4YT4A

Iron guanylylpyridinol (fegp) cofactor-reconstituted hmdii from methanocaldococcus jannaschii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
345
structure length
345
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEHAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 131
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt4A01
2IXAA 3IC5A 4S1VA 1R6DA 3RFVA 4CLOA 5TJHA 4DGSA 4BQRA 1L7EA 5H83A 3ADPA 3X2EA 4N5LA 2QX7A 4WLFA 1AE1A 3RC1A 5HS4A 2C07A 3L6DA 1UXGA 3AI1A 2I9PA 4PLYA 2VHWA 1J0XO 3C1OA 2ZJ0A 1EQUA 1MGOA 4R5MA 3ADOA 3CEAA 5JDCC 1UP7A 4FGSA 6ADHA 4FFPA 1BHSA 1H6AA 5L7WA 3PJDA 4PCVA 3LDHA 2B36A 4LSMA 5JC8A 4Q9NA 2GDZA 1B16A 1MA0A 3FR8A 5B12A 2G5CA 3HB4X 5L3ZA 4WCFC 5I8WA 3IS3A 3KTDA 1P77A 3GUCA 1KS9A 4BNHA 1NPYA 2UV8A 3AOEA 4K28A 2Q1WA 1I24A 3DTTA 5B4TA 4W7HA 2NVBA 1HXHA 4XX0A 2QHXA 1Y8RA 4RVDA 3LF2A 1A4IA 1LDNA 4FOSA 3IMFA 4NHEA 1NQOA 2NVWA 4AJHA 2VN8A 3X2FA 3ROKA 2GN4A 1XR3A 5KJFA 4XEHA 2Z95A 1EEHA 2IYOA 1G1AA 4UUOA 3NJ4A 2D2IA 1HDCA 3JD1A 3SXPA 1X14A 4D44A 3WG9A 1UAGA 4BO4A 2VTDA 3LC7O 3MTGA 1VJ1A 2C5AA 1TVEA 4F6LA 3FNHA 2C5EA 1WP4A 3BHIA 3PI7A 4E6PA 3GDOA 1F06A 3F4BA 4CLRA 1BGVA 3HE3A 3KLPX 4ZRNA 2X23A 1MLDA 2B4QA 3MJSA 5JE8A 4B7UA 1R37A 2WM3A 3RROA 5CDTA 1DFGA 1DEHA 4RDHA 4KOAA 2FR0A 2YHIB 1NX6A 2NV6A 4L4SA 3H9GA 4ALLA 1HETA 4GAEA 4KTTE 3IIEA 4IJUA 4CJXA 3DOJA 3ETDA 3Q1LA 3HZZA 4B4UA 5BSFA 5JC1A 4A27A 1O94A 1SB8A 3DEYX 3VPXA 3S2EA 1NP3A 3OJ0A 1N2SA 5K0ZA 4FIZA 1CEQA 1YWGO 2X5KO 5KVVA 2ZTMA 4GVXA 2GERA 1XLTA 3PWZA 5U9CA 2FPIA 1CYDA 3TL2A 1CDOA 1DBVO 1ZK3A 2DU8A 3OP4A 4DA9A 2VZ0A 1R16A 3NRCA 3GG9A 2W2KA 1NR1A 1IZ9A 2EKLA 3PHHA 4ND4A 3R0IA 1R66A 1LU9A 2FR8A 5CPFA 4KDEA 1BWSA 4HWKA 3UVEA 3VDQA 4YA6A 4YBZA 3IP1A 5A05A 3HJAA 3WSVA 1KVTA 4PIVA 3JQ9A 1S7CA 1WXDA 1EQ2A 2B4RO 4O1MA 1TT7A 5L9AA 2JHGA 3WGIA 2VYND 1Z7EA 4ZA2A 1PQWA 3I9OA 4OIMA 3BMNB 4CM8A 2O2YA 3S2FA 4YDRA 2QYTA 1I2ZA 5FEUA 3IQDB 5L51A 4M54A 2CY0A 2F00A 3AOGA 1ZKMA 1H93A 4MP3A 3NDIA 3W8EA 1LRJA 2VRCD 4HXYA 5JLAA 1DRUA 3DB2A 4YVFA 5CEEA 4BO3A 4R1NA 3WYCA 3RBXA 3OEYA 3QLJA 1GEEA 2FRDA 4TRNA 1BSVA 4L8VA 4O5OA 4DQXA 1WZEA 3PDJA 1LA2A 1T4DA 1D8AA 2YYYA 3ZGYA 1ZEJA 4BNXA 4EITA 1GFSA 2Y0EA 5F21A 1C0KA 5G4KA 3DO5A 1K6IA 3U5TA 2CUKA 4DPMA 1X15A 4QTZA 3O26A 1C0LA 4D79A 1RWBA 1SOVA 3MOIA 4LRTB 3BMOB 2EIHA 1K5HA 3O03A 5JY6A 3JTMA 4NBWA 4J43A 5HBRA 1U5CA 1LSJA 3B70A 1KIFA 1NVMB 2D3TA 4YTEA 1YONA 5EERA 4BO9A 5CDGA 1PL8A 3ZN2A 2Y1EA 4J6FA 4AG3A 3OM9A 3PXXA 1LSSA 3P5SA 2EWMA 4E5NA 2PZLA 4FCCA 3UN1A 5K6AA 4ZJUA 3Q3CA 3RUDA 3RU7A 4TROA 1GUZA 3RCBA 1B8VA 3AUAA 3GHHA 1GTMA 3W8DA 3DAGA 3OQ6A 1HTBA 5HA5A 3AI3A 1C1XA 1UH5A 3FSRA 1DC6A 1ZNQO 3MJEA 4MVJG 4MKXA 5LC1A 4GVLA 4MVJM 4XZ3A 1YKFA 4AJPA 3ZV5A 2I67A 3C1TA 4URFA 1CWUA 5I7VA 3GH3A 1B0AA 4X54A 1PS9A 4BGIA 4RVFA 5JO0A 1CJCA 4IZIA 3STHA 1QYDA 3U4CA 2H63A 2NU7A 5A4DA 4LGVA 5HM8A 1UDBA 1KC3A 3T7CA 4ALJA 4B3HA 3DBVO 1BXKA 1E3WA 1KC1A 3JCZA 4Y6PA 3H9QA 3PQFA 4C7JA 3KSUA 3PDUA 4D43A 1EK5A 2ZYGA 5A03A 2VRBA 2R00A 1ZMTA 4OMUA 1DIBA 3CPSA 3F5SA 1PJLA 4N54A 4CQMD 5T8KC 2RHRA 4UEJA 4XWYA 4XGIA 5B37A 2W90A 1E1MA 3BTOA 1X13A 5L7YA 4A5OA 2DBQA 3C7DB 3ITDA 4K26A 4CM1A 2DTXA 2H6EA 2X58A 1NPTO 4CLEA 5A9SA 2RAFA 4J16A 4B4WA 9LDBA 1HSOA 1NR7A 2EKQA 1YBAA 5EIOA 4CV0A 4U5QA 2ZCVA 3BYZA 4BMNA 2DM6A 1X7HA 3F1LA 1P1JA 4WGGA 3TQHA 5I9NA 1MX3A 5G0SA 3TZKA 3HDHA 1DRWA 3DR3A 2Q1TA 5DULA 4CLDA 4CODB 1PZGA 3DBLB 3LC1O 3ZWYA 3LLSA 1BVRA 1EVJA 3DMTC 4BGVA 3E1KA 3FD8A 3KSZO 2GRAA 2VWGA 3O4RA 3HNPA 3QP9A 1H6BA 2Q2WA 3KVOA 2ZJ1A 5L40A 5A9RA 2V6FA 4XB1A 2UAGA 1ZZEA 5G0UA 4YWJA 4IZHA 3ROPA 1TEHA 4WE3A 3WQSB 3TZHA 4Q3AA 1LLUA 3ANLA 1LEHA 1N7GA 4J9UE 4O6VA 7MDHA 2YW9A 5TIIA 3I4FA 5TQVA 3C3XA 3JQ6A 5BSEA 3WR5A 3ZNPA 2CDBA 3GZNB 2ZATA 3MJTA 4E5MA 5CHEA 1GZ4A 1X0XA 1UXHA 2VHZA 3I3OA 5AXDA 3QVOA 1DFHA 3QQPA 3MJVA 4DUPA 1JTVA 3D3WA 2O50A 3WWZA 4OQZA 1DSSG 3AM4A 1SB9A 3E03A 3DHEA 1JKIA 1M75A 3EY4A 4H7PA 3M2PA 1W4ZA 5EQDA 4NPCA 4N18A 1FDVA 2PV7A 4IQGA 3T4EA 1NM5A 1T2AA 5KJ6A 1YDWA 4BNUA 2YV1A 4CM6A 5B1YA 1V9LA 4J2OA 5F1OA 3DXFA 2H5LA 5JCXA 2PH3A 2H9IA 2J3JA 3DBRB 4A03A 2Y0DA 3EC7A 4R41A 4WKGA 1RM3A 3RKRA 1Y8QB 2O3RA 2P91A 2XAAA 4Z9YA 3CXRA 4JJIA 3IUPA 4W4TA 3F3SA 4DYVA 1K6XA 2BKAA 3QWHA 5KVSA 4PLHA 1DPGA 1B14A 1T25A 4IS3A 2DBRA 3O9ZA 4DIOA 4IMRA 3WNQA 3DOOA 3WGOA 3ZNOA 3TF5A 1ZBQA 1VM6A 2AQIA 3LVFO 1QG6A 2CDAA 4R9RA 1DIGA 4A10A 4DQVA 1AGNA 2P4HX 4JJFA 1ZCJA 1V6AA 1YJ8A 2VHYA 3VPSA 1G0NA 5DT9A 1FMCA 4E3ZA 2GN6A 4WLNA 3RUCA 3W6ZA 4CMBA 1WDLA 2AXQA 2VUUA 2BD0A 3H4VA 1O0SA 4ROSA 2O3SA 4J2HA 2I76A 4FBGA 5ICSA 2ZB8A 1A27A 4OKNA 3CTMA 4RQTA 1VJ0A 3L0DA 3OHSX 3GC6A 3JQFC 3GRPA 5G4LA 2FZWA 2I66A 4BO0A 2ZKLA 4XDZA 2QYSA 4BO2A 3C7AA 1SMKA 2FP4A 4UVDA 2DC1A 4CMGA 2Y67A 3DBHA 5JYEA 4XB2A 3A1NA 2GO1A 1B15A 1DAOA 4HFMA 1I32A 2OGUA 3FCOA 4D3FA 1VSVA 3KBOA 2GGSA 2AQHA 1EUCA 5JO9A 4D0SA 4YAKA 3OA0A 4BUCA 5IXSA 3U49A 2AE1A 4PVDA 5EN4A 2IZ0A 4GGPA 1J49A 2DT5A 1ZW1A 1PU2A 3PHJA 3GAZA 4OKIA 5ES3A 5DCYA 4DLBA 1GV0A 2C29D 1WZIA 4W9NA 3V8BA 1BTOA 4ND2A 3CZMA 5GZ6A 1X1EA 2DFVA 5DBFA 4HV4A 1U3WA 3F47A 3WQQA 4YT8A 3ONEA 2AMFA 1ZXBA 1ADBA 1E7MA 3INTA 5CAEA 3D4PA 3EZYA 1WWKA 1E5QA 3WOHA 2ZQZA 1SNYA 3PHGA 2J5RA 4E2ZA 1LDBA 1T24A 3PHIA 4QSMA 1W73A 1E6WA 5U4QA 4BIIA 4FC6A 3PJFA 1GADO 3B1JA 3BHMA 4J4HA 4WOJA 5JS6A 4OAQA 3AFMA 4CLXA 3QSGA 1BRMA 3MWDB 3KYDB 1ONPA 4CLHA 2JFFA 3MWEB 1PQPA 2GNAA 2OUIA 2BFOA 3GEMA 4GSLA 1GV1A 4I9HA 1AHHA 4YAEA 4FPXA 3WMXA 5BSHA 3KRTA 1E3LA 1CF2O 2A92A 1XSEA 4WJZA 4HY3A 4CR7A 1H9BA 2YY7A 4LCJA 5AXBA 2P5YA 1XDWA 3WGHA 4WCFA 5TGDA 2NVUA 2P68A 2I99A 4PLVA 1P1RA 4GMGA 5KKAA 1I3NA 1VI2A 3EMKA 4P4LA 4W82A 3DZIA 4BVAA 1ISGA 4MKZA 5A3JA 1VC2A 4G81A 2PFGA 4BKUA 3DHYA 5JMPA 2Y68A 1LJ8A 2BHLA 1ZXLA 3VOSA 5DCUA 5EPOA 1DJQA 1C1DA 4HFRA 1GYQA 2P9GA 1BXGA 2PZJA 4RVUA 3RASA 4YJHB 4RZIA 1HRDA 2B4TO 1IE3A 1T26A 3WJAA 5JDIC 1P9LA 1E7YA 1HDXA 2EGGA 3PYMA 4QFCA 5F3RA 3ZWCA 4B3IA 2E82A 1U28A 4KUEA 3PK0A 3D4OA 2OO5A 3EGOA 2ZIZA 3PFWO 3AJRA 1UJMA 3GDGA 5TF4A 1KERA 2F1KA 3CMMA 4GKBA 1PGQA 2E4AA 4WNIA 1QYXA 4DRYA 1ISJA 4C7KA 2EW8A 4R4JA 3OA2A 4XJTA 3A28A 1UZMA 2IEDA 3ST7A 1LSOA 2HJSA 4XRGA 3ICPA 2C2YA 4UVGA 1PX0A 1K0UA 4EYEA 2HJRA 4RPJA 1LRLA 4BMSA 3ZU5A 3K73O 3GRKA 3JQAA 3HN7A 1XQ1A 4L76A 3WWYA 1I2BA 2E6UX 2RBEA 2O2SA 1MFZA 3ZI0A 3ZW8A 3ZHZA 1BVUA 1M66A 1IOLA 5L4LA 3LZ6A 4EEZA 2JCYA 1GQYA 1D3AA 2VTEA 2OOSA 3PIDA 1CETA 3RBZA 1LRKA 1C0IA 5AOVA 4Z6KA 2WYUA 3I5MA 1YVEI 3G1TA 4YB8A 1DC4A 4TKLA 2VUSA 3UW3A 3DZGA 2HMVA 1NVGA 3Q6IA 4EJMA 3GGPA 2PD3A 3NT5A 2VT2A 1IY8A 3V1TC 1VL6A 1O6ZA 4L9RA 4CM4A 4GGOA 4DIBA 4YT2A 1EBUA 2AHRA 2PZMA 2W4QA 1SEVA 3PHLA 2HUNA 2D5CA 2VWHA 1HDGO 3GVPA 1PJ4A 3CKYA 4WPGA 4U6SA 1BG6A 3HQ4O 2IZ1A 3VKVA 1P1IA 5C5IA 5MDHA 4QECA 2VYVA 3ENNA 1CQIA 4DTIA 3PLNA 4MVJD 1BW9A 4CM9A 4A7PA 4XJSA 1E3JA 3P2OA 2Q45A 1N9GB 2X4GA 3PZRA 1LQUA 1OBFO 1UXJA 5KVQA 4XQGA 2AA3A 1JAYA 3GHYA 4BOYA 4TZTA 2FR1A 4H3VA 3N7UA 5JW6A 5KTKA 3LLVA 1JA9A 2AQ8A 1DFIA 4YAGA 1O5IA 1XU9A 3V2HA 3JYOA 5I9MA 4OGWA 4FGWA 3OJOA 1O8CA 3NJ8A 1DLIA 1NQTA 3RU9A 4DQUA 4WLOA 3WGYA 2CF5A 2PY6A 4OM8A 1Q0HA 4RF4A 4AJNA 4R69A 3QVXA 3PGJA 1A9ZA 1TT5B 2LDXA 4BNLA 4W7IA 1T2DA 2D59A 4ITUA 4G65A 1EDZA 3MEQA 4JK3A 4WEQA 5CG1A 1UXIA 4EUEA 4Y9DA 4BNYA 1YE3A 2Y1GA 4E33A 3GT0A 2NM0A 3E9MA 4IM7A 1IB6A 5GZ3A 4OOEA 5EMHA 3NKLA 4IXWA 4CLOB 3DZKA 2PZKA 2B83A 3DONA 4UUPA 2Y0CA 1NHWA 4BNKA 3RWBA 4DBVO 3U09A 1JLLA 4GL4A 1MB4A 1LI4A 1TA4A 3D1LA 4JNKA 8ADHA 4GLOA 2GASA 1E1KA 4PZEA 2Y66A 2PWZA 1MFPA 2FPGA 4RVHA 2Q3EA 1UAYA 3F6YA 4L4XA 4QO7A 3L9WA 3L07A 4EZBA 4U6QA 3PLRA 4GSKA 3AU9A 4YYZA 2HQ1A 4PLTA 1H2BA 3ZV3A 1ISIA 4BNGA 1GY8A 2ZB4A 2D4AA 3KO8A 4PG4A 1ULSA 3E9QA 2ZB7A 1B7GO 1ZK4A 1UP6A 1MP0A 1HE2A 2WE8A 2YFHA 4PG5A 4FDAA 1Y8RB 4PG7A 3VTFA 4MVJI 3AW9A 1GUYA 1ZEMA 1Z75A 3DWFA 1ZVMA 4XA8A 1T1RA 2O7QA 1TXGA 3E18A 2X0JA 3GVXA 4RGBA 5ILGA 1KYQA 4LK3A 3G0OA 3H7AA 3HUDA 4ZQGA 2AE2A 3VH2A 4IIUA 4EDFA 1JWBB 2CSUA 3OH8A 5T8KA 2BGKA 1Z74A 2J6IA 2DTDA 1EMDA 2I5PO 3ONDA 1DB3A 4NQZA 4KUHA 4YJFA 4J49A 4O59O 3TDKA 4IBOA 4NI5A 1J6UA 3V1UA 4BGUA 5H81A 2VT3A 2YHIA 4CLRB 4MP8A 3RUIA 1HYHA 3WS7A 5IDQA 1LLDA 2FZEA 2Q50A 4ZVVA 4IQ8A 4I5DA 2O3JA 3ZHXA 4J1QA 4CM7A 1LDEA 5I8ZA 3RC9A 1VSUA 1IZ0A 1NWCA 4UEOA 4BHTA 1ENPA 4BMVA 3JQBC 1OC4A 4OH1A 3LK7A 2CVOA 4NJMA 1KVSA 2PGDA 4XYLA 5L7TA 5IZCA 1DJNA 3GNTA 1YB4A 5TX7A 2QG4A 2VZ9A 5DP2A 3LYLA 3W4JA 1P31A 3HDYA 4RPLA 4FC7A 1JU9A 1N5DA 1NASA 1NQ5A 1Q0QA 3LT0A 4XYEA 2GPTA 2Q1SA 3UCFA 4OYRA 3JD3A 4GX5A 5JCJA 1PSDA 5F5NA 3FHLA 1YQGA 4FFOA 2O3TA 3I6QA 3JYNA 3I52A 5C7IO 1D1TA 2W2KB 3VVBA 3DAFA 3VTZA 1DAPA 3AK4A 3TWOA 5C3MA 2D1YA 3JQ8A 3H5AA 4RORA 2NSDA 4DPKA 2AG5A 5K9ZA 3AY3A 3O8QA 4RPHA 3T7EA 1GU7A 3D7LA 1E7RA 4I5GA 4RVSA 3OBBA 3DFUA 3EDMA 1EUZA 3RVDA 3OECA 2FSSA 4CM8B 1PJ2A 3SJ7A 1KEUA 3E6AA 2P2SA 2BFAA 5TNXA 1U3UA 3RBVA 3WX0A 4CUJA 4GH5A 5TC4A 1EFKA 1U8FO 5ILOA 4GQAA 4U7WA 3JQ7A 1I8TA 4RLSA 3JQGA 3RC7A 3VPGA 7ADHA 3NX4A 4CL3A 4JJGA 2P9CA 1YQDA 2CDCA 3C85A 2CF6A 4WLUA 1NWHA 1U9JA 4R68A 2P9EA 1R15A 4BO5A 3PJEA 5ICMA 4Y98A 2X22A 2OBNA 4MPDA 9LDTA 4AJKA 1ENYA 3FTNA 3WLFA 2Y1OA 1MG0A 1A71A 4AICA 4LMRA 3LSYA 5G4KB 4J7CA 1T1SA 1J5PA 1E1LA 3DZJA 2C59A 3IJPA 2C82A 1HL3A 4NBRA 1UDAA 4II3A 1ZSVA 3ASVA 4JXKA 1JW9B 1ZUD1 2DQ4A 1N1EA 4U0JA 5TRTA 1GQQA 1WMAA 2HLPA 2EEZA 4DC0A 1DLJA 4ONEA 4HFNA 2E48A 4IDDA 5A9TA 4PLPA 3ZNQA 3RC2A 4KQXA 1RYEA 3ZHYA 2X1HA 4NBUA 2BMAA 1QXSA 5THKA 4M55A 1HDZA 4XGNA 1PZEA 5LDHA 1KEWA 3EW7A 1NAHA 4XKJA 2WSBA 4CV2A 1I3MA 3H5NA 2W2LD 4BKRA 2JD0A 4XQ9A 1E7SA 5JAMA 3HB5X 2V65A 3GF4A 1FDWA 1A4UA 1DIAA 1IUKA 2HDHA 4ID9A 1C1XB 4K1LA 4FQ8A 1A7AA 3JQFA 4MINA 2ZTUA 1B3BA 3GAFA 3BMQB 2Q4EA 4PZDA 4DXHA 5EJ2A 1E6EA 3JQCA 3FBGA 4BB6A 4E5YA 5IF3A 1VL0A 1VKOA 3KYCB 1U4OA 1F0YA 3KLMX 2HKIA 3ANNA 2X7HA 1SC6A 4EUHA 3FN4A 3L4SO 3NTOA 4LMPA 1P3DA 3AWDA 4D42A 1JDJA 3SLGA 4R1SA 4R1TA 1M6WA 4NBTA 3DZFA 1YB5A 3OJLA 4PLWA 2VOEA 4RPGA 2PK3A 1E3WB 4Q39A 2CNBA 2J3IA 1GZ6A 3H3JA 5JYDA 4CMJA 5KJ1A 5HTOA 5I7FA 4Q3CA 4P4NA 4RF5A 5TT0A 1HLPA 1OMOA 4EBFA 1E6UA 4S3MA 4HKTA 1BXZA 3GVIA 2BFMA 5BQFA 5IDWA 1EVYA 2IYPA 1FF9A 1Y7TA 3CZRA 5JAZA 2JJYA 4OL9A 4LVUA 3FBTA 4B79A 2GZ2A 3D5TA 5KOIA 4BS9A 4UREA 5A9SB 1B2LA 5B4VA 1MC4A 1A7KA 1PGNA 3WBFA 2B5VA 1HZZA 1K3TA 1ZK0A 4CUKA 4MVJH 4QUKA 3MTJA 4OSOA 1NPDA 4E5KA 4ZICA 1DIHA 4D7AA 1R4MA 1E3EA 3BAZA 3RIHA 3VZQA 4EGFA 3GVCA 3NT4A 3TSCA 3PGXA 3QWIA 1ADCA 4J1TA 1I33A 1IL0A 3KM0A 1U7TA 2ZK7A 4Z0TA 2IE0A 4CMIA 3QE3A 3GFGA 2JAHA 3DDNA 1A9YA 4MKRA 4UVIA 4E2YA 5KIAA 4N5NA 1DC3A 4LSWA 5G0VA 4B7CA 3EZLA 2I3GA 4IY1A 1HKUA 1E3SA 1HDRA 3ZU2A 1PZHA 2FWMX 1W8DA 2Q2QA 4QXMA 2Z1NA 5TJ9A 3IKVA 1SOWA 4IGEA 5THQA 3Q9NA 4GPD1 3WGZA 1PWZA 1QKIA 2EHDA 3FNGA 3RUEA 4ZHSA 1EVIA 4I5EA 3NAQA 4J0EA 1LDMA 3U0BA 2FHSA 2NNLD 3ZWPA 1VRWA 1ULUA 2IZZA 2BGMA 3F1KA 2O3UA 1YJQA 3D3WB 4HFJA 3VVCA 5JDIA 3TNLA 1LLQA 2GLXA 3QW2A 1PWXA 1U8XX 1XHLA 1QYCA 1YS4A 4XR4A 4BNTA 4BV8A 4F6CA 2X5OA 3ICCA 1BMDA 4NU6A 4YJDA 2E37A 4E21A 2VNAA 4PN3A 2O3QA 5JNLA 3KYBA 1QRRA 1JQBA 3SVTA 2FN7A 4TRJA 1JVSA 4PVCA 3E82A 3WDSA 3JYQA 2WJPA 4MO2A 3DZHA 4JBHA 3UGKA 4EW6A 3K96A 1ISHA 2O4CA 2X9VA 3S8MA 4YRAA 4NJOA 1RJWA 4FSHA 3EHEA 3NYWA 5HS6A 2DUUA 1LQTA 2AEJA 1N1GA 3I9JA 5DZSA 2PLAA 1P45A 3CSDA 4B8WA 4NU5A 3I9LA 3E8XA 5JPIA 4FJ1A 4TVBA 3ZV4A 5A3VA 3FWNA 1ADGA 2NU9A 3OFSA 4D0RA 4RF3A 3ZNNA 2A4KA 4J4TA 1E92A 3HSKA 2J5QA 1M6HA 2HMSA 1BDMA 3FPLA 4ZQBA 3OMLA 3E5MA 1CRWG 2V7PA 2R6JA 3VDRA 4XDYA 1MC5A 2QRKA 1Y1PA 3NGLA 5HWSA 4IXTA 2QZZA 1G6KA 3DTYA 1XKQA 1PR9A 3PP8A 2PD6A 1LDGA 3M6IA 1HE5A 5ER6A 4BB5A 2BGLA 4NIMA 4IDGA 1QMGA 4J90A 4BKQA 2GSDA 3GEGA 3UF0A 3TPCA 4ZQEA 4EUFA 5ITVA 1L7DA 3E9NA 4BNNA 1AHIA 3OETA 4DVJA 1N7HA 4N7RA 3ZHBA 1PS0A 3JQDA 5DCWA 4L75A 2RIRA 5KKCA 5DOVA 1E77A 1GD1O 1CQJA 4Y6RA 4CMKA 5TT1A 4M8SA 3TJRA 4JX8A 4FJ2A 3OEWA 1OFGA 4IPTA 2YQ4A 4CV3A 5IDXA 2PR2A 4FFRA 4P38A 4BL5A 4Z0PA 4FFMA 3WYBA 4GX0A 1YXMA 2FMUA 4R54A 2EERA 3WBBA 3TZCA 4RVGA 3DBHB 2JD2A 1ISMA 3WICA 3K92A 3AM3A 3HADA 2I3AA 2PGJA 1WW8A 2R00C 1UUFA 4I1IA 1N92A 2UYYA 1Y9AA 3BIOA 3NEPX 3R3SA 3E48A 1WLYA 4ZQFA 1WDKA 2VOJA 1U7HA 5IDYA 3ZDFA 2G0TA 1E3IA 2J3HA 4H16A 4M1QA 4ND1A 5EQFA 3WFIA 5DOZA 4Y8VA 4JBGA 4CMEC 4NBVA 1PQUA 4CV1A 4CQLA 3Q2KA 1EVZA 3RUAA 3GMDA 1YB1A 5JDCA 1PR3A 4BNVA 4BNJA 4BNWA 1DOHA 4B3JA 1ADFA 2HRZA 2VCYA 2VYNA 2X6TA 1C0PA 4NFYA 4FD3A 1R4NA 5FI5A 2EV9A 2QZ9A 2HCTA 4RL6A 1HE4A 1LNQA 3WSWA 3KSDO 1Q7CA 2W98A 4DMLA 4DWVA 5TS3A 4GX2A 1NNUA 3A14A 3S2IA 2VRCA 3S2GA 4E0BA 5DBGA 1NAIA 1UZLA 2DBZA 3IOYA 5IXYA 1IHYA 4EI2A 1ENZA 4MP6A 3ZWMA 2WYWA 4UUNA 1HWYA 3ZWAA 1ZFNA 1WDMA 1D7OA 1Z6ZA 4UVHA 1P33A 3AM5A 4RZHA 4D3SA 1XU7A 3OIDA 4WCFB 1DC5A 1DRVA 5F1PA 1KOLA 2ZQYA 2NVUB 1R12A 1A5ZA 4B4OA 3G1UA 2DAPA 1GCOA 3GQVA 3MJCA 4CPDA 2Q49A 4XD2A 1H6CA 3RFXA 4L0QA 2ILTA 2ZYAA 1R0LA 3PZBA 1FDSA 4BKOA 3WLEA 2C2XA 1C1DB 1FJHA 1I30A 4A73A 1M67A 2X86A 1BXGB 2O7SA 4DPLA 5DP1A 4BO8A 3ULKA 3WYEA 5A5FA 5JAIA 5KJEA 4ILKA 4FB5A 2EW2A 2Q4BA 2OZPA 1F8GA 1XCBA 2FPPA 3GN2A 3WXBA 3E5RA 4IUYA 4M89A 5B4UA 3UKOA 1GYRA 4WCDA 3QVTA 5KJCA 2G1UA 2EF1A 4OOFA 3SX2A 5FYDA 3VHRA 2PKRA 3ENKA 1D4FA 4QX6A 3ROQA 2RHCA 2WYVA 3VH3A 5JFOA 1YOVA 3BXXA 4FR5A 5F5LA 4YXFA 1VKNA 3QVWA 1V3VA 3M1AA 3NUGA 4KWHA 5IJZA 1NFQA 4AJIA 3RQSA 2NQ8A 1U5AA 3JQAB 3KUXA 1YDEA 4YT5A 1GYPA 1AXEA 1JWAB 1E7QA 1WPQA 2Y99A 3PYXA 2Y1FA 3CH6A 4P22A 5KNLA 2QQ5A 5TSDA 2VQ3A 4FS3A 1HE3A 1YBMA 1T4BA 3OSUA 1IULA 3MJ4A 4HP8A 2J8ZA 2WE7A 2FSVA 1HZJA 2ZTLA 4IDEA 3PJGA 3K5PA 1EFLA 1RPNA 2D8AA 2V6GA 3INRA 4IJWA 4Q3BA 4EEXA 1T2EA 2HK8A 4YJGB 2V6BA 1H9AA 4CMCA 2O23A 3U4HA 3I23A 4CR8A 4CM4B 4CQMA 4E4YA 4WK6A 1NFFA 4PLZA 1B8UA 3RD5A 4UAGA 1XGKA 5A04A 1PJQA 2VWQA 4P4GA 1A72A 2XXBA 3UHAA 4D45A 3RSHA 2NTJA 3JD0A 3S55A 1XQ6A 1HSZA 3H6KA 3TZQA 1Y6JA 2HMTA 2HSDA 1SPXA 2WTBA 4YRDA 2ZCUA 5GMOA 1J4AA 1QORA 3VH1A 1OOEA 1XG5A 2D0IA 2WD7A 3NV9A 1BW9B 4D46A 5AXCA 5BT9A 3ZCXA 3GDFA 2HK9A 3Q2IA 1MXFA 3ABIA 5CDUA 3UUWA 3BMCA 4FFLA 3VC7A 2X9GA 4M87A 4WLEA 3I9NA 5BNIA 2BF7A 3G3EA 3GA0A 3JQEA 1H94A 2NLOA 2HAEA 3SJUA 4RLHA 4E31A 2DPGA 1N8KA 1B26A 3OQBA 3LC2O 3O38A 2W8ZA 4R5HA 2DFDA 1WNTA 3ZW9A 4IJKA 4ESOA 4AJ4A 3TOZA 3H9JA 3SBOA 1OAAA 3K9QO 5ENVA 1KETA 2Y05A 1NHGA 2GYYA 3JYLA 4HNGA 3ON5A 4JBIA 5KVCA 2JHFA 4O0LA 2GF2A 1ZK2A 2CVQA 1LBEA 3BA1A 1MUUA 3SC4A 4LISA 5BNTA 2RH8A 3AY7A 2X0RA 2A9FA 3N74A 2OXIA 3WGTA 4YEDA 3QY9A 1YRLA 4PGFA 4LVCA 4GKVA 3DC2A 4YR9A 2POQX 2DUWA 2YFQA 3ASUA 4CMHA 4MOWA 1Z45A 4MIOA 2OP0A 2J3KA 1JVBA 1L1FA 3PTZA 4JGBA 2AW5A 4U8GA 3EVNA 1PS8A 4XRRA 4Y67A 3H5RA 1RYDA 1EBFA 1OZAA 4CM5A 1T2CA 3I9MA 1KY5A 2RCYA 2R2GA 4WLVA 3PQEA 2G82A 2YHUA 4MIEA 6LDHA 5DN9A 1ENOA 3ZZNA 3QV1A 5A02A 3RJ5A 1K2WA 2VUTA 4YAIA 3W6UA 4MVJF 3TN7A 1U4SA 3F4LA 3FTPA 3GG2A 4KWIA 3H3FA 1D1SA 3HHPA 1RM5A 4BNFA 5I9LA 3KETA 1Q0LA 4DLLA 3GZ4A 1Q7GA 2QRJA 1YL6A 4YT4A 3L6OO 3GVHA 3JYPA 4EJ6A 1U3TA 4JN6B 4XQCA 2EG9A 4Z3DA 1IHXA 3SLKA 5AQ1A 4B7XA 1QP8A 3WTBA 3FR7A 5T64A 3QWBA 3UXYA 4K6CA 1KY4A 1C3VA 2BRUA 3U9LA 4E2XA 5FF9A 4WOKA 1U2DA 3PYLA 4OO3A 3D0OA 5I7EA 5C37A 1DIRA 4TKMA 1YQXA 3UICA 4CMAA 2ZB3A 1I10A 1B3RA 3RAJA 4LW8A 4Z9XA 4TQGA 3GK3A 4Q3EA 3M2TA 3QRWA 2AEMA 2SCUA 4ZGWA 2B5WA 2OHXA 4YJFB 5L45A 1ZMOA 3FI9A 4UULA 3LT1A 1Y9EA 2UVDA 3CINA 4Z0HO 4ALIA 2EJWA 2B69A 1B8PA 3I4CA 2BI8A 3DMTA 1EE9A 3GR6A 2OFPA 4G2NA 1ID1A 4XIYA 1ZJYA 1AXGA 3KHUA 1X0VA 4J0FA 4OSPA 4PRKA 1X1TA 2HO5A 4TMFA 2YZ7A 1GCUA 3N58A 4CR6A 1HT0A 3OF2A 5DDIP 2NADA 5T5QA 1QSGA 3PEFA 4NJMB 3IP3A 2QIOA 3F5QA 2C54A 4TRRA 4RQUA 1XWFA 2JCXA 3MOGA 3BMNA 4J7UA 2DBVO 3GNSA 3KV3O 4MDHA 4XR9A 3V2GA 5JY1A 4H15A 3SEFA 3VPHA 4I9UA 1F8FA 1U1IA 1E5LA 3ANMA 3K2BA 1ONOA 4RDIA 5KCZA 4II2A 1Q7BA 3D4NA 3PIIA 3GFBA 2TMDA 4BV9A 1JKJA 4G5HA 3QHAA 3WNVA 1LXCA 2EP5A 4R9SA 4E13A 2HRBA 3CIFA 2JFHA 3ZH2A 5I7SA 3JQ8B 5ER9A 2CMDA 1AN9A 4D3DA 4TSKA 3O8QB 3TFQA 2DLDA 3ETEA 2EXXA 5JMWA 1W6UA 3CE6A 5G0WA 2QW8A 5FI3A 1QYVA 3FRJA 2B0JA 1YH3A 4FFNA 3DOCA 5COBA 4OJNA 1PJ3A 4GMFA 5EESA 3IUSA 3FNEA 4IIVA 1Y5RA 1PGJA 2GCGA 3D3EA 1E7WA 3K31A 4HUJA 5ADHA 1FDTA 2WD8A 4PLFA 4QO8A 2GN8A 3BMOA 1P44A 4AJEA 3JQ7B 3JQGB 2EGHA 3NTQA 4AJ1A 3MZ0A 2Q1UA 4IQ0A 4LRSB 1I2CA 3L4BC 4B8ZA 5BNFA 4NH4A 4R16A 3T4XA 5AXAA 3KEOA 4IS2A 2PGLA 4NNJA 2HK7A 2DPHA 2XOXA 4AJLA 3HWRA 5J23A 3OIFA 2PKQP 4I8XA 4NK5A 4CM3A 1LC0A 1DHRA 1SO8A 1XELA 3AFNA 1IPEA 1GPDG 3COSA 4OXNA 4E5PA 2UUOA 3KXDA 3GLQA 5C7OO 2D5AA 4DL9A 3OIGA 1H2HA 1P0FA 3Q9UA 2CD9A 2PKQO 4JCOA 3RUHA 4AJJA 1WMBA 3V5NA 3A4VA 3RUFA 3NGXA 3CMCO 1TB4A 4YQYA 4QFDA 4J9VA 4FJ0A 1V3TA 3HN2A 1DHTA 2Z1MA 3JQAD 2JKVA 4J4BA 4NFHA 4XYGA 3WIDA 2ZYDA 2NWQA 5IN5A 2O48X 1IPFA 4JQCA 4K9DA 1F12A 5CEJA 1UR5A 1VJTA 3WGGA 1SBYA 3AOEC 2CVZA 4DYDA 4A0SA 3H65A 2WWRA 4E32A 3C8MA 2HU2A 1UXKA 2NU6A 5A5EA 1RM4A 1WAMA 2VHVA 4J3FA 1Q1NA 3BMQA 1GQ2A 3B1FA 4PZCA 4AJOA 4R01A 2NTNA 4BO1A 4YPOA 1XYGA 3KYCA 1PJCA 3AUTA 3JD4A 5BSGA 1KVUA 3H9UA 3L77A 1HEUA 1X7DA 4KUGA 1PTJA 4KDFA 3HG7A 5A06A 4BQPA 3VH4A 1TI7A 3GMSA 4PFJA 3C7CB 2G17A 3DHNA 2Y1CA 5T6BA 4PG6A 4B4VA 1P1KA 3JD2A 3W4IA 4I08A 1ZK1A 3K2EA 3LU1A 2GUGA 4NMHA 3R6DA 4RPKA 1QLJA 1U2GA 3ORFA 3QWAA 4J1NA 2BELA 5L4NA 2NACA 1EE2A 2PH5A 1PJBA 3PWKA 2VYVD 3RI3A 4I9NA 4UUMA 1IYZA 1QLHA 4GLLA 2P5UA 2Y93A 3HFGA 5DBIA 1QV6A 4RCVA 4CM9D 4DLAA 1UDCA 2ZTVA 4PLCA 4INAA 5HRUA 3DL2A 4RJTA 2AEFA 4CMEA 2GZ3A 3DBLA 3INGA 4NK4A 1PEDA 3GN1A 1YL7A 5FFFA 4ZU3A 3ETGA 1E1NA 4M49A 1HYGA 2QRLA 2UUPA 1SCUA 4CUZA 3TZ6A 2XPCA 2GD1O 3WFJA 3ZWWA 4LCEA 3OQ1A 3KEQA 3Q11A 1F14A 3DQPA 4XCVA 3UCXA 4A26A 4UEKA 2B37A 3H2SA 4N5MA 1DDOA 1JKFA 1YGYA 2G76A 4EJ0A 4LN1A 3U3XA 5IZCC 2Z5LA 1Y5MA 3GNQA 4MVJA 5CEFA 1MV8A 3VZPA 1NFRA 3G79A 2JAPA 2X9NA 1KEVA 1R4MB 2OMEA 1P1HA 3VZSA 4TWRA 3GZNA 2PNFA 1I3KA 1I3LA 4UVEA 4Z9FA 2YDYA 4GWKA 4HBGA 1X7GA 1RM0A 3JQ9C 3B1KA 4P8RA 5AVOA 2WDZA 4L74A 4YCAA 5ITWA 1K6JA 3W1VA 3AU8A 5IFLA 3I9KA 4L73A 2PA3A 1QR6A 2XF8A 1SZJG 1K89A 1CIVA 1YL5A 4CMIB 5C7LO 4BGEA 3ITKA 3S1LA 3OJEA 1SEPA 2JD1A 4NFSA 1GR0A 1YO6A 4F3YA 3H8VA 2NUAA 3Q0EA 1SAYA 5COQA 3DBRA 4AFNA 2EJVA 4MVJP 1Y8QA 1FK8A 1HLDA 1NYTA 2A35A 4JROA 1UZNA 1I0ZA 3NTRA 2OBYA 1V35A 3UH1A 1U3VA 1EZ4A 2PD4A 2DVMA 1PJTA 4DMMA 4YACA 5TLSA 8LDHA 1GPJA 4XIJA 4OXKA 4FOOA 3C24A 4Q3NA 5JAQA 2JL1A 5FWNA 2GN9A 5JBIA 1T2FA 4AVYA 4W6ZA 2OORA 3GY0A 3QIVA 1R0SA 2DKNA 4PRLA 5COAA 2OP1A 1AUPA 1F17A 2OL4A 3R3JA 3DMYA 1ZO8A 1KBZA 4KQWA 3BTVA 1LDYA 4RO0A 1O9BA 3GEDA 4TZKA 1LX6A 1V8BA 1GUFA 2WMDA 4U0KA 4PLGA 2EKPA 2HMUA 1ZH8A 3I6IA 3LQFA 5CDYA 3IDSA 2EP7A 1V3UA 2I65A 3PQDA 2FY8A 5K6AC 1Y81A 2UDPA 1HF3A 4J7XA 4XQEA 1PGPA 3H2ZA 3VKUA 2BH9A 2Q2VA 2C7GA 4ND3A 5IZ4A 3K8ZA 3BHJA 4JLWA 1FXSA 2C0CA 1EK6A 2CZCA 3JSAA 5IN4A 3TFOA 2GZ1A 2IODA 3RKUA 3BTUA 3WTCA 3GGOA 4CL8A 3NDRA 4R51A 3QJ5A 4WECA 4Z3KA 3U4DA 3V1YA 2VZ8A 1QV7A 3PVZA 3JV7A 1EUDA 2GR9A 2YV2A 4R1UA 1Q2XA 1LUAA 2XXJA 4XYBA 3CUKA 1VPDA 3C1AA 1Z7BA 5CG2A 5JCJD 1RKXA 2WEKA 3AUUA 2J5KA 3ZWBA 3WB9A 3BZUA 3I83A 4ZQHA 3F46A 1GZ3A 1DXYA 2A94A 4Y6SA 4WUVA 2JFGA 3HFSA 1M2WA 3AI2A 1NQAO 4E12A 4R3NA 5KWEA 4C4OA 4FW8A 2AG8A 3RFTA 1LC3A 1PJSA 2C20A 4IDCA 2BFPA 5L4SA 3B6ZA 5H82A 3G17A 2YDXA 1Z73A 3W4KA 3UFXA 4E2WA 1P0CA 2HMWA 1JAXA 5LDGA 4BNIA 3P2YA 1H6DA 4NZ9A 4ZN6A 4DIFA 2X0NA 3K6JA 3PWSA 3ZV6A 1HDOA 3KYDA 3UOGA 1O89A 4IDFA 3UCEA 3ZU4A 2VHXA 3A9WA 3RJ9A 1M76A 2X0IA 1XIVA 4OXYA 3LT4A 4BO6A 1LSUA 4AL4A 2Q46A 1GEGA 3AUSA 4CQLB 1NVTA 2CFCA 3ONFA 4Q3DA 3A06A 1GAEO 2YV3A 3NT2A 3DZBA 1KEPA 3OICA 3WGQA 3NDJA 2NQTA 3DFZA 4W99A 5G2OA 1R4NB 5GY7A 4BKPA 2JCVA 2IDZA 4OQYA 2NTVA 4TVOA 1ML3A 2VNSA 2YJZA 2X5JO 3TRIA 4ZRMA 2IEBA 5DF1A 1MG5A 3EK2A 1GDHA 2LDBA 1I01A 1HYEA 4YJHA 3ROMA 3QVSA 4PG8A 1FDUA 5CPBA 4RV9A 4IJVA 5L95A 3B20A 4GI2A 3FWZA 1G0OA 3QWFA 2YQ5A 4ALMA 3FF4A 3PFFA 3KOUA 1PIWA 2V6MA 4GWGA 3I1JA 3GGGA 1UP4A 1ZSNA 4HNHA 1GL3A 1W0CA 4ND5A 3GOHA 3M1LA 3EAGA 4IDAA 1ZIDA 3WMWA 3TOXA 3ZU3A 4JP3A 4ZD6A 3WJ7A 2AQKA 4OHUA 3ZWVA 5MGBA 2X8LA 1C14A 1WVGA 2P4QA 4D41A 4J1SA 2DTEA 1NTOA 4RF2A 4HX5A 3UAGA 1LLCA 4XYMA 4MJLA 3D64A 1R0KA 2B35A 3IAHA 3V2UA 3KZVA 4MIYA 3GUYA 2YUTA 3HDJA 4F46A 5CP8A 1E0DA 4F45A 1V0JA 3LT2A 4TRMA 3GPDG 1I5RA 4K6FA 4DC1A 4YQZA 1NBOA 4WNCA 5DNAA 2Q99A 3VPFA 3IJRA 1HDYA 5A1TA 3L6EA 1Z82A 2E49A 2W2LA 4BO7A 3TL3A 3P19A 3QA9A 3AY6A 2FOIA 2IXBA 1H0KA 3JQBA 4NDNE 4R3WA 4FN4A 3D5QA 3VZRA 1ZSYA 3IKTA 3U4IA 5GZ1A 4NR0A 3ZWNA 5CFZA 1YOVB 3PPIA 4WASA 4GBJA 1QYWA 1ISFA 3U62A 1TLTA 3ZWOA 1XEAA 4ALNA 4YAJA 5IAAA 1NXQA 1DO8A 4KP7A 3F9IA 2C7VA 4KTVE 3SC6A 3P7MA 3W8FA 2RH4A 5ENDA 5G0TA 3EVTA 1VL8A 3WQRA 5F1KA 1PL6A 4M86A 5EL0A 3R1IA 4O63O 4DBZA 2BLLA 1PL7A 1ARZA 4YJGA 1LTHR 2ET6A 4BNZA 5JXWA 1PZFA 5T67A 5IG2A 3L9XA 1PGOA 3PRJA 4L4RA 3DAPA 1O95A 2IRWA 3LF1A 4I5FA 4IMPA 1ZJZA 5U1PA 4WEOA 2VWPA 3EYWA 2H1SA 3FPCA 5BR7A 3KB6A 1N9GA 3EUWA 1JN0A 4JP2A 2Y1DA 2BI7A 4KZPA 4IGFA 4CQMB 4ALKA 1VLLA 4QT0A 5AYVA 4BNMA 1VE9A 4KMSA 3K30A 5T57A 4MVJE 4QQRA 1H5QA 4IDBA 1XA0A 1OC2A 2O4UX 1MXHA 4GX1A 4A2CA 4E30A 1OI7A 3G49A 3H9EO 2NU8A 2PTGA 4IINA 1I36A 5LCXA 3WIEA 5L53A 1YBVA 5JSFA 4JIGA 1KVRA 3HDQA 2I6TA 2TMGA 3BTSA 4QEDA 1P74A 4NG5A 4W9NC 4XGKA 1ORRA 3IL2A 3ZWXA 2WD7B 3OJFA 1EDOA 4YRBA 1S6YA 1P1FA 3MCVA 1TT5A 4J91A 3FNFA 5CDSA 1BDBA 4HADA 3VAZA 3BMCB 4DREA 1CERA 5EINA 1ONNA 3L4BA 4AJ2A 1KVQA 3GPIA
chains in the Genus database with same CATH superfamily
3IC5A 3GODA 1S9DA 3LLIA 4DGSA 1QRDA 1JG6A 5HZKA 4PY2A 3C1OA 2OZLA 2WAAA 4P3NA 1KH3A 4V0MA 3QFFA 1KU6A 5I8WA 1KS9A 3E9YA 3TK1A 4UDOA 4ZEMA 2FZLA 2NVWA 4U2CA 1RAIA 2D2IA 1HDCA 3SXPA 1UAAA 5L0FA 3ATPA 4HZUB 2V0CA 4F85A 3NTVA 3OD1A 3FHJA 3B5IA 3C6KA 3USZA 3TE6A 4MGZR 4UM7A 5TR9A 2PANA 4H7DA 4RMNA 4MNTA 3D7KA 1EJ0A 3HMKA 4CKEB 3DGFC 2E4XA 4YXWD 1NF8A 2ZTHA 5JC1A 2W6JA 1CS0A 3UJ6A 1WPRA 3HCPA 4MZDA 1ZK3A 1GVNB 2LSEA 1V8ZA 3O8CA 1X6VA 4N5DA 2FR8A 4BVJA 4CKYA 2ASRA 1S7CA 3PUKA 3ZXYA 3M6LA 5B2FA 1J9EA 1YNSA 1LFDB 1JKJB 1F60A 4ZO7A 2H8AA 2PWPA 3VR5A 5DGIA 4NMWA 4EFNA 2A9RA 2XLEA 1C03A 3PDJA 3GV0A 1T4DA 3A6GA 4EF5A 2OAQ1 1ZOSA 5EQJB 3WIBA 4V39A 1YR7A 1US8B 4W5NA 3DHWC 5F9HA 5J5CA 2X7XA 4EYQA 1S4MA 5KUTA 3KOZA 2Q7XA 1F6BA 3PXXA 5IXJA 3RCBA 4WWHA 3DAGA 3UMRA 5A4IS 4BGIA 1UPAA 3U4CA 1KC3A 2BFFB 3LECA 4D9GA 2HA3A 1KC1A 4QLBA 3BXPA 2HEGA 3PDUA 2ZYGA 2VRBA 3RFCA 3NVMB 3CSKA 1DIBA 3LYAA 2IHYA 4XM2A 3A1CA 5A2QA 3INNA 5B37A 1VLVA 1Z6PA 1CUVA 4K26A 1YMUA 4D92A 5MN5A 2ECKA 3MW8A 4HQNA 2C3YA 1BZ4A 2JASA 3DKAA 4G41A 4B6QA 4NAUA 3W2HA 4CLDA 3KVOA 1MOPA 4GMXA 1VXOA 4XB1A 5G0UA 3EG9A 2BM8A 4P3YA 3Q15C 2ZIUB 3DMGA 1UBMS 2FUG6 2VK1A 3N39C 2QSUA 1SXGA 4D3XA 5CT8A 1RWOA 5JPCA 3BRSA 1S8AA 4NEQA 3H1PA 4WGFA 3MJVA 3D3WA 3PENA 4F06A 2QP4A 4N18A 1NV9A 1YDWA 1EKYA 2NUAB 1WSBA 1RM3A 2WG0A 2Z2KA 3IUPA 3UGTA 4C3DA 1KP3A 1TTTA 4K2AA 5D3ZA 4V3CA 5E6RB 3MGBA 2EFJA 1OCCC 4RA6B 3HLKA 3O84A 3UY4A 2CB9A 1DIGA 2X8WA 5EHQA 2A7QA 2NU9B 1H4SA 2QB5A 1J20A 5KYKA 1G0NA 3QLVC 3WLNA 3LVBA 4H6VA 2P2NA 1MX5A 1RCUA 3GLIA 5KNDA 5CMLA 1HM5A 1R6XA 4MV8A 5GTDA 3L0DA 1V48A 3C6BA 1CD5A 1M3SA 2I66A 2JHAA 2CYAA 2G0NA 3H18A 1AQUA 5EPEA 2WHQA 3CBQA 2H85A 3OA0A 2ZE8A 1PK7A 4M98A 1JNYA 1NNEA 3FMPB 5BMVB 4OKIA 3IVMA 2O2ZA 3V8BA 4URYR 3UMCA 5DLYA 1HLGA 2I22A 4G0PA 1BAPA 1T9BA 3GLUA 3CF4G 1E5QA 4PO8A 3NR2A 4H6WA 5J4KA 2ZG6A 4J4HA 3KQWA 1DEXA 1EX7A 5JPDA 1F3OA 1D2GA 3O9MA 3ZLBA 4E4RA 1O9GA 2YLGA 4CR7A 1U6HA 1LVHA 2J67A 3IBYA 5LYYA 1WUKS 1H1TA 1NGSA 4LXTA 4PPQA 4XUEA 3S90A 2VQDA 1ISGA 2VEOA 1UIRA 3VSDA 2VHUA 5AI8A 3FKSA 2YOFA 4HAWA 4HFRA 2UUHA 4RZIA 2ONCA 2NAFA 1THZA 3WJAA 3NB0A 4G84A 4UJ3A 5F3RA 4OQFA 4L72A 5L0CA 1JIQA 3W9UA 1QYXA 3OA2A 3ZEAA 3UB2A 2C2YA 2GK3A 4AXXA 4M8NE 4QODA 4K9NA 1GQYA 3NBYC 2XUFA 3RBZA 1LRKA 1T6IA 5AOVA 1PWEA 4QWMA 4CM4A 4YT2A 1EBUA 3RF7A 2PKCA 4PHHA 4Z86A 3T7IA 4JMPA 2XHZA 1BG6A 4TWJA 2H51A 1TYZA 5C5IA 2OBFA 4OLAA 4DTIA 1M0SA 2VUHB 2V54A 4C22A 2DUNA 2A0WA 1JYEA 2X3FA 1UXJA 4XQGA 3M6AA 7YASA 2AA3A 4BWGA 4O02B 3V2HA 5IBPA 1G9TA 4DQUA 4JB2A 2XA1A 2PY6A 3H16A 4EHHA 1SBNE 5CDFA 2G4CA 1KK1A 4Y2UA 4JK3A 4ASUA 2KW5A 1O97D 1TRKA 1AA6A 3RE1A 1TZCA 2HLDA 4DBVO 2J0WA 1JLLA 1TA4A 2TMYA 2VC2B 4LFAB 2PZEA 4F5ZA 5EKSA 4OQQA 1FP4A 5LIRA 2Q3EA 3F6YA 2WFLA 4KQHA 1YYXA 4ZO9A 4CT0A 2D4AA 4KI2A 2Q5EA 1HQDA 4I2VA 1N0WA 1ST2A 3FJ1A 4PJJA 4PANA 1QHEA 3AR5A 3K9LA 2BMVA 3HN6A 2XODA 4DMRA 2X0JA 5FBWB 1QZTA 3K7EA 5FUWA 1WWPA 5FOQA 1R6TA 4PYNA 3EF0A 1RAHA 1XF1A 3TSYA 2VJCA 1X7XA 1QKRA 3VNSA 5BQGA 4CM7A 1G9SA 4AMVA 4UEOA 3IAAA 1ZD2P 4YLEA 1DI0A 2PGDA 2XITA 3KTAA 2WUDA 2IXTA 4FC7A 3OO0A 3D8TA 4YI5A 3O7MA 4JJ6A 3GJ6A 4XPXA 4LOAA 5FTNA 3M82A 1GT6A 4BMYA 1PJRA 4JR0A 3NBAA 5DM4A 1XTJA 3AY3A 3N86A 1NF9A 3ZUGA 1VMKA 1UDXA 2QUAA 1EB9A 1JAZA 2ADOA 3NX4A 3ESBA 1NUPA 2CDCA 1AV7A 3CTPA 1U9JA 2DJIA 2ZYRA 4GOND 9LDTA 3VR2D 1M1YA 1A71A 4RU1A 4HLNA 4LMRA 2XUDA 1VLJA 1IU9A 3V4PB 1R9MA 1ZSVA 3NALA 3F3MA 5A4FS 3AWIA 2LK4A 4DC0A 3UGJA 1ACMA 3I0MA 3WGJA 4N5IX 3B6EA 4OI1A 4O2BB 1CZOA 1XVIA 1HC7A 1M57C 2CUNA 2VZEA 4GMKA 4BAGA 1EVEA 3WKDA 3OAAA 4DS3A 2YL1A 1W4BA 4PZDA 3JQCA 1T3TA 3FBGA 4BB6A 3MLAA 4JI5B 1JH8A 1KEKA 2V7BA 4A23A 4R1TA 1YB5A 4DHWA 1E9DA 4Q39A 4ZZ0A 4TL8A 1LVGA 4DR1B 4NNOA 1LCIA 4P4NA 3AVVA 2WJ6A 1E2EA 4J7TA 2VDOB 2BEVB 4M53A 2XUIA 3MB5A 3QW1A 2GAQA 4ENWA 3E3AA 4G0WA 1BKDR 2HF9A 2JNWA 4NOLA 4TLBA 3ABLC 3VI3B 1TK9A 3WQHA 5JR3A 1VA4A 1YZLA 4TWIA 4JSTA 1I5NA 3WDLA 1W8DA 1VHJA 2Z1NA 4IOMA 4I3HA 3K1ZA 3U0BA 2FHSA 4UBJA 3QPVA 3CSSA 3JRTA 2ZBUA 4CVNA 1XHLA 4XR4A 3VHXB 3ZGOA 4UU1A 2HJWA 1FSFA 1QRRA 5DQTA 1RR6A 4MQEB 1B0ZA 2WJPA 3SS7X 2V1XA 3NDBB 1V8DA 4G26A 2UXCB 4P33A 1N1GA 4DM4A 3M3DA 4KKVA 3RWOA 4D0RA 3MFQA 2FWBA 4GPEA 1XD9A 4A15A 3UT0A 1IVYA 4OUDB 1NF2A 4NJEB 4HNUA 1FX1A 4IF6A 4RHFA 2GSDA 3G2KA 3JPWA 3M9LA 4BAZA 2VDMB 4RPIA 2VSXA 4JP5A 1L5RA 3BBLA 1CQJA 4QI2A 4FFRA 5AJYA 3TZCA 4ZVNA 2B4KA 5FQOA 3TCXB 2FNAA 5F5FA 3FVRA 4KJXA 1G60A 4RD3A 2O9XA 2IITA 4QPNA 4YHBA 1T8YA 5EWJA 4YCCA 4JBGA 4H4KC 4F04A 4QTTB 1CJVC 3SIXA 1T91A 1R4NA 1U7ZA 2ZSBA 2XHEA 2W98A 1V1MA 5ELLA 2E1RA 1KPIA 3T3DA 3EZNA 5IXYA 1FNDA 4UUNA 4HH0A 4YMVA 5DHQA 2AW3A 4B6PA 1A5ZA 1G8XA 4UNRA 2R85A 4QQFA 3GT7A 1R6VA 1CRQA 2ZT6A 3QXCA 1U9IA 4RJJA 3GRYA 2PL9A 3NMIA 1DAFA 1WR8A 4FB5A 3L6RA 256BA 1XCBA 1XEXB 2Y3HA 1P72A 1CJMA 2WVOA 1VG0B 1H2XA 3VH3A 1KMHB 3OWXA 2PE5A 2PYDA 4KWHA 5ULLA 4WK0B 3PNMA 3CIOA 3PGA1 2QLFA 4OU5A 2ZBQA 3RQFA 3INRA 1NONA 2QTCA 5DNYB 1JHPA 2ZANA 5ILQA 221PA 2C0QA 4G5GA 2CLSA 2HSWA 4MCJA 1JIKA 1WGWA 1F9AA 1FFCA 1JDPA 1XEWY 3GLFB 3IHKA 3Q2IA 5G02A 4M87A 3I9NA 3G3EA 3JQEA 1KTVA 3DOFA 1AZSC 3T1YB 4ZGBA 2DPGA 4JA2A 4XSVA 4K6HA 3BB4A 2M6RA 3PWTA 1TF2A 1TM2A 4BXOB 4RYDA 1J8YF 3OJXA 5JD6A 1ZK2A 1T9GS 1UBHS 5BNTA 4TKUA 2X0RA 1TE2A 3VR6A 1D2EA 5CH8A 2PFKA 4YCBA 1XL0A 4P0TA 5AHXA 4MRAA 2C58A 1Q0FA 2VPTA 4XRRA 2INGX 1P4HA 3TLZA 3ABZA 1QS0B 3PT9A 2QWXA 4CSAA 1ZLXA 1K2WA 1U4SA 3F4LA 5ISMA 2V6IA 3PE6A 1OBOA 5BQ3A 1SMYF 4NZMA 3WZ2A 1YJ5A 3DZ8A 4JN6B 4EK9A 1R6UA 4BMZA 3TLXA 4BZWA 4EMSA 1Z7Qc 5ALZA 1L4KA 1NVWQ 4EFMA 2XLVA 3BD7A 3P97A 4Q1BA 2XA9A 2UVDA 4F5YA 4MLDA 1NLZA 1EFVB 1G5HA 1MO2A 1YIDA 1X70A 4YECA 1M2NA 1CFZA 3RS3A 1GCUA 2NN3C 1QHHA 2CMFA 3MOGA 4NTAA 1U1IA 4N0EA 4E1VA 4UCQA 3ORRA 3UK0A 2CGEA 3DMPA 1MH9A 2BBTA 1WPGA 4G2TA 2BW0A 4G0QA 5EWMB 3O8QB 3N8NA 3C5WP 2YQYA 4YRNA 3IUSA 1G42A 1T5LA 5ADHA 1GGNA 4X90A 3GOQA 3O1JC 4IQ0A 3L4BC 4ZOLF 1DAIA 4NNJA 2HK7A 4ZARA 3P9XA 4IEFB 2PKQO 1VJ5A 9ABPA 2G1KA 3RUFA 4J4BA 4NFHA 2NWQA 4K9DA 1IPFA 2FQ1A 1OH5A 3MJHA 5BN4A 2R79A 4UPVA 5KQLA 2ETXA 2HU2A 4MW9A 2VHVA 3WRXC 3TINA 2XADA 1ILEA 1JTEA 3LW7A 2G62A 2P4SA 3KFXA 1N6OA 2WF7A 1X7DA 1NNLA 1SQ0A 2H0QA 5A06A 3D3NA 1P39A 1OXTA 3W4IA 1DRKA 1GPAA 5F5HA 4G1VA 3VUEA 2J9XB 5DBIA 4DLAA 5HRUA 3GNLA 1ZN8A 3ZD8A 3INGA 3ETGA 2PUHA 3AJ8A 5G3ZA 3X1XA 1YHYA 4HO1X 5JZSA 3IAEA 2XS1A 3H2SA 2NUPB 5FCLA 5CEFA 4YCMA 1NFRA 1H0HA 1H2FA 2I78A 5LP6B 1K4MA 5ITWA 2XQGA 3M79A 1K6JA 3KDPA 1Z26A 3ZCRA 3SC2A 1W36B 1USGA 3C45A 1YO6A 3HR7A 3OCWA 2C4MA 3SEAA 3W3AA 3DBRA 4PFPA 1W5AA 4AWAA 1CEEA 1CY4A 5FYQA 2CYCA 1PJTA 5TLSA 3CLVA 3TX2A 1EFRA 1NOIA 1ZCZA 4XIFA 2NZXA 3T9FA 3SBDA 1RFLA 3U1VA 3I6IA 1Z7GA 4G4SO 4HQKA 3BN3A 2O8CA 3H2ZA 4WI1A 1XCPA 5CXSA 3RKUA 3BTUA 3BS4A 4CL8A 4R51A 3UG6A 3V1YA 1CUSA 1X94A 1CJKC 2GR9A 2HMZA 2OKUA 1BROA 4LTMA 2XBMA 4UOQA 3NMUF 1EGVB 3ELDA 4BCDA 4UAUA 3LY5A 2NZJA 5AVXA 1DXYA 3L7LA 1MO4A 2J4FA 3QELB 2QT0A 5IT4A 2OXTA 3JATA 2FN3A 1C4KA 2A9JA 5JVDB 4DUZB 3LY8A 1CR6A 4DJFC 1Q20A 2C57A 4IO1A 4JBNA 4IIJA 3ZU4A 4HWRA 1GZDA 4ZO8A 4DLNA 3DDWA 1XMVA 1I6KA 2NQTA 1TW2A 4MRPA 5EY5B 5C8YB 2WG2A 1X8JA 2LDBA 2P1DA 2R6FA 2QQ0A 3FPEA 2P67A 3PCTA 1OB5A 3O6VA 3S68A 1XNHA 1I0LA 1BGWA 1B4DA 1RADA 1FLAA 1EESA 4K46A 1I0IA 2IBFA 4XIIA 2HL6A 2AJBA 2YYAA 4C1BA 1HRKA 5GJBA 4HX5A 4PZZA 3WAJA 1P2FA 3IAHA 4MUEA 3HDJA 4JL8A 2H4ZA 2GBCA 4K6FA 2CB0A 1NBOA 5EE3A 1A2OA 1RAGA 3GFVA 1PDOA 3F6PA 3N05A 2JLUA 1C9YA 5AO9A 5GZ1A 4NXMB 4IAQA 3H0KA 1E59A 1OXBB 1SG6A 5BT8A 2V7TA 3II6X 2RH4A 4UPDA 2G67A 2B30A 2QM7A 4H0FA 3EYWA 1TDJA 3GUUA 1KQ3A 2IEIA 2MR6A 1VLLA 2A5LA 4A4DA 2A1TS 2PTGA 5H80A 3ZIAD 5HMLA 2CXOA 5LCXA 2XYHA 2MHRA 3MBGA 4H3SA 1RJDA 3KJFA 4W9NC 4Z9HA 2E7ZA 4FMDB 3GX1A 4OQLA 1BDBA 1QVAA 1VDMA 4PX3A 3MC1A 1R6DA 3RFVA 3BWYA 4LA4A 2O0LA 2V3WA 5DWDA 1A9SA 4PLYA 4F4FA 1XMOB 5KDOA 1FRNA 1MGOA 2DR0A 2GFQA 1RRCA 1HYBA 1R8XA 5BWNA 5AVWA 1OE0A 4G5RA 4W7HA 4PJMA 3RVLA 4CZ2A 1QFJA 3A1TA 3QA3E 2Z95A 5J5VA 2ZWOA 3NJ4A 4CG1A 2F9LA 5L3VA 5LP6F 2PEZA 4QE3A 5JG7A 3MTGA 3N2GA 4IMIB 1U9IC 3KYIA 3PI7A 2CMKA 1B42A 1TO6A 4B7UA 4KRFA 3ZI4A 2P75A 3A1WA 1DEHA 4QDUA 4O8CA 3H2UA 2GLUA 1ODIA 3SGLA 2BMJA 4GOXA 3DOJA 2WSIA 3T8YA 3UM9A 4EGCB 1CEQA 2X5KO 3RH0A 3MCAA 3A26A 3GG9A 1B43A 1NR1A 1IZ9A 2EKLA 1IZZA 2QTLA 2JLSA 4U39A 3HU5A 5LU8A 2IOFK 1RE1A 1GHTA 1SOMA 2ADMA 3FVWA 3WBJA 3VC1A 3RS5A 5FOWA 1FSSA 1QQ6A 4M54A 4B35A 2O54A 4LWZA 1NLFA 3EIXA 5ALRA 3RQIA 1XQWA 4HXEB 4F8EA 3BE5A 3TB4A 4KQ1A 3MCTA 3K0FB 3B12A 4H54A 2W6MA 3S28A 1KZHA 1FFYA 3RYHA 3DO5A 3LO5A 5DTQA 1ECJA 4M7RA 4KI0A 5T3WA 4N7MA 3ZDZB 5KVAA 1XOIA 1JFRA 4NBWA 4YALA 3WQBA 4BO9A 1M83A 3ZN2A 3BH7A 4ZJUA 3RU7A 1GGQA 4PU0A 1CR0A 5TPWB 1RCTE 3GLHB 4RKEA 2R6GA 2NO1A 2OOCA 1EINA 4MVJG 4TLAA 4GVLA 4L5AA 3G13A 2YS6A 3CO0S 4NQRA 2C4NA 4EY7A 1M1ZA 4L6RA 3TH5A 2BE7A 3A4YA 1IONA 2PZ8A 1RWWA 4CSAC 3D6VA 2BHNA 5E7JA 2YZGA 5CJ2A 3Q98A 1WIWA 4LHSA 1ZMTA 3JRXA 4CHGA 4JI8B 3GXBA 1XROA 3K6RA 1X13A 3ZQ4A 1G98A 3IDOA 4ARCA 5A9SA 3ZGNA 3CKLA 1T9KA 3SK0A 3OO1A 4U00A 1Z6YA 5I9NA 3FMFA 1K05A 4ODIA 1ZC3A 1RQGA 1YZUA 2Y92A 2Z08A 3LC1O 4PINA 3LL4A 5D01A 3W77A 1K8ZB 5IF9A 4M9UA 1TEHA 3TEJA 4O6VA 1GQFA 3DQQA 1X0XA 1Z2PX 1DFHA 3OE7A 3QQPA 3WL6A 2VSFA 2B2CA 3QU9A 3EY4A 1W4ZA 2ZI3A 1BMTA 2ZYVX 2I1LA 2A86A 2HF7A 1F4PA 1V9LA 2I87A 1SXJA 5LNK1 4A03A 3ICEA 3FCXA 1Y8QB 2HDWA 3P9QA 4P86A 3LNTA 1T25A 4WVLA 4J94A 5FBZA 3MLEA 3UW1A 2M6LA 3N2YA 1YIAA 2CDAA 2XDQA 2BFDB 3RFUA 1V6AA 2J45A 4TT3D 1BU5A 5SYAA 4LDZA 2V8BA 1PG5A 3RVRA 5CFNA 3QEMA 2IZOA 4CMGA 2FP4A 4UVDA 1Z56C 1J1ZA 4X92A 3IBFA 4OHMA 1DAOA 4BJ6A 3FCOA 4IVNA 3VQTA 3GFRA 5JISA 1ZUNB 2AE1A 1YARO 3DE2X 1KEZA 4FHCA 2A57A 2Q2OA 2VJMB 4A3SA 3AG1C 2I3ZA 1X1SA 1KZ1A 2PXXA 5FLXA 4BQSA 1JWLA 5CAEA 5IEBA 2XMCA 4D81A 4OIQF 2ZQZA 3PHGA 1FXUA 2BSQA 1T24A 3PHIA 1RMQA 3BHMA 4WOJA 4OAQA 3KXKA 2JFVA 2GNAA 5EJ7A 1X80B 5AXBA 1XDWA 1SUSA 2EYUA 3BWVA 2R8EA 2BL2A 1I3NA 1HURA 3AF3A 4BRWA 1LPNA 1T6YA 1E1DA 4RDAA 3VTAA 4IKPA 1TUIA 2C2MA 2ZRAA 4B46A 1P9LA 1CUHA 1TWHA 3N0TA 4BWVA 4ZCLA 5I45A 1E5TA 4W5OA 5JEEA 3FVQA 1SHTX 5JZOA 1XD8A 4P7JA 4BX9A 4Z4EA 3T9CA 4EB0A 4V1CB 4UHEA 3IMEA 2Z4SA 2HUNA 2D5CA 2VWHA 1DARA 3WWOA 1YVPA 4QECA 2VYVA 1CQIA 2ATIA 5IVIA 4RD6A 4RE6A 4RIGA 4OIPF 4FFDA 5JW6A 1UJ4A 1XU9A 4GT1A 2ACEA 4BIMA 2CF5A 4EVQA 1RYZA 2V7XA 3PGJA 2FFHA 1P5HA 2R47A 3L7DA 4NPAA 1TK3A 1CUUA 2Y77A 3IAXA 1QO7A 2WNHA 2ZRCA 2RGEA 3JU3A 2QMQA 1E89A 1Y1KE 4QO7A 5CFOA 4EZBA 5DYGA 3AU9A 2HQ1A 4PLTA 2W2OA 3T7AA 1C02A 1ZK4A 5BV2P 1OYVA 2YFHA 4XEFA 5B36A 4TV9B 5C46F 1GUYA 5JQGB 3DWFA 3TX6A 5CBKA 5E4TA 2HFJA 5ECWA 4RGBA 1C3LA 5ILGA 3HNKA 4LK3A 1J90A 4XPZA 4ARZA 2J6IA 2DTDA 5HKKD 3GCDA 2L19A 5AJZA 1SHZA 3LWZA 4CIBA 1CZLA 2Q50A 1L4MA 2YIDA 5FT9A 5GONA 3U1TA 5LLDA 4RH3A 1MEEA 2AC7A 2BUCA 4FGJA 3EEYA 4Z8YA 2QJTA 2VZ9A 3W4JA 1BWPA 3RV3A 1JJAA 1Q0QA 3FM9A 1F20A 5DHSA 3I52A 4W63A 4IIHA 5JHHB 3TWOA 4GXQA 2SECE 1FDOA 1U11A 4FWBA 3CS3A 2G9ZA 1ZWLA 3DFUA 1ZM2A 5BRNA 1RI4A 3EDMA 2XGMA 3C16C 5FNVA 3T99A 1JKXA 5TNXA 3VSBA 3AETA 1X19A 5ILOA 1ZRMA 1KHTA 3U3MA 3RC7A 1YQDA 1Y6DA 3DGEC 3TL6A 5JAUA 3LZDA 2QRNA 5DM1A 2OBNA 2Y3IA 2GFHA 4JLOA 1NN1A 4NBRA 4B2YA 3W79A 3LIIA 3U4QB 4I50B 4E15A 1YS7A 1DUIA 3EQ8A 3QJGA 2EW1A 3EW7A 2ID8A 4FEYA 3UMSA 1GN9A 1AQJA 5K8IA 5IAOA 3D7MA 5ALUA 2OB1A 1XMQB 2FMKA 3BE4A 1W1UA 4NBNA 5EI5A 3OE5A 1RYFA 3L7CA 3ANNA 4HAOA 2QM8A 1THMA 4K9MA 3PRYA 3KZMA 2N46A 4WY2A 4QOSA 4ZZ3A 3TUIC 1TZMA 4EBFA 5KQPA 4GSYA 5E4FA 5BMOA 1ZVQA 4UREA 1B2LA 1N5MA 1TC2A 1Y9DA 3OP1A 3FETA 1NPDA 1M0TA 4JFRA 4WXEA 1UWCA 1KAHA 4BJ5A 3TSCA 4D02A 2QD1A 3GIWA 4XLNF 1P3JA 4MKRA 5ARDA 2C7QA 2AJDA 3X1JA 4IY1A 2C0PA 3H97A 3I12A 1JHDA 4C7VA 4URZR 2OWEA 1KWKA 3WDKA 2O3UA 4JOSA 2GKGA 1Q0KA 1NYLA 4YJDA 4PN3A 4IHQA 2IUUA 4LOHA 1NE7A 2QLBA 4CIYA 4YK5A 2FLWA 4TYNA 1XCGB 5IJ9B 1U0GA 2JB9A 1NVDA 4PAQA 1E60A 3LUPA 3KZKA 3RIYA 5A3VA 1LTQA 3WYDA 5C35A 4PC1A 3VDRA 1A88A 5TPZD 1UBNA 3OMLA 4KH0A 1RMVA 3UA3A 3O4IA 2R25B 3PP8A 3CZ5A 2HTFA 1UPCA 4D4GA 4EUFA 1PJZA 3E9NA 1PS0A 1SQGA 4CMKA 1S8OA 3OEWA 3KS9A 5KSYA 2YQ4A 4OAPA 1GRQA 3TBFA 1VK5A 5JNSA 3H2KA 4BLUA 3WICA 3B8HA 2PSJA 3AVTA 3PUIA 1UT5A 3CGGA 1N92A 4MI3A 2EIXA 4IVPA 4XCXA 1L7OA 3TLEA 4H16A 4M1QA 2Q6KA 4OM7A 2FF5A 2M9MA 2C9BA 1N3LA 1D6MA 4RCYA 1FCJA 3ORYA 4TT8A 4B40A 2RH5A 2Q3CA 3RK4A 2QQEA 1TK2A 1LV7A 2EV9A 1S3GA 2C5FA 3A14A 2Q5FA 5C51B 3W9BA 2RDMA 4LBVA 3URMA 1C9EA 1U7UA 5F1PA 2GJ8A 1A82A 3NKVA 4EPYA 2BKXA 4OIFA 3P27A 4XD2A 3T0FA 4CIXA 4JL6A 4BO8A 3OZXA 4C3UA 4NECA 1SD2A 1SXJC 1DBSA 4O4HA 1E84A 4WCDA 2VAWA 2OVFA 3EARA 1MHPA 4AJIA 2NQ8A 1DC7A 1IY1A 3KUXA 2HKVA 1KQNA 3WNCA 3PYXA 2Y1FA 2VQ3A 2RGGA 4HB0A 1SRRA 3VU1A 5ALFA 3HBAA 5ESWA 1HZJA 5LJIA 1QH8B 4IJWA 1MO3A 5K09A 5CXUA 1MPXA 3HU2A 3NWEA 1B8UA 1PSZA 5D2CA 3TW8B 1XT6A 1EIZA 3NORA 3ZXUB 4MUYA 2XJ9A 1SPXA 3DV0A 3FF1A 4JVSB 5DHTA 4BJ6C 1OOEA 3M6VA 4ZCRA 1NURA 2YXDA 3I62A 2IELA 1FZTA 5CDUA 4W1PA 3UUWA 2I7XA 3A3YA 4YRZA 5TDHA 2XD4A 5T4HA 4CTMA 4M8KA 2QZPA 1VE1A 2ETVA 1HFEL 3IAM1 3NNNA 2GEUA 4RHTA 1J8QA 3NVAA 3BA1A 4PGFA 2I71A 4NAVA 3LUTB 3LUAA 3M3PA 3M4ZA 5TQ0A 1Z45A 2QP9X 4X20B 2J3KA 4PRYA 3EDRA 1PS8A 4YRIA 2BCJQ 2BR3A 3B6JA 3PDCA 3IT0A 1ZVVA 1SZDA 3JWHA 5BWLA 3W7BA 2ID9A 3AM1A 5I9LA 2XLMA 1VYKA 4F0JA 4UBNA 4LF8B 4B7XA 2P2ZA 3IA2A 1V2GA 3QPUA 3FR7A 5JNTA 4FQ5A 1QVXA 3K9GA 3R7WB 3G2LA 5EWLB 1C8BA 1DL5A 3HGQA 3LT1A 2QR5A 4MAAA 4ER5A 2QT9A 2BI8A 1YF3A 4G2NA 2Z8YM 2IEGA 2VT6A 4YRCA 1J00A 1JMYA 2GEBA 4NJMB 2FWNA 2NPUA 5BSMA 1L4LA 4J7UA 4XR9A 3TNYA 4X5OA 4I9UA 3FZQA 1KKLA 5DRYA 1KO7A 4XWKA 4K9KA 1Q5PA 2H08A 1COWD 2HRBA 2JFHA 4CKZA 4KQGA 2XRMA 3ER9A 3CN9A 3CY6A 5JU6A 1QCYA 1C3OB 5FXMA 3Q3HA 3QMVA 4IIVA 2GCGA 3VX4A 2IYLD 4IG9A 2FJ0A 2B98A 1JB1A 3BGIA 3IGFA 4B4KA 2ZU6A 1MW9X 4V03A 4AJLA 2ID7A 1LC0A 1SO8A 1XELA 1GPDG 2W6PA 4E5PA 2GPAA 4PBTA 3R8CA 3B2NA 3H05A 4BPBA 3RUHA 3ZC4A 1JLKA 4RFLA 1C3XA 2JDID 1I4EB 2PVSA 3R41A 3EA0A 2JGJA 5J2TA 2ZYDA 3FMVA 3WGGA 1E2UA 3K20A 5A5EA 2R7QA 1GN8A 4OGFA 2ZRGA 4G8CA 4D3YA 3W8NA 3KWJA 4I08A 1YA8A 4LJRA 2AZMA 3FCYA 3NIGB 4EZEA 2OM6A 4IDHA 4QG3A 2ZXEA 2AEFA 4AZWA 4J0CA 3FX2A 1DS6A 4AROA 4PGHA 3S0XA 4HTFB 3TZ6A 1UZAA 3T1NA 2LBPA 4EF6A 2LRHA 3HRIA 2QRVB 1P7WA 2ZIXA 5DTEA 3RK1A 1HGXA 2XSEA 4MQ4A 1VGQA 2ZS8A 3KOXA 1W96A 3GZNA 5FWAA 2YJGA 4UCWA 5AVOA 3FB4A 3AB8A 4WJLA 4JBYA 2VRNA 5A0TA 2ZIAA 5BN3A 5C7LO 2AOTA 5LBTA 2KGOA 5JSLA 2YXNA 4BCBA 4UKDA 4MVJP 1IG0A 1O5TA 3H75A 3RK0A 4M0EA 4YROA 2PD4A 8LDHA 5FWNA 2GN9A 3F8SA 2QR2A 2FZCA 3G2QA 4TWAA 3G2IA 2F8TA 1RQ7A 1C7FA 1JDBC 3PL1A 5LQMA 1YI1A 4M8IA 2PUFA 5DTJA 3IFSA 5JD3A 2TMVP 4AXBA 2Q4OA 4HWPA 3I8SA 4TTTS 1F8XA 5IWCA 2F90A 2XMBA 3QTLA 2QV7A 3NP7A 1U0RA 3MXTA 1HI9A 1UJ6A 1ID8A 4F1JA 4AX4A 1Q7RA 5CYPA 4V38A 3JZIA 3AVYA 3JWIA 2YIMA 1MN6A 1TYEB 1IWBB 5L3QB 1N9KA 4WUVA 4DDVA 2VDKB 1EWVA 1YQ9A 2I1WA 2PGIA 3WP0A 1MIOA 1PFVA 3I5YA 3H3XA 5HJEA 5LM3A 1M1UA 1UPXA 2FW1A 1HDOA 1XRQA 4LZPA 1QU2A 3RJ9A 2X0IA 1E9EA 1EWYA 3AB7A 2Z04A 2YICA 4R2XA 3PNBA 4NOJA 2X13A 3GW8A 4BJ5C 1TAQA 3W5AA 2IF2A 2FDRA 3ROMA 1FDUA 2D1TA 5AUPB 2VYQA 1PDVA 3PFFA 1ABEA 3VSEA 5HKOA 1Q84A 2ZP1A 1ZIDA 3KWLA 1WVGA 4LBYA 4H1VA 2AN4A 5KYXB 3EGDB 1CX9B 1R0KA 4F4BA 2G77B 2PLRA 3OKAA 4Q4AA 2VHTA 3TZEA 2ICWG 4JYPA 3UHFA 1N2CE 1W5EA 2Y3GA 4BO7A 1UOPA 2YVQA 4Z2YA 3REOA 1DTWA 3QA9A 4RIEA 1RXQA 4F2WA 3VZRA 4GICA 4RZUA 4C7XA 3OURA 4KQ9A 4WDRA 5HKAA 1H8EA 4N6HA 3EQ7A 1ISFA 4X0EA 1KOGA 2QYHA 3MTIA 3SC6A 4MVUA 2P2LA 3WOVA 3EVTA 1IUOA 1B6TA 1KO8A 2PU5A 2ET6A 2YNMD 3VM6A 1KAQA 1CUBA 4R8KA 1LBIA 5KTNA 3UHOA 2ZUTA 2C9DA 1AOXA 3KB6A 5KSZA 5DBEX 2Y1DA 2ENUA 4KMSA 2C98A 1OC2A 3KXLA 1NN5A 5BRJA 3MGKA 1EWKA 4A16A 2ZSEA 1EZ1A 4JDUA 3G8BA 5L53A 5LZ5A 3R3WA 4NG5A 1RQRA 4QGBA 3FYDA 3QTHA 2IH4A 3LX6A 4GLBA 5EINA 1ONNA 3L4BA 1TQHA 3HTXA 5KTPA 2ZFUA 4W8GA 2B9VA 3EHMA 1TKRA 1H9GA 1TTQB 2I9PA 2VHWA 3AI1A 4P54A 1CUGA 4G5SA 4N47A 4RDCA 4LJLA 5CYOA 3FR8A 1G63A 1U1FA 1R88A 4MUHA 3MPUA 3P32A 1USKA 3KMIA 2RGYA 3ZDRA 4JURI 3NFYA 2BR4A 4XX0A 5BXYA 2D8MA 3WRXA 3TAXA 3RM3A 4ENPA 1A5TA 2XE8A 3KKKA 3L7JA 2OM2A 3K3PA 4KEAA 5BOSA 2C5EA 1KDPA 5KREA 2Q3DA 4M1ZA 3AKDA 4GXNA 3H4MA 1DDGA 3D6TB 1GTG1 2PH1A 4CEIA 1EFPA 5E1OA 3QXGA 1S05A 3Q1LA 5E7IA 4B4UA 2VTBA 3DEYX 2Q5QA 3S2EA 5C9ZA 3DWWA 2V98A 4OHPA 3X1MA 3CW2A 1KZ7B 3HB1A 5FV7A 5IS2A 3TL2A 2X4LA 2C9YA 4XSHA 3NRCA 2V3CC 3PHHA 4H7JA 2D06A 4PWYA 2DGJA 3VDQA 1QQ7A 4O1MA 3BCSA 1G18A 5CJPA 5FEUA 2CY0A 2OQMA 1JG1A 3DB2A 3K5WA 4U2FA 4LF9B 2WM8A 1ZHZA 3B3AA 4OXRA 4WT7A 3NIBA 1GKLA 4EITA 5DLQC 3MWGA 3EH2A 1KMIY 3TVYA 1UM9A 4B6JA 4BU0A 4TN1A 3MOIA 4ER9A 5C8DA 2P2DA 3VX3A 5JY6A 4MKHA 1RACA 1U0SY 2WTEA 1V11A 1KKMA 3JCUQ 5HKBA 2EWMA 4E5NA 1Q44A 2H4XA 5LZ8A 4JWKA 2H92A 3W8DA 1V5IA 2R8XA 3UPTA 3B51X 4L78A 1HOXA 4MVJM 4XZ3A 2PXCA 4GE3A 1U99A 3ESDA 3CO5A 2QYOA 3UPUA 2OV8A 2HJMA 5JSHA 3KSUA 1EK5A 3V6MA 1X2EA 3PB3A 3CPSA 3F5SA 1TCUA 4TTQA 3T35A 1RW4A 1KAMA 4O6YA 2ERYA 3C7DB 3FGPA 2RJ3A 1K06A 3ZBQA 2FYTA 1NY5A 4CV0A 4TMWA 2A9QA 2FDCA 2OCYC 3IUJA 1CUXA 3CCFA 2PZBA 4B09A 1CCWA 1SWWA 1PZGA 1BVRA 4BGVA 2YN2A 4G0VA 2ZJ1A 4RM3A 5L40A 5A9RA 1WCV1 1HMOA 4MKGA 1Z2DA 1IK6A 2B3TA 1TO2E 3JQ6A 5FOXA 3WR5A 1F2VA 4DQ0A 3AEKB 1OX4A 5B6IA 4KVFA 1YJBA 2FCRA 1TQGA 3EPLA 1MDFA 1OT3A 5K0CA 2LZ0A 4J2OA 1TL7C 4R41A 1ZQ1A 1KZGB 1SELA 5DYYA 3IPXA 3PC7A 5FEMA 3WNQA 3SHOA 3QH4A 3GP5A 1QG6A 4C14A 2YTZA 2P4HX 3G9XA 1YMQA 2I8LA 4EO7A 4KIWA 3MHPA 3V5ZA 2WLSA 4RV5A 3RC3A 2HRRA 1POWA 1I4WA 5DSXA 3VBEA 2O3SA 1ZN9A 3GD5A 3SDZA 2OCKA 3GC6A 4HC4A 4ZYZA 3RYFA 1UC5B 2QENA 1P7CA 3EEFA 2OO7A 1TUBB 4L8GA 2GO1A 1ESMA 4DB4A 4P3KA 2AFIE 4LTNA 4ZOLB 3AEUA 4W9NA 1X9GA 3KUCA 5AW1A 2ACVA 2EARA 2AMFA 4CN9A 5P21A 1P2VA 1CBUA 1IHOA 2XVYA 3L8HA 4R81A 5I4KA 2ODPA 4G1MB 3TZLA 3PNVA 1S02A 2IH2A 2WWFA 1KK3A 2P68A 4PLVA 5IANA 2VA8A 1L8XA 1KKUA 3UT5B 5DBOA 4KLAA 1GG9A 2CE7A 1VC2A 2Y68A 2HW8A 2H7CA 2HN9A 1M2KA 4ZREA 1JIVA 2EGGA 2MDTA 3PYMA 4ENSA 1U28A 2VSNA 3MINB 5TF4A 4ZANA 1WXIA 2GPNA 1ISJA 1V2HE 4DLPA 1F1BA 4A5SA 2HJRA 2H2HA 1V25A 2QGFA 3N8HA 4EA9A 3JASA 1P2DA 2PM8A 3ZUPA 1STOA 2EYQA 4L5IA 1MC1A 4AMBA 3ZHZA 5TB5A 4FFBB 2O8EA 1C0IA 1C5KA 3DZGA 2HMVA 4E7SA 1NVGA 3Q6IA 2PD3A 2Q4DA 4HGQA 4LLEA 4QQ8A 3MD9A 2ZRIA 3OWHA 4HWTA 3LCRA 1SR8A 3M33A 1U90A 1OBCA 1P1IA 2FP3A 1KSJA 3TKYA 1BW9A 5D5PA 2F3TA 5AW6A 4QBHA 3MUEA 4LXXA 4X8LA 2IIVA 1DELA 5I9MA 5HW0A 4H4CA 3RU9A 1NQTA 3V80A 1SXQA 2AWOA 1OGYA 1AQLA 3SYNA 3BKWA 1TZJA 1Q19A 3LA6A 1H0RA 3QEOA 4OHRA 2BBSA 4E6EA 3THSA 3KKBA 1PVVA 3TJZA 2ZZNA 2A30A 5I9SA 2NSLA 5FAXA 3EPVA 4K9SA 1FUYB 3ETJA 3DJFA 1V16A 3ZTZA 4EHNA 3TEFA 1M0WA 1OXSC 3E9QA 1U0OC 2CMHA 3KJEA 1OFTA 4R71A 4OJQA 5CA0A 4OI2A 4ZVKA 3ZWQA 1FTYA 4ZQGA 4EDFA 2WZGA 3SF0A 4ITVA 4YJFA 4QJ5A 1M34B 3NPMA 1C8KA 3ADBA 4IGKA 4IQ8A 2O3JA 4JELA 4NOKA 4BMOB 2HLNA 1K4KA 1PHPA 1IVSA 3GNTA 1ANKA 3WHPA 1M72A 3BX1A 1NQ5A 3AL0C 5DXAA 5F3DA 3TIVA 2C83A 3RAFC 3KB2A 2P3SA 3G02A 4WGZA 2NSDA 4UEWA 2G4LA 5JBQA 4LSZA 5K1ZA 4WMLA 4EGAA 2FPWA 1DBIA 3B0PA 1PEKE 4WD3A 4U7WA 3OSZA 1DXHA 5FWDA 2AFHB 4WLUA 2OECA 5ICMA 2AUNA 4AJKA 1ENYA 3IURA 3FTNA 3WLFA 1Z0DA 4ZCTA 3SC3A 1FYDA 2OSVA 4M99A 2QL9A 3ASVA 1PZXA 1ZUD1 1ESZA 1I1QB 2UVPA 4IDDA 2WJHA 4M55A 1KEWA 1EE1A 2HU8A 3D6NB 1WY7A 5FIUA 4BKRA 1TM7E 2FV8A 1E7SA 4DVYP 1A4UA 2NP7A 4LYYA 1ZGHA 4IDPA 1A7AA 5EJ2A 2XR1A 4GM4A 3IE1A 4D42A 3MVEA 4OLHA 4CMJA 1FS5A 1U2DC 3PTLA 1BQEA 3RTBA