4YT4A

Iron guanylylpyridinol (fegp) cofactor-reconstituted hmdii from methanocaldococcus jannaschii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
345
structure length
345
Chain Sequence
b'NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEHAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 131
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt4A01
1FMCA 1EVZA 3TOXA 2YFHA 4CLDA 4DTIA 4E3ZA 2G5CA 5KIAA 1AGNA 3EGOA 4CLHA 5IZCC 4GWKA 3IKVA 4NNJA 4QO8A 1T24A 2QRKA 4WNCA 1N5DA 2EERA 2W2LA 4WUVA 2D0IA 1RYEA 2DFVA 4FFNA 1Y81A 3H8VA 4RPGA 1CQIA 5CPFA 2HMUA 3RFVA 4LSWA 1R4MB 2I99A 4QT0A 5IXSA 3ZWOA 3Q2IA 4IZIA 5T8KA 3VZQA 3W4KA 5ENVA 2OORA 4FFMA 1XWFA 1LSOA 2O50A 3WLFA 1UXHA 3TZQA 3UCXA 2QZZA 3DTTA 1E1KA 4IY1A 2D8AA 1FDUA 1I5RA 4R51A 5L4LA 2O3UA 2VHXA 1K6XA 1EBFA 4Z0HO 1XQ6A 5C5IA 3FTPA 2BI7A 3KVOA 3LT1A 1B14A 1NVGA 1BVUA 3QW2A 5JDCA 3RC7A 2AQIA 4W9NC 3BIOA 1E6EA 3K8ZA 4FW8A 4DGSA 5KJCA 1ZFNA 1R15A 5DCWA 4TKMA 2Y1DA 4AJ1A 1WAMA 1GCOA 3OETA 3NRCA 3LSYA 3R6DA 3I1JA 1GV0A 4HUJA 1JN0A 1I2CA 2PZLA 2VUUA 2B4TO 2I6TA 3B6ZA 3BHMA 3GGOA 1KEWA 3JQ9C 4BGEA 4B3JA 2GUGA 4PZDA 4WKGA 1ZK1A 2HUNA 3QWHA 5COAA 1DRWA 4Y6RA 1HETA 1PS0A 3LLSA 1XIVA 2ZTLA 4WK6A 4LRSB 5T64A 2J5RA 2E48A 3FPLA 4OOEA 1H93A 4OGWA 1PS9A 3GEDA 2HMTA 1E1MA 5TT1A 5JCXA 3GF4A 4IS3A 3AUAA 1PL7A 3OMLA 1HE3A 1Q2XA 2FPPA 4XQGA 1NQTA 1GQYA 4XIJA 3F5QA 1NAIA 3KXDA 2CF6A 4O63O 3GVHA 1R4MA 3PYXA 4PGFA 2VRCD 4OM8A 1MC5A 4PZCA 3HDJA 2OGUA 5K6AA 2FSVA 4MOWA 2I9PA 4IMPA 2PA3A 5BSEA 2X22A 3AY3A 3U62A 3H6KA 2VYND 2X1HA 4NH4A 5TJ9A 2GZ3A 4KOAA 3P5SA 2CVOA 3KLPX 4J7UA 4F45A 1ZW1A 3H9EO 2FN7A 5G0SA 5AVOA 1P45A 3DC2A 1YOVB 3F4LA 3WXBA 4ITUA 4WJZA 4R5MA 1EMDA 1JKJA 5ICSA 4N7RA 4ZA2A 2IZ0A 1LC0A 2BMAA 2CFCA 1MG0A 4CV2A 2Y1FA 1CWUA 3UCEA 1ISGA 2V6MA 1EVJA 4R9RA 5FFFA 4UEOA 1E3LA 1SMKA 5HS6A 3WDSA 4PLYA 3HZZA 4P22A 3INRA 3NUGA 4GX5A 2R6JA 1HL3A 2CNBA 2QRJA 3M2PA 3FCOA 3NGXA 1UZLA 3SEFA 4IM7A 5A03A 1I3MA 3KEQA 1IZ9A 4CMEC 2P5UA 5DOZA 2QW8A 2GASA 3C7CB 2GR9A 2GERA 4D79A 3AI1A 4QUKA 5FYDA 1KVRA 5A06A 3UF0A 1GD1O 2X5KO 3GUYA 1FDVA 3PWZA 1PGNA 2FR1A 3DOJA 3BTUA 3QVOA 1ENPA 5EIOA 1NFRA 4XEHA 3U4IA 4EJ6A 1SCUA 3IS3A 5K9ZA 2W2LD 1J0XO 2AQKA 2RH8A 2PTGA 1GFSA 4RO0A 2Y1OA 1O8CA 2X23A 3ASVA 4BO0A 3WBBA 3SC4A 3I6IA 1WZIA 2D1YA 1GTMA 4W9NA 4OYRA 1UUFA 3JQ6A 9LDTA 5JDIA 2V6GA 1Q7BA 5TC4A 1GADO 3EZYA 3I4FA 1M6WA 2EKLA 4BNJA 3BTVA 5I7EA 5FF9A 4H16A 4ZRMA 2BELA 4YRBA 1P0FA 3MWEB 4WLUA 2PZJA 1YRLA 2DBQA 3JQ9A 1OC4A 3D64A 4W7HA 4B7UA 5DZSA 1VPDA 1VL8A 3K31A 1P3DA 3W6UA 3BHIA 3D3WA 5A3JA 3D5QA 1MA0A 1MP0A 4BMSA 4XR9A 4CMGA 1ZSNA 3WSWA 3BTSA 3MJCA 1HDXA 1SB9A 1C3VA 1OBFO 4R1UA 1N1GA 1NPDA 3A06A 1FXSA 4JBHA 1YBVA 2Q99A 3OIDA 4Z9XA 3OECA 3R0IA 1P1JA 1X13A 5DBIA 3ZNQA 1Y6JA 1IPEA 2HQ1A 4YWJA 3GFGA 4GI2A 1GUZA 4PRLA 3LT4A 4O5OA 3HADA 4I8XA 3K6JA 4J7XA 2B36A 2PH3A 1AN9A 1OOEA 4CMBA 4RVUA 3ZHXA 2DVMA 5F21A 5JC1A 1DHRA 2PNFA 1EE2A 4CODB 2XOXA 3HDHA 3ORFA 1UZNA 3I6QA 3KO8A 1YJQA 3ANLA 4J0FA 3JQBC 1YQXA 1ONOA 2JCYA 4WCFC 4AICA 4CR6A 2HRZA 2ZB3A 1FF9A 2DTXA 2UDPA 4XDZA 4A5OA 1LDEA 7ADHA 2GGSA 2YQ4A 4E0BA 3ON5A 1DIAA 1IHXA 4RVFA 1EK6A 2W4QA 3E18A 3HNPA 3IDSA 4QXMA 5CDSA 3OP4A 1E5LA 4PLZA 2Y99A 4F3YA 5TQVA 1T1SA 3WYBA 1HE2A 1X7HA 2FPIA 1Z7BA 4XX0A 4NK4A 3DWFA 4OL9A 4MVJG 1VRWA 1VE9A 3NGLA 1I36A 4LSMA 1S7CA 3BMNB 1WDMA 2X5JO 3H2SA 1H2BA 2OXIA 4QECA 3UH1A 3H2ZA 4RV9A 5JC8A 2JHGA 4YQYA 1DXYA 1ENOA 4HFRA 1A9YA 3RWBA 4E33A 3OF2A 3RASA 3I23A 5F1OA 1WPQA 3BMCB 1EQUA 3DMTA 5C7OO 1Z82A 2FSSA 4XQEA 5FEUA 3P2YA 5ITWA 1C0PA 3FNHA 5KCZA 5JO0A 4J43A 4WCFB 4BKRA 4KP7A 4FS3A 2IEDA 3TL3A 5JBIA 2I3GA 4XWYA 1PTJA 4W6ZA 3RC2A 3T7CA 3ZWCA 3DQPA 1DRUA 2VWPA 2FWMX 4M89A 4WLNA 5COBA 1R12A 2Q45A 3A28A 3DBLB 3EVTA 4ALLA 2X6TA 4E4YA 3AK4A 4BGIA 3ROPA 2PFGA 4NU6A 3S55A 3B1FA 2CUKA 3S8MA 2AE1A 3RBXA 2RCYA 5T57A 4PG4A 1PSDA 2V6BA 3PHHA 3AJRA 3D4PA 2GN6A 3I9MA 4CM3A 3IP3A 2X4GA 3RC1A 2NWQA 1ZK4A 3TRIA 2CDCA 4OO3A 5CDTA 3GY0A 1IOLA 2J5KA 1LTHR 1PX0A 2W2KA 3M6IA 3OA0A 4UREA 3RI3A 5HTOA 2Q1SA 3ZHZA 2O2SA 1KC3A 1B2LA 1MG5A 1KOLA 4B79A 4LCEA 1HRDA 3K92A 3PLNA 2ZYGA 2WWRA 4N54A 4HWKA 4BNXA 5CDYA 2GPTA 1A9ZA 1WVGA 8LDHA 3VVCA 1DJNA 4HFNA 4FFOA 1BWSA 5DP2A 3BTOA 3BMCA 5CDGA 1E3SA 2YDXA 5EESA 2DBVO 4GPD1 5TX7A 5KTKA 4E30A 1H6BA 2RBEA 3JQBA 2DKNA 1HLDA 1H6DA 4FJ1A 3PDJA 3PZRA 3G17A 1BDMA 1B8VA 4YJFB 1PU2A 1GPDG 3LC7O 4FDAA 2IXBA 5L7TA 2TMDA 3S2GA 4DLBA 4Z0TA 1H94A 3RU9A 1GZ4A 3DBLA 4R1SA 1TLTA 3UUWA 4BNIA 1IULA 4ZHSA 3RIHA 3I4CA 4B8WA 2RHRA 5G4LA 2X0RA 2PD3A 2VTDA 3Q9UA 1QRRA 3PWKA 4NG5A 5COQA 1B26A 3H9UA 4J16A 5A9TA 1MLDA 1V3UA 3QQPA 1I24A 1XDWA 2DAPA 3C1OA 1NAHA 1HDCA 4J9VA 2NSDA 3H5NA 4R5HA 1HYEA 3FNGA 4J2HA 4IXTA 4U0JA 1QV6A 1MUUA 1NHWA 4YT8A 4OSOA 2PKQP 4KTTE 4QSMA 1ZK0A 1F17A 1LLDA 2DFDA 4DWVA 3TZCA 6LDHA 4NFSA 1YQDA 2NU9A 1WNTA 3CMMA 3PJGA 4RPKA 1LC3A 4YTEA 5CAEA 1W0CA 2HSDA 1DBVO 2PD4A 3GRKA 3OICA 4UUPA 4A0SA 4DMMA 2EIHA 1FDWA 1GQ2A 3TFOA 2VHYA 4P4GA 1HDOA 2EG9A 4YJFA 5I7FA 2JD0A 5JSFA 3E5RA 1Q7CA 2SCUA 5IG2A 3DFUA 3O26A 3DEYX 1UDCA 4IUYA 1SOWA 2B35A 1UH5A 2ILTA 5HS4A 1M6HA 3DBVO 4Z9FA 4YPOA 1QYVA 2DBZA 4P38A 4RQTA 3ZV6A 1P33A 1T2EA 4DYVA 4WLEA 1JQBA 2E49A 2ZYAA 2PGLA 4XQ9A 5C7IO 4YAGA 2PZMA 1YDWA 3VOSA 3SVTA 1BVRA 1RYDA 2VUTA 3MJ4A 1I3NA 2CVQA 3OH8A 1GL3A 3OJOA 5KJ1A 2WJPA 3AU9A 2EP5A 3BAZA 1U7HA 3NDRA 3SXPA 2NADA 1SOVA 1I3LA 4CM7A 4NR0A 4CMAA 1B16A 1D3AA 1YL7A 1ZXBA 2WDZA 3DZGA 3GDOA 4PLPA 4QO7A 2G17A 3RFTA 5C37A 2Q2VA 2JAHA 4GGOA 3JQEA 2A35A 2R00C 4BO6A 3DHYA 1H5QA 3ZU5A 1J6UA 1GEEA 3ZNOA 4U8GA 3MEQA 3F9IA 1ZUD1 4Q9NA 1LDBA 1UZMA 3LLVA 5ER9A 4FN4A 5JW6A 1YE3A 3WNVA 4ZQEA 2Y1CA 1PIWA 2VYVA 3PTZA 2Q1UA 1Z45A 3F5SA 4OHUA 1TEHA 4MJLA 4YR9A 2HDHA 1B3RA 5BNFA 1IHYA 4BS9A 1EFKA 4M86A 2C0CA 1R6DA 4OIMA 2C54A 4BNHA 3DAGA 1LLCA 1GAEO 1ZXLA 3SLKA 4ZU3A 1QXSA 4IXWA 4FOSA 5A5FA 5CEEA 3GNQA 3WGIA 2EP7A 1JU9A 2PKRA 2YV3A 2OUIA 4YT4A 3ZZNA 1IZ0A 3ZCXA 4IMRA 4ESOA 4H15A 3WGHA 1ZSYA 4OQZA 4BNYA 2JFHA 1KS9A 4KDFA 1P74A 4D3FA 3GUCA 2VRBA 5JLAA 3F1KA 3CKYA 3PZBA 1I32A 2X9NA 3UICA 1B8PA 4GWGA 3VPSA 3HE3A 3EY4A 4PLTA 3WQRA 3VH2A 4XYLA 4ZGWA 5T8KC 3G49A 4DREA 1UP4A 2P68A 4H7PA 3LU1A 4N5MA 3U4CA 2WD7B 3AM4A 2VHVA 1QV7A 2P4QA 3GA0A 4FFPA 2BH9A 2B4QA 3ZWYA 1D7OA 1Z6ZA 1Q1NA 1U2GA 2C07A 1JKIA 3LC1O 3E82A 4TRNA 1BSVA 3ZHYA 1ADFA 2JHFA 4AJHA 5JDCC 1B7GO 4K6FA 5EERA 4BOYA 4BNKA 1U3VA 4A2CA 4LRTB 4NBRA 3W8FA 3TWOA 5L7YA 4PG8A 4NQZA 1D1TA 3D5TA 3IOYA 3WGZA 1M75A 3NX4A 4KTVE 1BDBA 4RDHA 4YB8A 2QIOA 2YV2A 4E2XA 1QSGA 2AA3A 3N74A 2H6EA 1Q7GA 3FHLA 3AFNA 1WDLA 3VPGA 2DBRA 4YXFA 4B4UA 1JW9B 4YAEA 4I5EA 2CMDA 1CDOA 5DT9A 3ZU3A 1GYRA 4FBGA 4FOOA 3ANMA 5FWNA 4IGEA 2J6IA 2O3TA 2QHXA 2VWGA 3KETA 1SPXA 2VOEA 3WICA 2JKVA 5JFOA 4L75A 1ISIA 4XQCA 3SC6A 3NJ4A 5DCYA 3VTFA 4WOJA 3V1UA 1U5AA 3I83A 4CM9A 1CF2O 4B8ZA 1EUDA 4J49A 1JVSA 1PJBA 1N7GA 5A3VA 2AG5A 1F14A 4TRRA 2WYVA 5K6AC 3B70A 1LRJA 1EZ4A 1Z73A 3EMKA 4IDGA 4MP3A 4U7WA 1ADGA 3GVCA 4I9NA 2ZKLA 4DXHA 4PG6A 2ZK7A 4HP8A 3VPFA 4MINA 4E31A 1XU7A 3DTYA 1CQJA 1HE4A 1PJLA 3EZLA 2YW9A 4PN3A 3EK2A 4FSHA 2GN4A 4ND1A 1I8TA 3H3JA 2GSDA 4G5HA 4PVDA 3PQFA 1UDBA 1W4ZA 4NBVA 4BNZA 5IZ4A 2HJRA 1EEHA 2BRUA 1V3VA 4JIGA 3PI7A 1HXHA 4E5PA 4J0EA 2C5AA 2X0IA 1ULUA 4XRRA 3K30A 2C29D 4IINA 4HNGA 3RUFA 1LLQA 1XSEA 3FBTA 2NV6A 1ENZA 2VNSA 3DZFA 4CMHA 1XGKA 5AQ1A 4BHTA 3VHRA 3CZMA 4BO3A 4BIIA 4ND3A 4W7IA 3IL2A 1U3TA 3C8MA 4M55A 4YQZA 4FC6A 4FGSA 1UXKA 3DZJA 3KYDB 1PGPA 4FIZA 1JKFA 3GN2A 3I9KA 4HY3A 4Q3AA 3IQDB 2RIRA 5L51A 5J23A 4F6CA 1PEDA 1VJTA 2EKQA 3COSA 4EITA 3NJ8A 5ILOA 3QV1A 1HSOA 1DPGA 1I2ZA 3ONDA 3DAPA 4LK3A 5B4TA 1HSZA 3NT4A 3F4BA 2RHCA 3DDNA 2PKQO 3BMOB 1E3IA 4BO4A 3M1LA 1XELA 2X7HA 3ZN2A 3GDFA 1BTOA 1ZK3A 1TB4A 1ZK2A 1HE5A 1LU9A 4RVDA 1A72A 2BFAA 2IE0A 4A10A 5JDIC 2BFPA 1X14A 4XA8A 3L4SO 3WJAA 3ZWVA 2WEKA 3UXYA 1E1NA 4L4RA 3WSVA 1EVYA 2V6FA 3E9NA 3Q6IA 1SZJG 2BLLA 2FMUA 4YJHB 2I76A 4EUFA 1BXZA 1UXIA 4W82A 5ITVA 4JLWA 1NYTA 4TZTA 5BR7A 4LGVA 3C1AA 4MVJH 1QKIA 2WMDA 1O5IA 2QG4A 1XCBA 2C82A 3CMCO 1MC4A 5G4KB 2DTEA 1FDTA 1ZMOA 3GAFA 4L4XA 2DC1A 1WZEA 4WNIA 1I3KA 1ADCA 4INAA 2DQ4A 2H1SA 3D4NA 3W4IA 4X54A 4XYBA 2GYYA 3K96A 3G3EA 1GV1A 4YDRA 4J9UE 1K6JA 3RROA 4DQXA 3SBOA 4CL3A 4CM1A 3JQFA 4Y67A 2POQX 1BMDA 1F12A 3KYDA 2V7PA 2W8ZA 2Q1WA 4TROA 3ROKA 4KUEA 3ZV5A 1PZGA 4O1MA 2ZB8A 1NR7A 3OQ1A 4L4SA 2XAAA 1Z75A 3GPDG 5DN9A 3ITDA 1YGYA 3QWAA 4YACA 2NU8A 1DRVA 3NT5A 3H5AA 4KUHA 4KQWA 2W90A 5EQDA 3BMOA 5JMWA 5TGDA 4NFHA 5CPBA 1A7AA 2HU2A 3QY9A 5H81A 4PG5A 5B4VA 4EEZA 3LT2A 1XA0A 3VH4A 4WOKA 1Q0QA 3NTRA 3IIEA 1T25A 2A4KA 1C0KA 4ZQGA 2PGDA 4GLOA 4AJIA 1S6YA 5DOVA 4E21A 3NAQA 1F0YA 2J3HA 3ULKA 2P91A 4FGWA 4RF3A 4NHEA 5CG1A 3D3WB 2CY0A 3JQ7A 3PDUA 4HKTA 5IDYA 1DIBA 1VJ1A 1OMOA 4CV1A 4YJHA 3BZUA 2DPGA 4GQAA 1ML3A 5BNIA 3NDIA 2YQ5A 3A4VA 3CTMA 3V2UA 3PHJA 3GZNA 3EDMA 1ADBA 2O3SA 2FPGA 4Z3DA 5G4KA 2VUSA 1ZKMA 9LDBA 2HJSA 3RC9A 1NR1A 2PWZA 4F46A 4YA6A 4EZBA 4EJ0A 4JP2A 3V2GA 1PQWA 1LJ8A 5FI3A 2P9EA 3DMTC 4DYDA 3WTBA 1XLTA 4NIMA 4ILKA 1B8UA 1JWBB 1QORA 3HDQA 3PJDA 3VZRA 4JJIA 5L4SA 1PWZA 2ZCUA 1HT0A 3JQAB 1XKQA 5I9LA 2OP0A 4P8RA 3TJRA 3WBFA 2XXBA 4DQVA 4LMRA 4PLGA 1H6CA 2UUOA 1E3EA 2YY7A 1PGOA 5L95A 4XGNA 4RPHA 2O3JA 1PZHA 2QZ9A 4IZHA 2FHSA 1I01A 5H82A 3LQFA 1CIVA 3ZH2A 4CLXA 1YB4A 4ID9A 1R0SA 5U9CA 5T67A 5HA5A 4AJEA 4R3NA 3TZHA 5A02A 3JTMA 5G2OA 5THKA 2O2YA 1E7MA 2F1KA 3BA1A 5A9RA 1GYPA 1KBZA 3HFGA 3LDHA 4J1QA 4K1LA 5B12A 1A27A 5DDIP 2WYUA 1NFFA 3UOGA 1N8KA 3DMYA 1SAYA 4JQCA 2BGMA 3DBRB 3ICPA 1C1DB 1DC5A 3GH3A 5BQFA 4CM4A 1H2HA 2Q50A 5G0WA 4DVJA 3BXXA 4L8VA 4ALKA 1KERA 4KWIA 1LSSA 1YB5A 3QVXA 3W4JA 3HB5X 1PQPA 3C85A 3TFQA 2B69A 4TVOA 4BKPA 3FD8A 2O3QA 2FY8A 2G0TA 1T2FA 2NLOA 4HFMA 3JV7A 2I67A 3KRTA 3U4DA 1M76A 4YAIA 5GZ3A 1UAGA 3PGXA 4JCOA 3OQBA 3AOEA 3PLRA 4ROSA 1JWAB 1MXHA 4K28A 3F3SA 3MJTA 2ET6A 3PRJA 2VZ8A 2A94A 2IZ1A 4IQGA 4M54A 3H9GA 3JQDA 4JJFA 1B3BA 1PS8A 4D43A 1HWYA 1JLLA 1GR0A 2NACA 5C7LO 5I8ZA 4M87A 4RLSA 4AL4A 2A9FA 4LVCA 3PFFA 1F8GA 4LW8A 4D45A 4BNGA 1PJ4A 3DR3A 2G76A 4CM6A 4JNKA 3JQAA 5L3ZA 4C4OA 1UXGA 2E82A 2NNLD 5BT9A 1ZCJA 4EYEA 1YJ8A 3GVXA 3R1IA 4S1VA 4BNWA 5ICMA 1BHSA 1I0ZA 1L1FA 5KWEA 3GG9A 3ZWWA 2BGLA 4I5FA 3AUSA 4WLVA 4CL8A 4CMIB 4IDDA 4JROA 1VM6A 5U1PA 1HTBA 1OC2A 2BF7A 3W1VA 4MO2A 3OSUA 2HAEA 1U28A 3A9WA 2XPCA 1GEGA 2J8ZA 2HRBA 1KVSA 4YAKA 1ID1A 5THQA 4XD2A 2B83A 2P5YA 2W2KB 3D4OA 5A04A 2PV7A 4GKVA 1LRKA 1P1KA 3DBRA 2QYTA 1LRLA 4Z3KA 2Y0CA 1U4SA 1C1DA 1I33A 4PZEA 1ENYA 1MX3A 4BNLA 1J49A 4FCCA 3B20A 4D7AA 2EEZA 4J6FA 2X58A 3MTJA 5DBGA 4YCAA 3OHSX 1HYHA 3AY7A 2D59A 3RKUA 1CETA 1MFZA 4D0SA 4EUEA 3MWDB 4URFA 3L6EA 4A73A 4JGBA 5KOIA 2IEBA 1AE1A 4RJTA 1X0XA 3ENNA 1RM5A 4IQ0A 2VT2A 4GVXA 3Q9NA 1OZAA 3ZW9A 4IDAA 4J91A 3WB9A 2G82A 3KZVA 2QYSA 4IDEA 2EJVA 1BW9B 1YBAA 2VQ3A 3ZV3A 4N5LA 4EI2A 6ADHA 3OIFA 4GMFA 2PK3A 3O8QB 3DOCA 3PXXA 5TJHA 4B4WA 2HK7A 4E5KA 1ZO8A 4QFDA 4FFRA 2OFPA 3FNFA 4XGIA 4CMIA 1HDGO 2IYPA 3WFJA 1XG5A 4B3HA 2UVDA 4Z0PA 3CINA 2GD1O 1DO8A 3FSRA 5L7WA 1SEPA 4I08A 1PGQA 5L53A 1BG6A 5HM8A 2GZ2A 1R37A 5I9MA 4FB5A 1LBEA 5JNLA 1T2CA 1KEPA 3U09A 4DQUA 4EW6A 1Z74A 5BNTA 3GMDA 4XB2A 4TSKA 4CQLB 1DSSG 2JCXA 1A71A 3I9NA 4IS2A 3RUAA 2Y66A 4DL9A 2ZQYA 1QG6A 4GL4A 4KMSA 3U9LA 3RAJA 2GN9A 4EJMA 3A1NA 3IAHA 4E2WA 1YQGA 4LISA 1HKUA 3CIFA 3MJSA 3ZNNA 3PHGA 4NBUA 1E7YA 3EUWA 3PYMA 3GRPA 2IZZA 2J3JA 4P4NA 3VZPA 1L7EA 4B7XA 4E5MA 1DC4A 1IE3A 1ZMTA 1Y8QB 4D44A 5AXAA 1VKOA 1VL0A 2OO5A 5T5QA 3LZ6A 5MDHA 3ZWNA 3GOHA 2Y0EA 1X7GA 5KNLA 3KM0A 1F8FA 1BW9A 1SB8A 1EFLA 2Q4EA 5JAZA 3GVPA 3O8QA 1HZZA 3JD2A 5JAIA 3FI9A 1U5CA 3O4RA 2NUAA 4PVCA 4YT5A 5ADHA 1HDRA 1QYXA 3WOHA 1P31A 1HEUA 4R54A 4E13A 1ORRA 2YFQA 1HDYA 3JQAD 3O03A 1JVBA 1U8FO 4OXYA 4OXNA 3QRWA 1IB6A 5TSDA 1ZZEA 3VVBA 3JQCA 3WG9A 4CPDA 2EJWA 3ADOA 3GDGA 1QYDA 1X0VA 5DBFA 3MJVA 1JAXA 3E9QA 1EVIA 1ZJYA 2WD8A 2BHLA 3KSZO 5B37A 1DFIA 4KDEA 3IJPA 3O9ZA 4Q39A 2QX7A 5AXDA 3KB6A 3PQDA 1TI7A 4G81A 1D8AA 1U7TA 4Q3CA 4L0QA 2ZIZA 3LF2A 4CQLA 1U9JA 2R2GA 3WGQA 4UEJA 2Q3EA 1G6KA 3RVDA 1WW8A 3ZU4A 1ZVMA 3GNSA 2P4HX 4J1NA 4BGVA 5IFLA 4BO2A 4IJKA 2D4AA 5F3RA 4GSLA 1ISHA 4TMFA 3NTOA 4PIVA 1EBUA 3FN4A 1Y5MA 5GZ1A 1GUFA 2YYYA 1E5QA 4GKBA 3GHYA 1V9LA 1YKFA 3L4BA 3CXRA 3FWZA 4MVJM 5I7SA 1Y8QA 4MVJI 3ENKA 3ZWAA 3UW3A 3UFXA 5BSGA 5L45A 4XYEA 1X15A 4ALIA 3QHAA 1M67A 4WEQA 4L73A 1DAOA 2YDYA 2D3TA 5EQFA 3U4HA 4WLFA 3Q1LA 4OSPA 1Y7TA 5A4DA 2HKIA 2QRLA 3FBGA 3L9WA 4NU5A 3KTDA 1N9GB 4JBGA 2AQ8A 1G0NA 3UVEA 2P2SA 4RDIA 3S2IA 3DXFA 1E7QA 4GVLA 5U4QA 1X7DA 4J4HA 1T2AA 3HN7A 8ADHA 4JN6B 4JXKA 2HMVA 1EE9A 1O94A 1YB1A 5HBRA 3WX0A 1E3JA 2HMSA 1GUYA 4NFYA 1DFGA 5IDQA 2P9CA 1SC6A 2TMGA 5CG2A 4D3SA 1P1RA 4II3A 2JAPA 3AM3A 4RF5A 4RPJA 1EDZA 3H65A 2ZYDA 1MGOA 2YHIB 2ZTMA 3KYCA 1R66A 4XJTA 4CUZA 4FPXA 3FTNA 5TNXA 3RJ5A 4YJGB 4AJOA 1D4FA 1LDGA 1VJ0A 4PLFA 5T6BA 4MIEA 1VSUA 4FJ2A 2O48X 1LQUA 2Q46A 1E1LA 2PLAA 1RM0A 5FI5A 1X1TA 5ES3A 4NMHA 2AHRA 4Y98A 4ZRNA 4H3VA 3WMXA 3AW9A 2C7GA 1LA2A 1V8BA 2JL1A 4NBTA 4TVBA 4UUMA 2Z1MA 5CP8A 3UAGA 2PZKA 3IUPA 1PL8A 4RPLA 1MB4A 4E5YA 3ONFA 1U3UA 1H6AA 2B0JA 3Q0EA 4MKXA 3WYCA 1M66A 1SBYA 4E12A 3EAGA 4R41A 3JYLA 5F1PA 3WWYA 2RAFA 4CJXA 1L7DA 4CLRB 3WLEA 3E5MA 2C20A 5JMPA 5EPOA 4ND4A 2I66A 5IF3A 1JDJA 2Q2QA 4BV8A 3VDRA 1NP3A 4LCJA 5TS3A 1KETA 5JXWA 1B15A 1AUPA 3PFWO 5A9SB 4LN1A 1N9GA 3TOZA 4NJOA 1E7RA 2H9IA 2Q1TA 3L6DA 2VHZA 4U5QA 4HV4A 5IDXA 1ZIDA 1SNYA 4MDHA 2UUPA 2DM6A 3PJEA 4RGBA 5CEFA 2EF1A 2C7VA 3DZKA 5G0VA 4AVYA 4AJJA 4O0LA 4P4LA 1NXQA 1C14A 4I5DA 3WTCA 4PLCA 2YHIA 3SJ7A 1G1AA 4IQ8A 1A4IA 5G0TA 3CPSA 3IC5A 3PYLA 1E92A 2NVBA 5KVVA 3QLJA 3TZ6A 2OP1A 2ZB7A 2JFFA 4YJGA 4HX5A 3RUDA 4CMCA 2F00A 2OBNA 4YJDA 2PH5A 2JJYA 3INGA 2E6UX 3AM5A 4IDCA 1DB3A 1VC2A 5EINA 1E77A 3QVSA 5EL0A 1GZ3A 4BUCA 4HBGA 3EHEA 2I3AA 3H3FA 5EN4A 1H9BA 4BO8A 1E7SA 2AE2A 2AW5A 2FRDA 4GSKA 3WGTA 2X0NA 4CLRA 3RUCA 5BSHA 1N1EA 5JY6A 1ONPA 2YUTA 4UAGA 3OIGA 3QA9A 3TNLA 5EMHA 2WE7A 2UV8A 1LXCA 2B4RO 3UGKA 1NNUA 1KVQA 5A9SA 1KEUA 1C1XA 1P1FA 1U1IA 3NV9A 3EVNA 2Z5LA 1AHHA 3T4XA 3WFIA 3PK0A 2BD0A 2JFGA 4RF4A 2NQTA 4BKUA 4R01A 4Z9YA 3JQFC 3PHIA 3K2EA 2DU8A 2VTEA 1DLIA 5JYDA 1RM4A 1AXGA 1E0DA 5A05A 2O7QA 3LVFO 4BNTA 1M2WA 1PJ3A 2AEMA 1XYGA 1W8DA 1CJCA 4PFJA 3KV3O 4R1NA 1E3WB 1YONA 1O9BA 3VDQA 3ZDFA 1YVEI 2QQ5A 1TT5B 4MKRA 1XQ1A 2VCYA 4Q3EA 1ZEMA 5LCXA 4J90A 1TA4A 2IYOA 3Q2KA 4WLOA 1DIRA 4IIUA 3MOIA 1LUAA 4R4JA 4YAJA 4DLLA 1IYZA 2Z95A 4PRKA 3GAZA 3S1LA 5JAMA 4EBFA 3C24A 2DLDA 2FZEA 3FR8A 5C3MA 2AQHA 3E6AA 4XR4A 5JO9A 4MPDA 3V5NA 3H7AA 3OM9A 3HSKA 3D0OA 3OA2A 3SX2A 2UAGA 3ETGA 1RWBA 4GMGA 3PJFA 3GEGA 2Y0DA 1YXMA 4Q3BA 4YBZA 2VYVD 3BMQA 1LEHA 3F6YA 3QVWA 2Y1EA 3DZIA 4G65A 4CLOB 1K6IA 3ANNA 3HB4X 3QWFA 3QP9A 4MVJA 1NHGA 2CVZA 3WQSB 3VPXA 3L77A 3ZWXA 5TIIA 3JD1A 2JCVA 2Y05A 4YEDA 3GEMA 1FJHA 4BV9A 5A1TA 3V8BA 1UXJA 3EYWA 1LI4A 2VZ0A 3N58A 1QP8A 4D42A 4J4BA 4PLWA 4CM8B 4UVEA 3AY6A 2E37A 2EXXA 4DPLA 3FWNA 1E3WA 3JQGB 1R0KA 4MIYA 1TT5A 2IXAA 3RKRA 2ZB4A 2J3KA 3NEPX 1NPTO 1WMBA 1Q0LA 3QWBA 4E5NA 2ZJ1A 1J4AA 3PQEA 1RJWA 1YWGO 4MVJE 4BO7A 3JQ7B 2Z1NA 4MVJP 3HQ4O 3TF5A 4XYGA 3M1AA 3D1LA 3JQ8B 2Y68A 1HLPA 3AI3A 5DCUA 3BYZA 1G0OA 4NBWA 3GZNB 3S2EA 2ZTUA 1V0JA 1W6UA 4KWHA 2ZATA 3MOGA 3VKVA 1GZ6A 4RLHA 3DAFA 2OHXA 5IXYA 2Q2WA 3TL2A 4J4TA 4OJNA 4UVGA 2VNAA 4KZPA 2VT3A 5JPIA 1R0LA 2WM3A 2WTBA 3AOEC 1I10A 1Z7EA 3TN7A 4CLOA 3HHPA 2Y1GA 3FF4A 3JCZA 1PJCA 4Q3NA 4XYMA 3GHHA 2PGJA 2D5CA 1CERA 4XKJA 1LX6A 1PL6A 4BMVA 1LSJA 1T26A 5F5LA 1YDEA 4BQPA 4DIBA 1O6ZA 1XHLA 3V2HA 4BNMA 4I1IA 4D41A 1I2BA 4RL6A 1UP6A 1Y9EA 4ND2A 4CM8A 1XEAA 3HN2A 3JD0A 3JSAA 4TZKA 1PJTA 3PIIA 4IGFA 3CSDA 2LDBA 4QEDA 3JQGA 3V1YA 4CM9D 1B0AA 1W73A 3IUSA 4HFJA 3VC7A 4XJSA 3ZWPA 3TDKA 4O59O 2RH4A 3JYPA 1KVUA 2HLPA 4DMLA 3JD4A 4CM4B 4BO1A 2Y93A 3QE3A 3GGGA 1QR6A 3CEAA 3GPIA 5GZ6A 2AEFA 4BNUA 4BGUA 3JQ8A 4DBVO 1T4DA 1A7KA 2X8LA 1K3TA 4A7PA 1ZJZA 1GCUA 1N2SA 3CUKA 4FFLA 4OKNA 3DO5A 3ZV4A 3PGJA 1QYCA 2CZCA 4ZQBA 1P77A 2FOIA 4ZQFA 4WECA 4J1TA 1EQ2A 2GF2A 1A5ZA 3G1TA 2NTNA 4AJNA 5KJFA 2PD6A 3F47A 3U49A 4TKLA 5IZCA 1WMAA 1DFHA 4GLLA 3L6OO 4UVHA 4J1SA 4U6QA 3E48A 3H9JA 3PEFA 3SJUA 4E6PA 1DHTA 2IODA 3AOGA 4IJVA 1NVTA 5DNAA 3RJ9A 2UYYA 1TXGA 4BVAA 4MVJD 2AXQA 1I30A 1HZJA 1NWCA 4PLVA 3WMWA 1SEVA 4B3IA 3I3OA 5KJ6A 1PZEA 1XR3A 1O89A 2EW8A 3KSDO 3WS7A 3W8DA 2JD1A 3WGYA 2DUWA 1NQOA 5IN4A 5CDUA 2B37A 1FDSA 2A92A 2C2XA 3I52A 3OJ0A 1ISJA 1EK5A 4ALMA 3ZGYA 1JTVA 2IDZA 2OZPA 5K0ZA 2EW2A 4CQMB 4MVJF 3ASUA 2HK8A 4YRDA 2X9VA 2O3RA 3ROMA 2E4AA 2NVUB 5JY1A 3K5PA 5F1KA 2W98A 1AXEA 2FR0A 4QQRA 3VTZA 4AFNA 5JYEA 2H63A 2HCTA 3AU8A 4UVDA 1ZH8A 1IUKA 3LT0A 1PQUA 2BKAA 4GH5A 4MKZA 3L9XA 4IIVA 3HG7A 5KKAA 2I5PO 1E6WA 3UHAA 4Z6KA 3DONA 1YOVA 1MXFA 1C0IA 1MV8A 3E9MA 1U4OA 3V1TC 1GQQA 4U0KA 3MJEA 4U6SA 4RVGA 4CV3A 1Y1PA 3W8EA 4J3FA 4AJPA 3QSGA 3WQQA 2I65A 3MTGA 3U3XA 3U5TA 3RCBA 4XCVA 1ZBQA 2EGGA 4R9SA 4S3MA 3CE6A 1O0SA 1DDOA 2B5WA 2P9GA 2HMWA 4I9HA 3ROQA 3ETEA 3UCFA 3NKLA 3GN1A 1QYWA 4A03A 4OH1A 1BXGB 4PCVA 2FZWA 1KVTA 3RFXA 5B1YA 5CFZA 4K26A 4M49A 4BO5A 3GLQA 3PP8A 4ZN6A 3I9OA 3KSUA 1IL0A 1BRMA 2AEJA 3K2BA 3M2TA 4TRJA 4CUKA 2DT5A 4ZD6A 4WPGA 5H83A 1Q0HA 1EDOA 2C2YA 3ZWBA 1CRWG 1ISMA 2BFOA 4CQMA 3G0OA 3E8XA 4GX0A 2AMFA 5L40A 2VN8A 1KC1A 2NVUA 4EGFA 4RCVA 5TLSA 3WGOA 5L9AA 4I5GA 2HO5A 4RZIA 3O38A 4R69A 4E2ZA 1KIFA 3MCVA 5G0UA 4L9RA 7MDHA 4R16A 3ST7A 4RQUA 1QMGA 4E32A 4R68A 1NQ5A 5TT0A 3JD3A 4MIOA 5F5NA 1P44A 3QIVA 5HRUA 1CYDA 1PJQA 4DUPA 2PR2A 5TRTA 1RPNA 2WYWA 2Q49A 3GC6A 2J5QA 1KEVA 1WWKA 1YO6A 3GK3A 4CMEA 1T1RA 4HADA 4YT2A 4TWRA 3L4BC 1WP4A 4Q3DA 4JJGA 1UP7A 1VLLA 4RORA 3ETDA 4M1QA 4QTZA 1U8XX 3HDYA 3OQ6A 4R1TA 1BXGA 1Y9AA 3OEYA 3GFBA 2GLXA 2Y67A 5ER6A 3B1KA 1DLJA 3GVIA 3S2FA 4MP8A 2OMEA 1YL5A 3Q11A 3R3SA 2C5EA 4JBIA 1H0KA 1NASA 4WEOA 4ZVVA 5DULA 5IJZA 3NTQA 4NK5A 4DIOA 3P7MA 4YYZA 3DBHB 2O23A 4W99A 3ZU2A 3NYWA 3H5RA 3IMFA 1PJ2A 3JYQA 4L74A 3GQVA 4CMKA 2OL4A 3TZKA 4BKQA 1LNQA 4QX6A 3FNEA 4DLAA 4DIFA 2B5VA 2GN8A 2X9GA 4AG3A 4J7CA 3N7UA 5EJ2A 4XB1A 1EUZA 4M8SA 4TRMA 3VPHA 3ITKA 5IDWA 3HWRA 1HDZA 1GYQA 5KKCA 3QVTA 3R3JA 4GBJA 2YZ7A 1EUCA 3STHA 1KYQA 1PR3A 3IJRA 3MZ0A 3X2FA 3IKTA 1V6AA 1NQAO 1YL6A 4YRAA 3GZ4A 2CF5A 4DC1A 4FR5A 2EGHA 1WLYA 1LSUA 1K2WA 4RF2A 2BGKA 1WDKA 2NM0A 5ILGA 1E6UA 1VI2A 3BMNA 5GMOA 4JK3A 3A14A 4WASA 3PIDA 4IPTA 4IBOA 3ONEA 2VHWA 2C59A 2EHDA 4OOFA 1BGVA 2CSUA 3INTA 3HUDA 3HJAA 3CZRA 3GR6A 1V3TA 4LVUA 5I8WA 3DFZA 3FRJA 1DOHA 1H9AA 3X2EA 4WCFA 4L76A 4YVFA 3U0BA 2OOSA 2X0JA 3I9JA 3OJLA 4UVIA 5AXBA 3DB2A 3DBHA 1AHIA 1LDMA 4GGPA 3TQHA 4Y9DA 4IDFA 3C7DB 3DL2A 4DC0A 4DRYA 4XZ3A 1OI7A 3AUTA 4HNHA 5AOVA 4ALJA 5I7VA 2CDAA 3H4VA 4CR7A 3RBVA 4UUOA 5TF4A 3Q3CA 3F1LA 3KYCB 2X5OA 4ZQHA 3EC7A 4TQGA 3ABIA 4OQYA 5KVSA 1O95A 1SO8A 4CQMD 2VZ9A 4BB6A 2GZ1A 4UUNA 4D0RA 5AXCA 2ZQZA 3OFSA 4XRGA 3KHUA 3NT2A 2H5LA 3JYNA 3T7EA 1NTOA 3LC2O 3LYLA 3WJ7A 1DAPA 1ZSVA 3C1TA 5B4UA 3GMSA 3VH3A 4RVHA 2FR8A 4KQXA 4RVSA 3GNTA 2NTJA 1K89A 2G1UA 2NQ8A 3E1KA 1TT7A 5KVCA 3IP1A 3G1UA 1PJSA 5ENDA 4OMUA 4D46A 5LC1A 1LQTA 4B4OA 1U3WA 2O4CA 3BHJA 3FR7A 3OBBA 3PHLA 1NWHA 5DP1A 4BO9A 5I9NA 5MGBA 1Y8RB 4DBZA 2DPHA 1VKNA 2EWMA 1WXDA 2YJZA 4KUGA 1ISFA 4AJLA 3UN1A 1NFQA 4NI5A 3WYEA 4XDYA 1DC6A 4NJMB 3W6ZA 1U2DA 2FP4A 1DJQA 3QWIA 4DA9A 2LDXA 2GRAA 3WR5A 3PPIA 1ZEJA 2VWQA 1OAAA 1T2DA 4DPKA 2XXJA 1P1HA 1V35A 4Y6PA 2ZCVA 4FC7A 2GDZA 3C7AA 4FD3A 4OAQA 4CM5A 1UDAA 1IPFA 4EUHA 1P1IA 3K73O 3AI2A 4Y6SA 3WNQA 1N92A 3P2OA 1KY5A 2HK9A 4CV0A 4BMNA 3P19A 1HF3A 3F46A 5KJEA 3DHNA 3WWZA 4F6LA 3H9QA 1NX6A 5LDGA 3EW7A 3VAZA 5IAAA 1JAYA 4IJWA 2D2IA 1OFGA 1DIGA 1PZFA 5L4NA 2VOJA 5JCJA 4ONEA 3RU7A 3WGGA 3ZI0A 2O4UX 2ZTVA 2NTVA 4PG7A 4R3WA 1JA9A 4MP6A 4NDNE 4BQRA 2CDBA 4B7CA 1E7WA 4C7JA 1VSVA 4NPCA 4E2YA 1QLJA 4ZJUA 1ULSA 3G79A 3KUXA 4UULA 1C1XB 3DZBA 4BNVA 2GO1A 4N5NA 3RUEA 1R4NB 3D3EA 1Y8RA 2BI8A 5A5EA 3AWDA 4GX1A 3ZWMA 5BSFA 1PGJA 3GG2A 2X86A 3LF1A 1LDYA 4B4VA 1NPYA 5JE8A 1PWXA 4NJMA 4RZHA 3I9LA 2Q4BA 2WSBA 3RD5A 3DZHA 4AJ4A 3ADPA 4WCDA 1YS4A 4DPMA 4ZICA 3B1JA 4II2A 2VWHA 5DF1A 3RUIA 4BNNA 1RM3A 3TPCA 3DHEA 4BKOA 3VZSA 4WE3A 3AFMA 3OJEA 3KOUA 1PR9A 2NU6A 3D7LA 1CEQA 3KLMX 1LDNA 4UEKA 2XF8A 3RQSA 3WIEA 3VKUA 4OXKA 4BB5A 5CHEA 4K6CA 1NBOA 1GU7A 2CD9A 1T4BA 2NVWA 1NM5A 3KBOA 2IRWA 4AJ2A 3JYOA 4NZ9A 4A26A 1F06A 4EEXA 3TSCA 5AYVA 1UJMA 2PY6A 1YH3A 3L07A 3BMQB 1A4UA 1UAYA 1Y5RA 2DTDA 3LK7A 3PVZA 4J2OA 4PLHA 1YBMA 1QLHA 3L0DA 4O6VA 2NU7A 3KYBA 1VL6A 3K9QO 4CR8A 1BXKA 3VH1A 1IY8A 4CUJA 3E03A 1LLUA 2J3IA 4G2NA 5GY7A 4LMPA 3QJ5A 4BNFA 1MFPA 1GDHA 3DOOA 3KEOA 1R4NA 1P0CA 2DUUA 4GX2A 1X1EA 4EDFA 3WIDA 4OKIA 1DIHA 3T4EA 3OJFA 3SLGA 1NVMB 3FPCA 4ND5A 2YHUA 3HFSA 3GGPA 2VRCA 2GNAA 4A27A 4HXYA 1J5PA 1GY8A 3ZHBA 1K0UA 1C0LA 2EV9A 1XU9A 4N18A 1N7HA 4CMJA 3GT0A 5LDHA 1ZNQO 5HWSA 1RKXA 4AJKA 1TVEA 1P9LA 4QFCA 5JAQA 4ALNA 2VYNA 2WE8A 4CLEA 4FQ8A 4W4TA 4JX8A 3ZNPA 1R16A 4IJUA 1K5HA 3RUHA 5IN5A 2GCGA 1KY4A 5KVQA 4D3DA 3RBZA 2AG8A 2V65A 4XIYA 3CH6A 4BL5A 3C3XA 2EKPA 4K9DA 1UR5A 1ONNA 2R00A 2JD2A 4JP3A 4I9UA 5JS6A 2WD7A 4C7KA 4GAEA 3ICCA 1DEHA 2D5AA 3ZW8A 1GPJA 2OBYA 2ZJ0A 4WGGA 1D1SA 2O7SA 4IDBA 5CEJA 4XGKA 3UKOA 1HYGA 2BFMA 3NDJA 3I5MA 2YV1A 1ARZA 3AUUA 1DC3A 1FK8A 5JCJD 3OEWA 4Y8VA 3RSHA 3PWSA 4FJ0A
chains in the Genus database with same CATH superfamily
2ONZA 1ODKA 3FGPA 3FHJA 3RRYA 3HFJA 4WQMA 4JKVA 3QF4B 3ZCUA 2JANA 4QO8A 1L4LA 5K3FA 2EERA 1E9EA 1XTPA 1RYEA 4WZAB 1TADA 1T4CA 4PHCA 1AM4D 1JE0A 5GGYA 5D6NA 4IZIA 3RG8A 2QMOA 1RXWA 5J2UF 4IY1A 1NNI1 3M4CA 2HV6A 5CVDA 2YXEA 2ZRDA 3KVOA 1BVUA 3VYRB 3QW2A 4Y2GA 2AQIA 2FPLA 5KJCA 2P9TA 1GNVA 1ORWA 3GLGE 2QW0X 3DE5X 5IH3A 1FYXA 2O0JA 1HETA 4RIHA 1T5BA 2WJ4A 4BGDA 1PS9A 1KR5A 5TT1A 1F4LA 3WYGA 1OIXA 1AGPA 4KWCA 2K87A 3OWHA 3GA7A 1GQYA 3W6PA 3LUBA 4Y1RA 1EDEA 3LUHA 2FSVA 1XVIA 3RJZA 4PYRA 2RONA 4ZI3A 2Q9BA 1ELOA 1CF9A 1WXHA 1KA9H 1MB2A 5EKUA 3MMXA 2WIFA 4C4TA 2BSXA 1H9GA 4HJRA 2B8JA 3B1VA 1DXQA 2VATA 1DX6A 3TJ5A 4XLTA 1H3FA 5HS6A 3U7QA 3TLMA 3NUGA 5E2IA 4OLJA 3ZZMA 2R6JA 2PXAA 3VO9A 5TDHA 1JG7A 4JSYA 3UY4A 4FOPA 1I6WA 1XCOA 1S01A 1I4DD 3OQMA 821PA 5FYDA 1GNRA 1SVIA 2WHRA 3PWZA 5HFAA 5ISMA 1G20E 3O9MA 1M33A 4P3PA 2XE7A 3VNAA 4I50B 1P18A 2PTGA 1M8PA 4BY9E 1U0EA 1S1MA 4LJKA 3I6IA 3LXXA 1GRRA 4OYRA 2V6GA 3QPAA 4HWGA 3C63A 4HH4A 4FB4A 1OR3A 3JQ9A 1R0WA 3D64A 1SC4A 4N7BA 3WMFA 2DR0A 4BMSA 1C3VA 2ICWG 3QEMB 4ND7A 3ZNQA 1Y6JA 1IPEA 1Z15A 2NO6A 3G2MA 3IQZA 4BBAA 1JQLB 1UZNA 3V80A 1E98A 4RHXA 2UDPA 2CHQA 2GGSA 4B76A 1KH1A 4RKFA 1BOFA 1UJCA 2QUPA 3M83A 3EFHA 4YDHB 4US0R 1NGSA 2DHEA 2MCFA 1C9DB 3H2ZA 4RV9A 5DHRA 3OF2A 1MB3A 3P2YA 1C0PA 3DJUB 4DVYP 1XNQB 1IATA 4AX2A 2OAEA 4DIEA 3CTPA 3DBLB 4FE7A 3REFA 3S8MA 1U98A 2LD6A 4IH1A 3OT1B 4WXEA 4NTFA 1WQ3A 2A1UA 4OO3A 4QPZA 1RWPA 1U0OC 3B36A 5HOQA 1KOLA 6Q21A 1FBTA 2ZBEA 2DFTA 4Q66C 1V8DA 5H70A 1Z5GA 1E3SA 5EESA 5LZ2A 4E30A 5K01A 4DY4A 5BXYA 4ZO7A 2H7YA 2HIHA 2TMDA 3DF9A 1QDUA 1N75A 3ITEA 4B8WA 2DR3A 2W0SA 4UBJA 1MMNA 3I8SA 3MTAA 1PQ4A 4HL6A 3CEMA 4MV7A 3P97A 2DJ5A 5ARBA 2F1HA 2GCOB 1Y4UA 3JARB 2XMPA 2ETSA 3EGIA 2G28A 1NHWA 1ZC3A 2DCMA 5BYAA 5AQEA 1R2QA 1YQDA 5B6IA 5JS2A 5JPDA 1XNGA 2V0GA 2CBZA 1P4SA 3GT7A 1Q7CA 4HVLA 2Q3DA 3AUXA 1LKZA 2BGIA 3A05A 4S1WA 4RZUA 2VJBA 3TTUA 5M2QA 5K2MA 3HA2A 3OJOA 3A4LA 4CM7A 1I3LA 1ZUIA 3UC9A 2HCBA 4QATA 1FOEB 1EDDA 1VSQA 4PYKA 1RWVA 3WNVA 3PTZA 3F5SA 3VYTB 1Z2AA 5DGXA 2Q0XA 2Z15A 3QVKA 3ZZNA 4H15A 4HYQA 2P9BA 2Q27A 2B7LA 2XT0A 2B78A 1YK0A 4DA8A 5FBRB 5BQHA 5DX8A 3G49A 3COVA 2FX2A 4KZKA 4C2AA 2P4QA 1FLAA 1ZHHA 1XA4A 4LECA 1P0QA 3TYXA 5JDCC 1ZP6A 4A16A 4A2CA 1PR4A 3TWOA 4KAFA 3PDIB 4MRRA 1BDBA 3TQCA 1KQGA 3THYB 1DBRA 2CLFB 5LZ7A 2CL6X 1JW9B 4YAEA 4DQKA 3WIBA 4X8MA 1L4KA 4B45A 3FDZB 1GLVA 1I1HA 2EAUA 1YDIA 5EJ8A 3KVYA 1K5PA 4EMBA 1OB2A 2WLTA 2XT6A 5E2QA 3AQ4A 4Q82A 1AKQA 3QKRA 2EFCB 1TF5A 1Z4JA 3OTIA 3KAJA 2OQ2A 5FNZA 4HP8A 1XU7A 2GF0A 4FGUA 2ZULA 1JL3A 3EK2A 3EB9A 2X42A 3EEOA 2GNPA 5C4IA 1OF1A 5DYGA 2GZDA 4E5PA 4JJAA 1JPJA 1OGYA 3DZFA 3QYFA 2R44A 1L5WA 3L18A 4DV2B 1U3TA 5KOHA 2QI9C 2TYSB 2JD3A 5IASA 5EHNA 1VFPA 4UDXX 4MI9A 1ZK3A 1IN7A 2J0WA 1R5BA 3OCVA 5KTSA 2AX3A 2ZBGA 2HT1A 3IT0A 1G41A 2AD5A 2J9WA 4L4XA 3RW9A 3K0SA 1I3KA 2DQ4A 2DPMA 3D4NA 4D9CA 4X54A 3GL9A 4FNMA 4YDRA 3VSDA 4CM1A 2POQX 3KZ1E 1ECCA 4NL4H 3VA7A 2NP6A 4L4SA 4QI2A 5DN9A 3L0ZA 5DSZA 5IKOA 4NF2A 2BGJA 5TGDA 2IU6A 3NBQA 1T25A 4AJIA 1S6YA 4R05A 1CY8A 2NSJA 2YLGA 4RF3A 3D6FA 1R5NA 2CY0A 2Y1KA 1CRPA 1V4AA 1QG2A 3LY8A 5KSZA 2ZYWX 3PXBA 5EE3A 2SKEA 4YCCA 5BVHB 4MYTA 4MQ4A 3GYGA 2PWZA 2HHCA 3UV3A 4RVCA 1VLZA 4ETIA 3DMTC 2F3TA 3LY5A 3QXHA 1IHPA 1D1QA 3SZLA 1NN3A 3TJRA 4KMOA 3MMZA 2YY7A 4Z51A 1FNTc 5L95A 3BWXA 1PTJC 1I01A 2P78A 5HA5A 3TZHA 1TF2A 3JCUQ 1UWVA 3OE5A 2CYDA 1A27A 1MW8X 5CIYA 2X9QA 2YNMD 5AHRA 1KI1A 1GRQA 1JR3D 5JTTA 1QHYA 4Z9HA 1XZEA 1P8AA 1V9CA 1W29A 2VT6A 4K3VA 2O2EA 3PA8A 2ET6A 4AZVA 4IQGA 3CLRD 2QRQA 5I8ZA 2B9EA 5TJ5E 3SXZA 2BFFB 3CLUD 5KYWA 3P4YA 1ODIA 1MZVA 4HDSA 2ZYSA 3FCYA 3GRYA 3ZWWA 1W25A 4W9RA 3IQXA 2WZQA 5U1PA 3GJ6A 1M2VB 2ZJAA 3IP9A 3TQOA 3V9AA 3NHLA 3PGVA 4ZVSA 3FGOA 2IXGA 3QFFA 3ROEA 4AMBA 3LQKA 4D0SA 2X1MA 3L6EA 3M9XA 4BU1A 4JGBA 4NZZA 2Z5FA 4M37A 1HNWB 3ZHVA 5BN3A 2PAFA 1JRAA 5EP3A 1HEIA 5CXQA 4B4WA 2HK7A 1UJ5A 2YZ2A 1VPEA 5F5HA 4TN5A 1HDGO 4YN0B 1YARO 2HL6A 1BG6A 5KZMB 4L9AA 3THWB 4R9NA 4LLEA 1YS6A 4IS2A 4E09A 3RS0A 4EOGA 4CQNA 1CQZA 4GYKA 5AKHA 4B9AA 2A0WA 2Z4RA 2RGUA 1F2DA 4D8WA 3CIFA 2JASA 1BXRB 3GRPA 5CAEB 4JLPA 3WL7A 3EXIA 3FZYA 3MAAC 1DADA 2VDRB 1X80B 3EDOA 4KIJA 4YP6A 3THSA 3O8QA 1VG0B 4PVCA 3JZAA 1HH4A 3C1UA 2YFQA 3JQAD 2YLDA 2AWOA 2YWEA 1EJBA 5ALLA 2W4BA 3IJPA 1S7ZA 2BM1A 3KB6A 2ZS8A 3Q12A 4RVNA 4Q3CA 3FPEA 1P2UA 2CCJA 3EZFA 3FJYA 3AETA 3ASNC 3LESA 3FN4A 4Q1DA 2YYYA 3H5IA 3ROFA 4JENA 1SCIA 3CXRA 4CDMA 3FHCB 3NDBB 3ENKA 1X15A 1E4EA 1DCFA 1JUDA 1TU3A 4CNBA 1ZKDA 1DCTA 1V5EA 3N39C 2JGDB 4DCNA 4GMXA 1SIUA 1EXMA 4TLBA 1UK9A 1QQ7A 1EKXA 1YZLA 1JZTA 4NYIR 5JD5A 4BFCA 1T43A 1G6OA 3BMXA 1E5XA 4I55F 5ALUA 1I13A 2CLKB 4WWHA 2WC1A 3A9VA 1GUYA 3X43A 5IY5C 4II3A 3V7WA 4I19A 2KNHA 1KIMA 3JVVA 3LFUA 2Q46A 5J9FA 1V8BA 1C8VB 3CLVA 1PL8A 5HF5A 5ALRA 4M0LA 2O8FB 3ZVNA 3O3CA 2XJ9A 5HYVA 4REOA 3U3FA 3FPFA 3UMIA 2PBFA 4G5FA 3I53A 3QY0A 3CF4A 1WA5A 4U5QA 4MDHA 3QKWA 1N1DA 1KDRA 1XZIA 2GAOA 1MAUA 1FX1A 5JAUA 2OP1A 1XAHA 4DE5A 1CQJB 3MHPA 4AZ0B 1PL0A 3Q9SA 3VR0A 1DU4A 3JRXA 3PHF2 3WHKA 1EUYA 4ZVLA 2HJWA 1PBTA 1TC2A 1I3OA 2FW1A 2X0NA 3T6JA 1N1EA 5DNVA 3BN3A 2UV8A 1DKRA 4BVEA 1KGDA 3NV9A 2GM5A 4GP7A 3HWWA 4WK4B 3LP5A 3EASA 2AXPA 3I1YA 4MDYA 4FMBB 4H3SA 1O9BA 5ICFA 4LJRA 1QKRA 4MI1A 2QBYB 3QX7A 3A6GA 2HKVA 4RYDA 4ZALA 1G9SA 4TMXA 3IB6A 2DLDA 3EISA 3ZD6A 4X41A 1WKBA 1S4MA 5E0OA 1ZM7A 2XY4A 2EFDB 2IA5A 4MVJA 5J5AA 1EJ2A 4RFLA 2CVZA 2EZTA 4E51A 3N28A 4D4KA 2GJ4A 4U7HA 5EIAA 3H1GA 4KE8A 5LP6F 4MJ7A 1SKYB 1CULC 2WQ7A 2OBBA 3UMJA 3I76A 4V2IA 3I2JA 3K1ZA 4MMXB 1WMBA 5GAJA 4QDOA 1Z6PA 2X40A 1K7FB 1MVNA 4JJ6A 4L8WB 5DM60 3COYA 4G24A 2A78A 3H97A 5CBPA 3DAFA 1U7PA 1XMQB 4JEUA 1R0LA 2PUVA 3D7SA 3ES9A 1H4SA 2V4UA 2YRXA 1LX6A 1MQ9A 1NRXA 3MTIA 5BYKA 4O4LA 4UU7A 1NDHA 1CIPA 1Y42X 2GJ8A 4CM8A 1VTKA 3JSAA 1Z28A 4CRWB 1BX1A 4HFJA 5HKKA 4FYYA 5KAPA 4YUXA 2PT9A 4WBNB 1O97C 3I04M 1K3TA 3ZV4A 2VQDA 2VXOA 5DBOA 1P77A 1ZR2A 4DWOA 1JDZA 3JR7A 3T1QA 1SHUX 3W2FA 3AHEA 4NWIA 1D09A 2XVAA 3B51X 1AXRA 3VYSB 4LZWA 2ZUUA 4EHKA 4GQIA 2KJQA 3KV1A 4B3IA 4PFOA 2HMZA 1C9EA 1QHIA 5FTKA 4IWXA 2C2XA 2FEAA 2IDZA 1YJAA 1L7VC 4K9NA 4K3UA 4PYIA 3ENQA 4AFNA 2BKAA 1KO1A 1E6WA 2H9AA 2ZE5A 2P9HA 4G36A 2A69F 1L6IA 1AS0A 2I65A 1HNXB 3BDVA 1O0SA 4QEKA 3TXAA 1Z0AA 1DUIA 1QCYA 3UCFA 3NKLA 2QD4A 1DJLA 4K26A 1MX5A 2NAPA 2PBLA 4AWBA 1KZYC 5IKXA 1Y3BE 4PFQA 3TRFA 2C2YA 3ZWBA 1VPVA 3TD2A 2EYQA 1KC1A 4IYRA 5FWYB 4QUAA 2XQJA 7MDHA 3ZIAD 3IEVA 3VX3A 4H54A 3W6NA 1E9VA 2O8NA 5BXQC 2J0VA 2HOQA 3U9JA 1TYCA 4D3YA 2GEFA 4EW1A 1DKPA 5TRTA 2R48A 4MI6A 4YT2A 3L4BC 5DU2A 4ZQCB 2X0EA 1U8XX 3QNWA 1Y9AA 5ER6A 2PX8A 4DMRA 2EPNA 5FUMA 2GK4A 1UPAA 2BZ0A 4H9GA 1HFEL 4DLWA 3AR9A 3H99A 3DMRA 4XB1A 1H6GA 4M8SA 5ICGA 2V7EA 1GYQA 3IJRA 3MNFA 4FZ5A 5AW1A 2PZBA 1NQAO 1XZ8A 1S3IA 2XDYA 5CB4F 2Y0BA 1AUQA 2WAYA 4RMNA 3NBYC 1IM8A 5J4KA 1K06A 4CGYA 5KTMA 2PGOA 1VMDA 3ONEA 1GL9B 2YHBA 2HH9A 1CUXA 3DV2A 3NNDA 2CLOB 2ST1A 3EZ2A 1KGSA 1I5NA 4CE6A 1F20A 4AWAA 4P32A 2FFJA 3VI4B 1RI5A 3DP7A 5IT9A 4EG3A 3K3PA 5EWJB 1D03A 1VL1A 2ZR9A 1KJJA 5LBIA 5AI0A 3M4BA 4ZXFA 3IALA 3LUKA 3N2NA 2QT0A 4B47A 3JYNA 3AF3A 5FZTA 5LJLA 5BRJA 3E1KA 3OWTA 1F2VA 5GONB 4ABYA 4OMUA 3ABMC 4QEZA 3HKKA 2M6KA 3EEBA 3K2IA 5J2UB 5A4JA 1Y8RB 4AKEA 2GBPA 3KPWA 2P3LA 5KEIA 4FM9A 4QRIA 4Y6PA 2XCQA 2GDZA 4PHHA 1JG3A 2B1QA 3C98A 1T9HA 3IQTA 4AQYB 4OU4A 1I14A 2ZJYA 4A6EA 3ER9A 2XNCA 1Z5UA 2WUGA 4ER6A 4ZCSA 5KYUB 3WL3A 2QTLA 4E2YA 1CIJA 1ULSA 1M8KA 4FT4A 3LHDA 3BEDA 1C50A 3AWDA 3TX6A 5CVCA 3K0FB 4WK0B 5LD2C 1VJGA 4MR8A 3BE4A 2O54A 2WF9A 3RUIA 1FP2A 5J4HA 4W8HA 4P7KA 1I9CA 4ZOQI 3D7LA 3NIGB 1OWNA 4ARZB 4OGLA 3WL6A 3FFAA 1HFJA 1NM5A 4HDRA 3EXHB 4HI0E 2XR1A 3EIHA 5CVVA 4G37A 3ZCQA 1DEKA 4JT8A 1UG7A 5JZ9A 1SQ6A 3AERB 4D0GA 2CC2A 3Q98A 4DT1A 3HFSA 5FADA 3P9KA 5GOZA 5HXAA 2Z2IA 3WIVA 3B0PA 5A4FS 2VYNA 2XMSA 4JQZA 2P0AA 3O8OA 2EJCA 3IEEA 4N9WA 4V39A 2ZPAA 1KQNA 1QIDA 1NBBA 4ZJYA 4N41A 3FSJX 3P27A 3TBFA 1UK8A 2P9YA 4JOCA 4CLDA 1OD6A 2VJCA 4LYGA 5IZCC 4LDNA 1W1UA 2FWIA 2H4HA 1OAKA 1SUIA 2FWNA 4ULVA 1RADA 2VXYA 2BDTA 1Q20A 2D4UA 1VE6A 1Y6ZA 2NPIA 3OU7A 2I1WA 2OCXA 1TRHA 3AP3A 4QARA 2WMOB 2QZZA 4LRYA 1WPRA 3HJFA 3ZCTA 1TUGA 1L4HA 2VDQB 1O96A 5DNEA 1JDSA 4FW8A 2QMZA 4TKMA 2ZVPX 4MQUA 2BUBA 1A8IA 1GXSA 4IV5A 2XV1A 3M1IA 2B4TO 2J09A 3UHOA 3LCRA 2FFQA 2E48A 4FQ7A 1JSCA 1QRTA 1EM8B 4C7VA 3UMFA 4EPYA 2XJ4A 3F5QA 3KXDA 5TMBA 1V96A 5EKDA 1EYZA 3K0CA 1MC5A 2ZG6A 5B30A 4DV3B 5FOXA 4NH4A 1WD7A 2VAMA 1ZW1A 4Q37A 2FN7A 4LXXA 3F4LA 3DOFA 3BAFA 3R3YA 5ABPA 2IHVA 2O19A 4J0IA 2V6MA 5FBHA 5LXTF 4IHKA 1J5EB 4C0LA 2IUTA 4PYLA 1SBNE 2I2FA 2V0NA 5ALQA 4WTOA 3T4UA 5C3UA 5I3CA 3GRFA 2CXXA 1R0YA 2XUKA 4F7WA 2IIPA 2QAIA 4G01B 3VZDA 1I80A 2ZXPA 4MEAA 3OMXA 4ZMSA 2WQZA 1C1HA 3DEIA 2G67A 1QMPA 3K31A 3W6UA 2VI5A 1MA0A 4IEFB 3I12A 4PZUA 5I3ZA 3NTUA 3OCJA 1G55A 3OIDA 1U3GA 1X13A 2ONKA 2QYHA 1APBA 2J32A 4GI2A 2APJA 3MWYW 4PRLA 3ZHXA 3DJNB 1SVNA 3ANLA 1TQHA 4EA6A 3TGWA 3TSWA 2PU5A 1IHXA 1R9NA 4ID3A 4V3CA 1G8JA 4F3YA 1SUCA 1SPBS 1CV2A 2YS6A 4FOTA 5H4HA 1D1BA 2V6IA 3FE2A 2ZIVB 4OHYA 4OVKA 3QBVA 1H2BA 5CDHA 3SXJA 4LWPA 2HQRA 3OY7A 1J21A 1IMJA 3OD5A 3WVNA 4ZAWA 5HR5A 3RWBA 2H1RA 3STVA 3FZQA 2M64A 1WPQA 3OMWA 2BSQA 2F3PA 2PLWA 5JBIA 4XWYA 4NLLA 3S29A 2X6TA 1KP9A 4CVNA 2B1JA 5LBTA 1Q91A 2GN6A 4C6RA 1SQSA 1GVNB 3G82C 2W2KA 3H1FA 4EI7A 1QAMA 1T3HA 1WXGA 4ZCTA 3K92A 5DSTA 2HF7A 1EP1B 3LMKA 2CE2X 4KV9A 1JSRA 1H1TA 3IAS6 4PSVA 4QDJA 5KTKA 1R3DA 2XUQA 2OAP1 1HLDA 4UW9A 1Z2OX 1FYWA 1WG8A 2ZAMA 2WBLC 4TMVA 4MCAA 1QE3A 2GA8A 2XE8A 3D54D 3CJRA 5GOTA 3RT1A 4YH1A 3FB4A 2CJXA 2GQ0A 2GM9A 2VTDA 3WDLA 2XOKA 4PJNA 3LA6A 1FX0A 4V1CB 1X8JA 5E1OA 3SS7X 2GVZC 3TBHA 2PYIA 4ENTA 4IXTA 3KLNA 4NHOA 2HV9A 3HB1A 2DFDA 4DWVA 2C9OA 5AVQA 1LC3A 4Y1EA 1FSSA 3E9YA 4WNYA 2ZUFA 4WJKB 4JDUA 1SH7A 1PEKE 1TM7E 4NKRA 5LU8A 3BBLA 1ND6A 4F4JA 1U02A 4WA8A 5FLXA 3ZV6A 1T2EA 2IOFA 5CLJA 3MT8A 1Y4AE 1U0GA 1TZBA 1U7HA 1ESMA 4BYGA 1SOVA 4N3GA 5K51A 3PICA 3L82B 4L50A 1JB1A 4KXNA 3W5CA 3ZW7A 1RBMA 1IUOA 3C6ZA 3LJKA 3PQCA 3AXSA 2OUKA 1GSIA 2ASEA 2HNKA 1YAUO 2W70A 4JEIA 4WCVA 4BS9A 5C8ZA 2PUBA 3VVLA 3H2KA 1JKXA 1QXSA 4TMZA 3ZQJA 4IXWA 4KLRA 4YDQA 1CPQA 3WGHA 2PX0A 3D6MA 2NYRA 4YC7A 3D43A 2VT7A 3PZBA 4OXQA 1GHTA 1Z7Qc 5A7HA 2QTVB 2RHDA 4Y30A 5CW1A 3LGAA 2WD7B 2VHVA 4XWGA 2B4QA 4QBTA 3A6HA 4ENPA 2VF4X 1Z0IA 1SKBA 3OCUA 1B7GO 4UMFA 1OV6A 1TZMA 3TOLA 5F2NA 2D5RB 5FOVA 3ELWA 3FXAA 4XTRA 4IKPA 3AFNA 2RFLA 4YXFA 3IYLW 3WK9A 5DT9A 4XSGA 3L1VA 1QAQA 5C5EA 3EFOA 2VWGA 1YR9A 4ZAFA 4JBWA 4L75A 3MMPA 4LNAA 2XT9A 2HMYB 4QVGA 3V1UA 1JLHA 4PJLA 1PR5A 2F59A 3K09C 1E6KA 3OKCA 4MP3A 3US6A 1ZICA 3I1IA 4EVIA 5IULC 1FU8A 3LH5A 1QQTA 2VP2A 2WJ3A 3R74A 4PVDA 3VUFA 5IZ4A 3NETA 2PS3A 4WW0A 3GLIB 2YWGA 3KVRA 4YRCA 2VC2B 1MNAA 4NCIA 1XSEA 4IVNA 3RSGA 1NW3A 2YXPX 3IL2A 1TQGA 3DDOA 3Q3EA 4FEAA 2PGAA 2UYOA 1UXKA 4FGSA 3VPAA 4PZAA 5BV0A 2HUJA 4AY5A 3ONDA 3CM0A 3DDNA 2HDWA 3W06A 4LYFA 3REGA 2FEOA 4MKGA 5JCPA 2NXCA 3CQ9A 4YALA 1CS0B 3BGDA 4UM7A 3ESYA 3BOSA 2IE0A 3UJ6A 5BRNA 1CXZA 3CG0A 4BU0A 3L4SO 3OY2A 5BSMA 1T1IA 3TULA 2GD6A 4DNPA 3A0RB 1DT5A 4JLWA 4TZTA 2NZ8A 4LNUA 2NXWA 3UPDA 1ZRSA 3M4YA 5G4KB 3EUEA 1P5HA 1WUHS 2FHPA 3WI7A 1HLGA 3OOHA 1AK2A 4CEIA 5CRIA 5ESRA 2W6QA 4YPVA 1YDHA 4O0MA 4AWXA 3GPDG 4YACA 3EIUA 1SZDA 4KXUA 1A7AA 3TLCA 3IAFA 1Q0QA 3S90A 3UG6A 3TZEA 1Q5PA 2FPMA 4GLOA 3NAQA 3PUWA 1YA8A 4C78A 2P91A 3HVHA 4JR0A 3BFKA 1JMKC 1OMOA 1P2SA 2ATEA 4Z99A 1DINA 1ML3A 3R9KA 5AIAA 4BLRA 1U0NA 1CSEE 1ZKMA 4DIUA 3AILA 2BEJA 2O14A 3EVAA 4UHFA 2PXCA 3U13A 3RYTC 4X61A 3MT0A 3FHTA 1E86A 1H6CA 4IZHA 3JVIA 4ID9A 1UBFA 3GUHA 5THKA 5K7SA 4BYMA 2GAFA 5CA0F 1QRDA 1LE4A 3GH3A 1QOPB 1J5XA 4ZCIA 4KGVA 2MWMA 3D6UA 2YL7A 2LGJA 3W4JA 1VCIA 4X3CA 2FWAA 4C3EA 3W2GA 5IWAB 4I55B 3HJGA 3Q7RA 3TTVA 4PK4A 4CIYA 2JLAA 1QWSA 4HZUA 3IQFA 1DARA 2PHZA 2Z57A 3PR3A 1PJ4A 3G8YA 4LBVA 1MORA 3ZQUA 2IDKA 1TKBA 2AFHA 1XLWA 2XPCA 4K7BA 3W3AH 4YAKA 5A04A 4Z3KA 2WSSA 1TJYA 1VE3A 1OAOA 4JYCA 1PJZA 3A3YA 2JF0A 2OILA 1SKUA 4LFCB 1O0BA 3NM4A 4CGZA 2CLDX 1IJKA 3SFTA 4WFJA 4E4RA 4DDHA 3SHOA 4CQJA 2VF2A 4QG3A 2IYPA 4QHYA 2JB9A 2GD1O 1S2LA 2G25A 1QGED 2VTVA 5TMPA 2BBWA 4ZT3A 2GZ2A 4WV3A 2PQ6A 2J07A 4YL0A 2BONA 4G8DA 3HA7A 5LYJA 5TQJA 1DSSG 1N0HA 5IW8A 4P3OA 5KSYA 1EPUA 3A1NA 5KSWB 4DV7B 3SYMA 4AY3A 1EUQA 1ABBA 3F3MA 3PI6A 1LW6E 1RJGA 4F60A 1MJNA 4TMYA 3ZG6A 3GFFA 2IUUA 4WKBA 3WAGA 3T1NA 3K1AA 3NMKA 2Z56A 2IZ5A 3EZ6A 2Q6IA 1ZWKA 1CRLA 1EVIA 2MSKA 1EJ6A 2XA1A 1UKCA 3BSYA 2Q3EA 3RVDA 3O0TA 3H42B 10MHA 4GG1A 4K6KA 3MCUA 4DARA 3U7RA 1YCGA 4HXEB 4X65B 2ZITA 1IFXA 2HQSA 5GM2A 4Z8XA 2WUDA 2I8CA 4M7PA 3UV7A 4Y2XA 2Q4DA 2UUAB 3LWDA 1M6VA 5FNVF 3BHNA 2L2QA 2YCLA 4DG5A 1N0UA 1P1RA 1U0LA 2FEWB 3OVMA 3BQNB 1LQUA 5HNKA 5HZHA 3B7PA 2ROQA 4O08A 2BEVA 3R2PA 3GEPA 1MB4A 1KEZA 1SBYA 3JYLA 3I6MA 2MJLA 4FCWA 2C20A 2COEA 4JQOA 3QSYA 1NJ6A 4LOLA 4NEGA 2DY1A 4L4YA 5ALFA 1NMXA 4YCDA 2H4YA 4WABA 1O5TA 2DM6A 3O75A 4BQQA 5FWAA 4K2AA 4P4LA 4ZDIA 1HG1A 4I6EA 3WTCA 3FUXA 3NQ41 1M1YA 1A4IA 1FR0A 4WKOA 4YS6A 1RPZA 1JFTA 3BXHA 2E6UX 2PZEA 2YBEA 2QNBA 1ESZA 4Y2YA 1XZCA 3ZJUA 1KK0A 4IZOA 4BUCA 4YJ2F 2RMKA 1UF9A 1Z8FA 2A9QA 1E0KA 3T6GB 1KKLA 2CZQA 1MH1A 3TNLA 3NHKA 2B4RO 3G68A 1KVQA 4I14A 5HMMA 1H2WA 2BKLA 2GHRA 2J3EA 1DI0A 4BKUA 2QUHA 3ZTZA 5JYDA 3AH8A 3WL8A 5K0CA 1W8DA 3ETJA 5JAHA 1TT5B 5BURA 2MIIA 1G1MA 1UODA 1XQ1A 1YZQA 3FOFC 3UBMA 2WOOA 1TKCA 1GLNA 2HNAA 1CJTC 3DKRA 5CMLA 2CJWB 1IDN1 4IOKA 4XAQA 3O8LA 3I2FA 5TS2A 3L0IB 4L6AA 1K6IA 5EJ7A 4RD2A 3ZVRA 2G3KA 2HV7A 3LEVA 1SGWA 1GL7A 4PC2A 2IOFK 3BJZA 4EX6A 1NONA 5JNTA 4O4HF 1FJHA 4AIIA 5A1TA 1JG6A 4C04A 1ZPDA 1QYRA 4YI5A 2QTNA 4QBIA 1MT0A 3KB1A 3JQGB 1R0KA 2ZB4A 1GNPA 1VL2A 2E4UA 3U6KA 1YWGO 4BO7A 3ROZA 2V1XA 2YJTD 3BVPA 2A59A 4JI0B 1HLPA 3RPEA 2ZSHA 3M81A 4C21A 2QGFA 3O95A 1W96A 2YJNA 1CX9B 6CHYA 3OZWA 4X9XA 4XKJA 1KAMA 2ZT8A 3FLMA 2QN7A 2ZIGA 4OYYA 1XHLA 2R6CA 4K9MA 2JLXA 4O4JA 5CB4B 2IBMA 1B0AA 3KAKA 4XJSA 3EMVA 4KI0A 3TMKA 4N8SA 4BO1A 1FJXA 3S68A 1QR6A 4Z7JA 4QL3A 1KTMA 5GZ6A 2YWXA 3PFCA 1TQ8A 3QUBA 2CZCA 2XUGA 1VECA 3O4VA 4R2KA 4TUYA 3I01M 1SIWA 3RNLA 2PMBA 3F47A 3A4MA 1MDBA 3E0QA 1J39A 3GLVA 4A2PA 3GXBA 4DDVA 5KINB 1T0HB 1NVTA 3A1EA 4HOYA 4O8CA 4EPTA 4EIWA 3KALA 1JFFA 2ICAA 4NJEB 5CDUA 3LZCA 1VLVA 2C77A 1JHUA 4UEQA 1TWCA 1Y89A 3RRJA 3SKYA 4UVDA 3L9XA 2B2XA 3OZXA 4GUAA 4O2AF 4OQDA 3WB0A 1OROA 1THZA 4ZK6A 4OHRA 4JSRA 1KQPA 5E6SB 4I44A 1W7AA 3S5JA 3H3XA 2B5WA 1Z83A 2NVOA 5AVSA 4YUZA 2PDAA 4L15A 1ZLXA 4X1IA 5T3TA 3U4MA 2O2IA 4MXDA 2HS5A 1EDOA 5JJBA 2YMPA 1I2AA 5IANA 4KPUA 2HSJA 5L0HA 4LDQA 3E0XA 4CBVA 3QIVA 3A6KA 2II6A 3PUVA 3K1IC 4PHFA 4K81B 1WP4A 2P2GA 3D8TA 4BX9A 3AR3A 4ZODA 3S2FA 2OMEA 2J31A 3RVQA 4CS9A 3KWLA 1YLMA 2O23A 3CJQA 3KR1A 3JYQA 1PJRA 3TZKA 2E4WA 1NU8A 4J7CA 4V0ME 2YMMA 2QLJA 2CNWD 5B6PA 3VO8A 2YTZA 1UDXA 4ZI2A 2YUIA 4MS3B 2AJCA 4ARVA 4PRYA 3PIDA 5P8WA 1CLEA 3INTA 1F7VA 1XEXB 3N2YA 1QOZA 2QX4A 4DNFA 4JB3A 1ZHWA 1JBKA 3I9JA 3DLCA 1LDMA 2V7WA 5IVKA 4JZYA 3A7DA 2IVZA 1GT6A 4JOSA 3EC7A 4XD7D 3LVQE 4R0NA 2NUTB 4A15A 2QDKA 4EMTA 5ECWA 3UPTA 1B43A 3ZE8A 3NP9A 1Y3CE 3HP4A 2EATA 2J9BA 3E9VA 4IRMA 1EFHA 4M63A 2GF9A 2WJGA 2Y6UA 3WISA 2R1ZA 2YJZA 4KUGA 5AUOB 4Z4FA 4D8XA 4UATA 2O59A 4HAWA 3W6ZA 2FP4A 2ETVA 5LQCA 1V8ZA 4BASA 4HDQB 1BCSB 2QR3A 2GT1A 1BWPA 4X1KB 2XWSA 3KOXA 3DV9A 4TZ0A 1QH8B 4P4SB 3EW7A 3T9BA 4IJWA 1D07A 4LHWA 1YD7A 1DIGA 3FKSA 1EWYA 3BIXA 4MP6A 1VMEA 2E1PA 2ZANA 4C7JA 1N5MA 4HWRA 5CVUA 4NCAA 5CB6A 5DK4A 3PE3A 3UZUA 2VUHB 1X9IA 2X2FA 2OCYC 3I9LA 4M0UA 4BKOA 3VZSA 5TPWB 3FRIA 2OK8A 1MRZA 1UBEA 2AG6A 2H07A 1RQRA 2VJMA 1EK0A 4JRZA 4U9HS 3ZKWB 4EH1A 5CHEA 4MGKR 4PYOA 4LJ8A 1NU7D 1P8JA 2QT9A 2QK4A 1F06A 2BFBA 1OX4B 4HH3C 1UJMA 4A36A 1W85B 3L07A 1OLSB 1RJ9B 4CR8A 1K98A 3VH1A 3OOSA 5FI0B 1JBQA 3SQMA 4B6JA 1R4NA 3RAFC 3T38A 2WFMA 2ZM5A 3SF0A 4TYNA 3T4EA 3OJFA 4EY8A 4BLVA 4JVLA 1IZYA 3F49S 4N18A 3NRBA 4KR6A 4X60A 5T3UA 4FQ8A 1ZIOA 3LGXA 5KVQA 1IVYA 1TWAA 1J07A 2H5IA 2ZAIA 4K46A 2H1OA 3ICCA 4NCBA 1JEYA 1CGNA 3PXUA 1XNRB 4LRWA 1I5EA 4KXQA 3BK2A 1YZAA 4YIHA 3TOXA 1MAWA 3V33A 3CNQS 2KLBA 1XTIA 3IKVA 4MLDA 5LOVA 1NDQA 2JVIA 2C5GA 1OASA 3I0ZA 1G21B 3H2GA 1FVOA 4FFMA 3THRA 3MGKA 1DNPA 3EPLA 1I4YA 5EOVA 1H4TA 4U1RA 2GHQA 2CXHA 4CKXA 1E1RD 3C14C 4PX5A 3LM8A 4H3KB 5EHHA 1SR8A 5DTRA 2AOVA 1ACJA 1IAQA 1XCGB 2ZTLA 4WK6A 5JCXA 4RFVA 2NZWA 2VBCA 3QF4A 3EVCA 1RC1A 2VP9A 4A0HA 3OMLA 4C7OB 4NMLA 4WZAA 1NW6A 2ZRGA 2CF6A 1VLMA 2CMKA 1RWOA 3BM5A 4TLDA 1Y48E 1OR8A 3K0KA 3PKIA 4HTFB 1SHZA 4XM0A 3T61A 2Y0PA 1YOVB 4ITUA 4DB4A 4ZA2A 1KZ4A 5DRTA 3IUYA 3CF4G 3WDSA 1T8WA 3ACCA 4QUKA 2Q5JA 2OQVA 5EIOA 2IY7A 3R7SA 2AQKA 3ACBA 2G4VA 4BO0A 3P4XA 3SC4A 5FA8A 4DSZA 5D6OA 5TC4A 1M6WA 4LJ7A 4FT2A 5EIBD 5I7OA 2PT6A 2ZOSA 2R02A 5DNWA 2XKJE 4B7UA 4IILA 1VPDA 3IE0A 3KU1A 3E9EA 1CR1A 4XR9A 2IX3A 2RD2A 4CBEA 1HDXA 4LDRA 3OE4A 3PQ6A 1T2NA 4YJKA 2AN5A 4ER0A 3LT4A 3HADA 4I8XA 5JJ5A 2B36A 2PH3A 4MVUA 4JW1A 3DMDA 1K4MA 3ORFA 2RSLA 4P7GA 4Q4CA 1YQXA 2WWXA 4H7JA 2L69A 4HQ0A 2HRZA 2ZB3A 2W6PA 3R3XA 1TCUA 2I6GA 4RVFA 4ODIA 4D3ZA 4Q4ZF 2C9CA 521PA 2VZEA 4L9SA 4U6NA 4CCYB 1QF9A 2R2AA 4OL9A 4MVJG 3INNA 2G09A 2FE1A 4AD8A 1ZGZA 2FLVA 1P2GA 5EMKA 3UH1A 2OG2A 2EPKX 5IYZF 3UOAB 4MHSA 1LNZA 4YX9A 1T2VA 1GPMA 1OBVA 4KP7A 4FS3A 4JB2A 3ED5A 4W6ZA 4C0JA 2Z8YM 4DA4A 2E5FA 3PTAA 1XL1A 2IYZA 3N2LA 5EJEA 1RQ7A 3TD7A 2NZ2A 4NU6A 4O6MA 2I33A 5DM70 4HB2A 1PSDA 2GARA 3BDAA 3L4EA 2XMZA 4L0CA 4KAAA 1LTHR 3NMIA 3UATA 4Z1MA 2K2WA 5E33A 2V3VA 3OKAA 2WKPA 1KS2A 1A9ZA 1DJNA 1FDOA 2EPLX 2DBVO 2W6JA 3POVA 2Q5OA 4UHCA 1B8VA 1DBPA 1GPDG 3DBLA 2Q0QA 2PAAA 4OHBA 2PX4A 3IQ5A 4Q48A 4QULA 3OT1A 3TLBA 2C2WA 3ZDRA 3EOZA 4KWTA 4NG5A 5DISB 4BB9A 1AHPA 4GLFA 3E9CA 4MQEB 3TTXA 2G7MC 1M2NA 1DAHA 2YZSA 3ZQVA 4P3KA 4U0JA 1NM5C 2B1IA 4EHAA 1DQPA 4Y1GA 2AFRA 4DJTA 3OJCA 4PGGA 1ZZGA 1IBSA 5IM4F 4OB7A 4ZO6A 3MJHA 4LAFA 2OK7A 1KJNA 2AN1A 4HGNA 3TFOA 5AJVB 3KH2A 3E5RA 1UFBA 2B0CA 2GPJA 4DN6A 5JD4A 1KJYA 3R7FA 3HL4A 4OBEA 2IOQA 2PGLA 4XQ9A 3TSAA 4C76A 5DQZA 1YFKA 2C92A 4N5IX 4KXMA 2GCOA 1CY0A 3T5PA 3MMNA 4B3RB 4CMAA 2FZVA 3GDOA 5KTNA 3JARA 1XE3A 3SX0A 5E2AA 3HNJA 4BO6A 3HLZA 3DHYA 2NXJA 3R0XA 4TL9A 5AOAA 5JNVA 3UMGA 4ZQEA 1YOBA 4F5DA 2X6RA 1XV5A 3TJ6A 2IPOA 2AZDA 1R8YA 1D2RA 2IYFA 1DS6A 3OCZA 2AXNA 2AWCA 3WNBA 2AW3A 1G7TA 5E8JA 1IN6A 3CE9A 5AK4A 1L7OA 4YREA 4H7PA 4U5DE 2QM8A 4MEBA 3L7AA 2Q5QA 1W1WA 1ZZPA 1XTUA 4R2XA 2Y4OA 3I5YA 4ACAA 1ADFA 3T1VA 3S28A 4NBRA 4MB0A 2VTKA 2XNDD 4V0QA 1M75A 2B3DA 3TG2A 1Z7GA 5CA0B 4I5EA 5HE9A 5AVTA 1ZI9A 1UMCB 3W7BA 1QPZA 4FBGA 2ES4A 3L1HA 3KETA 3C8GD 5JFOA 3ZBQA 1U6KA 3LCMA 2M98A 1C4KA 3SJZA 3K0CC 2ZXUA 3WK8A 1JAZA 2ZWMA 1YCFA 1LI5A 5FO0A 3KZOA 5K3DA 4DXHA 3VPFA 1HDIA 5K3EA 1JECA 1K7CA 4PN3A 4FSHA 4ZVTA 3PQFA 5I48A 4M9RA 2R6ZA 2WJHA 4OINF 3AG1C 3EIXA 3VHXA 1FQWA 3CF2A 2C29D 1N25A 3THYA 1DCMA 1O77A 4EZIA 1HYQA 1J09A 3I9KA 3FDZA 2B8EA 2XUOA 3UAXA 4C0WA 1L7RA 4QTYA 3F4BA 5ALYA 1O57A 8AT1A 3UK2A 1NC3A 1DMSA 3WAKA 1A77A 3QKUA 1JEOA 2BFAA 4A4AA 2Q5CA 3FNQA 1V7PC 5K0NA 2BLLA 2FMUA 4XW2A 1BXZA 1DBQA 4W82A 2QG9A 4MPPA 2WMDA 1XKTA 5CX1B 2ZRBA 4RZQA 1X70A 4XVQA 2JJQA 4WVFA 1G8GA 3SBOA 3LA8A 2JGEA 1NMSA 3OQ1A 3N0TA 1XDBA 1Z75A 3GP5A 1YGYA 3ZCRA 1SCQA 1DTWB 1M2GA 2W90A 1E6CA 1RHRA 3NYJA 3ZE1B 3IR6A 4D57A 3GWLA 2XUHA 2YZGA 5SY4A 5ED0A 1MJFA