 4ND3A 1X1TA 2BKAA 4GAEA 3EYWA 2BGKA 4R01A 3VH4A 1B8VA 3PXXA 3R6DA 1ZK4A 4WK6A 3ICCA 3TSCA 2ZTVA 3DOOA 3FRJA 4BKQA 3ZU2A 3W6ZA 2NU6A 4L75A 2WDZA 1WZIA 4PG4A 4BNJA 1I3LA 2AA3A 1UJMA 2H1SA 4P38A 3GDGA 5JCJD 1NFRA 4KQWA 3E5MA 1K89A 3WJAA 2EW2A 2VYVD 1Y8QB 1ISGA 4TKLA 1XHLA 2P9EA 1PR3A 3BAZA 3AI2A 1V0JA 2GD1O 1QSGA 3NKLA 4DVJA 3GHYA 3LC7O 3PIDA 1ZH8A 3EUWA 4O1MA 5BT9A 4CMIA 5K6AA 2HSDA 3GZNA 1M76A 2GYYA 4YAGA 5JDCA 2Q1SA 4LN1A 4WLUA 2Y1CA 4MVJE 3PK0A 4IGEA 1ADFA 4D7AA 2D59A 1GU7A 3KYDB 4J49A 5TSDA 5HM8A 4GGOA 3O03A 1HYGA 4IQGA 1BW9A 4RVDA 3GT0A 2QQ5A 1AGNA 5L9AA 2Y0DA 2X0IA 1R16A 3RFXA 3WS7A 1GQYA 4O59O 4AJ4A 5JCJA 4L4SA 4U8GA 4LVCA 2OP1A 3NTOA 4D44A 4EGFA 5GZ6A 4GGPA 4U5QA 3D4OA 2QZZA 2C5AA 4LCEA 1R4MA 4CM4A 3C85A 3DTTA 3ZV4A 4AJEA 3CIFA 4BIIA 4OSPA 4YYZA 1X7DA 4S1VA 5A02A 5G4LA 3QA9A 4NK5A 1ENPA 4K6FA 5IF3A 5L7WA 2DPHA 6LDHA 4XIYA 2CMDA 4IDBA 4YJHB 3JYOA 4A27A 4KMSA 4BUCA 2GUGA 1PJ4A 1Q0QA 3TNLA 2B83A 1LTHR 1GYRA 2AW5A 5A5EA 1GAEO 1YL5A 3PJDA 1VPDA 4CMBA 4CM8A 2P68A 5JYDA 1IPEA 2Z1NA 4BO9A 1UXKA 1I3MA 4GMGA 3B1KA 2WJPA 4GWKA 1PZEA 4JBIA 3MJCA 2DUWA 2Y0CA 4BNMA 2P91A 4ZHSA 2PD6A 4U7WA 1YO6A 3N74A 1XGKA 4KTTE 3RUIA 1W4ZA 4J7CA 2FPIA 2Q45A 1H2BA 4P4NA 3WYEA 1QRRA 4L0QA 2VCYA 3ONDA 4OHUA 3WIDA 1IY8A 4BNLA 1E6UA 4PGFA 1NVTA 2IEDA 4JJGA 2DTDA 4CLDA 1M2WA 3PPIA 5COBA 3BXXA 3DHYA 4E32A 4YAIA 5A5FA 3MWDB 4ZQBA 4UVHA 1DIAA 5FI5A 4BNKA 3ZV3A 4PG7A 4NPCA 3TL2A 3H4VA 4TVBA 5B4VA 5TJ9A 2CFCA 3R1IA 1V35A 3A4VA 2VWGA 5JNLA 3BMCB 2Y1OA 4BHTA 4CUZA 3DR3A 3JQ9C 1NNUA 1I33A 3DMYA 3GDOA 3MJVA 3PJFA 5IN5A 3W4KA 1DRUA 1A27A 3K73O 4J1SA 4E2YA 4BNXA 3ITDA 3KETA 3PYXA 4I5EA 4F46A 1OAAA 2VN8A 1D1SA 4IUYA 1N8KA 3G0OA 4EJ6A 3F4LA 3W6UA 2PGDA 3I9OA 3AJRA 1ISFA 3NDIA 4ID9A 3GGOA 4AJLA 2DT5A 3EW7A 3WGYA 2C2YA 1NFQA 1R0SA 3A1NA 4J90A 5C3MA 1P9LA 3KLPX 3UOGA 4ZQEA 1Z45A 4MKZA 4RDHA 4ALIA 3PIIA 4Z9FA 4EYEA 2VHZA 4GSKA 3MJ4A 4IBOA 2O3QA 5G0SA 1IHYA 1ZW1A 1E7QA 1GR0A 5DNAA 1B8UA 3QVWA 3DZBA 3DOJA 4FIZA 1TA4A 3CTMA 4CV0A 2I76A 1UP4A 2PH5A 3F5SA 4UEOA 3GEGA 3E6AA 4DRYA 5JAIA 1FF9A 2O4UX 2AE2A 4DBZA 1OC2A 4XYGA 5U9CA 2I67A 3HB4X 1U4SA 4A7PA 2NUAA 3H7AA 3TOZA 3LLSA 1KETA 3OH8A 1VJ0A 4Z0TA 5LC1A 4D43A 3L6EA 4BGEA 3ANMA 1PWZA 2B36A 5G0VA 2EP5A 5IN4A 2D3TA 3ZH2A 4YT4A 2CDAA 5B37A 4YCAA 1M66A 3FBTA 2I6TA 2F00A 4J9VA 5T5QA 1DFIA 4NFSA 5ITVA 3WLEA 4I5FA 3I1JA 1ONPA 5JCXA 3UF0A 4J2OA 1QYVA 1H0KA 2YQ4A 2O3UA 4AFNA 3EZYA 2QRJA 2VYND 3B1JA 3WOHA 2NLOA 2NADA 4IMPA 5AYVA 3ZHZA 2NSDA 3O8QB 1V8BA 3UAGA 4JJIA 4P22A 1DAPA 2Q2QA 1H6BA 1Z7BA 1LDYA 3PQEA 4CQLA 1PTJA 3EK2A 2VZ9A 5EINA 1CJCA 4DQUA 3RFVA 2V6BA 4FJ1A 2PR2A 4OM8A 5ES3A 2JCYA 3OFSA 4TSKA 2DBRA 3HDJA 1SPXA 4Y9DA 1BHSA 1IB6A 4UVGA 1YB4A 1E7YA 3B20A 1ISJA 4LSWA 4YB8A 4W82A 1ZK2A 1WAMA 1DC5A 2VYNA 3T4EA 1HXHA 3F3SA 4HUJA 1O5IA 3DZIA 4WOKA 1DSSG 2BHLA 3I3OA 3OA2A 4R5MA 3AOGA 3HDHA 3OECA 4RJTA 4D79A 1BVUA 4DPKA 2AXQA 1GYPA 5L7YA 2WD7A 4KWIA 4XKJA 3JQ7A 3NDRA 1JKIA 5A9TA 1W8DA 3WQQA 4UUMA 5JY1A 1N9GB 3L4SO 2EKPA 2YUTA 1X7GA 1XDWA 2AQHA 5CHEA 3TZHA 4ROSA 1EEHA 3ETEA 1U3TA 1P0CA 4AJ1A 2D0IA 2O7QA 5JW6A 4BO4A 4J7XA 2YFQA 3QVXA 4J7UA 2P2SA 4B7XA 1E3WB 1I0ZA 3NTQA 4WCFA 5F3RA 5IJZA 3PFWO 3VC7A 3TOXA 3WNVA 3QQPA 1YONA 5B1YA 1PJ3A 3BHJA 4BO3A 1YJ8A 3DMTC 4TVOA 4BGUA 2Z1MA 2GERA 4XYLA 2X5KO 4E12A 4W4TA 1VE9A 2EGGA 4RF5A 2NVUA 3DAGA 1LI4A 5B4UA 2NM0A 3F46A 1A7KA 1QLJA 4BNIA 3ONFA 1Z74A 3ZWNA 2C07A 4HV4A 1ML3A 4IPTA 3RKUA 4CM1A 1UAYA 4O6VA 4BNZA 3MZ0A 1XQ1A 4B4VA 1IZ9A 1Y81A 3H9UA 4BNGA 4F3YA 5IAAA 1KVRA 1UDCA 2PV7A 1KIFA 1XSEA 1PS8A 3DQPA 3E48A 4IJVA 4DWVA 1A5ZA 4WCDA 3UVEA 5CG1A 1XU7A 2XPCA 4L8VA 1NVMB 3EMKA 3PJGA 3C7CB 5GMOA 2VOEA 3UFXA 4TKMA 3BIOA 1XR3A 3LK7A 4ZQHA 3I9MA 3PWZA 2W4QA 4NI5A 3PDJA 3AU9A 3LVFO 4UULA 3L9XA 5AOVA 1LX6A 4PVCA 3S2GA 1KEUA 1MV8A 3CZRA 3DB2A 4WPGA 4Y98A 4K6CA 4BGIA 3A14A 3HADA 3NAQA 1EK6A 4B3IA 3QV1A 3ST7A 3GEMA 4DGSA 1JVBA 4GI2A 3H5NA 4PLGA 3TFQA 2EGHA 2GNAA 4TRNA 4M49A 3TRIA 3JQGA 4RO0A 1U3WA 3OETA 2FR8A 4CQMB 2A94A 4ALMA 4CR8A 2X0JA 4Q3NA 1I01A 4PIVA 4AJHA 4A5OA 3I6QA 2PD3A 4NIMA 3ROKA 1I2BA 1NR7A 4BNTA 2EERA 3ROMA 2ZTUA 3VHRA 1X14A 2C7VA 4IMRA 5ICSA 1MC5A 2OO5A 4CLOB 1HWYA 1E6EA 1VL8A 1EE9A 4JK3A 1P1RA 9LDTA 1Y5MA 1FMCA 2UUOA 3JV7A 2B4TO 1YDWA 4DYVA 3VZSA 4HWKA 4YRAA 1PJSA 3PJEA 3OIFA 3GPDG 1M6WA 2AMFA 3SJUA 1Z73A 2E48A 4GSLA 3AI3A 4G65A 2H9IA 3LSYA 4WE3A 1CIVA 2EWMA 4GLLA 2AQIA 1EUDA 1ULSA 4MKRA 3BHIA 4W7HA 1E5QA 1FDSA 5KJEA 2IODA 3QWFA 1UDBA 4NJOA 4RV9A 2ZQZA 3JTMA 3ONEA 5CEFA 2O3RA 3NTRA 1P1KA 3ZHYA 2HJRA 1S7CA 2B5WA 2JFHA 2W98A 3AY3A 3R3SA 3DWFA 1MUUA 4KUGA 1B3BA 4PFJA 4PG5A 5G0TA 3VZPA 1VSUA 1H9BA 2I3AA 3I9LA 1C0IA 3PFFA 3F4BA 1KERA 3CKYA 3H9JA 5DBIA 4PVDA 1C1XA 3U4DA 2DC1A 2QIOA 4FJ2A 3BA1A 4OOFA 2X23A 5BQFA 5I8WA 1A71A 1CQIA 1F8GA 4XB1A 3C3XA 3UKOA 1C0PA 5JBIA 1SEVA 4CLXA 1QYWA 1HZJA 2H6EA 4G5HA 4RLSA 4I5DA 1I10A 3PZRA 3SLKA 3GRPA 2C29D 3BTVA 5A3JA 1R66A 2TMDA 1K2WA 4WUVA 1V3TA 1YOVA 3AM3A 4FPXA 1PJQA 4R68A 1O95A 1BXZA 1DRVA 5BR7A 4BQRA 2A9FA 1DIRA 3I5MA 1UXHA 1E7MA 3HZZA 3L0DA 2B0JA 1T2DA 2G1UA 1E1LA 1V3VA 3LT4A 4BO6A 3JQFA 1MFZA 1KVQA 1NPYA 3ZW9A 1PR9A 2F1KA 5FYDA 3WG9A 3IS3A 3LZ6A 1V9LA 3H3FA 3KRTA 3GA0A 1B8PA 4EBFA 4OXKA 3IQDB 3GY0A 2DU8A 3KSUA 3H8VA 2DLDA 1VC2A 5ITWA 1AXGA 2I66A 2VHXA 5KKCA 3ZDFA 5CPFA 3AWDA 4ALNA 1LDEA 1YVEI 4NH4A 3ICPA 1BMDA 3JQ9A 3E9QA 3G3EA 4JBGA 3PHGA 3H65A 4RPKA 3W4JA 1PJCA 2ZTLA 1ZUD1 1UR5A 2A4KA 3IL2A 1KC1A 1ZXBA 3D3WA 3FCOA 5J23A 3EHEA 3WGZA 3PZBA 1LSOA 1OOEA 3ZNNA 2FR0A 1AHHA 4YRBA 4XR4A 1T2AA 5EN4A 2PKQO 2XXBA 4R1NA 1H93A 3AFMA 2H5LA 1TT5A 2FZEA 2PKRA 3FR7A 5T8KA 1QYCA 3RBZA 4YT5A 2AEMA 2Y67A 4YWJA 3V5NA 4E5PA 4NJMB 3F5QA 4BNHA 2RH4A 2JAPA 1FK8A 1VSVA 5K0ZA 3I23A 2OP0A 1C14A 4FSHA 3RUEA 4OMUA 1XU9A 5DP2A 4K9DA 1LDNA 3WDSA 4YBZA 1LXCA 3DBLA 5T67A 4NBTA 1NPDA 1YDEA 2Z5LA 5GZ1A 3B70A 4J91A 4TWRA 4EITA 2BF7A 1X0XA 3AU8A 1XG5A 4BVAA 2CF5A 3F6YA 2W2LA 2ZB3A 3JD1A 1HE3A 1WXDA 2NWQA 2QW8A 1U3VA 2VUSA 3GOHA 3ZW8A 1O9BA 2NTNA 1SCUA 2UAGA 3JQBC 1DC6A 1WDKA 2VHYA 4OAQA 1LLUA 4R4JA 1BG6A 4O0LA 1KOLA 3VH3A 3K5PA 1W6UA 3U4IA 5CDTA 2IXAA 3IC5A 3ZWWA 4CLRB 4CMCA 4DTIA 2X1HA 4NNJA 1EBUA 2JHGA 3KSZO 4FFMA 3GF4A 3PP8A 3ZWAA 1G0OA 1H94A 1D4FA 4XCVA 2RIRA 1A7AA 1ZSNA 1JN0A 4N54A 4XB2A 2OUIA 4NFYA 4CLHA 3IJRA 5DCWA 4LRTB 3TZ6A 4UEKA 4DC0A 1CERA 1DRWA 1GL3A 1YBVA 2O4CA 3OIGA 4N5MA 5KOIA 4W9NA 3WFJA 1E1KA 3UN1A 4LVUA 1AXEA 2GN4A 4Y67A 1QMGA 5JY6A 1QYDA 3GVIA 3K31A 3ZV5A 1ZZEA 1B16A 1DHRA 2GCGA 2X9VA 3V2GA 1Q2XA 2WE7A 1SO8A 1T24A 1MB4A 3E9MA 1H9AA 1OBFO 3FHLA 2JCVA 4OIMA 1J4AA 3JQAD 4Y8VA 3QY9A 4IXWA 5TQVA 2A35A 3E5RA 1UXJA 4YR9A 2Q99A 4CMGA 4L74A 1J6UA 1WDMA 1LA2A 1R0LA 5TT0A 5ICMA 1YQGA 3L6OO 4CV1A 3HG7A 5IG2A 5ILOA 3OP4A 3RVDA 5KJFA 4BNUA 3KYDA 2ET6A 4WEQA 4M54A 1ULUA 2Q1WA 1KYQA 3ABIA 2OXIA 4DC1A 4BKPA 3ADPA 2ZJ0A 4B8WA 2CDBA 5FF9A 5L40A 4MVJG 2NU8A 3NT2A 4W99A 3W8EA 1P31A 4TQGA 3FTNA 5JLAA 4YT2A 3JQAA 1D3AA 3NT5A 3BMOA 2O50A 1HT0A 4G81A 3K30A 4R3NA 2YJZA 3GH3A 4XRGA 3Q0EA 2Y99A 4J1NA 4MVJP 1DJNA 3IUPA 4DPMA 1YQDA 2OHXA 4YACA 2J3IA 4N5LA 3OF2A 2C82A 3DMTA 1R4NA 2R2GA 4XJSA 5CG2A 3OJFA 4RGBA 2Y66A 3PYMA 4YJHA 1PJBA 1T1SA 3WLFA 1LDMA 1S6YA 3NRCA 5DCYA 5AXCA 4CM3A 1PZFA 2B69A 4JBHA 1NYTA 4HXYA 3C1AA 2FHSA 1I3NA 1ZEMA 4XJTA 4DIFA 2J5KA 1ORRA 1VJ1A 1HEUA 4RCVA 3RU7A 1LSUA 5BSFA 1GEEA 1QXSA 4IY1A 4IXTA 4MVJH 2JCXA 2QHXA 2Y93A 4FDAA 1FDUA 3EZLA 4NQZA 5A9SA 2YDYA 3VDQA 4IDCA 1QKIA 4DYDA 4TRMA 4XGIA 3F1KA 2Q1TA 3K92A 4UEJA 3SJ7A 2DTEA 3NEPX 3PEFA 3I4FA 1QG6A 1YS4A 4J4HA 1EFLA 3WXBA 4XR9A 3PI7A 4PLFA 4A26A 1WZEA 3QW2A 4URFA 4WNIA 2NVBA 4GPD1 2O2YA 5CEEA 5KTKA 3ETGA 2D2IA 4LSMA 1EUCA 1SEPA 2CVZA 5BNIA 1PGQA 1EVZA 4FB5A 3R3JA 4PZDA 5KNLA 2DUUA 2YZ7A 2C20A 3X2FA 2Y0EA 1QLHA 4XQ9A 4E3ZA 3E82A 4XQGA 1BXKA 3PHLA 3D5QA 3A28A 5TNXA 1IULA 5EL0A 2VYVA 3AUAA 3H9EO 2Q4BA 2C59A 4A2CA 3Q1LA 4FCCA 4OJNA 1F12A 1WMAA 2AG5A 2FRDA 2QX7A 3AW9A 3D3EA 1E92A 2CSUA 2YFHA 3OBBA 3PHJA 1VKOA 1EDOA 5KJ1A 1IYZA 1NBOA 4PG6A 4R69A 2HMTA 1VKNA 2BI8A 1YGYA 3AOEC 1PL8A 3QP9A 5L95A 1LUAA 2GGSA 3AUSA 3KXDA 1YL6A 4DUPA 4AJNA 3JQEA 3KLMX 3QVOA 4MVJD 1DXYA 4IZHA 4JGBA 1NTOA 1HL3A 3GN2A 4W7IA 4L9RA 4QECA 1EFKA 5F5LA 2ILTA 4IQ8A 2J3KA 4XX0A 4MVJI 1GZ6A 1W0CA 2CVQA 4GX0A 1T25A 4FR5A 1O89A 4J43A 5DBFA 3WGHA 5FI3A 3Q3CA 2W2KA 2GZ1A 1NHWA 4OKNA 4ONEA 4BMVA 1U7TA 3UCEA 5DZSA 4XYBA 3KB6A 4BO5A 3OIDA 2HMWA 3OSUA 4XGKA 4AVYA 1HE5A 2E37A 5G4KA 4XA8A 8LDHA 1LBEA 4DQXA 4IDFA 4MVJA 3UHAA 1XLTA 2Y05A 1LDBA 3ASUA 4GBJA 4QO7A 2VWHA 5C7LO 4E5YA 1MGOA 4CR7A 4GX2A 1QV6A 4IDGA 4Q3AA 2J6IA 5GY7A 1ONNA 5A4DA 2Y68A 1N1GA 2IZZA 2ZJ1A 3GC6A 3BZUA 1KC3A 3OICA 4DLBA 4CMIB 3VKVA 3GZNB 1NWHA 2D1YA 2HU2A 3DBHB 4LGVA 4U6QA 5T57A 1ADBA 1OC4A 3JQ8A 2UUPA 3LF2A 1Y6JA 3CINA 4XYEA 3ZWCA 5A1TA 3EDMA 3RI3A 4OQZA 3HN7A 3ANLA 3QE3A 4NBWA 4NMHA 2QYTA 3I9NA 1F14A 3LT1A 1HDRA 1E6WA 1NM5A 4Y6RA 1HRDA 4K28A 3BMQA 1QV7A 1YH3A 4FC7A 3EGOA 4CM6A 4FGSA 4Z3DA 1YRLA 2VTEA 3HUDA 1NAHA 1ZNQO 3FNGA 1R4MB 4CM4B 2QZ9A 1I36A 1E1MA 3AY7A 2PFGA 3MEQA 4B3JA 2Y1DA 2YV2A 2ZIZA 1RM5A 3KM0A 4BS9A 4DL9A 1PQPA 3IKTA 1Y7TA 1YL7A 1LNQA 2VOJA 4NU5A 4D46A 2FPPA 3MTJA 5CFZA 4B3HA 4XQCA 4OXNA 3RUAA 2WYUA 2I9PA 4BO2A 2EW8A 3JD0A 1GZ3A 4XZ3A 3VVCA 2VNSA 4J2HA 4WLFA 3S1LA 3N58A 5TX7A 1N9GA 1ZEJA 3GG2A 5HS4A 4RL6A 1HF3A 2IYPA 5I9LA 1I3KA 1NQAO 4Y6SA 1JWAB 1PJLA 2P4HX 1E3WA 2BLLA 3DBRB 2PLAA 1LRKA 1CEQA 4QSMA 1R37A 1X13A 3KV3O 3KHUA 3ENNA 3PRJA 4KZPA 4YJFA 3ZHBA 4YRDA 1DDOA 1AHIA 3NJ8A 1ZIDA 4WEOA 1SBYA 3WMXA 3TL3A 2J3JA 4K1LA 4IDEA 4YJGA 5HBRA 3UUWA 3PQDA 4MP6A 2JKVA 4XWYA 1JDJA 3GLQA 1GPJA 1ZSYA 4CUJA 1P1FA 1U1IA 3O38A 3E18A 3H2SA 1PL6A 2OL4A 4KWHA 2JD0A 2DAPA 3EY4A 4H15A 2X58A 5BSGA 1K6IA 1DOHA 1YJQA 2OGUA 3M6IA 3FPCA 4Z0PA 1PS0A 2OORA 4J1TA 4CQMD 3DZJA 4AJPA 1PIWA 1JAYA 3GMSA 3H9QA 4RZIA 3ZWVA 1R0KA 5KVCA 4Z3KA 1DEHA 5B12A 2QRLA 2AQKA 2HMUA 2PH3A 2ZQYA 3EC7A 3RU9A 3D5TA 3MTGA 4DLLA 5KIAA 4MOWA 1DLJA 4M55A 5JAQA 4I1IA 5C5IA 1DC4A 3RCBA 3L4BC 4ZA2A 1LQTA 3M1LA 1O8CA 5JSFA 5IDYA 2HO5A 2YHIA 3UCFA 2RHCA 1Q1NA 7MDHA 3JD4A 3CSDA 2FZWA 5AQ1A 3HHPA 1PL7A 4TROA 4CQMA 1B2LA 2RBEA 3P2YA 3EVTA 4AICA 1Y9AA 2X7HA 5U4QA 1KVSA 4I08A 3ROQA 4HFJA 2NACA 4PCVA 1MXFA 3BTUA 3FF4A 2PGLA 4KP7A 3QWIA 1XCBA 3WJ7A 3QSGA 1QP8A 4XRRA 5A05A 4BKUA 4FN4A 1UZNA 2GR9A 3S2IA 3SX2A 4CLOA 4AJKA 4Z9XA 2EKLA 1ZK3A 5B4TA 4UREA 3RBVA 3V1TC 4MP8A 2JAHA 5BNFA 2CVOA 3ZWBA 3ITKA 4MINA 4PRKA 4CMEC 2Y1EA 5K9ZA 4B7CA 2UV8A 2VNAA 2AEFA 4LISA 4BNNA 3WGIA 3OJLA 3AUTA 2D8AA 2EHDA 1Z6ZA 4TZKA 5AVOA 2BFOA 2C0CA 4GLOA 2EJWA 4E13A 4ZN6A 2CNBA 2QRKA 2FWMX 5TIIA 1TEHA 4I9NA 4PLYA 3DFUA 1PWXA 2E6UX 4XYMA 4Y6PA 3V2UA 5L53A 2O3SA 3CZMA 4LCJA 1WVGA 3TZQA 4QFDA 2RCYA 1WDLA 4CQLB 3WTBA 1P44A 3RJ9A 1ZO8A 3GAZA 4ALLA 2CDCA 2OBNA 3NGXA 3HDYA 3DZGA 4A0SA 2Y1FA 3OQ6A 4W6ZA 3WSWA 2C5EA 2O3JA 4J6FA 1Z7EA 1ZK1A 3JYLA 1LSSA 1DC3A 3JCZA 4R41A 3ORFA 2V7PA 3KO8A 3GVXA 4J16A 2JHFA 3GVPA 3L9WA 4E31A 4RLHA 4LMPA 2UYYA 1ZCJA 4EI2A 1P1JA 4D3SA 3JD2A 3DHEA 3GAFA 1I2CA 3PHIA 3RUDA 3ZZNA 5K6AC 3BMNB 2PZKA 3KYCA 1NQTA 4IGFA 5AXBA 4J0FA 4U0JA 3WX0A 5ILGA 3PWSA 4ZD6A 3NT4A 2WD7B 3DFZA 4JROA 3DDNA 3JQ7B 2J3HA 1MX3A 4YVFA 2G76A 1UP7A 1VJTA 2O48X 3VH2A 1YB5A 1BXGA 2OBYA 1P0FA 2BGMA 4CL3A 2E82A 2ZCVA 5EQFA 4ITUA 4BMSA 1IPFA 1Z75A 5A06A 1T26A 5CAEA 5T64A 3UICA 6ADHA 3DOCA 3VTFA 4GH5A 3QWBA 4JXKA 1DLIA 3LYLA 2O7SA 3QJ5A 3PLRA 4WCFB 5I8ZA 3PQFA 1YKFA 1ZMOA 2ZB7A 2NV6A 1GCOA 5ENDA 2X0RA 4Q3EA 1Y1PA 5C7OO 4NBVA 3OEYA 2RHRA 4RVHA 2FP4A 4E6PA 5ER6A 5F1PA 4CM9D 2FMUA 3WTCA 1OI7A 3HFSA 5KWEA 1B3RA 3G49A 1HSZA 1HDOA 2HK8A 3JYPA 4JIGA 3W8DA 3WBFA 4H16A 4WLVA 5ENVA 5A9RA 1Q7GA 2NVUB 1LEHA 4HFRA 3AM4A 3WB9A 4AL4A 1ENYA 4CMJA 3HN2A 1QR6A 2IZ0A 3IP1A 3VVBA 3RSHA 4BKRA 3UGKA 3JYQA 4DPLA 4IDAA 3KSDO 1BVRA 4OSOA 4JLWA 1MXHA 4A03A 1AUPA 3GNSA 5L4LA 2IXBA 3IAHA 1NX6A 4B4WA 4RPGA 4BGVA 4BL5A 3CMMA 2PKQP 4CM9A 5JC1A 5JYEA 4E2XA 3VPHA 1M67A 1C1DA 3AY6A 2H63A 3A06A 5THKA 2V65A 1XA0A 3DO5A 1FJHA 4XIJA 2PWZA 4A10A 4P8RA 3PHHA 1TVEA 4BB6A 3DL2A 1N7HA 3PWKA 1U9JA 3HFGA 1GTMA 1ZBQA 1FDWA 3HWRA 4NJMA 1LJ8A 4R5HA 1ZK0A 1P3DA 1ZVMA 1UXGA 1O0SA 3K6JA 5H81A 2AE1A 1X0VA 2VRBA 4HY3A 4IJKA 1ZFNA 5TJHA 3T7CA 5AXAA 3WWYA 3E1KA 3G1TA 2WE8A 3F9IA 3Q2IA 3M2TA 1XWFA 3Q9NA 3GPIA 4EDFA 4Q39A 4IIVA 4QX6A 2Z95A 4U0KA 5DF1A 1SNYA 3GN1A 3DONA 4BNYA 4D3DA 4UVEA 3SBOA 3O26A 3DHNA 3RIHA 1HE2A 2P9CA 1HLPA 2HJSA 3LT2A 1UH5A 4QXMA 3U09A 4AG3A 3LU1A 4RVSA 2YW9A 4B4UA 1F0YA 5U1PA 1D7OA 1B14A 3GFGA 1R12A 3OJOA 4GVXA 3JD3A 5DOZA 5IXYA 1WNTA 3FN4A 4DMLA 3BYZA 3F47A 4NHEA 1SAYA 3WGQA 4INAA 3RWBA 3BTOA 1RM4A 2ZK7A 3TN7A 5HRUA 5IDWA 4JX8A 3U3XA 1D1TA 1B0AA 1ZMTA 4G2NA 3L07A 3RASA 4QUKA 1C3VA 2GPTA 5G0UA 3MCVA 1ZXLA 1JKJA 3Q11A 2VT3A 3HDQA 5I9MA 3KEQA 2DTXA 4PLCA 3U9LA 1Q7BA 1JU9A 5F21A 5JAMA 1IL0A 5EJ2A 5F5NA 5JC8A 2O23A 3KUXA 1Y8RB 3C7AA 1JVSA 3KBOA 3ZWOA 4FQ8A 3AK4A 4D41A 1ADCA 3IMFA 4R51A 1SB8A 1HDGO 2G5CA 2PNFA 4E30A 5HA5A 3S55A 3QIVA 1L7EA 1YWGO 2ZYDA 1EK5A 2W8ZA 2ZYAA 1GUFA 4I5GA 5JMWA 5A04A 4O63O 3C8MA 3GEDA 2G0TA 1RPNA 2WYWA 1LLCA 1C0KA 3IOYA 3U4HA 5A03A 1KVUA 3TPCA 1GQQA 2D5CA 5KKAA 2Q49A 3PTZA 3GGPA 4JQCA 5BNTA 1H5QA 3AFNA 3H6KA 1U2GA 3CPSA 4BOYA 2XF8A 4ZQGA 2B37A 1DIBA 4FFRA 3RJ5A 4MIOA 4B79A 4IM7A 1B7GO 3OMLA 3WQRA 5BSEA 5T6BA 4GX5A 4CM5A 4E33A 2I99A 4Z0HO 4Q3BA 4OGWA 4RQUA 3PDUA 3G17A 4B8ZA 4PLVA 2UDPA 5CEJA 3HB5X 3U5TA 1JTVA 3ON5A 4PLHA 5ADHA 4MIYA 4HX5A 2DQ4A 4MIEA 3DEYX 1Y8QA 2GASA 2J5QA 4WLEA 1DIGA 3H5RA 1GFSA 3D3WB 2P5YA 3NGLA 4WCFC 4Z6KA 2I65A 1BRMA 3C24A 4BV9A 4WOJA 1MG0A 5DCUA 1N1EA 1EVYA 4IJUA 4DREA 2LDBA 1NXQA 3V2HA 1NQ5A 1HZZA 4NG5A 4IJWA 4R9RA 3JSAA 1TT5B 2O2SA 3WGTA 2X5JO 2X5OA 2WMDA 4YJDA 1WMBA 3C1OA 3S8MA 4AJ2A 1QORA 1U28A 1XKQA 4RVFA 4YXFA 2ZCUA 4ALJA 2VWQA 4PG8A 1ZJYA 3WBBA 1UZMA 2BELA 2HDHA 3I9KA 1EVJA 4UVDA 2EF1A 4F6CA 1MA0A 1JA9A 2FOIA 2FY8A 3DBLB 1P1IA 1GQ2A 3IKVA 2I5PO 3LLVA 4J0EA 2ZYGA 3KTDA 1UP6A 4HKTA 3LDHA 3WNQA 4FOOA 2CUKA 4RPLA 2BFMA 3E03A 1JWBB 1B26A 2PZMA 2WM3A 7ADHA 1HDZA 3RUFA 2DBQA 3O4RA 5IDXA 2Q1UA 2DVMA 4WECA 2IEBA 2HRBA 4NBRA 2R00C 2G17A 5CDUA 1E3SA 5JMPA 1GUYA 4E2ZA 5KJCA 1NR1A 3DAFA 5COAA 4CR6A 4PN3A 4CMEA 4GWGA 3WICA 3E8XA 4EZBA 5C37A 4L73A 2C7GA 1TLTA 3AM5A 5I7FA 2VQ3A 2X8LA 1H2HA 1KY4A 5BSHA 3U62A 3N7UA 3M1AA 4BB5A 3H9GA 1LDGA 4Q3DA 3W4IA 4J4TA 4QFCA 3GUCA 4TRRA 3M2PA 1KVTA 2V6GA 4R1UA 1NHGA 2IRWA 3IUSA 3WIEA 4NBUA 4EJ0A 2D4AA 3EVNA 1U8FO 5JO0A 1YBAA 4IQ0A 3AUUA 5GZ3A 2Q2VA 3GVHA 1Q0HA 3L77A 1T4DA 5L3ZA 4C4OA 2E4AA 4EEZA 1PZGA 4M8SA 1YQXA 4CPDA 1OFGA 1P1HA 2X9GA 3SVTA 2BD0A 1J5PA 4FC6A 4YAEA 3BMCA 1CYDA 1U5AA 3COSA 4IZIA 3U0BA 4H7PA 3K2EA 5COQA 2IE0A 3ETDA 1V3UA 3ZU3A 4JP3A 1E7WA 3STHA 3DBHA 1YXMA 2X0NA 3ZI0A 1PU2A 2UVDA 1SMKA 5THQA 4BO1A 3OA0A 4OOEA 2PTGA 5CDGA 1NVGA 3K2BA 1SC6A 1RYDA 2X86A 4RF2A 4BNVA 3MWEB 3GZ4A 1EE2A 4PLTA 4ND4A 5F1OA 1LRJA 1R6DA 1WWKA 3ZHXA 3ZU5A 1JLLA 1RM0A 3JQAB 1HYHA 4I9UA 5IXSA 1TT7A 3ZWMA 5HS6A 2ZTMA 3BMOB 3V1YA 2VUTA 2NU7A 4FD3A 1NASA 1NP3A 3K8ZA 2C2XA 2LDXA 4B7UA 3ENKA 1SB9A 4OO3A 4RPJA 1LQUA 4FBGA 4RPHA 3C1TA 1J0XO 1PQWA 3VAZA 3VH1A 2RAFA 2OZPA 2EV9A 3QVSA 2POQX 3I9JA 4YEDA 3DZFA 1ISIA 1IZ0A 3DTYA 3GHHA 1R4NB 2NU9A 2PY6A 3RUCA 4JCOA 3RD5A 2JL1A 1EZ4A 1DIHA 2NQ8A 5AXDA 4RQTA 5JPIA 3UW3A 5MGBA 4AJIA 1O6ZA 2P5UA 2NTVA 2YDXA 4D0RA 2EIHA 3VPXA 4OQYA 2WWRA 4RVGA 1PJTA 5TRTA 3W8FA 2VRCD 4E21A 3LC1O 3ZWXA 3QWAA 2J5RA 3MJEA 4KQXA 1VL0A 4L4XA 4CV3A 1FDTA 4I9HA 2WYVA 1ZKMA 5FEUA 3GGGA 3I6IA 1E7SA 4TMFA 3G1UA 2WSBA 4C7KA 1EMDA 2EJVA 4RDIA 2PZJA 5A9SB 1PEDA 4OH1A 1K6XA 3DBRA 3CMCO 3NJ4A 3L6DA 4R3WA 4R16A 1CF2O 5F1KA 1SOVA 4KDFA 5FFFA 2VZ0A 3ZWPA 4ESOA 3ASVA 1ISHA 3JQFC 4WGGA 4MDHA 4OYRA 4BNWA 4XD2A 2VWPA 1GZ4A 4BO0A 2OMEA 2VRCA 2BH9A 2NNLD 2Q46A 3O8QA 1FXSA 1AN9A 1F8FA 1U4OA 3KZVA 4QT0A 1BW9B 2E49A 2YYYA 1UZLA 4EEXA 4D42A 4DIBA 3H3JA 2FSSA 3CE6A 5CDSA 2FPGA 1K6JA 1EQ2A 4CMKA 1GDHA 1PGPA 5IFLA 3ULKA 1N5DA 4GMFA 3VOSA 2X6TA 1VRWA 3OEWA 1WP4A 1PX0A 5L51A 3S2EA 1N7GA 3GUYA 3EAGA 4TRJA 4ZICA 2I3GA 3DXFA 1J49A 3HQ4O 2VUUA 1CQJA 1NPTO 2GDZA 2DBVO 2FN7A 2PK3A 3D7LA 1HDYA 4FJ0A 3BTSA 4GX1A 3P5SA 1C0LA 1EQUA 3P19A 4MVJM 3ZNOA 4Q9NA 4CMHA 5T8KC 5KVVA 5ER9A 4PLZA 4HNGA 2W90A 4NZ9A 5TGDA 1BGVA 4CM8B 4MKXA 1U8XX 3F1LA 1HKUA 2YQ5A 2NTJA 1PGOA 3GNQA 1L1FA 4IS2A 2W2KB 4XEHA 1I8TA 2JFGA 3JQ6A 1E3EA 4N18A 3FBGA 2R6JA 5TLSA 4U6SA 3JQDA 1P74A 4WASA 4WJZA 1DAOA 1L7DA 1UXIA 4II3A 5A3VA 5TF4A 3VZRA 1UUFA 2EP7A 3INTA 1MP0A 4KUEA 4ZRMA 5G4KB 4E4YA 5EIOA 3NX4A 3LF1A 2HRZA 4UUPA 4ZJUA 4YTEA 4QEDA 3IDSA 1YBMA 2AG8A 3Q2KA 4BQPA 4OXYA 4PLPA 4PZCA 3DC2A 3SC6A 2BMAA 5FWNA 4BO8A 1VI2A 2HK9A 1JW9B 1KY5A 4J1QA 1V6AA 3D64A 5HWSA 4N5NA 3VTZA 4YDRA 2GN9A 1GEGA 5H83A 4IDDA 5CDYA 2JD2A 4E5NA 4DA9A 4AJOA 1PJ2A 3TZCA 5L45A 1R15A 4AJJA 1ENZA 4II2A 3WSVA 4UVIA 1PGJA 4EW6A 4NFHA 4J9UE 3D0OA 3JQ8B 3NV9A 1Z82A 2YY7A 4W9NC 4I8XA 3S2FA 1M75A 3I4CA 4ILKA 1F17A 1N2SA 3RFTA 3GK3A 5DN9A 3RBXA 2B4RO 3JQBA 3FNEA 2DKNA 3BMQB 3RC1A 2WD8A 2TMGA 2PA3A 2B5VA 5L4SA 1LLQA 1E3LA 1GY8A 5IZCC 4M1QA 2DFVA 3RROA 3E9NA 4GVLA 2D5AA 4E5MA 4ND2A 4C7JA 2AEJA 4L4RA 1K3TA 5TC4A 3VPFA 3ZCXA 5TT1A 1Y9EA 2QYSA 1U2DA 1NAIA 3NYWA 4H3VA 3KYBA 4MJLA 2XXJA 3RC7A 4ND1A 2BRUA 3BMNA 1LU9A 1CRWG 5H82A 3MJTA 3ZNQA 3D4PA 4FFPA 3WYCA 1Q0LA 1BSVA 4KTVE 4A73A 1RYEA 4M86A 1EBFA 3PVZA 2C54A 2A92A 3LT0A 5DT9A 1NQOA 4FGWA 4CV2A 4E5KA 1GCUA 3K96A 3FD8A 2Q50A 4OL9A 2BFPA 4XDYA 3U4CA 2Y1GA 3FWNA 2HKIA 3OJEA 5L7TA 3OM9A 3MOGA 5C7IO 4KDEA 3TDKA 4CMAA 2P9GA 3ROPA 2DFDA 3JQCA 3SEFA 5JDIC 1A4IA 3RUHA 4CLEA 4MO2A 1DHTA 4YJFB 3CEAA 4CUKA 1ADGA 3VPGA 2VZ8A 1DFHA 1MLDA 4LRSB 1GYQA 4YJGB 5MDHA 1HDXA 2GO1A 3GDFA 4M89A 2AHRA 5LCXA 1T1RA 3QRWA 1ZSVA 4D0SA 5JO9A 4NDNE 1SOWA 1CWUA 3RC2A 3HNPA 1ISMA 4KOAA 4R9SA 1Q7CA 5CP8A 1IOLA 4L76A 4MVJF 1XQ6A 1QYXA 2EEZA 2HMSA 1TI7A 5JXWA 2CY0A 1HTBA 3IP3A 4P4GA 5JAZA 2HQ1A 5I7SA 3FSRA 2VHVA 2O3TA 1HDCA 3B1FA 2R00A 3PGXA 2IZ1A 3TF5A 2B4QA 2GLXA 1NFFA 4ALKA 1GV0A 3OQBA 5JDCC 4FFLA 2FSVA 3CUKA 2HK7A 2B35A 3KEOA 1E5LA 5KCZA 2FR1A 3O9ZA 4S3MA 1D8AA 1I30A 5JS6A 3SC4A 4YPOA 5KVSA 4R1TA 3GR6A 1DFGA 4J4BA 4JN6B 1DJQA 2EXXA 2YHUA 4KUHA 4LK3A 4BMNA 1U3UA 3INRA 3NUGA 1IE3A 2YHIB 3ZU4A 4EUHA 4RZHA 1GADO 4F6LA 1GUZA 1TXGA 3V8BA 1AE1A 3PLNA 4MPDA 4ZGWA 1DB3A 1ZJZA 3RKRA 1PS9A 3G79A 4R54A 5KJ6A 1EUZA 3FNHA 4CL8A 2GN6A 3INGA 1X7HA 1K5HA 1KEWA 2HCTA 4X54A 1I5RA 2CF6A 2XAAA 3OQ1A 1BWSA 1KEPA 3V1UA 2SCUA 5DP1A 1BDMA 2Q4EA 3IIEA 4YA6A 1SZJG 3BHMA 1UAGA 1LC3A 3AI1A 1B15A 2IYOA 1VLLA 3FR8A 4JJFA 4F45A 3I52A 1X1EA 1RJWA 1F06A 4YAKA 2Q3EA 1ID1A 4UAGA 4YQYA 3GNTA 4UUOA 4WNCA 1GPDG 3AOEA 3WWZA 1U5CA 3GFBA 5DDIP 3LQFA 4LMRA 3WQSB 1G1AA 2AQ8A 4FFNA 9LDBA 4JNKA 1H6DA 5EQDA 1TB4A 4EUEA 3SLGA 1T4BA 1WPQA 5TS3A 1KBZA 1T2EA 4IIUA 2GN8A 3QHAA 4D45A 4DXHA 2WTBA 1A72A 4ZQFA 3W1VA 3WR5A 2HLPA 4J3FA 1IUKA 2PZLA 4BV8A 3JQGB 1E0DA 2JD1A 3PGJA 1XYGA 2ZKLA 1Y8RA 4QO8A 4DLAA 2VT2A 4R1SA 3RC9A 4Z9YA 1E1NA 2XOXA 2RH8A 1E77A 3D4NA 3KYCB 1CDOA 4GQAA 1E3JA 4IS3A 3ADOA 2QG4A 3VDRA 3WGGA 3RAJA 3HSKA 1G6KA 1PZHA 1P77A 3IJPA 3NDJA 1VL6A 2DPGA 5IZ4A 1JAXA 3HJAA 1I2ZA 1BXGB 4JP2A 1A4UA 3ZV6A 3DZHA 2BGLA 2BI7A 3Q6IA 3HE3A 4CLRA 1X15A 3R0IA 2CD9A 3RQSA 1P45A 3PYLA 5G0WA 4BO7A 3TZKA 3H2ZA 3QVTA 4IINA 2GRAA 4QQRA 1A9ZA 1EVIA 2YV3A 4ND5A 3FTPA 3ZGYA 5DBGA 1A9YA 1GD1O 1E3IA 3K9QO 4P4LA 4CM7A 3UCXA 2GZ3A 4GKBA 1H6CA 3WMWA 3WGOA 2NVWA 2EG9A 3I83A 1HE4A 3X2EA 2G82A 1HLDA 4HBGA 3B6ZA 1MFPA 2NQTA 3FI9A 3KOUA 3C7DB 5EMHA 1O94A 2OFPA 1YE3A 3GVCA 4PLWA 5DOVA 5LDHA 1JKFA 4MP3A 3ANNA 1C1XB 1C1DB 1CETA 3GRKA 4HNHA 2GF2A 5I7VA 2CZCA 1VM6A 1DBVO 4WKGA 4DMMA 5G2OA 1MG5A 1LSJA 3TWOA 2P4QA 2X22A 5EESA 2W2LD 4XDZA 1P33A 1KEVA 4XQEA 4NK4A 3FWZA 2V6MA 1LLDA 2YV1A 1ARZA 3FPLA 1M6HA 3CXRA 5I7EA 3SXPA 4GL4A 1JQBA 3WFIA 1YOVB 4RF4A 1UDAA 5EPOA 2JFFA 3CH6A 3OJ0A 1WW8A 2HUNA 3DZKA 3TQHA 4O5OA 3VZQA 5I9NA 3JYNA 4UUNA 3QLJA 1RWBA 2OOSA 4B4OA 1BDBA 4D3FA 4WLOA 2J8ZA 2PGJA 1XIVA 4NU6A 5EERA 3VPSA 2GSDA 2BFAA 1T2FA 4RORA 5LDGA 1W73A 1N92A 1LRLA 5JFOA 2ZB4A 8ADHA 3VKUA 3P2OA 1BTOA 4YQZA 1T2CA 2HMVA 3LC2O 2HAEA 2WEKA 4PRLA 3ZN2A 1G0NA 1RM3A 1XELA 1Y5RA 3GQVA 4WLNA 3GG9A 1E7RA 3DBVO 5DULA 2VTDA 1H6AA 3T4XA 4HFMA 4BKOA 5CPBA 3KVOA 4Q3CA 4XGNA 3H5AA 2ZATA 1KS9A 1HETA 3DAPA 1I32A 3A9WA 3UXYA 5L4NA 3TJRA 3MJSA 4NR0A 4FFOA 4LW8A 4TZTA 5HTOA 1OZAA 2IDZA 4BNFA 1RKXA 3TFOA 3ZWYA 2DBZA 2JJYA 2X9NA 5IZCA 4GKVA 3D1LA 4K26A 3L4BA 4EUFA 4QTZA 5JE8A 3U49A 4YT8A 2X4GA 2VHWA 1HYEA 4EJMA 4HADA 4YAJA 3FNFA 2EKQA 4RF3A 1DO8A 3OHSX 4E2WA 3ZNPA 1LC0A 1PGNA 4DQVA 4DBVO 4OKIA 1OMOA 4HFNA 4RVUA 4HP8A 3MOIA 4N7RA 4ZRNA 3GMDA 1GV1A 3T7EA 1FDVA 2V6FA 4M87A 4FS3A 3P7MA 1NWCA 4FOSA 1ONOA
chains in the Genus database with same CATH superfamily
2Q2WA 2CVFA 4E0BA 1CP2A 5B1EA 3TIIA 4TV9A 2ZB8A 4CODB 3KHKA 1OXUA 3NVMB 4DQLA 1WU7A 1EP1B 3DEHA 1USVA 1X1SA 2XJ9A 3DOOA 3SJAA 1SD5A 2O1EA 4ED9A 1TQ8A 4B35A 1MO3A 1H4VB 3WB0A 3N0RA 4TKLA 4DVGA 2W6QA 1R64A 4DVJA 1E59A 3JSXA 5KI6A 3MS2A 2O1WA 4JHLA 5JDCA 4WLUA 2VPXA 3KL2A 3WKBA 1XZLA 4NL4H 5L9AA 1G8XA 3VUEA 2FEMA 4KE7A 4BAGA 1KXZA 1TA9A 2W43A 1R4MA 2X4IA 3CIFA 4S1VA 2ZRAA 3FUVA 4NK5A 1ENPA 3BWDD 2ZIAA 2WWVD 5ISMA 1AS2A 5IJ9B 9ABPA 1PRYA 1RP1A 2J6CA 2BFEB 2GUWA 2FCRA 1JDSA 1YL5A 1VPDA 3M5PA 5JYDA 1AD2A 1NXSA 2OILA 4NU8X 5F5FA 2J9XB 2P2LA 4C3OB 1I5OA 2BEVB 3WYEA 2VVTA 1KZ6A 4FP9A 1HR0B 3BXXA 3C5HA 3DHYA 4F5WA 3G7NA 3PEWA 1SIBE 1XO1A 4OFZA 5JNLA 3UG6A 2BCEA 3DT8A 1V5GA 1J2RA 1I33A 5K51A 3SF8A 3LY5A 1BR4A 1OAAA 4R0MA 3EW7A 4HJXA 3UOGA 3O0DA 3UOWA 1Y6RA 5LLSA 2QSZA 3AVVA 3L8EA 2O3QA 1DAHA 1OY1A 2IYVA 1IWBB 1EWTA 3SEQA 4UEOA 3E9RA 3GEBA 4CVNA 3T5CA 5A7GA 2WM9B 1OLSA 2DFPA 2PGNA 1J2TA 5CLIA 4NAVA 1BMTA 5IN4A 2AD5A 1Z7Qc 3NQ41 1T6QA 2KW3C 4EHNA 1RQXA 1FLDA 5AVUA 3QBEA 2H07A 1YA8A 2X14A 1N6HA 2CWWA 4NYIQ 5AQEA 2ONYA 2ZE7A 4OIOF 2DBRA 4Y9DA 2V98A 2XUPA 3HKBA 4TYNA 1XCJA 1B8OA 1HXHA 2GAQA 4UJ5A 3OA2A 1G8JA 3KAQA 3BX1A 3AC0A 4H4KC 4UMVA 2BSXA 4AB1A 4MLDA 4B7XA 1IATA 2E1PA 3UV7A 5LUAA 5HQ3B 1L5NA 4BGUA 4F9TA 1ZLXA 1VE9A 1I2AA 1A7KA 1QLJA 2WJ6A 1UAYA 3ZQ6A 2QBYB 3JVUA 2AOWA 1ES9A 4H6PA 5ABPA 1K8XB 3UVEA 3FYUC 3EMKA 3C7CB 2VOEA 5F73A 3PDMP 4IDQA 2JFVA 4E18A 1Z9BA 1JIVA 1MV8A 4DN6A 2X40A 4DGSA 1JVBA 3H5NA 4ZCLA 4LE0A 1MVLA 1U3WA 1WPXA 3I72A 2A94A 1H2XA 4DSUA 3L3BA 4FAPB 3CCBA 3ZDEA 1U6IA 1I2BA 4BNTA 1KMCA 3OFNA 4BZZA 1HWYA 3N2GB 1EE9A 4RA6B 4HWKA 2A2ZA 4G65A 2H9IA 2OU6A 3RLIA 4XWKA 1PHPA 3JS5A 4P81A 2IODA 4OD4A 1WCV1 2QI9F 4O5AA 2W98A 2XEDA 5E1DA 4PFJA 3IXLA 1HOTA 1OTYA 5AHKA 3AEKA 3IUJA 2EW1A 4UM9B 2ZYSA 1RQGA 3WL6A 2OZLA 3I2JA 4TUYB 1J20A 4KAAA 1CZHA 4HEAJ 2ZAYA 4CLXA 2ZAIA 3G2LA 2PKYX 3BE5A 2R66A 4MVCA 1S3GA 2KJQA 2Z6VA 1U8CB 2ZUUA 2PT5A 3Q41A 2XMDA 3VR6D 3DD5A 4EBFA 4EYSA 1PYGA 1ZR4A 5E3JA 1PJAA 3N2IA 3ICPA 2JAOA 1P81A 1PJCA 4HDMB 3G2IA 2REQA 4H6VA 1T2AA 2Q2NA 4OJKA 1MX5A 2H5LA 1TT5A 1J09A 3UMHA 4E6EA 5K20A 1V43A 3CLRC 3I23A 2QZ4A 5K0ZA 4RGYA 2FZCA 1WUYA 1HNNA 3DBLA 4OXXA 3RSSA 1HTTA 2XNKA 3R6TA 4BVGA 2Z5LA 5A6JA 4XPWA 2G9VA 1SU8A 5D3MB 1XG5A 4H6WA 4DCGA 4AKIA 2ODAA 3UT0A 1WDKA 3U4IA 2IXAA 4GQIA 5GJVC 4XOIA 4TUYF 1ZSNA 4QATA 4EIWA 4BAZA 4N54A 2XCTB 1OFUA 3ONNA 1C9KA 3LVBA 1DRWA 1GL3A 1U2DC 4N5MA 3KT0A 4Y67A 3GVIA 4YAFA 4HATA 4PPYA 3WYAA 1I4LD 4R0VA 3QA3E 4P08A 2PJUA 1J97A 1MB4A 3E9MA 1VMAA 4HN9A 1G4HA 3UJ6A 1E9SA 1OBHA 4P3XA 3FOWA 4LXTA 2HIAA 4KQ2A 3GCZA 4QGSA 1CUFA 3SPXA 2IPOA 3AFIA 1LH0A 2ZJ0A 1QIJA 4N8DA 2FN4A 3JQAA 3WO0A 3KYJA 5ALSA 2HL6A 4DPMA 4BASA 2A68F 4XJSA 4PC7A 1YYJA 2WSYB 1E99A 1T1SA 1GZ7A 5BSKA 2FSVC 1KP9A 3PF9A 4DSZA 1XZQA 2EFCB 4IY1A 1LTKA 5JQGA 3AB3A 4R9VA 1QCCA 1QKIA 4I1UA 5EMNA 2DTEA 1MMDA 2W83A 4O6YA 1ZWKA 5JNSA 3ETGA 2OHVA 2D2IA 1Z6GA 5BNIA 3R3JA 2DUUA 4E3ZA 1UANA 4EQZA 5D5PA 5LOVB 3Q3GE 2VSFA 3K9HA 2JAQA 1DO2A 5BWNA 3SICE 3R44A 3QQ5A 1O87A 3KKMA 5CRIA 1PL8A 3TZLA 3M6MD 3IP9A 4OJYA 3E4DA 1MNDA 1SVWA 1E64A 4CF5A 2XZPA 3HACA 3H7IA 1ZR2A 5FUBA 1W36C 3HWSA 4OKNA 2CT8A 4ER5A 2EZ8A 1X74A 5ERXA 2K4MA 2QRNA 3NMJA 3FBWA 4R05A 1DGQA 1D1PA 3A58B 1HKHA 2Y68A 3PDHA 1YJXA 1QGYA 4HC4A 1E3TA 1G5TA 1A2QA 4RFLA 5HZHA 4NMLA 2XCOA 4BB9A 1NM5A 4G8BA 1QV7A 4I4TA 4P53A 1W5AA 3VHXB 3DM9B 4YRLA 2ZJBA 2EAUA 1UOEA 2V8OA 3ZBTA 3B2EA 3T3OA 3WB1A 1XYYA 1TM5E 3KM0A 5AKGA 1YZNA 5CFZA 5LOVF 2WF6A 3PFBA 3SBDA 2ZU6A 4CSAA 3UJ9A 1K7CA 2SKCA 4BXOA 2V7GA 3SK0A 3I01A 1CCWA 4N5HX 3KT3A 4YONB 3FHDA 1VB5A 4KNWA 2ZSKA 4RKRA 2HHCA 5AW2A 2XNDA 2AN5A 3T1VA 3TZEA 2ZUCA 3UUWA 4EUNA 3KQNA 4MP6A 3ZZTA 3EIOA 3KEMA 1K63A 2XQFA 4KWHA 3PMRA 1P9NA 3UMYA 3JVDA 2NV0A 5AK4A 1K6IA 5JJLA 2F4VB 1NRIA 4DJAA 3SVZA 4CQMD 1CPYA 5DLPA 1SVOA 3WLJA 4Q0MA 1Z3CA 4GL2A 4TXNA 3VX3A 3ZTTA 1T8WA 2I2CA 1TECE 4J32B 5JOQA 3M1LA 2XVMA 4Y0VA 3ML1A 5KHLB 3PUYA 4R1QA 4KU4A 2PUHA 2ZJ6A 4HGNA 1KI6A 4XRRA 4FI3F 4FN4A 4BKUA 3DAYA 2PU7A 2VP0A 2HH9A 5FUWA 3ONVA 3GFOA 2V7XA 1CE8B 4B1FA 1A9QA 5EUBA 3R7NA 4G36A 2JZNA 2C0CA 2DPXA 1L5OA 3KQVA 1T9GR 4EVIA 2XSEA 1BCRA 5HR5A 4EG5A 1WVGA 2E4ZA 2HHHB 2OBNA 2Y1FA 2C5EA 3VKHA 1TD9A 4J16A 1X7YA 1MO5A 4MPTA 3PNBA 3DHEA 1BKDR 3ZZNA 1ZNWA 2J33A 2PZKA 2QUHA 5ILGA 2G4CA 5JJCA 5CBPA 2FA9A 1WEKA 2Q5LA 4P92A 5CNKA 2G76A 4C2AA 1ICIA 2UUBB 3KKLA 3ER6A 4AU1A 2AS0A 3RS7A 2BDTA 5H02A 4UE2A 1U1FA 3R5KA 4RVHA 1B23P 3HFSA 3I9V6 1B3RA 3G49A 2IV2X 4DLZA 1I7PA 3DCNA 1QC5B 5D1NA 4WZBB 3RSHA 5IARA 1C4WA 4QLAA 1BVRA 1TIBA 2IX3A 5L4LA 5E6SB 4RPGA 1WV1A 4E2XA 3VPHA 2JLAA 3IUEA 3NHWA 1GVNB 4E14A 3PLAE 2XYPA 5TQ0A 5IWAB 4EVQA 4R98A 3F9CA 4KLRA 1F8YA 3RGGA 1EXNA 2O7VA 1Q21A 4EDFA 1B4DA 4Z9HA 4UAVA 2JLSA 1GN8A 1P60A 1D5CA 2ZE6A 2IOQA 4UUQA 4WCVA 3PJRA 4HMOA 1D7OA 1B14A 4M46A 3D8UA 2A3NA 2R4TA 4DMLA 2O1XA 4NHEA 4EJSB 5J1SB 1MZVA 3A4NA 3ZJ5A 4AXBA 4LF9B 1PEYA 3VR2A 3ILHA 4MV4A 3GJRA 1WZUA 3S90A 4JJ7A 3DDOA 1YHZA 4BFCA 4D26A 1Y8RB 1DBPA 1ADCA 1Z13A 4M9RA 1HEYA 1L7EA 1IUNA 3W2WA 4DA7A 1XHEA 1G8HA 1A2BA 3ZHUA 4LGMA 4PWYA 1C0KA 3MC1A 5A03A 1KVUA 1T9ZA 3ABRB 4N6NA 5BYJA 2TMVP 1VB3A 4EHFA 2EIKC 5DGDA 4FZVA 2XF8A 2H4HA 3KJHA 2UKDA 3RJ5A 3GRAA 3IQIX 2WB4A 3QTBA 1ABFA 1IFXA 4MIYA 4QYXA 4C6RA 1GFSA 4DLRA 5IVKA 1W9MA 4B6IA 3V4VB 2X5JO 3O6VA 2F1JA 1I5NA 1N5JA 4ALJA 3RFFA 2Q7XA 4JBLA 2ZRHA 3EVDA 4ZYXA 3ISJA 3QVGB 3WNQA 3CTPA 1IJBA 1NVVQ 2HRBA 2G17A 2E4WA 1G4WR 3G5TA 3K1AB 1BCSA 3OZSA 4RNCA 1RW4A 5FOTA 4FFBB 1YAJA 3KQQA 4YYEA 5DW3A 1IZ8A 5JI3E 3D8HA 4EUKA 3WIEA 3EXHB 4D0GA 3JRMO 4EEZA 1V7CA 1XTJA 2XCRB 4EGCB 2YBEA 1OFGA 2BE5F 3L8JA 4L27A 4FC6A 1Q0PA 3COSA 3RTAA 2A59A 3ETDA 2B0HA 4E08A 2VP6A 1FAPB 2X86A 1DUVG 4MLZA 4L51A 4CF4A 1IVSA 2AX3A 1V47A 2ETVA 4GXTA 1LRJA 1WWKA 2G6BA 2FDXA 1YAHA 5I3ZA 1PFGA 4MUXA 3CISA 1GGJA 4PGHA 1FNBA 1NZEA 4DCUA 1OZHA 4N3CA 5GTDA 2A6PA 3S68A 5LQUA 2G1JA 1NJGA 4YV0A 4KBLA 2YS6A 2PSFA 1B1CA 4EOGA 4I1OB 5TRTA 3H83A 5BURA 3G82C 1VL0A 3OE1A 2OUKA 5LXTA 1FDTA 2WYVA 2BM0A 1E7SA 2WJAA 4I5IA 4O1IA 5EZ6B 1U8EA 1UPXA 1GLGA 1NUQA 3BXOA 3CMCO 4R3WA 4R16A 4RIGA 3NUQA 3ZZUA 5CX1A 1EUCB 2Q46A 1F7UA 3VYWA 3V8QA 6GPBA 4MDEA 5GPBA 3A6ZA 4LF5B 2OCCC 1PGPA 3V8NA 3HS3A 3VOSA 4GLFA 1KDTA 5FOXA 3DJUB 5DS4A 5LBTA 4QASA 2YL3A 3B8EA 2WMOB 4HFFB 1JDNA 4GX1A 1H8HA 3REOA 4PSKA 5AO9A 2IW1A 2JI8A 3JASB 3IP7A 4K40A 1RNLA 4C5CA 5JQWA 4YCSA 4DR5B 4JI6B 2AHOA 3VPDA 2FPIB 1DUIA 1CUJA 5ALJA 3T7DA 4GI3A 4PZCA 4EY8A 1TEXA 3TRHA 1OBCA 2BMAA 4J6EA 3D64A 2PRJA 2CFOA 4CDAA 2JD2A 1VLHA 3PUHA 3SR0A 2J1LA 4UVIA 1K7EB 1EJ2A 2CLCX 3FNEA 5KNDA 3O94A 1GT91 2PVPA 1CY0A 2K7ZA 1ORWA 4B71A 5FAXA 1VJRA 2GEVA 2P8SA 4TKZA 4ETWA 4RSGA 5JSUA 4HQLA 1BN6A 3U9MA 1KJIA 3OO0A 4O4LB 3ZNQA 3KMIA 4FFPA 5L6MB 5DNDA 5JYCA 3W1EA 4B32A 3IB3A 4O4IB 5EVCA 5F2EA 3QBDA 2CCYA 2O6HA 2X1LA 3GQBA 2WNSA 3SEFA 4ND6A 4JODA 1YCHA 4GWLA 4CUKA 3OMXA 3GLSA 3WL7A 2AHRA 2QD1A 3UHJA 1ECJA 4U1RA 3AP1A 2H4YA 4MVJF 1WG8A 1DQSA 1KO5A 5JXWA 2JHPA 3FSRA 4IOLA 4OHBA 4ALKA 5FBVB 3MX3A 4S3MA 5DGXA 1D8AA 3GR6A 3NEAA 4GPIB 4EATA 3NUGA 2QRPA 3G2NA 4U5XA 4E0HA 1ISPA 1IN7A 1GUZA 2AR0A 1AE1A 1QQTA 4F2PA 1EUZA 2FEKA 3INGA 2ZJAA 1H1DA 4C08A 1RFLA 4GE0A 2QZJA 3CEXA 2X2OA 1Z18A 3CLTD 1SZJG 5KYYB 1YOBA 1M33A 1XQ9A 3R9IA 1JG7A 4UAGA 1GPUA 4Y1RB 1GPDG 1YR8A 4NHOA 4O4IF 4FYPA 3EBLA 3FH0A 4TYWA 1J00A 4LMAA 4W1PA 3ZD7A 1QRTA 3SLGA 4DARA 4IIUA 4D45A 1NJ5A 2J9FA 4DMFA 1E0DA 4BLRA 4DLAA 3U7QB 4Z9YA 4ZVPA 2YV5A 2QG4A 3WGGA 3NDJA 1I2ZA 5E0OA 1MB0A 3RC8A 5FL7D 1NOIA 2C9ZA 2N47A 3R3YA 3BRCA 1M7BA 1E5TA 3UOAB 2B1QA 4Z7OB 3DI5A 2P9FA 4JC0A 1QZTA 1RBYA 5EFOA 1E3IA 1VYVA 2FMFA 4P4LA 2GZ3A 2GTPA 5B57C 4A8JB 2XDQB 3WGUA 3NHKA 1YB2A 1O08A 5JYBA 4B84A 2OFPA 2WLSA 5AM1A 3ENVA 1CETA 1Y6QA 1GIAA 2EP8A 4Q1AA 4WKGA 4BTVA 1MG5A 2W2LD 4XQEA 3OPQA 5C8ZA 2RBKA 3BERA 4RF4A 1Y3IA 2JFFA 2GEJA 5K3FB 1X39A 2X7XA 3MUOA 2CV0A 3DLIA 4MTCA 1BDBA 2OECA 1KH1A 1XE3A 1XALA 3WRYC 3D59A 1NZDA 5TR9A 3QJGA 1GZSA 4DV6B 2HSBA 3ZN2A 1Y82A 1E7RA 4ZJYA 5BWOA 3UJ8A 3ECAA 3CZQA 3R7AA 4HVLA 1C9MA 4NR0A 4LW8A 1RQLA 3R6WA 3AG4C 3D8SA 5B1HA 3FPBA 5JE8A 2C5GA 2VHWA 1BAPA 5BOSA 3FCCA 1YUMA 1DNPA 5K4GA 4OKIA 1QIHA 4HFNA 4GYWA 4ZXFA 3T7EA 1FDVA 4O25A 4TZ0A 1I6KA 2XB6A 3VR5H 3IMCA 2PGIA 4PYLA 4CJXA 1XEAA 4ZVUA 2Y69C 1M34E 3EFBA 5JDIA 3K70B 3OLYA 2P40A 3ZLBA 4M98A 1DXOA 3PXXA 1OV6A 1W0JD 3W7VA 2GBLC 3W6ZA 4RUKA 1UK8A 4CKEB 3DB1A 4BQOA 5EP4A 3CNOA 4JYMA 2F9LA 3PIDA 1E66A 1GR1A 1SPBS 2D74A 3I9V1 1QHIA 5CH8A 3WK7A 5B5SA 3FYHA 3LJBA 4U8GA 1ZD4A 4LVCA 1P2SA 3M5DA 1ECCA 3ZV4A 3QFHA 4ISCA 5LLDA 1P7YA 5L7WA 3H0KA 4IDBA 4XWOA 1X38A 5COGA 1FSZA 1QQAA 3LNRA 3IIIA 4GRIA 2AW5A 4JLSA 4CM8A 2CNWD 1TJ5A 1UXKA 4GMGA 1OLUA 4GWKA 4JBIA 2J4DA 2PD6A 4U02A 4U7WA 2GH1A 2WVNA 3VVLA 2Q4DA 4H7JA 3MTQA 2VCYA 3QBVA 4IAOA 4PGFA 4RHCA 3LHDA 1H0SA 3HBFA 4DA6A 2FQWA 3QKUA 1ZW6A 3ZV3A 1B43A 1FTSA 1T3HA 4YREA 1Y1TA 1CQWA 1A8PA 5KX5A 2QRVB 1CFZA 3JQ9C 4MHTA 4E2YA 4E11A 5KAPA 3F4LA 1K6EA 3AJRA 1SVIA 1TQ4A 4C1NA 2BFNA 1ISSA 3DE6X 3LAYA 4CG0A 3PIIA 2ZDHA 5EGNA 1KP2A 2R7NA 1OW3B 4EY5A 5JAIA 1OC2A 1NRWA 3CWQA 3K4QA 3FVTA 4A7PA 3BCHA 3TOZA 1VJ0A 4IIHA 2ZM5A 2IW3A 1RHQA 5G0VA 2V1XA 2JRCA 1YMVA 2AXPA 3FBTA 2F00A 3I1JA 1TM1E 2JA2A 2ODPA 1ZM9A 3EZYA 4C5AA 3ZHZA 1WS6A 5DGTA 4EY6A 1R5OA 3V5ZA 1Z7BA 1H6BA 4DT1A 3RHZA 5AVYA 2FFJA 3HEBA 1EXDA 3ABOB 3ZYCA 2IFTA 4HNUA 1DTEA 1VGVA 3IVAA 5EFZA 5CH3A 1NTRA 4JOSA 2R6ZA 2CJWA 1L7MA 3CUVA 1T01A 5L7YA 4P93A 2Z4SA 1RWNA 4LYGA 4BDSA 4ZZ2A 2OCDA 1E2LA 5JY1A 4GPAA 2APJA 4KH1A 3Q0TA 3R8FA 1OR3A 3E8MA 3VC7A 3P9YA 2HRRA 3QQPA 2D5IA 2GHTA 2YIDA 2CSXA 1PR1A 2EGGA 2X15A 2OGTA 2AV6A 1F3OA 3RW0A 5SZJA 1PS8A 2JFQA 5KYNA 3D54D 3LK7A 3PDJA 4WPGA 3DB2A 1UPCA 2YXNA 1F60A 2GM5A 2C7OA 3FUUA 5D5QA 5DK4A 4GZLA 4U5EE 1SK8A 1I01A 1TM3E 5M29A 5AW6A 2L7AA 5AUPB 1TM2A 3NHMA 1V9SA 2IIPA 1CY7A 3TD7A 4YRAA 1V16A 1Z73A 1BD4A 1D9XA 1XTQA 2AQIA 1Y1QA 5K0CA 3A1FA 5GP1A 1L7QA 4B3SB 5CEFA 4M0MA 1P1KA 5FLYA 2B5WA 3AY3A 3IBTA 3H17A 2IF2A 2M1ZA 2OV8A 5EJ4A 3O1HB 4N0EA 1H3EA 2XSZA 3ZK9A 3DR5A 1ZPDA 3TLMA 2QIOA 3OJWA 3UTDA 2C3PA 2OCXA 1Z7WA 1TMGE 2ID4A 5K3EA 3SLKA 1S2NA 1KO4A 1NVAA 2PZGA 3KT8A 2ERYA 3HO1A 3A9VA 3NHAA 1A2OA 4LFCB 3B0UX 4UFNA 2ENWA 1PR9A 4D3XA 3A1DA 2WKQA 2IWRA 5DHSA 1SK9A 3WOVA 1N78A 4R7GA 2WJYA 4I50B 1VC2A 5KKCA 3ZDFA 3AKCA 3HXTA 3BFKA 1KEZA 4PZYA 1NRJB 1NMSA 1N6OA 1FP4B 3BREA 1USKA 1L7PA 1VKJA 3HI4A 1KI7A 3TQSA 1NBWB 3FR7A 4LF6B 4BNHA 3T1QA 3VO8A 3Q2OA 1K40A 5KMGA 5AVXA 2W6ID 1T0UA 5GZ1A 1QX3A 3TMKA 5FA8A 3ZW8A 5IWCA 4OAQA 3UKJA 1F2TA 4NNJA 4L0MA 2JHGA 4FFMA 5JRZA 1H94A 2G72A 3L0IA 4NFYA 4BQQA 3KR0A 3OF3A 4S05A 4DY6A 1N3IA 4LVUA 2GN4A 2J6HA 3KB8A 3DGFC 3V4SA 4J0CA 4ZOLA 1UMDA 4QUHA 3S81A 4XUEA 4QRHA 1ZJWA 1UBNA 3VZBA 1A4RA 3IEKA 4CMGA 1YZ3A 4XIFA 3FDZA 1YQGA 3HG7A 1GN9A 4BP3A 4QXOA 3IQZA 2CDBA 1UK7A 2ACWA 4Q3LA 3OEED 4KCGA 2QNLA 3ZE2B 5AHXA 3M3DA 3AEXA 2WFMA 1BNCA 3GH3A 3VSAA 4NC3A 2AN9A 3WK9A 5DM0A 1R4NA 3OJFA 1A8SA 1SFRA 2YN0A 4YJHA 3NRCA 3ZWQA 1H42A 2LXNA 1IN6A 1ZY2A 3BJEA 5FHQA 1OFUX 3MWJA 1Z56C 2CEKA 2W9XA 1YS4A 4WNIA 1RZRA 1XOIA 4P36A 4J0IA 4H7IA 4PYOA 3CKKA 1JS1X 4XQ9A 3D5QA 2VYVA 1MX1A 1UDXA 3JARA 1JA0A 1M34A 1RAAA 2AOVA 1KIAA 4R69A 5KYTA 3ZDAA 1S7GA 2A0FA 3BQ9A 4RL4A 1QKKA 3CLTC 2BFDA 3GN2A 3MRVA 1IQPA 3OPYA 4QYSA 4UAUA 2OVBA 2FLKA 3TVDA 1O89A 2NZYA 5AR1A 2QTGA 5LU9A 4ONEA 3RH3A 3HJRA 5I6DA 3FOCA 3R7DA 2F4NA 1M2JA 2CN1A 4B76A 1VMKA 4XCXA 3NIBA 4LNUA 3WNZA 2FSGA 1ZM4A 3L0SA 3G13A 4DMRA 3VKVA 3BK2A 1TFUA 1TEVA 1ADBA 3EVFA 4W8OA 2XH8A 2BBOA 2ZZNA 4MRMA 1E9FA 1HQCA 4LC9A 5IY5C 4FGSA 1YRLA 1WSWA 1QK4A 3A7DA 1U0GA 1VE1A 2MYUA 4O0MA 1I3CA 3KP1A 4EZEA 1E2IA 2ZR7A 4EHPA 3KALA 1Q6YA 3VMMA 2F6RA 4OK5A 5DCLA 3CLRD 3OX4A 3EBPA 1HI9A 2OENG 5IJXA 2YOFA 4XQ0A 4S35A 3KV3O 1GNQA 5FBLB 2AOXA 3ZHBA 3SQDA 1DDOA 3WYNA 3GLQA 1YZVA 2MSKA 3LPNA 2OC9A 3TTTA 3HKDB 2YIMA 3E18A 2BSAA 1XMOB 4I55B 1RJEA 2OR3A 2X7JA 5K8VA 2DAPA 3EY4A 2FEXA 2FW7A 4BC1A 3C62A 1UMCA 3H9QA 3GCXA 4AP5A 3IR5A 1TUBA 3E22A 5B12A 2BVNA 2PMWB 5HBGA 1IH8A 1ZMBA 5D85A 3STVA 4B31A 3CHYA 4DR1B 4ZA2A 1CP3A 5L3QA 1G4UR 1PLJA 3OUZA 2HO5A 1Q1NA 3GRVA 3GV0A 1DEKA 4Q7EA 3O83A 1OXVA 1YFZA 2R8OA 4C0WA 3UC5A 1XCBA 1MQAA 1PNTA 3USES 2C00A 4AJKA 2EKLA 4MINA 1MJFA 3WV4A 5ELLA 1K06A 4BNNA 2POCA 4KC0A 1IU9A 2PSSA 1W4CA 4DABA 1TAHA 3NIFB 5JD6A 3O8BA 1TD1A 4JC8A 4WFKA 4Q7QA 2PZEA 4A0SA 2W37A 3H5OA 5K8CA 4D3SA 3JD2A 4RX1A 2C2HA 5E95A 2Q62A 3U80A 2ZTSA 4Q5IA 1A9PA 1QVAA 4I55F 1ZI6A 2PDAA 3TK1A 3PUKA 1DLIA 3LYLA 3R3XA 3PLRA 3I09A 3UB3A 1K4MA 3A4MA 4OBWA 4Q3EA 3OEYA 2YQYA 2RHRA 1KXJA 2VIIA 3QYFA 5BRJA 3N05A 5JHHB 2QAGC 1HSZA 3UWDA 5A9RA 1KEKA 2NVUB 4K0KB 4LQDA 3DKAA 3P9CA 4CMJA 5FUQA 3QG5A 3AVQA 4ZZ0A 1U0LA 4JKOA 1W36D 4DM4A 4Q48A 3VZCA 4ZOCA 1QHEA 3HNKA 1BROA 3IAHA 1WU8A 4BGVA 3W2IA 4C2BA 3SBXA 4OGLA 2BMWA 1J90A 1A9SA 3LLCA 1Z2CA 5HCNA 4FEYA 4GM0A 2C1EA 1MAUA 3K6JA 4GVPA 2B8EA 1ZCAA 3HRHA 1M8GA 2YWXA 4ZKDA 1EESA 3E1KA 3JWJA 4QICA 4PO8A 1LK0A 5TE9A 1ZX1A 4PFKA 3SMVA 4M1YA 1SQFA 1EX9A 1GSIA 4MR8A 4LTNA 4D3DA 1S1CA 4WUTA 3SBOA 3RIHA 2AG0A 2QQGA 4RE5A 2D1FA 4QL3A 4MR7B 2YW9A 3R0JA 3HBJA 3L7LA 1E8MA 3EISA 2NNWB 2H5IA 3TEMA 4X7BA 2YOHA 2ZYHA 3M83A 4EHAA 1UODA 2XM4A 3FTEA 3Q11A 1TUGA 4MROA 5ALHA 2Q6OA 3P8ZA 3EZ6A 4XWAA 1PNOA 3AHFA 1RAFA 4DEXA 4FQ8A 4CCYB 5HA5A 1N2CE 4OQFA 4PAWA 2Y39A 3MTIA 3T9OA 4IFTA 2GM9A 2DUJA 5JSZA 3H1TA 1QYIA 1VYIA 5JPCA 2I99A 3G1WA 4GR5A 2X51A 3H2HA 4DQDA 4PX5A 4AQDA 4H27A 2QA5A 2WHRA 3V4ZA 3L4JA 1WMSA 3GM2A 4HB3A 3OQOA 3H5RA 3D3WB 3U37A 4WCFC 2WYHA 1FU4A 4JB2A 3K0CC 5IKOA 1RJGA 2O2SA 5I4BA 1SCQA 3B0VC 2QUKA 1UZMA 2HDHA 2FW9A 2OG2A 1T8TA 3KXLA 3OM1A 1P1IA 1YBFA 2Z2KA 1V5WA 2ZYVX 1ZP6A 1KTVA 2YVQA 5TV2A 4C6TB 4QDTA 1MC8A 4UBNA 5IDXA 4WECA 1Q17A 3EGWA 5BWCA 5JMPA 1FDIA 4YLEA 4CS8C 4PN3A 3ZK7A 3EVCA 4MYTA 2BL4A 4EZBA 4L73A 2R6DA 1Y7PA 2H4ZA 4AKSA 3KXKA 4HN4B 1Z4JA 5DWQA 4RHTA 1EXWA 2AIRA 2AVDA 5EXPA 5GZ3A 1V54C 4BN4A 3I2HA 2PUFA 3SVTA 1DVRA 4YAEA 3C6ZA 4R84A 2J6BA 2YJ6A 2X0NA 3ZI0A 2F90A 4M2LA 2LCIA 2UVDA 5FQNA 4OOEA 3SHTA 3CLHA 1Q14A 3FNQA 1EE2A 4PLTA 3ZHXA 4OHVA 1AUEA 3CZPA 4RGVA 4JLDA 4M9UA 3ENKA 3I73A 4N6OA 1PQWA 2CFIA 2WPDA 2CDRA 3FCSB 1NUHA 2YDXA 2NTVA 3NDPA 3SQOA 4U2DA 2PA0A 5K0LA 2OHOA 1OA1A 4KVZA 4QYTA 1D07A 1Y63A 1QH0A 3ZDYB 1CF2O 5FFFA 3A9TA 2CL6X 1VSTA 2PX0A 2PLNA 3A9SA 2VRCA 4H18A 2NNLD 3HA5A 4AQ7A 3KZVA 1RHMA 4NYMR 3PDIB 1OZ0A 2TSYB 3QBTA 4REQB 4WBSA 1R8YA 1DCTA 1J49A 3BRQA 2PMFA 2MIIA 3F2VA 1SUWA 1IZ7A 1T3LA 4PLZA 4WJLA 5TGDA 3MAAC 5HHTA 4UM8B 4JSRA 3SSOA 1CY6A 3QEMB 3JTLO 1UUFA 5G4KB 4FZRA 2P2GA 2IHNA 3OY2A 4ZYTA 1NXWA 5A0FA 3ED5A 3KU4A 4L78A 1OI4A 3H5VA 3T34A 4II2A 4EBJA 2I2FA 3NH6A 1N3BA 1NW9B 2R68A 1G20E 1GARA 1FVXA 3MFNA 2B5VA 5DWDA 3CVYA 2QROA 3I2GA 2QR3A 1NAIA 1E1CA 4MKIA 2FPPB 2O8NA 2Y71A 3EG9B 2F1RA 1JDTA 2C5FA 2OBBA 4L7VA 1BH6A 2A92A 4CV2A 1GCUA 1NI4B 4RQAA 2Y1GA 4IIBA 1RI1A 5LQSA 1Y1SA 4ENPA 4LHZA 2KGOA 1A4IA 2C8JA 3FPAA 2YRXA 4YJFB 1NU9C 3AG6A 5TMDA 1R6UA 3OZBA 5I9SA 2JCBA 4JEIA 3GDFA 4NV1A 2JIZD 1OCCC 1M5TA 2QTBA 3QRWA 4W5RA 3TUZC 3HNPA 2G40A 2OD7A 4PPGA 5THXA 2OAQ1 5A5DA 2HMSA 2CY0A 1GUAA 2A58A 2F55A 2W5UA 4K8OA 1X77A 4ZYLA 4JP8A 5KCZA 3QXSA 4TTTS 1F6BA 3E70C 1JEQB 5DMXA 4UNSA 5GM1A 1I30A 3OKAA 4LK3A 1U3UA 2VAWA 5FCLA 3IVXA 2C03A 1JR8A 1W7AA 4N5DA 2PIDA 4EF4A 1JMVA 2XLCA 4P3KA 3EUAA 4MV9A 1WXWA 2X3FA 3OM8A 5DP1A 2NYAA 3TGLA 1Z5WA 1XDZA 3P0JA 4P4UA 4CS9C 3GNTA 3O3NB 3UB2A 5CLLA 2AQ8A 3VMFA 4LBYA 5EQDA 4B45A 4BU1A 1T4BA 2LFDA 1T2EA 2HTEA 1JVNA 2C3MA 1S2IA 2B34A 1X3LA 3V5XA 4D4NA 4R1SA 4BNDA 2NO4A 4QREA 2HRCA 1PZHA 1DTWB 4YRCA 2D3WA 1MQ8B 3SQNA 4G0XA 3U13A 3C0KA 3U9TA 1W2GA 1X15A 2GAOA 4F8EA 5G0WA 3IQ6A 2GTHA 1TQDA 4C76A 2B61A 5LZ2A 4NBKA 2VPQA 1TKAA 4QYIA 3JRTA 3RSQA 3NHJA 4LQLA 1C2YA 1CR2A 1O94A 2PXCA 3DBOB 3KDAA 3A3PA 2GF2A 4EM6A 5G2OA 1JV2B 1JEJA 1SKYE 3FWZA 3UH0A 1T43A 4CKCA 2Z5VA 2BAGA 5I7EA 5B1BC 4GL4A 3UBTA 4WGYA 3WFIA 3CH6A 2HUNA 4D4XA 2D7DA 3VZQA 1O6GA 3PC3A 3T1YB 2FCAA 1J8FA 2JIBA 2Q6KA 5M04A 4X20A 5IX8A 3VKUA 3W8RA 1F20A 3IIJA 4C4TA 1ZVZA 4MNDA 4IZOA 3LC2O 4PC3A 4WLNA 1XNQB 4BKOA 3G5UA 1QUEA 3W3AH 2BEWB 5G40A 2ZRBA 2FKNA 2JIRA 1GXSA 2VJBA 3KB2A 2D0DA 3TFOA 1N2CA 2DBZA 5IZCA 3UK1A 2ZRQA 3LUGA 4HLUA 2HRDA 2PT7A 5C8YA 2JKYA 2V6FA 4G5OA 2CXXA 3D02A 1TL7C 4KXVA 3N2NA 4U5GA 2H57A 2KWIA 1M6TA 1DPGA 2DM6A 1CEEA 1FVFA 3UV6A 4R01A 4MQEA 4HTFA 4JR0A 3H9CA 1C5KA 3VBCA 1WZIA 1Z4PX 4ARSA 4WESA 1EM6A 2P9EA 1PR3A 4JEUA 2O05A 2Y92A 2A6EF 2HYIC 3VR5D 2WSLA 1KQFA 5HM8A 1IJKA 1R27A 2X0IA 4H17A 4G0OA 3MWLA 1O54A 5KNBH 2DEUA 2RHOA 3O84A 1LY1A 3MIIA 3C85A 1U0SY 3MAGA 3GBPA 1L5RA 1CYEA 1ZH2A 2CMDA 4H35A 4DMUB 3P71T 4EKDA 1KBQA 2XOEA 4W1QA 2LRHA 3N86A 2FKAA 5BQ5A 3B6JA 3MJCA 2EVWX 4W8HA 2OLEA 4KAXA 3R24A 4C4XA 4J7CA 1NKVA 3MSXA 1PEKE 3COVA 3MWYW 2XWPA 2GZRA 1ICEA 3E05A 4TVBA 1AJEA 3HR8A 3TSYA 1NNUA 3GDOA 1V55C 3EN0A 3I2KA 4AWXA 2MT9A 3G0OA 3VNRA 3NDIA 5FNVA 5KWSA 5FNZA 5NULA 4D8UA 1VPEA 3L79A 1XRNA 2FJPA 1YRAA 3F71A 3O4IA 4EG8A 1MEEA 2NU9B 1E63A 1C3OA 3IBSA 3VJLA 1DKQA 1TA4A 1DZIA 3OLCX 2PH5A 3VU0A 4DAOA 2EQBA 3PICA 4FILA 3H7AA 5LC1A 1GPAA 4JR2A 4JSTA 4O3FA 4RD4A 1UK9A 2KPOA 4DE5A 1NNSA 1KAGA 1QK5A 1XNHA 2VYND 1X8XA 4K9QA 2RSEB 2NSDA 2P6UA 3K20A 3HLZA 4RK0A 4U5CE 4DF3A 1VJDA 5JD4A 5EINA 4DQUA 1I9GA 3MINA 1ECPA 4TVSA 4YJWA 1R50A 4OSEA 5K3DA 3BJMA 2FMHA 3T4EA 2OBFA 4M0EA 2VJKA 2D6FA 4D79A 4DBLE 2ZI3A 3WL4A 4IFIA 1GG8A 3AF0A 2JGKA 4RHYA 3ICWA 2HZBA 1U3TA 1YIDA 3JCUQ 3TZBA 3NHUA 4ZDKA 3EPJA 4KO4S 1YJ8A 4QBHA 3G02A 1G20A 1XZBA 4WNAB 3WYFA 2X41A 1DKNA 1RLMA 3GJSA 4YHHB 5KOJA 4FESA 3NATA 4WKCA 4DWVA 1G8GA 4IJVA 2N9UA 4Z49A 4CFZA 3M81A 3U3ZA 3UFXA 1Y34E 3FYTA 5U4XA 3OPMA 4NI5A 4ZVLA 1C3JA 5BN5A 1LX6A 3AETB 2WMNB 2W00A 1KEUA 2BFWA 1JEOA 3B9QA 3QV1A 5EIXA 1NVWQ 4RO0A 5JADA 3KNZA 4LWQA 2HKVA 3FKSA 5CLHA 2IV7A 3WE7A 3O8DA 3ZQUA 7GPBA 2LGJA 2PSEA 2FSIA 1E6EA 4PTLA 1Y5MA 1JLMA 3H1EA 4KX5A 1O6FA 3TSAA 1TRHA 5IC4A 1T9BA 1JFLA 2ZT5A 2Q6LA 2XNJA 4DY4A 1IOZA 3R3SA 1Z4QA 4X7PA 3CZ5A 2II6A 4I99A 2F3TA 3F4BA 1ZJ6A 1U9ZA 3U4DA 2B7LA 3B3JA 1EWKA 4D3ZA 5C4MA 4Y6GB 4EELA 1X7ZB 1QYWA 4QFBA 3PZRA 2G63A 5LLTA 1XP8A 3PSAA 3T5DA 2H9YA 1DIRA 3OPVA 5ITZB 3OZAA 2G1UA 2CFSA 4BP8A 5AUQA 1Y7LA 4LZPA 4LDQA 3K0AB 4RCZA 5CPFA 1RPZA 2QG9A 3H1PA 4JZYA 1KYXA 1CS0B 3O4GA 1NIJA 4FS8A 5KDLA 2FZEA 3L43A 3GT3A 2GRUA 3E2PA 4MDFA 4PIMA 5T67A 4ZJPA 2AXNA 3B70A 2BR5A 2WUDA 2WFLB 2QW8A 3GOHA 1M2VA 1H8EA 5AHOA 2WV7A 1G0OA 4AROA 1SWWA 5F76A 2H8AA 3I8SA 2JFWA 2HLDD 1POXA 1RBMA 1Q83A 2XWJI 2CNLA 4Y8VA 3UWSA 4P9TA 2PZBA 2A35A 3IBGA 3IURA 5KSPA 4YR9A 5CW1A 4L74A 5JMTA 1FYXA 1LA2A 3K33A 2L17A 2FHPA 2XI4A 3DOUA 5HF6A 3ADPA 4Q01A 3C3CA 4MVJG 2XXAB 4MI1A 4YT2A 1WQ4A 4W5NA 3WG7C 3DT9A 1AN0A 2ZR9A 3HJFA 4JOCA 2OHXA 4FEGA 3TQQA 1T8YA 5EP1A 3CXUA 4FNMA 1KTMA 1YZUA 3N7TA 1NBHA 4L8GA 3WNBA 1T9AA 3VDQA 4MV3A 5HJ2A 4U2EA 4DIKA 1JQLB 2OY0A 4GP9A 2RHJA 3DYIA 5I7RA 3SCZA 3HB9A 3U44B 2WAAA 2R1ZA 3EQZA 1UT5A 4US2R 4BP1A 3MM4A 3M6AA 4MRRA 1DXYA 3W78A 3DUFA 3GYBA 4FR5A 4B83A 4YH1A 3Q3CA 3E3LA 4CTNA 2CW0F 1VP9A 4XQ1A 3M70A 4F38A 3VUFA 2CVPA 2VWHA 4X5OA 3RVZA 3WLSA 1T35A 3L8FA 1KRHA 2ESRA 5LQCA 1AKYA 4COKA 1R0WA 2UUPA 1QS0A 3EDMA 3V7YA 4DNXA 2GD6A 4HYTA 1GPWB 1F14A 3LT1A 1JLLB 2DH6A 4CM6A 4TXMA 1M2GA 5HK9A 1V7ZA 3FNGA 4UPVA 2YV2A 3PDCA 3VDNB 4CZ2A 3PQ8A 4QVKA