4YT4A

Iron guanylylpyridinol (fegp) cofactor-reconstituted hmdii from methanocaldococcus jannaschii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
345
structure length
345
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEHAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 131
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt4A01
3TF5A 1HETA 4BO5A 4M87A 1P1FA 4L0QA 3Q2KA 2CDCA 1YJQA 2GN9A 3FNEA 4BQRA 1Y5MA 2AE2A 4XEHA 2Q45A 1UXHA 4K28A 1HXHA 3JD4A 4DL9A 3V2HA 3JQGB 3C85A 4DIFA 1Z82A 1PS9A 3LLVA 1C0PA 3OA0A 2VOEA 1E1KA 3DBLB 4BMNA 3LF2A 4EEZA 3NEPX 3S2FA 2O3JA 3IDSA 4GQAA 2J5KA 3DHYA 1X7GA 2OGUA 5IXSA 4NFYA 1A72A 4J2HA 4R68A 1FDUA 4UEOA 3PDJA 1E1LA 1PX0A 4YQZA 1JTVA 3AWDA 3PHJA 4ZQHA 4L8VA 1U4SA 4ESOA 1YQXA 2X58A 3JQ8A 3EZYA 2X4GA 3WJAA 3NJ4A 4TKMA 4XYBA 3MWDB 5JBIA 2QHXA 4WLOA 2FZEA 1Q0HA 1H0KA 2Q1UA 3OICA 3E9MA 1F8GA 2UDPA 1YS4A 1OC2A 1B3BA 4J9VA 1NP3A 3PIDA 4BNTA 5JYDA 2VHXA 3HB4X 4XQGA 3MJCA 2ZQZA 4R51A 4EZBA 5KTKA 4XKJA 2CF5A 2DM6A 2UVDA 1NHWA 4GX1A 3GUCA 2X0RA 1AGNA 4K1LA 4CR6A 1AHIA 2HMWA 1N9GA 4BO1A 2Y93A 4NZ9A 3ORFA 1KVQA 1AN9A 1KC3A 3VH2A 2PKRA 4OJNA 2AA3A 3RU9A 3K73O 4MVJA 2J3KA 2Y1GA 4LCEA 4XDYA 4CQLA 3WOHA 4RF5A 5CHEA 5U9CA 2DVMA 2HO5A 1IHYA 1ZFNA 2Z1NA 4JCOA 4HNGA 5IDWA 1UDAA 1YRLA 4NPCA 1Q2XA 3C7AA 2FSVA 1HL3A 2YHIA 2B0JA 4R4JA 4TZKA 1UXKA 4CV1A 5A9SB 5GZ1A 2X5KO 2X23A 4IDCA 5ENDA 4GBJA 2WDZA 3HG7A 3G1UA 3JQCA 3E9QA 4UVEA 2CF6A 1GV0A 1DRWA 2X9NA 3F1KA 3QP9A 5I9MA 5KJEA 3ZWBA 2JCYA 3T7CA 3BXXA 2V6BA 3PIIA 4FGSA 3LT2A 3QVXA 3WGHA 1K89A 3DAFA 2VRCD 4I1IA 1E5LA 3K8ZA 3SEFA 1B15A 1QV7A 3QIVA 5ITWA 3T4EA 2BFAA 3VDQA 4EITA 3G1TA 2O7QA 3G0OA 4GMFA 4YBZA 2HLPA 1E3WB 4BVAA 4AJ4A 2P2SA 1QYVA 3NT5A 3TNLA 1R0LA 4W4TA 2R00A 4XDZA 4PLHA 1SAYA 4GX5A 1PZGA 1N1GA 1FDSA 1O0SA 4G2NA 4GPD1 2QX7A 3P2OA 3GVHA 4XYLA 1SC6A 1JA9A 4PVDA 3WMWA 4ID9A 5DOZA 1R15A 2GD1O 3TDKA 3Q9NA 4WEOA 4J3FA 1NPTO 3GA0A 3O8QA 1B3RA 5TNXA 3WG9A 3Q1LA 4B4WA 5L4SA 1GEEA 1WWKA 2BGMA 4NFHA 1E0DA 4BO8A 1QP8A 2JD0A 3HDQA 3BMOB 3TZKA 1HWYA 5CDSA 3WJ7A 1YBAA 2W2KA 5JDCC 2HMTA 4CLRA 3DR3A 2X86A 4YWJA 1GYQA 3D3EA 2CUKA 4BNKA 3QWAA 3PTZA 4YA6A 4HNHA 5CAEA 3LT1A 3DFUA 4RQUA 4R9RA 1KY5A 5KVCA 1OI7A 1LC0A 1J0XO 1DLIA 2PR2A 1I32A 1C0IA 4TRJA 3EW7A 4DYDA 5GY7A 3GFGA 4DGSA 1H9BA 1DO8A 3RKUA 1I3NA 1NQTA 1YL5A 3INRA 2I99A 3RU7A 2NNLD 3G17A 4GWKA 2OBNA 3LQFA 4KUEA 3NAQA 4XGIA 3RC7A 1U7HA 2OP0A 1DRVA 4P4NA 3KB6A 4HADA 4CM7A 2A35A 2ZTVA 3OEWA 4B3IA 1ISIA 1T4BA 3VHRA 5JO9A 2IZZA 3FNGA 2E82A 3RUCA 3HDYA 3OHSX 5ES3A 1WPQA 2EWMA 4JP3A 3DBRB 5A9RA 2PH3A 4QO7A 2AE1A 3OECA 2NSDA 5T57A 2Q4BA 4PVCA 2DTDA 6LDHA 1V3UA 5JC1A 1H9AA 1PZFA 4EYEA 3CKYA 1LLUA 3VPHA 4BQPA 4JGBA 3EMKA 5AXCA 5ICSA 1LXCA 3UICA 5A06A 4CV3A 4WUVA 3GY0A 4BO6A 3MCVA 3GR6A 4FJ1A 3TOXA 3PLRA 2ZB8A 5T64A 4A26A 3OIFA 4NMHA 5KKAA 3U0BA 4PRKA 3WX0A 9LDTA 1VJ0A 5L9AA 1L7EA 1NNUA 3DZFA 3TWOA 4E5PA 5B1YA 2NVUB 3D4PA 1KOLA 5HRUA 5EN4A 3RUEA 3PI7A 1YONA 3I9JA 5JLAA 2C0CA 2O3QA 4AJJA 4FFLA 4YYZA 5A04A 2NQ8A 4ZQFA 3BTUA 2V6GA 1HYHA 3U4CA 4BO3A 2UUOA 2VWHA 3WMXA 1OAAA 4YAEA 4Y67A 4AG3A 3IC5A 4CM5A 3NJ8A 3FF4A 3PJEA 3RROA 3JSAA 4EDFA 1DBVO 3HN2A 4ZQGA 3BHIA 3H9JA 3GC6A 4WPGA 3JYOA 2DUUA 4NDNE 4CLOB 2G5CA 2RH4A 3ZWXA 1E7WA 2BF7A 4L74A 2E37A 1P0FA 1KC1A 4M89A 2XAAA 1WMAA 2DTXA 2JFGA 3K9QO 2NU8A 4RV9A 3VPFA 1ONNA 3GK3A 2ZKLA 1ZKMA 3HUDA 1R16A 1XQ1A 1B16A 4XR4A 3SXPA 4OAQA 1V8BA 5BT9A 4ALKA 1D7OA 3HFSA 2V65A 1X0VA 1ZEJA 3WWYA 4NI5A 1WVGA 3I9NA 3PHLA 2CDBA 4CQMD 1LC3A 1SZJG 3HWRA 2AMFA 1LSJA 4ZQEA 1CRWG 3H2SA 1JKJA 4W7IA 3SLGA 4ALIA 1HDXA 4D44A 3IJPA 3F47A 2C5EA 3ZV5A 4FFRA 3D4OA 4FW8A 3SLKA 2FMUA 3PVZA 4LRSB 3MWEB 1M67A 2Y0CA 3EVNA 3K30A 1SPXA 2VZ9A 1PQWA 4E12A 3TZHA 3VH3A 4YJGA 1EK5A 5EINA 5BSFA 5JCXA 4GKBA 2B4QA 1HDCA 4JXKA 2OOSA 3D64A 5JDCA 1H93A 2XOXA 1R66A 5A5EA 5KJCA 1I3LA 2CNBA 1OZAA 4L4XA 1XLTA 3EUWA 4EUFA 1J49A 4FC6A 1I36A 4RVGA 2C29D 5GZ6A 4NH4A 4CL8A 1S6YA 3R3JA 4RPKA 1T1SA 2VNSA 2XXBA 1XIVA 3KYCA 4NFSA 4UEKA 4TROA 1O6ZA 3EK2A 4DC0A 2Z95A 1VL8A 3KO8A 3RBXA 3WB9A 5KKCA 1E6EA 4OQZA 2WTBA 1B26A 1U9JA 4PLPA 4CM9D 4HBGA 1UXIA 4BB5A 4E13A 3PHGA 1LRJA 1ADBA 1VKNA 4B8ZA 3S2EA 5AXAA 8LDHA 4WLNA 3Q3CA 1RKXA 4KDFA 3GEDA 5IDYA 2PNFA 3O38A 2XF8A 2D4AA 3C8MA 3I5MA 4AJKA 3ZW8A 2J5RA 4RO0A 1EQUA 1KERA 1V3VA 5C3MA 2BGKA 1XCBA 3NT2A 2Y68A 3PK0A 2WD7B 3KZVA 4U5QA 4J1TA 2P4QA 4BO7A 2C2XA 2G82A 5HA5A 4INAA 3BMCA 1ZXBA 1H6DA 4IGEA 2JD2A 4DMMA 1GYPA 1L1FA 4RORA 3ZNPA 4IIVA 5A1TA 1OBFO 4UVDA 1UAGA 4ZA2A 2Y99A 3GGGA 2Y1EA 3OIDA 3U3XA 2O4CA 4FR5A 4BOYA 1LQTA 2GCGA 1LRKA 4BMVA 2IDZA 2IZ0A 3QVOA 3ADPA 5I9LA 1HSOA 3MOIA 4BGEA 4BO2A 1MUUA 3ZWPA 1X1EA 5CP8A 5T67A 1HSZA 1XQ6A 1YQGA 4I8XA 2GYYA 3LSYA 3HDHA 4Y98A 2FOIA 3GQVA 3W1VA 3WICA 2W4QA 1HDYA 2ZTUA 2H5LA 5DCUA 1G6KA 2TMGA 3IS3A 4YTEA 5G4KB 1X7HA 4YJHB 4B7CA 3WGZA 3LC2O 1AUPA 5FEUA 1Q0QA 5JAZA 4JJGA 3IL2A 4CQMB 1RJWA 2VZ8A 2EXXA 2NACA 4FS3A 4Q3AA 5T5QA 5AVOA 4BO0A 3PGJA 3WGOA 1T25A 3WQSB 4IJWA 4FB5A 5KVSA 1EE9A 1YDEA 5A4DA 5BSGA 1BVUA 3E48A 2EW8A 1XWFA 4XX0A 2B35A 3WGGA 3INTA 1Z6ZA 2C7VA 2HCTA 1U5AA 3AU8A 2HMUA 3ENKA 4ZICA 1VSVA 2DUWA 2WMDA 4YT2A 4WLUA 4CM8A 4JBHA 3K2BA 5IFLA 4PGFA 2HRBA 1BW9B 3OBBA 1I30A 1N7GA 4G5HA 3TL2A 1YL7A 4IDDA 1HKUA 2W90A 3GH3A 4WGGA 2HQ1A 4DLBA 5CEJA 3D3WA 4L9RA 1ZVMA 4BKOA 1Y7TA 3QWIA 4CR8A 1Y6JA 2RAFA 4II2A 1HYEA 1JVBA 4LCJA 4BGUA 4J9UE 5FI5A 5IDXA 3QA9A 4HV4A 4MVJP 2YDYA 3UCEA 3U9LA 3BMNB 1S7CA 5H81A 1PGOA 5TT1A 1YE3A 4EEXA 1P0CA 3CZMA 3KSZO 4Q39A 2VUSA 2Q3EA 4WLVA 4XCVA 4ALJA 3P2YA 4CLXA 3JYLA 1N1EA 3ETDA 4Y8VA 2ZCUA 3KBOA 1BGVA 5AYVA 3BMQA 4RVHA 3QV1A 3VH4A 3OQ6A 5K0ZA 1DIGA 1O89A 2Y66A 2X8LA 4B3JA 4GSLA 1GQQA 3INGA 1X0XA 5EIOA 5I7VA 3OMLA 3C7DB 4ALLA 3CINA 4WCDA 4R5MA 1DIAA 1C0KA 3ZNOA 5JCJD 5ILGA 4S3MA 3DZIA 4YJFA 4XA8A 4A10A 3TFQA 5JS6A 1KETA 5K6AC 2OUIA 4ND5A 8ADHA 5TSDA 4TWRA 4DPMA 3H9QA 2GN8A 3DEYX 5L4LA 3RUIA 3G49A 1QYXA 4GMGA 4E5YA 4R54A 3AM3A 1DIHA 1BHSA 3OH8A 4J4TA 4Z9XA 1BRMA 2Y1FA 1ENOA 4A7PA 1R12A 1GL3A 4TQGA 4BNGA 4DA9A 2QW8A 1BMDA 2JAPA 2AG8A 2O3TA 4TRMA 1D4FA 3IOYA 1I5RA 1M75A 5ILOA 2JCXA 3I9LA 3WQRA 4KQWA 2ZJ1A 4CQLB 5BQFA 1MC4A 2NM0A 4MIOA 1W0CA 1V3TA 3GNTA 4HKTA 1VL0A 3Q11A 1IZ9A 1EZ4A 2ZYDA 1PU2A 2DBQA 3UXYA 1PZEA 3GNSA 1IL0A 4GH5A 4LISA 3JV7A 4D46A 5JC8A 2VCYA 2W2LD 1GFSA 1NHGA 4L4RA 4P8RA 3W4KA 3AM4A 1BTOA 4RPHA 3L0DA 1WDKA 3ICCA 1YBMA 1KY4A 4NBWA 4C7JA 2WSBA 3BHMA 2I5PO 4TRRA 1VRWA 3KLMX 2QG4A 3N74A 4GWGA 4E5KA 3B70A 2IEBA 3H9EO 2EGGA 2TMDA 2CDAA 4MP3A 3K92A 3L9WA 3RUAA 1RM5A 1ENZA 2YZ7A 2FPGA 5TT0A 2WJPA 4TVBA 4F6CA 3BTOA 1HDGO 3KXDA 3KTDA 1FF9A 3RC9A 4WLEA 3UAGA 3D4NA 1E92A 4J0EA 3VKVA 2PZLA 1IZ0A 1ID1A 2C7GA 3AI2A 1JKIA 1DFGA 4B3HA 3DXFA 1DDOA 3PFWO 3FNHA 4J91A 3TOZA 3RJ9A 3VZQA 4AICA 2B4RO 3QWHA 4HFRA 3TZCA 1K0UA 4E0BA 3MOGA 3DFZA 2X0NA 1EUCA 3EAGA 3F3SA 4RCVA 5BNIA 1LEHA 4PLCA 3JQ7A 2WYWA 4TSKA 4DLAA 4PG8A 3E9NA 1P31A 1WLYA 2P91A 4OIMA 2VYND 5G0SA 3JQ6A 1GADO 1G1AA 4O59O 3WQQA 4CLRB 4OOFA 4PG7A 1GDHA 1R6DA 3IJRA 3GEGA 5DOVA 1EMDA 3DZKA 2QYTA 3NGXA 5DP2A 3HSKA 2VWPA 4I5EA 2QIOA 4YT8A 1A7KA 3H8VA 3WGQA 4IDFA 1PSDA 4A73A 1F0YA 1V9LA 4BO9A 3C1AA 2ZTLA 3VTFA 5A3VA 4J2OA 4B4VA 1N8KA 1MFZA 1YBVA 3FR7A 2AG5A 2I65A 2HK8A 4DVJA 4OSOA 1VC2A 1DIBA 4W6ZA 3IKTA 2EJWA 2J3JA 1I10A 2VWQA 4BV8A 1NAHA 1ISHA 4RF2A 3UKOA 4JK3A 1E3EA 1ZNQO 3L4SO 4DRYA 1HDRA 4PLGA 2QRLA 4GSKA 4TKLA 3ZU3A 2PD4A 2OORA 4E30A 3CTMA 1Z7EA 3IP3A 3PHHA 4J7XA 4QT0A 4CMIA 3WLFA 4BNUA 1I0ZA 1LLQA 4TZTA 3KRTA 2JD1A 3CE6A 3RWBA 3S55A 1MG5A 5HWSA 3KUXA 4Y6SA 4DIOA 1H2HA 3FHLA 1XHLA 3CEAA 3PZBA 1QRRA 4IQGA 1JKFA 4XIJA 5EPOA 5K6AA 5KIAA 2BLLA 2FR8A 2IE0A 4OQYA 4L4SA 4Y6RA 5B4VA 2JFHA 5L7WA 2PK3A 2FSSA 1UP7A 1E7MA 1LX6A 4CLEA 1VJ1A 4BKPA 2BD0A 4CM4A 3IUSA 2GN6A 1XU7A 2NU9A 1OMOA 1UH5A 2VHWA 5DZSA 2CVZA 4NHEA 5DDIP 1PTJA 4QSMA 4I5FA 3DOJA 1VKOA 3WR5A 3ETEA 3RBZA 3S2IA 5KJFA 3O9ZA 3DL2A 1Q7BA 3W8FA 4MVJE 4WCFC 1GU7A 3W6UA 1T26A 5MGBA 2E6UX 4CMCA 3ZHBA 3STHA 3CMCO 3D1LA 1QMGA 1I2ZA 5L7YA 2QZZA 4QEDA 4RPGA 4CMBA 1EDOA 1QYDA 1RWBA 5I8WA 3NYWA 3TJRA 2RHCA 2YDXA 4CPDA 4GGPA 1EUZA 1NFRA 4JP2A 4AJEA 3QE3A 4P22A 4FFOA 4AJ1A 4URFA 3KYDA 4MIYA 2B36A 5FWNA 1DPGA 1LSSA 2NVBA 3RKRA 1Y5RA 2ZCVA 3NTOA 2ET6A 3I9OA 3FTPA 4UVHA 3L6OO 3ROPA 5HS4A 4EUEA 4QTZA 2FPIA 3GDOA 3BIOA 1SNYA 1PL8A 1ORRA 4PN3A 3GNQA 1ARZA 1ISFA 3D5QA 3SC6A 1GPJA 1WP4A 4RVFA 3LC1O 1BVRA 1T2FA 4LMRA 4NBRA 4DPLA 4Z3DA 1ZEMA 1C1XA 4I9HA 3PFFA 3ASVA 4YQYA 1H6CA 5ENVA 4BNNA 2HSDA 4Z0HO 4M86A 1IUKA 5H82A 3H6KA 3U4HA 4CMGA 4RL6A 4R3WA 4E5NA 3UVEA 3NV9A 1YOVB 3H3FA 2I67A 4TVOA 3IIEA 2C2YA 1U8XX 3JD1A 4YJGB 2ZB7A 5JO0A 1TA4A 1MA0A 1D3AA 2B4TO 3WNVA 3AOGA 3HFGA 4RDHA 2GGSA 1Q7GA 1KBZA 3MJSA 2IZ1A 1VE9A 1W73A 2Y1CA 4F45A 5ER9A 4EJMA 3RQSA 2VT3A 4F46A 3AY6A 2ZQYA 2Y1OA 4U7WA 4YRAA 4KUGA 1HZZA 1V6AA 3DDNA 4FFNA 3WBBA 3ZHXA 1CF2O 4CMHA 1WZEA 1GUZA 4RLSA 5TQVA 3PYXA 1VLLA 3PLNA 3JQDA 3ONDA 4D42A 1NR1A 4FD3A 1EFKA 1NPYA 3PP8A 1NVGA 1LSUA 4I5GA 4BNWA 2XXJA 2X0IA 1IPEA 2X1HA 4CUJA 1UAYA 1M66A 5CDTA 3FD8A 1EE2A 2NU6A 1E6UA 3HQ4O 5IZCC 5F1OA 5EQDA 3CPSA 1U3VA 4CJXA 3JQGA 3V5NA 1NM5A 5G0VA 3O26A 1ADCA 1N2SA 1QSGA 3DBLA 1PR9A 3JYNA 3CXRA 4ZRNA 2EKPA 3U62A 2EJVA 2HK9A 5TIIA 5EL0A 2IRWA 2O7SA 4DBZA 3RUFA 1YQDA 3BMCB 2JAHA 3JQFC 2JL1A 2YQ4A 3AM5A 3LZ6A 3UF0A 1DB3A 1RYDA 2DU8A 5C7OO 4WNIA 3FSRA 2DKNA 4UUMA 5BR7A 2RCYA 1YKFA 2X9VA 3NGLA 4KQXA 2CY0A 4HP8A 4JNKA 4WE3A 3TQHA 2GZ3A 1GAEO 1DC3A 3AUTA 4FOSA 3D5TA 2C07A 1GZ4A 4WCFA 3WXBA 1DXYA 2YYYA 1EBUA 1NPDA 1GV1A 4LK3A 5DT9A 3ZU4A 4ZD6A 4ZGWA 4B7XA 2FHSA 3DBHB 1WNTA 3WWZA 2NQTA 3ZU2A 1QR6A 4FJ2A 1DAOA 2JCVA 2DFVA 1M6WA 3Q9UA 5IJZA 1LU9A 4E6PA 2G17A 1BXGB 2GLXA 1TEHA 3EZLA 3K5PA 1N7HA 1SMKA 2O48X 2FN7A 1Q1NA 4BNXA 4DLLA 1E3IA 1LRLA 3I83A 2BHLA 3OJ0A 2YFHA 4UVGA 3WBFA 2QRKA 2Q2QA 2VN8A 3KM0A 3WS7A 4ZJUA 4W82A 2JHGA 3UOGA 3WSWA 4J1QA 1XELA 5A9SA 3DO5A 1B14A 4DUPA 1TVEA 4JN6B 3AUUA 3GZ4A 3W6ZA 1A27A 5DULA 4P4GA 2PKQP 1X13A 4IJVA 1RM3A 1Y8QB 4OO3A 4BHTA 1K2WA 1H5QA 1D1SA 3PJGA 2VYVA 1A7AA 3WTBA 2PGLA 1KVSA 4D3SA 4HFNA 4XQ9A 3ADOA 1NX6A 1F14A 4DC1A 3ANLA 1YJ8A 4K26A 5CFZA 3GG9A 1HDOA 4AJPA 4NJMA 2BKAA 1AXGA 4R9SA 3OQ1A 3V2UA 2AW5A 1GY8A 4N5MA 4OL9A 2AXQA 2WD8A 4RF3A 3ZZNA 2GO1A 2OP1A 5MDHA 3OIGA 5CDUA 4YACA 4YRDA 5DF1A 1HE4A 3GN2A 3ICPA 2VTEA 3GFBA 4UUPA 4YT5A 1DFIA 2HMVA 3QLJA 3OJLA 2GSDA 1AXEA 1PJLA 1ULUA 4ALNA 1U3TA 3AI1A 4BIIA 2Q99A 4KOAA 2BGLA 3AOEC 2C59A 1YB4A 3BZUA 4P4LA 4H7PA 4RLHA 3PYLA 4QFCA 2HAEA 2VTDA 5L95A 1H94A 3O03A 2VHZA 2D2IA 3E5MA 3KLPX 5T8KC 3WNQA 4QECA 5HTOA 3QQPA 3L6EA 4YXFA 2PGJA 3COSA 3GMDA 4NG5A 3JQEA 5JE8A 1HF3A 1LTHR 3BMQB 3LU1A 4UAGA 3FBGA 1JAXA 3BMOA 2EHDA 2G76A 1DAPA 1JWBB 4Q3NA 4AJLA 1Y81A 3B20A 3QWFA 2WYVA 4J16A 3T7EA 2EKQA 2PWZA 3TRIA 3EY4A 4D0SA 1PR3A 2DLDA 3I6QA 1G0OA 3RUHA 5B4TA 2W98A 4DREA 1FJHA 4GKVA 4BV9A 3I6IA 4HUJA 3AFNA 1CYDA 4YJFB 1FDVA 5DBFA 3WIDA 5L53A 4J0FA 4WOKA 4HFMA 1H6BA 4ND4A 3EYWA 4JBGA 5G2OA 5IZCA 1I2BA 2B69A 4DBVO 3MZ0A 1ZW1A 1FK8A 3PZRA 3VDRA 4XYMA 2B5WA 3RFXA 3LK7A 4BNMA 3GVXA 2WEKA 2G0TA 1Y8RA 4RQTA 1CDOA 1GR0A 2BI7A 4PLWA 5IN4A 2PD3A 4IM7A 2AQKA 3MJTA 2E4AA 3O4RA 1I3MA 3NDJA 5IXYA 3DZBA 5DBGA 3ZNNA 4A0SA 1LLCA 1ZMTA 3GUYA 5LDHA 1QKIA 3ZDFA 3DBRA 1UZMA 2AEFA 5FI3A 4IJUA 5B37A 4NIMA 1SO8A 4NU6A 4IZIA 4DXHA 5CDYA 4OKIA 4BKQA 4WOJA 1MV8A 4IPTA 3H9UA 2UAGA 4KDEA 1PJ4A 3I52A 4I5DA 3F4LA 4B8WA 2J3HA 1R37A 3GG2A 2FRDA 4EJ6A 1VSUA 3S8MA 1TT5A 4H15A 1A9ZA 3PYMA 3ZCXA 3QY9A 1PEDA 4J7UA 3LDHA 5F3RA 2ILTA 1T24A 4M49A 1DC4A 2DC1A 3RUDA 5I9NA 3GT0A 1ZIDA 1E3LA 4CLHA 4MVJD 4EGFA 1TXGA 5CPBA 4PLVA 3AFMA 1PL6A 1JN0A 2GUGA 5F1PA 2EEZA 3ASUA 3DOCA 1IY8A 3KEOA 2AEJA 3ZV4A 4NBTA 4PZCA 1PWZA 4MJLA 1O5IA 4RJTA 3HE3A 6ADHA 1C1DB 2IYPA 3WYBA 4Z6KA 4PIVA 1P1JA 2VRCA 4GVLA 1YL6A 2Z1MA 3JD0A 1E7QA 2PFGA 3SBOA 2VNAA 5JFOA 2FWMX 1NWCA 3NDRA 1DIRA 3CH6A 1NVTA 2A9FA 4IZHA 4YPOA 3GHYA 3AUSA 4NU5A 4GAEA 3M2TA 1MX3A 1HE3A 5B4UA 1LDYA 1PS0A 4FGWA 5I7SA 4CLOA 2H1SA 1HZJA 3VC7A 4CMEC 3OSUA 3X2FA 4B4OA 4B4UA 4JJIA 4MKXA 2P5YA 1YWGO 3FNFA 3GZNA 3R1IA 4GX0A 4IDBA 4OM8A 5JNLA 1K6JA 1P9LA 1VL6A 1B8UA 2HDHA 3BTSA 3KHUA 3MJVA 4I9UA 4ALMA 3H5NA 2HK7A 9LDBA 1YO6A 1P44A 4R1NA 1X15A 1B7GO 5L40A 3E82A 4MVJG 1YXMA 1UDBA 4J7CA 3ON5A 1I3KA 3ZV6A 5C5IA 3E6AA 2X22A 1E7YA 2IXBA 5H83A 2EIHA 1T2EA 4LMPA 1TLTA 1EVJA 3RFTA 4LRTB 1GUFA 4WECA 4EI2A 4K6CA 4KTVE 4A03A 4RZIA 3AOEA 5K9ZA 1P74A 4XGKA 2IYOA 5U1PA 3UW3A 1PS8A 1CQJA 1KEUA 1ZK0A 4CUZA 5BSHA 1VI2A 5T8KA 3RAJA 4DMLA 5CG1A 5KWEA 1KS9A 3BA1A 1C0LA 2DFDA 1K3TA 3PQDA 5EMHA 1I24A 1EK6A 1Z75A 3T4XA 3GEMA 2GR9A 3HZZA 2Y1DA 1Z7BA 1MLDA 1LQUA 3GF4A 1IHXA 4OKNA 4JQCA 5IF3A 5G0WA 3AK4A 3W4IA 3H9GA 4A5OA 4JJFA 1RYEA 1UP6A 3U49A 1T2AA 2J6IA 5KJ6A 2RHRA 3P5SA 1UZLA 2BFOA 2GPTA 3QHAA 4PLZA 4LGVA 4LVUA 3JQ8B 1HE2A 1KEPA 1W6UA 3W4JA 2IXAA 2RBEA 1ZUD1 3K96A 3S1LA 3WTCA 3P19A 3PQEA 2YV1A 5LC1A 1ZZEA 4J4HA 1DJNA 1PGNA 2HMSA 2X0JA 4MINA 3GRKA 4DQUA 1U28A 2I9PA 3ZNQA 1DOHA 4CMKA 5ITVA 1V35A 1BG6A 3I4CA 4ROSA 1MP0A 3DOOA 5JMPA 1MXHA 1J4AA 4B7UA 3I23A 1XU9A 2YQ5A 3IQDB 3NTRA 4WK6A 3ANMA 3V1UA 1LDMA 5EQFA 1F06A 1XKQA 3OFSA 1N9GB 2PKQO 2Q2VA 3GGOA 3GVPA 3CIFA 1AHHA 1X7DA 3JQAA 2SCUA 2Q2WA 2BFMA 4MO2A 5COAA 4NBUA 4QO8A 1QG6A 3NT4A 5JY6A 4R16A 4XIYA 4IDAA 5CPFA 3OQBA 3ZWVA 4BO4A 1QV6A 1ZBQA 4RF4A 2D1YA 5DP1A 3ROQA 1H6AA 1SCUA 1U7TA 3PJFA 4Z3KA 1E5QA 2WD7A 2NTVA 2YHIB 1E7RA 3NKLA 4B79A 3W8DA 3B1JA 3F46A 3Q6IA 1HDZA 3E03A 3AU9A 1T4DA 1PJ3A 3UCXA 4YAGA 5BNTA 2LDXA 1Y9EA 2ZYGA 1Y9AA 3V8BA 5DCWA 4QUKA 4R3NA 4R5HA 1P1HA 3KV3O 3QWBA 3U4DA 1MC5A 4W7HA 1XDWA 1P1IA 3C24A 1JWAB 2O2YA 3IAHA 2Q4EA 3GGPA 3DB2A 1I01A 3GOHA 3M1AA 3JYPA 4YJDA 2GNAA 5G4LA 5JAIA 3P7MA 5A5FA 1V0JA 1B8PA 2NLOA 4FFPA 5FFFA 3RASA 3WIEA 3ZN2A 4N7RA 4XGNA 4CM6A 1NAIA 3M2PA 4MKZA 3H2ZA 2BH9A 3MJEA 2GERA 1UJMA 4BNIA 4CR7A 2DT5A 4KWHA 2PD6A 4RDIA 4CQMA 3O8QB 5TJ9A 3L4BC 3TZ6A 5TC4A 4I08A 3DHEA 4H16A 1ULSA 2CSUA 1HE5A 1ONOA 4O0LA 4A27A 2IEDA 1NFQA 3PWZA 1XEAA 2W2KB 5DNAA 4OGWA 1EVYA 4YAJA 1K5HA 1NWHA 3WFIA 4CMAA 4E32A 2NV6A 1UZNA 4WEQA 4PZDA 3QSGA 4Y6PA 4D43A 1HRDA 1BDBA 2DQ4A 2Q50A 3RFVA 3SX2A 4MVJF 4DPKA 1R4NA 4MVJM 3ZWMA 3QVWA 2OBYA 1GZ3A 2ZB3A 1VM6A 4JIGA 4Z0PA 1ADGA 4YAIA 4Q3DA 4HXYA 3H5RA 3FTNA 2D3TA 1JVSA 2BFPA 1N92A 1U8FO 1P1RA 2O3UA 3LF1A 1DEHA 1PZHA 3KEQA 1E1NA 3AUAA 4OOEA 4AJNA 1KEVA 4YRBA 4OSPA 4M8SA 3K2EA 1LDGA 4DYVA 5JAMA 4OYRA 2NTNA 3BMNA 4F6LA 3JQ9C 4AJIA 1D1TA 3TFOA 3ITKA 3PWKA 4C7KA 3EC7A 5L51A 5KNLA 3H65A 2I3AA 3NDIA 4LSMA 3KSUA 4CM9A 3GRPA 1R0SA 1U3WA 2RH8A 4E2ZA 4J1SA 4BL5A 4J49A 4W9NC 2VWGA 3FR8A 1J5PA 3DZJA 1MG0A 1KVRA 3ETGA 4ILKA 3H7AA 5TLSA 3I4FA 1CIVA 1UP4A 4M1QA 1F8FA 4BB6A 1DRUA 1F17A 4BNVA 4FQ8A 5I7FA 5AXBA 2BRUA 4PLTA 1WXDA 4UUNA 2E49A 4C4OA 1RM4A 4YR9A 3H5AA 5U4QA 2PZJA 3UUWA 4LSWA 2FR1A 2P4HX 3DTTA 3DMTC 2ZYAA 1E3SA 4FBGA 4AJHA 4IINA 4WLFA 5JAQA 3A9WA 2O2SA 3DAPA 4WCFB 3SJ7A 2A94A 5T6BA 2R2GA 4E3ZA 2V7PA 1Y1PA 1ZJZA 2YY7A 3F6YA 4R1TA 3FBTA 3OF2A 4Z0TA 1R0KA 2DPHA 3SVTA 3ABIA 1DSSG 4YEDA 3ZU5A 1XYGA 3ZHYA 2X5OA 1CJCA 1NQOA 3DMYA 1U2DA 4MDHA 4GI2A 4D3DA 4RGBA 1JQBA 1QYWA 1R4MA 4A2CA 2OO5A 4S1VA 3S2GA 1ZK2A 3JTMA 4RPJA 4RVDA 4WASA 1P77A 4FSHA 5GMOA 2DBZA 5JMWA 4QFDA 5CDGA 1QORA 2G1UA 5KJ1A 4J1NA 2E48A 1MXFA 4K6FA 2R6JA 5KVQA 1O94A 3I3OA 4XZ3A 5DCYA 3NRCA 1ML3A 5FYDA 3OA2A 2X6TA 4PG4A 4AL4A 1ENPA 3GDFA 4ND1A 5G0UA 3EHEA 2Q1SA 4U0JA 3GAFA 2EG9A 5EESA 3GHHA 4Q9NA 3OETA 3A14A 2H6EA 4NJMB 2PLAA 2GF2A 1T1RA 3PWSA 2I3GA 1PJ2A 4PCVA 4MIEA 3QVTA 3ZHZA 3L4BA 3RSHA 4OXYA 3E18A 1BXZA 5EERA 5TRTA 4EUHA 3DBVO 3WGIA 2PV7A 4U6QA 2J8ZA 1PQUA 3AW9A 2ZK7A 5JW6A 4L76A 3B6ZA 1Q0LA 1LNQA 4LVCA 1PWXA 2PZMA 4JROA 3KYBA 4XJTA 1PJSA 2X7HA 4WJZA 5JYEA 1ZJYA 3F5SA 4MVJI 2QQ5A 4KZPA 3HB5X 4RPLA 5CEFA 1O8CA 2O50A 3EDMA 3FN4A 2LDBA 1JLLA 3G3EA 1L7DA 1NXQA 3ZWYA 5F21A 3ZWCA 4PRLA 5L45A 3KYCB 2Y0EA 4IBOA 2POQX 2F00A 2YV3A 3F9IA 4ZVVA 1BDMA 1IE3A 3MJ4A 1M2WA 1LA2A 4K9DA 3HHPA 5TF4A 5LCXA 1E77A 1U4OA 3PDUA 4WNCA 5IAAA 4UEJA 4U6SA 1WAMA 2ZJ0A 4OMUA 4XD2A 3ST7A 4RVUA 4BUCA 5CG2A 1ZSYA 2PZKA 7ADHA 2YUTA 3I9KA 2VOJA 4F3YA 2UV8A 4R69A 1P33A 2FY8A 4MKRA 3JQ9A 5JDIC 1Z74A 2V6FA 3VPGA 4GX2A 4IMRA 3PGXA 5JCJA 2GZ2A 1SOWA 1YDWA 4W9NA 1IYZA 3ANNA 1TI7A 4DQXA 1ZSNA 1UUFA 1Y8RB 2B83A 1SB9A 3I1JA 4D45A 5TS3A 2YV2A 3VVBA 1ADFA 2JKVA 3JYQA 4XB1A 1PIWA 3PQFA 3SJUA 3MEQA 3V2GA 5KVVA 1CERA 4E2YA 1WDMA 3NX4A 4XRRA 1EVZA 4D79A 1PJBA 1ISJA 2GDZA 4IGFA 4P38A 4O5OA 3UHAA 4E2WA 1A9YA 1ONPA 1PGJA 1HLDA 5B12A 4Z9FA 3DMTA 3TL3A 5KCZA 3ULKA 1SEVA 2CD9A 1E6WA 1GCUA 1I8TA 2C20A 4IQ0A 3VTZA 4Q3CA 3Q0EA 4TMFA 2PGDA 5C37A 2DBVO 4E33A 5A05A 2Y05A 4HX5A 3G79A 1TT5B 5THKA 4YT4A 2O3SA 3UN1A 3SC4A 4IMPA 3JQAD 2AEMA 2D59A 2XPCA 5JSFA 2BELA 2BMAA 1X14A 4CV2A 2OL4A 1NVMB 1HLPA 2W2LA 3DONA 2HU2A 2O4UX 3DWFA 3C1OA 3BAZA 3PXXA 3DTYA 3L6DA 4I9NA 2H63A 1BSVA 4IXTA 1IB6A 5ER6A 3LT0A 4OXNA 1DHTA 2Z5LA 3CUKA 4OXKA 4XYGA 3WDSA 3BTVA 3VZPA 3VKUA 3PPIA 3B1KA 2IODA 1YGYA 4FFMA 4NJOA 1YB5A 3FCOA 2EP7A 4BGIA 3ROMA 4Z9YA 1NTOA 1WZIA 4E2XA 1U1IA 4N54A 4KWIA 3BHJA 3DQPA 2OXIA 4U8GA 4D7AA 3N7UA 4EW6A 4CMJA 2PA3A 2A92A 2EV9A 3PRJA 4JX8A 1LDNA 5BNFA 4E5MA 1M6HA 1VPDA 1XR3A 4KP7A 3DAGA 5CEEA 1LI4A 3N58A 3I9MA 4CM1A 5COQA 5A03A 4ZQBA 2VRBA 5TJHA 3GZNB 4XB2A 4CM8B 3VZRA 3LVFO 4DQVA 4D3FA 4O1MA 4YB8A 1OFGA 3LC7O 4QX6A 5C7LO 3E8XA 3PEFA 3ZV3A 1U2GA 1UDCA 2HJRA 2Q1TA 1E3WA 2CFCA 3D3WB 3M1LA 1ZH8A 4N5NA 4E4YA 1EFLA 3GLQA 4J90A 1I2CA 4ZU3A 3HN7A 1LBEA 2VYNA 5L4NA 3OJEA 1A4UA 2CMDA 4JBIA 3DC2A 2NUAA 3IP1A 3FPCA 3GVIA 3AY7A 2H9IA 3VPXA 3CZRA 1A5ZA 2EP5A 1E7SA 5JXWA 3EGOA 1U3UA 4XR9A 2I76A 1DFHA 4Y9DA 5IDQA 1GEGA 3L9XA 4BNJA 1JW9B 2P5UA 3ZH2A 1VJTA 2JJYA 2P9GA 3VOSA 2C82A 3C1TA 1ZXLA 1YOVA 2DAPA 2O23A 4ND2A 1BWSA 2UUPA 4OHUA 5DBIA 2PTGA 4G81A 1LJ8A 1JAYA 2OMEA 3VAZA 1CQIA 1ZSVA 3FWNA 1X1TA 3VZSA 2RIRA 5HM8A 1QXSA 1W4ZA 1RPNA 4BNFA 4DIBA 1IULA 1HTBA 2NADA 1XG5A 4BNZA 1WMBA 5AQ1A 3ONEA 5JDIA 1GQ2A 3ZWOA 3OP4A 1EEHA 1DC5A 2WWRA 2J3IA 3ZW9A 1NQ5A 2YHUA 3JD3A 2VT2A 4LW8A 3JQBC 1C14A 2DPGA 4YDRA 5HBRA 3QVSA 5ICMA 1GQYA 1YH3A 2Y67A 4ZN6A 1YB1A 1H2BA 1ZK4A 4AJOA 4HWKA 2PY6A 1GUYA 4GLLA 4GVXA 4BKUA 2JFFA 1U5CA 1HYGA 4O6VA 1EDZA 3JQFA 5AXDA 2HKIA 2D5AA 1B0AA 3JQAB 3R3SA 4R1UA 3BYZA 3K6JA 2AHRA 4DTIA 3HADA 2PH5A 2Q46A 5FF9A 3B1FA 1E1MA 1HT0A 3UGKA 1XA0A 3CMMA 3H4VA 5I8ZA 3NUGA 1N5DA 1J6UA 4R41A 3U09A 3WGYA 3F5QA 1FDWA 2OZPA 4AVYA 1PJQA 3E5RA 3GMSA 3TZQA 3RJ5A 4LN1A 2VQ3A 3OJOA 2WM3A 1FXSA 4H3VA 1XSEA 3ZWAA 3TN7A 2Q1WA 5I7EA 4YAKA 1WW8A 5TGDA 2EW2A 3WFJA 3HJAA 3FWZA 1PGPA 2NVUA 3FRJA 4CL3A 5GZ3A 3VH1A 3LT4A 3ROKA 4E21A 1CETA 4FCCA 2VHVA 2VUUA 4MPDA 2X9GA 4DWVA 2C54A 4PLFA 1IPFA 3R6DA 4ZHSA 3DBHA 1T2DA 3EVTA 1TB4A 3WSVA 2EGHA 1P45A 4GL4A 1FMCA 4PFJA 2P9EA 1BXGA 1SEPA 1YVEI 4FN4A 4J6FA 2AQIA 1P1KA 2EERA 2HJSA 4D41A 2X5JO 3ITDA 2QYSA 1NR7A 5L7TA 1UXJA 3TSCA 2YW9A 3WYCA 4XYEA 3JQ7B 2NTJA 2NVWA 3AY3A 3F1LA 4PLYA 2WE8A 2WYUA 1LDEA 3HDJA 1GD1O 1AE1A 1JU9A 3L77A 3R0IA 1GPDG 1XGKA 1A71A 2WE7A 2B5VA 4FJ0A 4CLDA 5IG2A 2D8AA 1Y8QA 1OC4A 4ND3A 2DTEA 1Z45A 4QXMA 1QLHA 1SB8A 5JPIA 5THQA 4UVIA 4BNYA 2OFPA 1FDTA 1EUDA 2A4KA 3QRWA 4GLOA 5A9TA 1MB4A 1O9BA 3WLEA 1F12A 4IY1A 1R4NB 3ZWNA 2ZIZA 3W8EA 2QRJA 1LLDA 4N5LA 4MOWA 1ZCJA 4PG6A 1DHRA 4FC7A 1PJTA 4RZHA 1IOLA 1DJQA 3LLSA 1A4IA 2ZTMA 3DHNA 4BS9A 4FPXA 3PJDA 4IDEA 4NNJA 4NQZA 4E31A 2Q49A 1PQPA 1LSOA 1NBOA 1ISGA 1LDBA 2C5AA 5J23A 4KMSA 3PHIA 3RCBA 3H3JA 2ZB4A 1K6XA 1KYQA 4IIUA 2JHFA 4BMSA 2B37A 4CMIB 4GGOA 2YFQA 4NBVA 2AQ8A 3X2EA 1EQ2A 4TRNA 4W99A 1RM0A 4XQEA 5HS6A 5JY1A 4G65A 4NK5A 1Q7CA 2J5QA 2YJZA 4IS2A 5A3JA 1B2LA 4CODB 4AFNA 2EKLA 1T2CA 2CVOA 2FPPA 4ITUA 5AOVA 4FDAA 1UXGA 3RBVA 4OH1A 4ZRMA 4IDGA 1JDJA 2HRZA 1GZ6A 3JQBA 3M6IA 1SBYA 3FPLA 4NK4A 3WGTA 2Y0DA 4QQRA 4BNHA 4R1SA 4CM4B 4IS3A 4IUYA 3L07A 3OM9A 4UREA 4KUHA 3UCFA 3FI9A 5L3ZA 4NR0A 4RVSA 1E3JA 1QLJA 2P68A 3CSDA 4FIZA 4HFJA 4KTTE 1PGQA 3TPCA 3UFXA 1ISMA 3Q2IA 3HNPA 1QYCA 3E1KA 1KVUA 1O95A 1M76A 1C3VA 3UH1A 1ENYA 2I6TA 2QZ9A 4EBFA 2W8ZA 4D0RA 1PJCA 2CZCA 2AQHA 3GDGA 3A1NA 3GPIA 4II3A 4PZEA 4XQCA 1D8AA 3ONFA 3RIHA 2I66A 2CVQA 4BGVA 7MDHA 4J43A 4XRGA 3KYDB 4IXWA 1R4MB 3A28A 4BKRA 2EF1A 3RI3A 4XWYA 5F1KA 4J4BA 3U5TA 3MTJA 3F4BA 2VUTA 2D0IA 1NASA 4CM3A 2FP4A 4UULA 3C7CB 4Q3EA 4AJ2A 4N18A 5DN9A 4CV0A 3VVCA 1HEUA 1DLJA 5ADHA 2GRAA 4R01A 5A02A 3GVCA 4BNLA 3WYEA 1G0NA 3D7LA 2UYYA 5BSEA 2V6MA 4IJKA 5TX7A 1ZMOA 3ZGYA 1KVTA 1UR5A 3ZWWA 3OEYA 2GN4A 4M55A 5C7IO 1C1XB 3ENNA 1TT7A 3GN1A 4L75A 5G4KA 2P9CA 5G0TA 1MGOA 2VZ0A 3QJ5A 4YJHA 3RD5A 3ZI0A 4L73A 3KETA 1W8DA 4HY3A 4MP8A 3RVDA 1SOVA 3RC2A 1K6IA 3MTGA 5KOIA 3IKVA 1KEWA 4CMEA 3DZGA 2HUNA 1C1DA 3AJRA 1LUAA 3DZHA 4O63O 2GZ1A 3K31A 1GCOA 3JD2A 5EJ2A 4FOOA 4UUOA 1Z73A 1CEQA 1EBFA 1KIFA 1OOEA 2OHXA 2R00C 1PL7A 2VYVD 4M54A 1EVIA 4ONEA 5LDGA 3A06A 5COBA 5IZ4A 1GYRA 4XJSA 3IUPA 1GTMA 1DC6A 4MVJH 3V1YA 4Q3BA 1CWUA 3AI3A 4MP6A 3OJFA 5F5NA 3GAZA 2NWQA 3IMFA 3KOUA 3V1TC 4YVFA 2VHYA 2F1KA 2NU7A 3C3XA 2DBRA 3QW2A 4U0KA 4YCAA 3KVOA 1NQAO 1BW9A 1WDLA 1ZO8A 1I33A 4X54A 2D5CA 2FR0A 2FZWA 3NTQA 3GPDG 3D0OA 5F5LA 2GASA 3U4IA 4IQ8A 4WKGA 1B8VA 1ZK3A 4JLWA 3VPSA 5IN5A 3KSDO 1MFPA 3RC1A 2O3RA 2ZATA 1ZK1A 1P3DA 1NYTA 3A4VA 1BXKA 4PG5A 3JCZA 2BI8A 4CUKA 1NFFA 3LYLA 4EJ0A
chains in the Genus database with same CATH superfamily
2CDCA 2C4KA 1Y5MA 4Q9IA 3IAEA 1IUNA 4DIFA 2WKRA 3SXJA 4WIAA 3HCWA 4LXHA 2YMQA 3B3GA 3DHYA 3OTGA 4R68A 3UC9A 4YQZA 3UR3C 4EUKB 4AZWA 4ZQHA 1OGJA 3F2IA 4CKEA 3HUUA 5TPZD 4FDMA 2CLOB 2BGRA 2O5RA 1MW9X 1HQDA 1QP7A 1P8AA 4PZPA 2B30A 4UDVA 2R7UA 4CDYA 2QU8A 5JYDA 2XZDA 2FOLA 2X0RA 4G0QA 2Y93A 2P9HA 3SOPA 1U4NA 5KNDA 3SJBA 3MERA 2GQ0A 1TK9A 1XWJA 4HVAA 2VUHB 4HXFB 4Q18A 3C6QA 3Q9SA 3ZWBA 4OB8A 3GL9A 1SQGA 4WI1A 1V43A 4BMOB 1V11A 4ERXA 1IAVA 1J1ZA 4BLUA 4GX5A 1JA0A 2BKUA 2OECA 5FKJA 1E4YA 4AN1A 1PV4A 4ID9A 2GD1O 4DQDA 2R7KA 1K7FB 4TLCA 5AOAA 3Q1LA 3VNUA 1E0DA 4KW7A 2DP4E 4F5ZA 3BMOB 2HNBA 3P9IA 3RLFA 3PS9A 1OFTA 1RHRA 4M36A 4LDRA 4D2IA 3GJSA 1XLTC 5GY7A 4OQPA 1F8UA 1YL5A 3INRA 3IIMA 5ALDA 4QKQA 3GEBA 2X51A 4PSDA 4KNYA 3EXAA 1AUQA 1T36B 5ES3A 4CKCA 1HFEL 5LMZA 4OAOA 2NSDA 5FT9A 4NBLA 3UV6A 5DNEA 2JEOA 4FYKA 5H68A 2ZB8A 2ZZMA 3NDBB 4JWKA 3SSMA 2E21A 1VJ0A 9LDTA 3LS2A 2AG6A 1CRLA 2IFTA 3PGVA 1OFIA 1NQXA 1ST2A 1MX1A 4H2DA 3R6WA 1BZYA 1ZKDA 2LRHA 4ZVOA 4R8VA 5EZQA 2D74A 2J3QA 2J3LA 5EE0A 3PEWA 3IVCA 3KELA 4LV5B 4GOLD 1T0PA 4OI1A 4Q24A 4LE2A 4XJVA 4YMWA 4X0EA 1F4VA 1S8AA 3HB7A 2IIBA 4BBZA 3A7EA 1XQ1A 3UYKA 3LIIA 2XLDA 2V65A 2LXNA 3W5SA 3AP3A 1FXWA 1NZEA 3HWRA 1R5OA 2EL9A 2XJ4A 1VLJA 3H2SA 2XMDA 4U9IS 4MUHA 1QQ5A 3GAMA 4GQIA 5CI9A 1ULZA 4CEJA 1HFKA 2ZE6A 5JCXA 4OHZA 3A1UA 1NJ1A 4CCAA 1JJIA 4B17A 5A5EA 5LP1A 3ILVA 3VA7A 2PSEA 3HP4A 4IXMA 1G3UA 1I36A 2C29D 1ZJJA 3OE1A 1RZUA 4TROA 3CVYA 3KUKA 3N8GA 5J4LA 2BH2A 4EH1A 3LDUA 3IQCA 1ZR2A 4YXWA 4EHAA 4V1CA 3IQ5A 1I4ZA 5AHOA 5DN6D 1WMFA 2R79A 1EP1B 4DMMA 1NXPA 3ETCA 1UAGA 4Z7QB 1LRKA 5K0GA 3U3MA 1QU3A 1M2KA 3LLMA 3HUFA 3WDLA 4UM9D 1P7YA 1SM4A 1SUDA 3WAKA 2NZJA 4QNRA 2LPMA 3DV0B 2R6R1 4GXNA 3CHYA 4BO0A 1JXQA 3D43A 2YJTD 2Z2KA 5A4DA 2EW8A 4U5EE 2HCTA 1Z38A 1K9SA 1JQ3A 4PX5A 3A9VA 3C3MA 1L3PA 4PHHA 1N7GA 4JCCA 2PO5A 4RHUA 1TA0A 2GBFA 5KTSA 3PFNA 4FKZA 4HV4A 3M33A 2PUGA 3PNSA 5TT1A 4EJSA 1R88A 1Z6YA 4HZUB 4ALJA 1Y6RA 1YARO 4POAA 3SXYA 3DTVA 1CUHA 4TM8A 2ZUWA 5EIOA 3CX4A 4ALLA 4KYIB 3AHEA 2YC4C 5ED0A 3R5XA 5ILGA 5EWLB 1NNEA 4YJFA 3AB3A 5JS6A 3OTQA 3ZLUA 4TKUA 2PUWA 3H9QA 2PKCA 1QE5A 2R8BA 1NDUA 4A7PA 3U7QB 4UASA 4IDPA 4CGZA 4X8OA 3NBAA 1QGUA 2J3EA 3J81k 3FAKA 4KQWA 2AWNA 1A7JA 1ACJA 2DWOA 4D46A 2W2LD 4L4RA 4P8RA 2GH1A 1YBMA 4RY0A 1BIFA 1USWA 1TCBA 3VR2D 1ENZA 4TVBA 4CIAA 4XWJA 1KARA 3A04A 2NPFA 4C4SA 4B2LA 1JKIA 3GODA 5JROA 2AOTB 5KYUB 3KK0A 3WKDA 2AFIB 2ZROA 5A69A 3VU9B 1PE0A 3O4HA 4LCBA 4HLNA 2VDUE 3F5DA 4O4HA 4D99A 4G84A 4QXRA 2VYCA 5DP2A 2QIOA 3R4CA 4A73A 5MFPA 3HCFA 1MFZA 2NUBA 4S04A 1VC2A 2QVLA 1CDDA 1ISHA 1BFUA 3CX7A 1T4CB 1SCJA 2PWPA 2NAFA 1RLTA 3A6HA 1FTGA 1G2QA 4G5YA 1X8XA 1BVHA 2YOFA 1UP7A 4V2UA 3M4NA 3BEOA 3IUSA 3QF4B 1F2DA 4I5FA 1J21A 3RBZA 3NHSA 3O9ZA 4ZKDA 4MVJE 1JEQB 2L17A 2QZZA 1ORWA 1JQEA 4YMSA 5J63A 3LA6A 4U7TB 1UFVA 2IELA 3MN1A 4CDMA 1RYMA 3FTPA 2QTTA 4CJOA 2AN1A 2GMWA 4EUEA 2Q5HA 4PN3A 1TTTA 3OAAA 4XPZA 1IXZA 1JRLA 2N1BA 4DPLA 1B74A 3AXSA 4QL3A 4HL6A 1NNLA 5REQB 1YZ3A 4HDAA 2I15A 4RMGA 2WF9A 1U8XX 2WHXA 1N2GA 1OW8A 5CBKA 4WXEA 1VZ2A 3U16A 2G71A 3FHTA 1DJPA 4UBJA 3U3BA 5LJLA 1BGWA 3M70A 4U7WA 1HZZA 1AG9A 1AZSC 1U02A 1V6AA 3DDNA 1NQUA 2D5RB 1K3UB 3PLNA 3S2SA 3PP8A 4JI1B 3TQFA 1M66A 2XUIA 2O05A 2NIPA 2V03A 4US2R 3JRXA 1IWOA 4IOKA 4UBIA 1I0LA 2MJLA 2EKPA 1GARA 4BU1A 3WB0A 1T15A 4GICA 3BMCB 3JQFC 5THXA 4PC6A 2IH2A 3FSRA 2QAGA 4QEKA 2WM8A 4HP8A 3TFWA 4TYMA 1V95A 3C5HA 5DT9A 1NPDA 2I6UA 3EUFA 3NC4A 1UK9A 1VA4A 3GLGE 1OI3A 4L50A 1IOVA 5IJZA 4DRXA 4IW3B 1OH8A 3K5PA 2GEBA 3J7AC 4BNXA 1QYIA 3R0JA 2JVIA 1JZTA 2H7YA 4QPNA 2G7MC 1DINA 2JIZA 2V74B 1J25A 5LZ8A 4W82A 2JHGA 3SZLA 3K72B 1G64A 4P4GA 3ZDXB 3K0FB 3NNDA 2Q0SA 1KU6A 1HDOA 2PZ8A 3IPMO 1GY8A 3DE4X 3PC3A 2A3RA 3X1OA 1WCIA 3O74A 4HGQA 2J5BA 1H1DA 1E9AA 3OJLA 1Y34E 2DY1A 2GAFA 3DE1X 4WA8A 1YB4A 3ENQA 4RIFA 2Q5CA 2QTCA 4S0XA 4KQCA 2AK3A 3COSA 3JQEA 3C3KA 3B20A 3UMVA 1C9KA 3DL7A 3TRIA 5B4TA 2WZFA 3LUTB 4HUJA 3P45A 3Q3GE 4HFMA 4TLMB 1XDGA 3ANSA 3A9TA 3RAFC 1Q20A 5DEIA 2I8LA 1FJ2A 2Z8YM 3E3OA 3GUYA 1QK5A 3EGXB 4CXMA 4BLVA 4KK3A 1VRCA 1GSIA 4TWBA 1SCNE 1J06A 2B1IA 3F4LA 1VL2A 1BXRB 1A9ZA 4BX3A 5BWMA 3LX5A 3CWCA 1HURA 5AI9A 1IJEA 2GT1A 3DMDA 6ADHA 3D3QA 1G2PA 3EC1A 2Z1MA 3YASA 3KHSA 3VC3A 5LL6P 1A7DA 1ZG3A 3GLSA 1IC6A 3SR3A 3ACDA 2WKWA 5BRNA 2ZPUA 4GD3Q 3LXMA 5CB4F 2OAQ1 2TSYB 5CVEA 5L40A 4XEKA 2WF7A 1PTKA 1V1MA 3IKLA 2BZ1A 4GOXA 4BIMA 1KAGA 1I6WA 2ZBDA 1Q1AA 3UAZA 3GA7A 1J2JA 2L6GA 2FEXA 1OILA 3RAJA 4IARA 4HXGA 4ZT2A 1ZUNB 4OD5A 4OKNA 5AM0A 4R1PA 1BAPA 4YALA 3P5SA 2HBQA 4EWLA 1ZUD1 2NXCA 5DI3A 2HMSA 4MINA 4FCVA 4TS9A 4O2RA 4X1YB 2MYTA 4OQFA 5AK5A 1PDWA 3RS3A 1D9XA 3I23A 1NU9C 3DVAA 3V1UA 4Q37A 2WP0A 2HIMA 2PZBA 4FMCB 4TYWA 3DWEX 3NT4A 4IDAA 4DCOA 2FEMA 1X8JA 3SHOA 1XMXA 1S2DA 1FMWA 3V7UA 3W78A 2JVKA 1RS0A 1T4DA 4GWLA 4GE3A 4O1IA 1KJ9A 3V8BA 4LE1A 4R5HA 3U9SA 4LY6A 3A1CA 3P9XA 4B3BA 3C24A 3DP7A 1FSGA 3M1IA 2GEJA 1EXNA 4G1CA 1LVKA 2GNAA 2HHLA 1V0JA 3ZLBA 9MHTA 4F7DA 3C8ZA 5DTEA 2COUA 4PGGA 5GJBA 5DNVA 2ZULA 1KORA 4RDIA 3DHEA 3BFKA 2AMJA 2CSUA 5DNWA 3R09A 4AWBA 4Z1OA 5JLJA 2VYFA 4OX9B 2GCEA 2F3RA 3PNOA 3K16A 1N6NA 2XSZA 5HRCA 1VJDA 4MVJM 3HA7A 1U8FO 2MYSA 4RXTA 1D4OA 3KFXA 1E1NA 3K2EA 5LWQA 1GQOA 3BMNA 1P7ZA 4AJIA 3K7EA 3GRPA 1R0SA 4XWAA 5EUCA 3BCRA 1YVPA 1P2TA 3L1UA 4I4CA 1AUVA 1JB1A 1F5SA 1F8FA 3CUSA 1DRUA 2B82A 4RKWA 5CVCA 3TBHA 4EKIA 4ZQCB 1OI2A 2YL7A 1U1EA 4LJYA 1W25A 4DR4B 1SUWA 5H70A 1TUIA 5EE3A 5JSLA 3SJ7A 1Z7YA 2PSFA 5CRIA 5HFJA 2PXCA 3DHWC 1XXHB 4R71A 2QV0A 1L0BA 2OV3A 2BFBB 4B6SA 3FNIA 3P2IA 1U7XA 1JQBA 3IDOA 4FX5A 2OO5A 3R9WA 1VLHA 1XROA 5GMOA 3QU5A 4Q00A 2E48A 4WN9A 4RH1A 4RV4A 2FFAA 5DCYA 5DBOA 3OA2A 4PG4A 3AHJA 2QTVB 3FPBA 5IULC 2IYSA 1GFIA 2FMXA 1XEXA 3UMSA 4FW9A 2CJFA 1I6KA 3GDWA 3OETA 2H6EA 3N2YA 2PLAA 4BMDA 1RRVA 1D1CA 3WGIA 2VK8A 3DGEC 3P0RA 3OX1A 1PQUA 1M5TA 2ZVPX 3HA5A 3KYBA 2VJOA 3O4JA 3F5SA 5CEFA 1W36B 4E07A 2VQDA 4GPTA 3L40A 4OB7A 4OHCA 2UKDA 4IYRA 4EA6A 2CL5A 1FMTA 3BRSA 1V71A 4LZJA 1C30B 1V8PA 4Q7EA 1M2WA 2I91A 4P54A 4U6SA 4D6XA 1ZSYA 2PZKA 5JWHA 2QLJA 4KG7A 3OPMA 2PANA 4NMLA 4K0RA 4BJ5A 4NC9A 1IYZA 3M1YA 2IDMA 1QP0A 1M56C 3JYQA 1REQB 1PJBA 3ZDRA 1TW3A 3QMPA 1ZESA 4CFSA 4Q03A 4QYIB 3TL3A 2ZUUA 1E6WA 2PUCA 4V0SA 3FE2A 1NMXA 4WACA 1MOPA 3SE0A 2PGDA 5LP6A 1FNSA 2FSGA 4HX2A 1IXKA 1Y80A 3PICA 4DQ0A 1GU0A 4Z7OB 3C1OA 4Q05A 4LA4A 2NO1A 3RVJA 4URZR 1W96A 4KRYA 5DNYB 1KDPA 2X1VA 1N6RA 5EP1A 1XL1A 2IVZA 2OXIA 2B9VA 4CMJA 3FGNA 4LFAB 4U5CE 1RXSA 3DO8A 2PJUA 3MJDA 3A2NA 1RD4A 4J2TA 1LVHA 2ZBGA 4DQVA 4RX1A 2YKZA 1OFGA 4MW3A 4WRRA 5G02A 3TINA 5U1PA 2IU0A 5IJ0A 1Q1GA 1TIKA 3R7FA 1YDMA 4Q4DA 1UM9A 3BXPA 2RHGB 5JASA 4JBIA 4MJXA 3TR6A 2EP5A 3EGOA 4PYLA 4I55B 1DFHA 1GEGA 4K9NA 3LJKA 1U0JA 2QTRA 2R1ZA 4Y6GB 3VAZA 2LSEA 3NALA 5JS7A 4OFBA 2O8BB 1XVIA 3AKYA 3UJ3X 1QDLB 4WJ0A 3WY9A 3I39X 4ESEA 4DNQA 1C14A 1UM8A 1JDTA 3KJIA 2PYZA 2Y67A 4ZN6A 2F17A 1HX7A 2QJFA 4WBNA 3HKBA 2HKIA 4FKBA 3JQAB 2Q46A 3URKA 2GYVA 3KKEA 2RK6A 1IHPA 4R41A 4UM5A 2ZPAA 3RJ5A 2MYNA 2WPNA 1GGHA 5BWOA 3HV0A 4FZRA 1NU6A 2QMHA 3V8NA 1PX2A 1UWCA 5AVJA 4GQBA 2AV6A 4DHWA 3DMPA 4MPDA 2VDNB 3GAAA 2YXDA 1DKOA 3DS8A 2JW5A 4PLFA 4P5PA 3PPWA 1TCUA 2C7OA 4B6FA 2CSXA 1HR0B 2A58A 4L16A 1WLSA 3DT6A 4CGYA 1EGQA 4KVGA 4V1CI 5ECWA 4DZTA 5CYGA 1RRKA 4QYTA 4FD2A 5E33A 3MJRA 1XGKA 4MLPA 3T95A 2JGFA 3IDAA 3PQ4A 4YWHA 5THQA 1EFPA 1CR1A 2P75A 3OCJA 2Q8QA 4L5IA 4JLPA 3MILA 3DE9A 2CFRA 4Z54A 1EQ2A 4NCAA 2VNHA 3DAHA 2J32A 1FUYB 2BSAA 1L4LA 1RWMA 4E2FA 4BNHA 3AHCA 4KSCA 3HWWA 3L0IA 1D0IA 2P68A 5NULA 3UFXA 4R2WA 2JBHA 2FGKA 5ALUA 1LBQA 4S2EA 1ENYA 4NY1A 2I6TA 4IIGA 2YN2A 3DA8A 3BRQA 1ZNYA 4KXLA 2XJ9A 1XPJA 3IQFA 1OQAA 3KYDB 1UKYA 3OLXA 5TQJA 1TK2A 2WZBA 1L9XA 1Z39A 3VVCA 4ARSA 2HFJA 1DLJA 2MWQA 2FSVC 2UYYA 2QRUA 2V6MA 1C4XA 1QB7A 1OCCC 3HUEA 2WIAA 3KV1A 4O2AA 5KAPA 1C3XA 2GJSA 4F6RA 3VUEA 3FRHA 3ROFA 4AKIA 3H6HA 1ZI6A 1SOVA 1XTUA 3FZYA 1SVWA 1BBHA 1XD2B 4MVXA 4ONEA 3IUPA 5H5JA 1DC6A 4EF5A 2QLBA 1WPRA 4H7JA 1MU0A 1CFZA 1ONSA 2DPLA 3LPAA 1DTWA 3HACA 1NU7D 4B73A 2W4MA 4JLWA 3ZZ1A 3RC1A 3OM1A 3G7NA 2ES4A 2XYPA 3ZQUA 4TT3D 3NTLA 4EEZA 1V47A 3KYJB 3T6GB 1YJAA 2QX8A 5IXSA 3WOVA 4QBFA 2ZUBA 1LF0A 1E1LA 1CVLA 1ZHWA 2E87A 1SUAA 1I4OA 3R2PA 1M2VA 1Y9ZA 2SBTA 2IKSA 4KPUB 4JBYA 2QGZA 3RT9A 3LQYA 4M1YA 5JS1A 2QBYA 4OFWA 3HEBA 3SF8B 5JATA 6Q21A 4C2AA 4PBSA 3NORA 1OXTA 3AF5A 1KC3A 1KMNA 4IIHA 1A0BA 4CQLA 2X4IA 4CIVA 2HO5A 4HNGA 3O55A 1UXKA 3H2JA 1AT1A 4KE9A 3ANYB 3IRVA 5JIBA 3LT2A 3U0CA 2XRYA 1KQPA 5ITWA 1QIHA 3G1TA 5GONA 1CK4A 4XGQA 1TWGA 3W6PA 1QYVA 3B38A 3O75A 3MK31 1I2AA 4W4TA 3E35A 4PLHA 2ZBPA 4ZHQA 1OR2A 4RETA 4PVDA 4UHBA 2B7CA 4QUEA 1OX4A 1B3RA 2A0KA 3O7WA 1OE0A 1Z2OX 4DCNA 3R7WB 3NCTA 5F2OA 1CQIB 1IVSA 1IN8A 2WB2A 4OFXA 2FWNA 4HNHA 4YLEA 5E6RB 3RYIB 3ZHUA 4TRJA 4BC0A 1O8BA 3NUZA 3OQVA 4ZDWA 3RC7A 1QZZA 2OP0A 1UPTA 3KB6A 4DSOA 4CM7A 1V7ZA 5HX7A 4JXXA 2VJYA 3DD1A 5DTJA 5FD8A 3L8EA 5LPNA 4DXWA 1ZW6A 2W93A 2AE1A 3FZQA 3QJYA 4IG4A 1LK5A 4FS8A 4TTJA 3NBFA 2CFSA 4G5RA 4CV3A 2QM0A 4C7VA 5JVEA 1KIAA 2PX4A 4F9EA 2K2WA 2PX0A 4TPKA 1BKDR 4PRKA 5GM2A 1LI7A 1KOLA 3KKBA 4G0WA 3I9JA 1OIWA 1Z17A 3UPTA 3H2KA 5A04A 4COOA 1NDHA 4YAEA 3AQCA 5KOYA 1XJ5A 1UIMA 1W75A 2ZT5A 1OI4A 5IHXA 4CEIB 4YNBA 2BFDA 3PCTA 1AS3A 3HFSA 3FDZA 2JKZA 4DJAA 4ZO4A 1LSJA 2QN2A 2CEAA 3AEKA 1TQ2A 4QBTA 5ICGA 1MC8A 4DLXA 3TZHA 1VK5A 3SFTA 1VIDA 1K75A 2B4AA 1DOZA 3KKQA 2CVPA 5KDOA 3BEDA 1SQFA 2ZRGA 4BECA 2VHEA 4KQ1A 1B26A 4KDFA 5GOZA 5IDYA 3O38A 4YCNA 4MRAA 3LNMB 3LKBA 2WD7B 4P0TA 1E2KA 2C2XA 2B4KA 4F7WA 1EP3B 2H08A 2A9VA 1TKAA 3AR7A 2P2CA 4FTWA 1NATA 4M6WA 1JOGA 1TVMA 1AS0A 1VCIA 2IZ0A 2GZAA 2PSSA 5J1TB 1BHO1 1XQ6A 3D4IA 4URYR 2IPXA 3US6A 3QEKA 3GM1A 1EJ2A 2OCLA 3GROA 2FXVA 3TRJA 1WUIS 2ATEA 4JJGA 3USES 4WK2B 1K06A 4K5QA 1IDN1 1NVAA 1UDWA 3FUXA 3EXIB 3G5AA 1L4UA 1MJGA 3BM5A 2VPIA 2ID7A 3CSKA 1V37A 4RLFA 3UCEA 2VDQB 3DT9A 2WG1A 2QD1A 3JYLA 1E0AA 3RF6A 2IPNA 3KBOA 4OEHA 2O8EA 5K0ZA 3NC0C 4C89A 4YN3A 1XN1A 2X8LA 3IXMA 3QOXA 2WPDD 5AI6A 3LW8A 3UJBA 4PYQA 3U19A 5A7FA 4ULVA 1OLSB 3WFZA 4S3MA 1HG0A 3HA2A 8ADHA 1AVOB 4N4AA 1RDFA 1QYXA 4GMGA 4MKHA 2IOHA 1DBSA 4UNSA 4YI3A 4CCYB 2H1CA 4K40A 4GC9A 4QAJA 1SFRA 2HRQA 2W6JA 1M75A 3I9LA 2FGYA 2CK3D 3CEHA 2CBZA 4RXUA 2BM0A 2J0XA 2PU7A 3HNJA 4XPYA 3Q11A 1B1CA 4Z4FA 2XB8A 3G68A 2VCYA 2ZYHA 4V0LA 3L7JA 3KIPA 4H18A 5TDHA 5ERXA 4TRRA 4Q9DA 5IF9A 4F1JA 1WZNA 2TMDA 1QFSA 3HEMA 2JI9A 2WJPA 4F6CA 3R7NA 4J0EA 5B1AC 2PYDA 2C7GA 4C30A 1T5IA 3PFWO 3C3WA 2YY5A 3EXHA 1YHYA 1CY7A 1K0UA 3DFZA 2CLDX 4MUXA 2O8FB 1Q14A 2Z98A 4GECA 4TSKA 4QATA 2P77A 2R7AA 1QGZA 5EIWA 4JYZA 3EIXA 5C4GB 1GADO 1KZ7B 3ZE7A 1A7KA 3OPYB 1AZLA 4PU0A 5HKKA 2VJCA 3C1AA 3JXEA 1N8KA 1A2KC 4PQRA 3QTHA 3FYUC 4BCBA 2O5CA 5ADVA 4YX9A 3NIDB 2GPSA 4TSFA 1ZD9A 4A8TA 3FTCA 3KD3A 1MAAA 3PHHA 4V39A 3WVNA 3NAGA 2H52A 3DCNA 4EW3A 5DM70 1XHLA 4IQGA 1RRGA 2JFHA 5L7WA 4GUDA 5LYJA 1TYDE 5DZSA 4NHEA 4X45A 4PF1A 2RB4A 1PWYE 3OLZA 2H0AA 1JDUA 1B68A 4FE3A 3N05A 1QYDA 3LFHA 3HU1A 4JP2A 1A50B 4AN4A 2VL7A 3T5DA 3O8BA 4G78A 2NUPB 2M9MA 2ET6A 2WYOA 5HS4A 3V55A 3RQGA 4DLSA 3FSGA 4EZIA 4B5KA 1T2FA 4QJBA 4QTXA 4Z3DA 1A2BA 4D6PA 1SKMA 5EJIA 2AMYA 4YQYA 4JOQA 2JLUA 3B0PA 3H6KA 4R3WA 4A6EA 4NJEB 3B2QA 4XUGB 1FJGB 1Q7TA 5K2MA 4KL8S 1W73A 4BBJA 3EF0A 3QXHA 3K6BA 2HNKA 4JSTA 2ZS9A 2L2QA 4YH1A 3IESA 8ABPA 2ZVQX 3ONDA 3A6ZA 2CCYA 4K88A 5CDTA 1EE2A 2D2VA 4WZ6A 1XT6A 5F1OA 2IV7A 3OQNA 1L7PA 1XZAA 5HPYB 3AH8A 3BX1A 3HNRA 2HWWA 7REQA 2DU8A 4W5NA 1CUAA 4ZI7B 3RHTA 3PENA 4BG0A 1GAEO 3V4ZA 1DXYA 1HK7A 1GV1A 4DDMA 2HPAA 1H2FA 3WWZA 2DFVA 4F4HA 1M6WA 5JSYA 3GCWA 2H31A 3R3YA 3S81A 3L84A 2C9BA 2YFHA 2WWYA 4DADA 2FPUA 5LQAA 3UGJA 3D2LA 4X6UA 5BQ5A 1DBWA 4GP7A 3G0GA 2ORWA 5CFZA 5LQKA 3GZJA 1BCSB 1F4PA 1OYVA 1LPSA 1K1EA 4M0PA 5FA6A 1KO7A 3A27A 4M7PA 4ALNA 1E0KA 4BIIA 1WRBA 2Q99A 3AOEC 3SYNA 3CCFA 2ZYWX 3VGPA 1NVVQ 3W5BA 4N5IX 1OXKB 2D2IA 2A5GA 3QQPA 3EFOA 1B6TA 1LY1A 3TGWA 3SFZA 3DTNA 1JDBB 3HI4A 2V0CA 4PSKA 3U3ZA 1AK9A 4ZVQA 1G8FA 3ZJYA 1XNQB 2W98A 4ARBA 4QPZA 1FDVA 7MHTA 4J0FA 3E58A 4WOKA 4UZEA 3LVQE 6NULA 5FUBA 4A3SA 5E9AA 1TEZA 3E27A 4QOIA 1B2RA 2FMKA 4ES6A 1M34E 1I3MA 5FI3A 4IJUA 4YO7A 1QC5A 4IFEA 1RP7A 1UMDB 2O5VA 2QSZA 3FYHA 4GM0A 1Q7EA 4FM9A 1C50A 2E89A 3LDHA 2ILTA 2JATA 3TIIA 2KGOA 1RTTA 3RAGA 2CHQA 4CLHA 1KU0A 3ZEAA 4PS1A 3B5IA 2G9ZA 4LYEA 4WXHA 1O5IA 1PWHA 3WYBA 1ZOOA 5JFOA 4ITVA 3CH6A 1PJZA 3TNJA 3QG1A 1YE8A 2A69F 2QZ4A 1UFRA 5DTIA 4OK3A 3EHNA 3ZKWA 1V2GA 1VL6A 3QLTA 3WQHA 2QX4A 3OPNA 4KWTA 1I3KA 4DKJA 4GPAA 3WI7A 1ZRSA 2R1TB 4DEVA 2ZSHA 5FI0B 3ZIDA 4WECA 2CJWA 5GV8A 5EMNA 1G98A 3NP7A 1IPHA 1TFRA 3RO7A 5FO1A 5G0WA 3S9OA 1NI5A 5KMGB 1UP6A 1S8NA 4UHEA 2BR4A 4HUQB 1KAOA 3L7KA 3FOCA 1ZHXA 4OIOF 3S1LA 3MWYW 1VTMP 3I4CA 1J42A 4D1YA 2PH7A 4B7UA 1VLQA 1XKQA 2WAXA 2FFRA 4KC9A 4LLCA 1ZBQA 4RF4A 4EENA 1C7RA 4ZTUB 4RK7A 5I4IA 3LVBA 1NVFA 2I71A 3UB3A 3N6RA 2OCPA 1DXOA 1PJ3A 1VOTA 3KJQA 4I1OB 5ALQA 1TJNA 1HTWA 2HLNA 3QWBA 4P1ZA 2XKKA 2JLCA 1XAJA 4FN5A 4RZXA 2YJ4A 5FYQA 3Q7RA 3E4DA 3P7MA 5L0FA 5GM1A 4RTLA 1WHTA 4CR7A 3AFHA 3WLIA 4C0LA 2PD6A 1F2VA 4H16A 4EYGA 1ZGGA 4IL5A 4JFAA 3RREA 3OTIA 2HPVA 1LE4A 1OY1A 1OVMA 4B85A 2XQKA 3IURA 1QGAA 4XVQA 2IY7A 1HRDA 2DQ4A 4MVJF 3WGNA 3ZWMA 4RD1A 3MWJA 1MJHA 3OZBA 2XRFA 4NAHA 3ZTZA 5DLEA 5KSPA 1VKZA 4HTFA 5EK0A 1NR5A 4Z8YA 1VG1A 2D0OB 4LSMA 3JQPA 2OSVA 2RH8A 4AECA 3PL1A 5K0LA 4IZOA 5TLSA 3H7AA 2ZM6B 1QVVA 2YVQA 3PFBA 8ATCA 1F17A 3NM5A 4UUNA 4UBOA 1NF3A 1TA9A 1SG9A 3EDCA 1E3SA 5L3QA 1EFTA 4Q93A 4WLFA 1L7AA 4Q02A 3SXZA 2WMOB 4WCFB 1NXTA 1QVXA 3TQIA 4NG4A 1DZIA 1EJ6A 2VSYA 1DIOB 4JUAA 2ZJ6A 1Y37A 1Q22A 5JADA 3QY0A 3M6UA 2V54A 5G1PA 4S1VA 1GKUB 3K94A 3LIPA 3OQPA 1ZLYA 3P2JA 5JMWA 4WABA 4HNVA 3K5WA 3T1QA 3T6BA 1EVQA 1NP7A 2H7XA 3G50A 4O4LB 2OKGA 2QU7A 1QOQB 2VJBA 3WRWA 3JTLO 2GF2A 3PC8C 5EERA 1XFAA 2ICWG 4ESHA 5AKLA 1U2RA 4FEAA 1I94B 5A1JA 3TLJA 121PA 5GOTA 4OK5A 4B2YA 2N47A 2X6QA 1T8PA 4U7GA 3U61B 3F9IA 3V7YA 4Q6WA 5CG2A 5KTYA 1R0XA 3Q7QA 1BH2A 5SZIA 3VU1A 2GXUA 3WGKA 4BVGA 4R84A 3URMA 3OCUA 3PQFA 1SELA 2NVOA 4XRRA 4IGFA 2C1XA 3EMVA 2XVMA 1GPWB 4O2BB 2YNMC 4DY4A 1JYSA 1TT5B 1IZ8A 1IU9A 2BMAA 2PFKA 4GI7A 1X14A 3HC7A 3VVMA 3E7PA 1MB9A 2QE7D 4I9NA 3UM9A 1RRPA 4EO9A 3ZI4A 1G6Q1 4PJMA 5JISA 3LY5A 1JPNA 5LOVA 1U0HC 1OIVA 5DYIA 4TV9A 3OWOA 2OENG 3KG2A 4R8KA 4BMZA 5I45A 1BWRA 1M5RA 3C8GB 4FYJA 4QHTA 5JLIA 3GVIA 1C8LA 1E7SA 1A9RA 1MTOA 3FW1A 5BN4A 3HJCA 1XCMA 1XRLA 1CY8A 2QZPA 5BR4A 2JZCA 1BWSA 2P6UA 1SZCA 3TRDA 1JAYA 2OMEA 4ZCLA 4OMCA 2ZIWB 3GCZA 3MGCA 1W4ZA 1CUXA 5A71A 3EPVA 1GGQA 1WMBA 5AQ1A 4JI4B 5F9FA 3PXBA 2OCCC 3JQBC 4YDRA 5HBRA 2G07A 2HCRA 4JLOA 3F6BX 2PY6A 3AVXA 1B0AA 2V9ZA 2JFZA 3NVKI 4BWVA 4MUAA 2I7VA 4DLZA 1QOPB 4YP1A 5EJ4A 1J6UA 1XZBA 4XPIB 2REQA 3AT1A 4P3YA 3GMSA 1VPTA 2R7XA 1E2GA 3L3BA 1TD9A 1FXSA 5JV5A 5TGDA 4CIHA 3UBMA 3ROKA 3OQIB 2H2HA 4D4NA 1TTHA 1UZAA 3R6LA 1BXGA 5BR1A 3ONNA 4LJAA 2ENWA 2W2NA 2BGJA 3L7CA 3ESZA 1JG3A 1WIWA 1U0FA 3GLFA 4PLYA 3ISJA 1GD1O 2H7OA 4D4HA 1FP6A 5JVDB 1A71A 2ZETA 1N0WA 2RHMA 1PLJA 5IG2A 2X5NA 1Z45A 1FDTA 2IXDA 2O2GA 3JT1A 1XDSA 1F12A 2UVPA 3WWEA 5CU7A 2ZIZA 1LLDA 1K9VF 1NXOA 1JBKA 4NNJA 4IIBA 3B6IA 4KVFA 1K6XA 2YMLA 3AEUA 1J2EA 3I0ZA 4DSTA 1VHJA 4BZWA 3CB2A 2H1VA 4AFNA 1JZSA 3BJZA 3E53A 3I8SA 4ZVUA 1T0HB 1ECBA 4MW0A 4R81A 1EFHA 1MORA 2V7UA 1AKVA 1WUYA 3OM9A 4L72A 1ZUIA 3ZUGA 1IJFA 1GRVA 3V6LA 5TQ0A 3PHCA 1G20B 4C1BA 3NHUA 5T4FA 4K2HA 3MIZA 1R6UA 4J4BA 3UMFA 3F4BA 4CM3A 2PSDA 3E05A 5BSRA 5HCUA 2G63A 2XVXA 1WVMA 2G06A 1SOUA 4U2CA 3VUFA 4FDTA 2IYZA 1WOMA 3WAQA 1YS7A 5KOIA 3UJ6A 3DZHA 1XMVA 4COKA 4FOOA 1OIXA 1SXGA 3A06A 1XP5A 2VBGA 4FMCF 1FR0A 3H75A 2FN8A 3QVLA 5I3CA 3A1EA 3NTQA 5F5LA 5IN5A 3V7OA 3E3AA 1NYTA 1G19A 4IF6A 5CX1A 3PE6A 4E5VA 3PRKE 5M7EA 4XEHA 4HRXA 1GPYA 4K28A 1D0ZA 1NIJA 1NUAA 4ML3A 1E1KA 3LF2A 4MR8A 4ZYVA 3LQ2A 4RMJA 1FW6A 3AWDA 4LEIA 2KNHA 1U98A 2FFJA 3E5HA 4L78A 1APBA 3B8EA 1ZA1A 4EZBA 1G20E 1NHWA 4C6HA 5IM5A 5HQ3A 1L1QA 1EXMA 2TYSB 2W6IA 1U8YA 3UANA 2XB6A 4XVRA 4FEEA 2IU6A 3ZD7A 3G4ZA 4D57A 4R4JA 2PNJA 5COFA 3EEOA 2CF6A 2V8OA 1DRWA 2X9NA 3G89A 3B7GA 4N3BA 2VC9A 1YVRA 4OYLA 4RSGA 2EIMC 3QIVA 1ZD8A 4PQGA 4KC0A 4OLFA 4MSUA 2C2GA 1Z37A 1S05A 3TR0A 2AFIE 1R15A 1H3EA 2CD7A 4DV1B 4X24A 1JT9A 4BJHB 5BWNA 2HWYA 1EESA 4ANJA 3IE0A 4DC9A 2HMTA 3V2IA 4MDFA 5SICE 2X86A 2RGXA 1VSTA 3DKVA 3V80A 2W2MA 1AKQA 3RKUA 4F4UA 3Q5EA 2DXIA 4XGIA 1S3SA 4W8KA 3TTSA 1V16B 2ZIXA 2QM7A 2LNDA 1HEYA 1Z5WA 2HV9A 5JRDS 1Q91A 4OIFA 5MGNA 4M7OA 1YA7O 6LDHA 4DVGA 1YZHA 1E9SA 2ONCA 3I1FA 2QIPA 5ALOA 4J0QA 4G9EA 1XNRB 5JSQA 5D5QA 5T64A 1D0VA 3WO0A 3FMFA 2RI6A 2REOA 1LS6A 3PI7A 3ROGA 3IBYA 3ZZUA 1GDTA 3NBZC 4QTUB 3RROA 4JVOA 1EJ0A 1GA6A 3O91A 2RD2A 3BA6A 3H97A 2WAYA 4J3NA 3L4JA 3VHXB 1AKTA 1UJBA 3LYUA 3MC1A 3BIXA 1XPUA 1ZKMA 3IOEA 3SXPA 1PD0A 5BT9A 1Z5NA 4D4MA 1XWWA 1SZJG 4MRVA 1E79A 1TMYA 4JSYA 3UJCA 2G67A 1X19A 5IM4A 5DYTA 2VJQA 4F38A 1XAIA 1I4YA 4MPTA 3VH3A 1Z22A 3L7BA 5KS2A 3QLVA 5JDCA 4HMQA 4U9DA 3AF1A 4G56A 1QHSA 4ZAYA 1ESMA 4L4XA 2BGGA 1J49A 2OXRA 1BS9A 2EPMX 5DTMA 1U3GA 3N0XA 4IO1A 1O6ZA 3EK2A 4CKBB 1VL8A 1GAQA 2W9XA 3L7OA 4IWBA 1L6RA 2MR6A 2M6KA 2FNAA 3RBXA 2IXGA 1VJGA 3ELBA 3KQSA 3OWTA 3T3HA 2ZYSA 4NLLA 2PRKA 4HVLA 4OUKX 1DO0A 1OXMA 2XDYA 4ZALA 1NJ5A 1YZKA 4EHPA 3R5KA 1JSRA 4NPHA 4B84A 1YRHA 2FP4B 4I55F 3ZY2A 2P9YA 2AEEA 4CS8A 4JD5A 4X85A 2AOVA 1JDZA 1UC9A 2W83A 4Y98A 3QVGB 4I3MA 1CUCA 5CCEA 3FOAA 1RRMA 4YJHB 2HSGA 5JQGA 1NBMA 3ABQB 2O8DB 5C1IA 1WTYA 1KO4A 3ZVKA 4HE8D 3U44B 5AVOA 3PGJA 1ZOPA 3A25A 3C3YA 4UCQA 1TU0A 1ZH4A 1Q0RA 5F23A 5H1YA 1QE0A 2DUWA 5D92A 2Y3IA 4JBHA 4WGFA 1ST3A 1YQTA 3TL2A 3BGSA 3DLHA 2BUCA 4F56A 4ENTA 4B34A 1P17A 3KKKA 3HVRA 3JWHA 4UE2A 3CZMA 4FHEA 2HPZA 1O9GA 4ZI5A 3ETDA 3LWNA 3VH4A 5IVHA 1ZHTA 3CUWA 1SUBA 3OMLA 4IUCS 3TQRA 3CINA 2IXTA 3ZNOA 1CVIA 1Y4UA 1JT2A 3PTAA 3B9PA 2CFTA 5FUQA 4KFSA 3N70A 3B2EA 3EUAA 1ZH0A 4E5YA 3SQDA 4J4TA 1RXQA 1BRMA 4BNGA 3A4YA 4U3JB 2PGNA 4NYMQ 4ODIA 4I8DA 2XWJI 5DK6A 3IXLA 4N0PA 3NB0A 4S1NA 5IARA 1O5OA 3JV7A 1EM6A 3VO9A 3W34A 1C3OB 3BHMA 1YTUA 3D9QX 1JR6A 4WGYA 3KJFA 1XU4A 3SDBA 2R86A 4BMYA 3TOZA 1L5NA 1E2BA 1A9QA 3EQLF 2NZ8A 4PN7A 4DVYP 3P4YA 3T3NA 3WP1B 2VYND 3DJYA 3WNZA 3WQQA 2EJUA 1ZNZA 3SMQA 4ZGGA 3AETA 1ADJA 1AMNA 1WVIA 3VTFA 1YBVA 3GPCA 4TMZA 4FINA 1JQJC 1CJMA 3IKTA 2G80A 4JLKA 1U9IC 2VWQA 4YY3B 3L4SO 3FUVA 2BMVA 5KTPA 1CGOA 2Y2UA 4DIOA 4C14A 1QRRA 2J9VA 1KFBB 1Q0KA 4L4SA 1Z23A 1X7WB 2FSSA 2J67A 2FETA 1M74A 1XE3A 2RH9B 4QUHA 2NU9A 4BLPA 3VVLA 4CIBA 4NTZA 1RQGA 2IEAA 1TNDA 3BWEA 1CUVA 3BK7A 1QMGA 4JA0A 4PTZA 2WMNB 3F7OA 5FTKA 1IXYA 1JFSA 3S1AA 2NVBA 1DAHA 2PT6A 2UZ3A 3NMIA 2JGEA 1W29A 5PGMA 5J47A 4W6QA 4F96A 5BV0A 3FAJA 1Q19A 2EW1A 4JB3A 2P6OA 1I7DA 2XQJA 3SS8A 6ABPA 3GJXC 2JJMA 3G2KA 4QYXA 5H82A 2KBFA 2VDWA 4MMYB 3KJNA 1U0SY 4TVOA 4YJGB 3RRNA 5JO0A 3ND6A 1P4JA 3CR8A 3QTLA 3WNVA 3KOOA 2ZAGA 3AOGA 1PT5A 3LPDA 2F1IA 3OEOA 4FT2A 1MPXA 1ODLA 4LJ4A 4F86A 2ZQYA 4XVCA 1CW2B 2H57A 3ZHXA 1MR3F 4D42A 1JP7A 1NVGA 3PPYA 3OESA 3NVDA 2J4DA 2I78A 1ZAKA 2N46A 1M5UA 1BC5A 2BF4A 3RIGA 1IHUA 4MV9A 3V5NA 4R1QA 2DYKA 4I4TB 3CXRA 5JALA 5F76A 5JOQA 2GB4A 4GYTA 4NCQA 4PWZA 2YFKA 2DKNA 4UUMA 5BR8B 2HMZA 4KXUA 2GYWA 4KLAA 2CNWA 2WTAA 1Y4ZA 3BORA 5KTTA 4B7XA 2FHSA 1OAOC 1XXHE 2C4HA 1QR6A 3H5OA 1HI9A 2VZEA