4YT4A

Iron guanylylpyridinol (fegp) cofactor-reconstituted hmdii from methanocaldococcus jannaschii
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
345
structure length
345
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEHAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
total genus 131
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt4A01
1NTOA 1YGYA 3HJAA 3HG7A 3RCBA 4BMNA 1MV8A 3GPIA 1GAEO 1BW9B 2GN6A 3GAZA 2GZ2A 5BSGA 3S1LA 3Q2IA 4TZTA 5ENVA 2HMWA 1LDBA 3PRJA 4TQGA 2AQ8A 1V3VA 5F21A 4J6FA 1R6DA 4RLSA 1CETA 4BB5A 4E33A 2GNAA 2Y1OA 3IJPA 4GBJA 4Q9NA 4R69A 5DF1A 1NYTA 2IXBA 3WG9A 1XLTA 3U9LA 3ETEA 2EV9A 3DZJA 4WLUA 4ZQHA 2E37A 4A73A 4DPMA 1KEWA 2OXIA 1E1NA 2V65A 2EJVA 2IZ1A 3W8EA 4RCVA 3H9JA 2IRWA 4RVDA 1HKUA 4IQGA 4CQMB 3H5AA 3JD0A 3RKUA 4WJZA 3BXXA 4NFSA 1BSVA 3WXBA 3GVIA 1PU2A 5DBIA 1ZMOA 1GY8A 4Y6PA 3OJFA 2OFPA 4RVHA 2P9EA 5CP8A 1BVUA 3DHNA 1NFQA 5JPIA 1V3UA 4BNMA 3RSHA 2YFHA 1WW8A 3RBVA 4ALMA 4RF5A 2PGDA 3A4VA 1LDYA 3LVFO 4LMRA 5KKCA 1E7WA 4L73A 2XAAA 3KEOA 4OGWA 3PDUA 3UKOA 4CMCA 5GZ6A 4YR9A 4DQVA 2NLOA 3WGYA 1V3TA 1UDBA 1ISJA 2FPGA 3I9KA 5DBFA 1OOEA 4B4OA 4R1NA 2FRDA 4EEZA 1EEHA 2ZK7A 3EC7A 1MX3A 4WPGA 3GY0A 4E0BA 4EYEA 2QW8A 3FTNA 2HLPA 2QYTA 2NTNA 1AHHA 3FBTA 5JCJD 4CJXA 5GZ1A 3GHYA 4Y6RA 4B79A 4NZ9A 2XPCA 1T1SA 3U4HA 3ZU4A 3GEGA 5FI3A 4YYZA 3V1UA 5IDXA 5KJ6A 4RPHA 1VSUA 1H6CA 1U4OA 1ZK0A 3MTJA 4Q3DA 4WKGA 3PWZA 2B5WA 4CMGA 1NVMB 5I8ZA 1J5PA 1OI7A 1E7YA 3NDRA 3RUEA 3Q0EA 1U3WA 2D8AA 4AJNA 1YQDA 3ZWMA 4B7CA 5IDYA 1YL5A 2GZ1A 2IZZA 1SOVA 2BGKA 4IUYA 4UULA 3TF5A 4YA6A 4AJEA 4DC0A 3G1TA 1KOLA 1NXQA 1CDOA 1HSOA 3LC1O 4R9SA 1M67A 3P5SA 4GGPA 1AXGA 3GG2A 2GN9A 4K9DA 1TB4A 3VC7A 3X2FA 4BGEA 3K9QO 2DQ4A 5A05A 3NGXA 4XR9A 4INAA 1U9JA 2GUGA 4FOOA 4LCJA 2VRBA 5FWNA 1YBMA 3FHLA 2OP0A 3ZWPA 1UAYA 3ZWYA 4QEDA 1PL8A 1I01A 5KVSA 4K6FA 1JKJA 3O38A 3TFQA 3WTBA 3ZV5A 1PL7A 4JBHA 2NTJA 4QQRA 3H4VA 1E77A 4EBFA 5HBRA 3KXDA 2VYND 4BO2A 2FR1A 2Q4EA 4E5PA 3JQAA 3B6ZA 4DTIA 1R16A 1P3DA 2HJRA 1ORRA 4Q3BA 3SJ7A 5L51A 2PY6A 1DFHA 1EE9A 1P9LA 3ENNA 4EJMA 2O48X 4MIYA 3C24A 4F6CA 3CINA 3H6KA 3W6UA 2Q45A 2YW9A 4GL4A 3WS7A 5KJCA 4II3A 4PLWA 4NBVA 5TJHA 5JYDA 1BDMA 4NU5A 5MGBA 3NJ8A 4PRLA 2QRJA 1YXMA 4Q3EA 4MP3A 1RM3A 1QSGA 2QYSA 3UXYA 4CR6A 3PYMA 5A5FA 3ICPA 1KVQA 3CE6A 5BQFA 3M2TA 3CXRA 4FC7A 3ROPA 1GTMA 2OBNA 1F17A 1FJHA 4FB5A 3UF0A 5CAEA 3DFUA 3GT0A 5HS6A 1XU9A 3V5NA 2AW5A 2ET6A 4KTVE 3JQAD 4XEHA 2PKQO 5A3VA 4JN6B 4CV2A 5JDIA 4TKMA 1SO8A 6LDHA 3ETDA 4FJ2A 3RIHA 1PGNA 2OHXA 4IDCA 1E3WB 1DOHA 4BNTA 4KQWA 1GCUA 1YBAA 2OBYA 2W2LD 2X58A 2QQ5A 4WLOA 4AJKA 1BW9A 2EKQA 2DU8A 3ZI0A 1J49A 4HX5A 4BL5A 5HWSA 4UVIA 3MWDB 3RROA 1X0VA 3FSRA 4ZU3A 5G0SA 2X6TA 3CZRA 2G82A 2ILTA 1GQYA 2CSUA 1NP3A 1YRLA 1ISMA 2F00A 2J3KA 2Y1FA 3WQRA 4D3DA 3SLGA 1YWGO 4J90A 5JBIA 5TLSA 3UCXA 3QV1A 4M54A 3AM4A 3WGGA 3LLSA 3U4CA 4RQTA 5G0VA 5CDTA 1DIGA 3I4CA 1MGOA 3L77A 3GMDA 3ZNOA 5IF3A 2B0JA 1JVSA 1JU9A 4YAJA 4FSHA 3BMNA 1Q7BA 5THQA 5AQ1A 4MKZA 1UP4A 2EIHA 3OQ6A 4K26A 3O4RA 2YDYA 1Y6JA 2XF8A 3EVNA 3ZWNA 3R1IA 1PQWA 3K31A 3AOGA 3R0IA 3OM9A 4IS2A 5A04A 4MJLA 1O94A 3UVEA 2PH5A 4GX0A 4BS9A 1S7CA 4R01A 5F3RA 4Z6KA 3WGZA 2AQKA 3L0DA 4Y8VA 1U28A 1UJMA 4RV9A 2O2YA 1UR5A 1VL6A 1ARZA 1P44A 3QJ5A 5CG1A 2Z5LA 4N7RA 4HNHA 4RLHA 3GDGA 2W8ZA 3TRIA 3D3EA 3KYDA 1X15A 4HUJA 4GVLA 4QTZA 5F5LA 3FNFA 1JKFA 1CYDA 1W6UA 1ZK2A 2VZ0A 3C7CB 3CEAA 5JCJA 1O6ZA 4FFNA 5DOVA 3BIOA 4DIBA 3AM3A 4I5EA 3RFXA 3TJRA 3QIVA 1I36A 1DHRA 1NVTA 1PWXA 3PQEA 4BKQA 3GZNA 3AY7A 5JNLA 2UAGA 3OEYA 1KVUA 1RPNA 4UVGA 4Z0PA 1GL3A 5JC8A 4BO3A 1KETA 1F06A 4YAEA 1JAXA 3DHEA 5I7EA 3AY6A 1SNYA 4B8WA 2B5VA 2X5JO 3JQ7B 2PV7A 4LSWA 4A03A 4BNHA 3TZHA 2AG8A 4CUJA 1JLLA 3JV7A 4PRKA 4G81A 4OKIA 3DFZA 1U8XX 2PD4A 3WIEA 4Y67A 1DRWA 4BHTA 2E49A 3UOGA 1HYHA 3H65A 4D3FA 4DIOA 3HDJA 2EP5A 4JGBA 3FD8A 2NVBA 3GPDG 1C1XA 1GQ2A 5ICMA 4DGSA 2VUUA 1P0CA 2VTEA 1DJQA 4DRYA 3HZZA 1ADFA 4E32A 1GCOA 4I1IA 1PQPA 1HEUA 1A7KA 1GV1A 2BFAA 3PWSA 3V2GA 4C7JA 1ZEJA 2YV2A 3ZWOA 3PQDA 1DFIA 4ALIA 1MB4A 3TN7A 4DUPA 1ZEMA 2HO5A 2W2LA 5F1KA 4QT0A 4JP2A 1HE4A 3CMMA 4DQXA 1G1AA 3D5TA 2NACA 3ZZNA 2NM0A 9LDTA 2E82A 1IULA 4NK5A 5EL0A 3WQSB 1QRRA 2BD0A 1ZKMA 2ZQZA 1XQ1A 3HSKA 4HADA 1GPJA 3JD3A 2UUOA 1OC2A 3JCZA 1CJCA 1LX6A 5G4LA 1HZJA 4CMJA 3FWZA 3KM0A 3BMOB 1UZNA 1NVGA 3H3JA 1EQUA 5IXYA 1TI7A 3BMOA 4BO6A 1CWUA 2CF5A 1PEDA 1I2ZA 4UAGA 1QYCA 4RPJA 3RAJA 1A9ZA 3QY9A 4ZHSA 3A1NA 1EVIA 1K6JA 3OA2A 3GDOA 1XU7A 5I7FA 3VPXA 2PR2A 4QO8A 4ZN6A 4OH1A 4B7UA 4J49A 3GGOA 4LRSB 3G0OA 4BO0A 1ID1A 1FK8A 5L53A 3ZNNA 2R00C 4NJMA 1VRWA 1EFLA 4KUHA 4WLNA 5JO9A 4OXKA 3I6IA 3JD2A 3CIFA 3GEDA 4R3NA 4BNVA 4FIZA 3UN1A 2Q4BA 2CUKA 4GLLA 2VYNA 5C37A 3JYOA 1OMOA 3NJ4A 2YDXA 1AE1A 1BG6A 2I76A 4URFA 3A28A 1LA2A 1AGNA 2GDZA 2E6UX 3BMQA 1RM5A 1ZK3A 3G1UA 5AXDA 4BNYA 4OXYA 4OIMA 3AI3A 5F5NA 1PSDA 2FSVA 1LJ8A 4ZGWA 5IJZA 3ZHZA 1LLCA 1U5AA 3LU1A 3ANLA 2CDAA 3FPLA 3GVHA 4GSLA 3PK0A 5U4QA 4ZICA 4LW8A 3TPCA 2ZYAA 4CLDA 3G49A 3U5TA 1EVJA 4JXKA 3K2EA 3TQHA 2JJYA 2RHCA 1EVYA 1PL6A 3KLPX 2FMUA 1SC6A 4H16A 3HFSA 2UYYA 3ASVA 5KTKA 3RVDA 1U7HA 3KYBA 2TMDA 2Y1EA 1Y8RA 3B20A 1H6DA 2VWHA 4JCOA 4XZ3A 1A27A 2PWZA 3AFNA 4OAQA 1D1TA 4R1UA 2UDPA 1XSEA 1U2DA 4R3WA 5T5QA 5KJFA 4RPLA 1KBZA 5I9LA 5BNTA 3QQPA 3S2IA 1DPGA 1HDYA 1N1EA 1P1FA 1SPXA 3Q11A 3VKVA 4PLCA 3TZ6A 2IEBA 2VYVA 1B8VA 2BFOA 3RWBA 3ZHBA 2NADA 1H2BA 2I3AA 1T26A 2X8LA 2IE0A 3DBHB 1QXSA 1YOVA 3FF4A 5AXAA 1LI4A 1XEAA 5IN5A 4BNNA 1XG5A 2JCXA 2BFMA 5JAZA 4MVJH 3U62A 4XQCA 1V8BA 3JQBA 1FDWA 4ALJA 3DZKA 4WCFC 1ZJYA 2GR9A 4BGVA 3OH8A 3GK3A 4PLHA 2Q3EA 5A03A 3GOHA 4R5MA 1FF9A 1EUDA 1XHLA 4DLLA 4TRRA 4I9HA 3D4PA 2D2IA 2B36A 1A4UA 3RBZA 3OICA 3C1TA 4RVSA 2IDZA 1P31A 4RZHA 3S2FA 4IJWA 3JQEA 5H82A 3EYWA 3ZWVA 4WLEA 3GH3A 2P4HX 3VKUA 2UVDA 4R41A 1T4BA 1KIFA 2GASA 3I6QA 4WEQA 5JAQA 5JDIC 1EBFA 1IHYA 3ZDFA 1NQOA 2IEDA 4JIGA 1WDMA 4EUFA 4FJ0A 3I9NA 1Y9AA 5T67A 2Z1MA 5DCWA 2G17A 2BF7A 1PX0A 2NVWA 4WEOA 5JDCC 4GX2A 4DWVA 3QVTA 4XKJA 5JMWA 1GD1O 4ZJUA 1SB8A 1U4SA 2HRBA 2GLXA 3DBLB 3EDMA 3ASUA 3L07A 3O8QB 3S55A 4CLHA 1MG0A 5K6AC 4O6VA 5ENDA 4BNJA 3D4NA 4EDFA 4W9NA 1ZO8A 4AJPA 3TDKA 1NNUA 3ULKA 1F8FA 1K6XA 3F4BA 1VJ1A 3GC6A 3ROKA 3CUKA 4UUOA 2AE1A 2GSDA 1ENYA 5BNFA 2RH4A 4M87A 3S8MA 4C4OA 4OMUA 1N9GA 3KO8A 4YBZA 1Z7BA 3A06A 2JFFA 4ZRMA 4CMKA 4D0RA 3PHIA 2QZ9A 3HN7A 3R3SA 1B7GO 1GV0A 2ZB4A 4GWGA 2C7VA 5IXSA 2C07A 2DPHA 4XGNA 3GMSA 4YT8A 5B37A 4TZKA 3CKYA 1XKQA 4CLEA 2PZMA 4CV0A 1E6EA 3A14A 4FGWA 4WASA 3KV3O 3PGXA 3LT2A 4L4SA 3W4KA 4Z9YA 3F9IA 1YH3A 1QR6A 1FMCA 3IJRA 3RBXA 4CQLB 2O3UA 5A1TA 4DIFA 3P7MA 3VPHA 3VVCA 1YQGA 2PNFA 3A9WA 3F3SA 5CPFA 2I66A 3FBGA 3INGA 3DOJA 1T4DA 3I9JA 3ZWCA 1C0LA 1JTVA 3LSYA 5G0WA 1R12A 3PJFA 1BVRA 4DVJA 1PS9A 3OFSA 2VOEA 1DLIA 2RHRA 3FRJA 4G2NA 3WSWA 2CZCA 4E5NA 3RQSA 2I9PA 2C5EA 4MVJI 2WSBA 3H5RA 4FBGA 4TKLA 3DZBA 3WGQA 1C1DB 1I2BA 4E5YA 3L9XA 3HHPA 1CQJA 4JBGA 3GAFA 3ZV4A 2V6GA 1JWBB 2ZJ1A 1UXJA 1PJTA 1SZJG 2HRZA 3AW9A 4Z9FA 1XWFA 4IDDA 4FCCA 5G0UA 1RWBA 2VHXA 1HSZA 3PZRA 2ZTUA 3QVWA 5I9MA 4J7UA 1HTBA 2Q1SA 3MJTA 1LC3A 4GVXA 3DZHA 3PP8A 4S1VA 5IZCA 3WBBA 1Q7GA 4L74A 1UXGA 3L9WA 1IB6A 2EGHA 1E3JA 1ISIA 1T24A 3HDHA 4J1NA 1ENZA 3U4DA 2LDBA 4TSKA 2J6IA 3RC1A 1F0YA 3WGIA 1SOWA 1XIVA 3ZU3A 2GPTA 3GFBA 3TWOA 4U8GA 4ND1A 3JYQA 3QW2A 3IC5A 1I24A 2O7QA 4YRDA 4Q39A 5KVQA 4YWJA 2DBRA 2IZ0A 3D64A 3PDJA 1DC3A 3JTMA 5DP1A 1H93A 4I5GA 1LC0A 5A06A 4YJFA 1V0JA 4FFPA 4FD3A 3NDJA 5ITWA 4FFLA 1PJCA 5ER9A 2Q50A 1SEVA 3NTQA 4AJ1A 2BHLA 4BO7A 1XGKA 2IYPA 5DT9A 2DTDA 3QLJA 1T25A 3DZGA 4RF4A 2ZQYA 4Y98A 5L3ZA 3RKRA 1I5RA 3E5MA 3QVXA 4K6CA 3C8MA 2AXQA 3LT1A 4N5LA 4YJGB 4P4LA 3OBBA 2OMEA 4LSMA 2Q2QA 1DC6A 2HQ1A 5T57A 4BNIA 3GVCA 4FOSA 4PLTA 4IXWA 4BUCA 4BMSA 2HMVA 3GNSA 1Q2XA 4MPDA 3MJCA 3BA1A 3NTRA 4ALNA 2ZB3A 3JQFA 2ZYDA 5C7OO 1ZH8A 2WM3A 2FZWA 3U0BA 4D41A 4RDHA 3W8DA 1Z74A 3IP3A 4YJGA 3DDNA 3COSA 2OO5A 2NU6A 4TROA 2DFDA 2NV6A 2UV8A 1R0LA 1M66A 1Y5MA 5TQVA 3E1KA 4YVFA 1JW9B 2YFQA 3WQQA 2BGLA 1LUAA 4RF3A 3G79A 4IY1A 1K3TA 2VCYA 3I4FA 5LDGA 1E6UA 1K89A 4MP8A 3C7AA 4TVOA 1C1XB 3KSUA 1GUYA 7ADHA 4Z0HO 4CM7A 3ZWXA 3ZH2A 1HDGO 1Z82A 4XIYA 5BNIA 5KJ1A 3OSUA 4KTTE 2GGSA 5DBGA 1QP8A 2W90A 4RF2A 3PJDA 3PXXA 4XDYA 3E6AA 3WR5A 2Y1DA 5DN9A 3LQFA 4MVJF 3DR3A 4GSKA 1FDSA 2FR0A 1DLJA 4ONEA 5DZSA 1EDOA 3UW3A 5TRTA 4IIVA 1YJQA 3UAGA 5C7IO 4MP6A 1HLDA 4TMFA 5T8KC 2CVZA 3PHGA 2EKPA 2R6JA 4U0KA 2HK8A 4LN1A 3RUCA 1N2SA 4EEXA 5JSFA 3EZLA 3JYLA 4JBIA 3I83A 4PZDA 1RYDA 1YOVB 2J5RA 3F1KA 4ZVVA 3ZN2A 3HWRA 1QYDA 3O8QA 1HL3A 4KZPA 1NAIA 2ZB7A 1WAMA 5EIOA 3NUGA 2ZIZA 4XYBA 1B3RA 5TF4A 3WJAA 1O8CA 4OQZA 4IDEA 3ITKA 2PK3A 3W8FA 2FHSA 4LVUA 4B3JA 3DQPA 2C5AA 2PZJA 3JQGB 2FSSA 2QRLA 5ILOA 4NH4A 1LTHR 2H6EA 1E3IA 4Q3CA 2VNAA 4QXMA 3GN2A 4FFMA 5JE8A 3KLMX 3RUDA 4D45A 5C3MA 5T8KA 3ROMA 5A9TA 1HDZA 2CD9A 4RPKA 1BHSA 1T2DA 2B37A 3DXFA 3JQ9A 4P38A 5C7LO 4CLXA 2HDHA 3GZ4A 4B3HA 1AHIA 3ANMA 1R4NB 4W99A 3C85A 4Z0TA 1WP4A 5G2OA 1KC1A 4B4UA 1YB5A 3M2PA 4RVUA 4RVGA 3EW7A 3F6YA 2Q2VA 1YVEI 1DIRA 4HNGA 4AJHA 4CM9A 3VVBA 1IOLA 4CQMD 1B2LA 1PJ2A 4GGOA 3Q9UA 5TT1A 3X2EA 2HMUA 1U3UA 4RQUA 3I23A 1O0SA 2W2KB 4NBWA 3DEYX 4D44A 3GZNB 1PZEA 4OSPA 3EUWA 1EVZA 3L4BC 3PYXA 3EMKA 3HFGA 2VZ8A 2A35A 4FW8A 3WDSA 3I5MA 3WJ7A 4Y6SA 1R4NA 2XXJA 1WLYA 1QMGA 3ONFA 1B3BA 3IL2A 2VRCA 3GN1A 4J7CA 5KVCA 4BOYA 5KJEA 1ZNQO 5AOVA 3N7UA 1B16A 3ANNA 2O3TA 2VHZA 3DTTA 3K8ZA 3BAZA 4J43A 5L9AA 3PWKA 4CLRA 2EHDA 1Q0QA 2OZPA 1HT0A 3D0OA 3RC7A 4PLFA 1W4ZA 1H9BA 1BTOA 1D3AA 1DJNA 1ZXBA 2DTEA 5FF9A 4CMAA 1Y5RA 4ESOA 3QWBA 4MVJM 4QFCA 1IZ9A 3WFIA 1TA4A 3V8BA 3TZKA 3IOYA 1PR3A 3WMXA 4E2ZA 5CEJA 2NU7A 1MG5A 2DUUA 1Y81A 1AXEA 4PG7A 1E7SA 1H6AA 1NFRA 2AG5A 2AE2A 1VPDA 2A94A 3GF4A 2WD7B 3D3WB 3EK2A 5L7TA 9LDBA 4PCVA 3SVTA 3V2UA 3WYEA 2WWRA 3PHLA 4GX5A 4IZIA 4FQ8A 2VWPA 3DMYA 4WLVA 4PG5A 1GPDG 4RZIA 5HS4A 1K0UA 1XCBA 1MC4A 1EZ4A 3DBVO 1I3MA 3PJGA 4NI5A 4DPKA 5A9RA 1GZ3A 3WFJA 3IIEA 4WCFA 4P22A 2CY0A 2Y1GA 2PFGA 4LRTB 4YT5A 4YCAA 3BHIA 4NNJA 4XGIA 4IGEA 4JQCA 1BRMA 4PLVA 2WD7A 1P1KA 7MDHA 3ZU2A 2P2SA 1K5HA 1I32A 2XOXA 2O4CA 4XYEA 3ZWAA 3F47A 1IYZA 4J1QA 4DQUA 1HDCA 2JCYA 5L4NA 1MXHA 2YUTA 2EERA 2FPPA 3NYWA 3UFXA 3GNQA 3I9OA 3P2OA 3WGTA 1MFZA 4FJ1A 2GYYA 1J0XO 2VT3A 1TT5B 1L7DA 3D1LA 2JD0A 4WECA 3ZV3A 1C0PA 4Z3DA 2Z1NA 4XDZA 5COBA 4LK3A 3KUXA 4BO1A 3GVXA 2BI8A 4XRRA 2HMSA 4QX6A 2P5YA 3WMWA 4YAIA 2G76A 2QIOA 4Q3NA 2YHUA 1MA0A 4YQYA 4CM9D 3K92A 1ISFA 1BXZA 4MO2A 2B35A 4C7KA 3GQVA 2PLAA 1HWYA 1WPQA 4HXYA 3SBOA 4MKRA 4ZQEA 1LRLA 5LCXA 3H9EO 2IODA 3DOOA 4RPGA 5CPBA 2H63A 3L4SO 3RUHA 5I7SA 1QLJA 3IP1A 5HRUA 3HDYA 2AQIA 1MP0A 2EWMA 4OO3A 2Q1WA 4A27A 1OAAA 2B69A 3KEQA 3KRTA 3U4IA 1W73A 3ROQA 3WSVA 1R66A 1EK5A 3GHHA 4E5MA 4BO9A 3GR6A 1DB3A 2HCTA 2VWGA 4N54A 1N9GB 3HADA 3VPGA 5ES3A 3S2EA 2FWMX 2YV1A 1PTJA 4A0SA 1I33A 4R9RA 4KWHA 4ROSA 1UDCA 1BGVA 2OGUA 1MUUA 1VL8A 4ZQGA 1T1RA 1PR9A 3HNPA 3RD5A 2PGLA 2EF1A 4BIIA 2B4QA 4TRNA 2PH3A 1NBOA 1Y8RB 3FWNA 4PFJA 3JQ8B 3K5PA 2WYUA 2I6TA 1TEHA 2J8ZA 4BV9A 3KOUA 4W82A 2YQ4A 1VI2A 3BTSA 4BNXA 2EP7A 1KVRA 3TOZA 3MEQA 3PGJA 3E18A 4CM4A 4YDRA 3AY3A 3ZNQA 3ONDA 1YONA 3ZNPA 3RC9A 3NKLA 3VZRA 1LLDA 1X7DA 3SLKA 2Y93A 1MXFA 1B14A 1JA9A 3WOHA 3VZQA 2AA3A 1LLUA 3DBHA 3TOXA 1M6HA 1ADCA 4ND2A 1EK6A 1BMDA 4Z3KA 2W4QA 6ADHA 4YRBA 3T7CA 2JAHA 1NR7A 2JFHA 3EVTA 3PIIA 3ITDA 3GGGA 3VH3A 3Q3CA 4L4RA 4BO5A 5JLAA 2GN8A 1TLTA 1DFGA 2BMAA 3JQCA 3RI3A 4ND5A 3D4OA 4R16A 4BKOA 3OIGA 3ORFA 3ENKA 3F5SA 2X23A 1DO8A 4MKXA 1PJLA 1DAPA 4B7XA 2JKVA 2IYOA 3OA0A 3R6DA 3KB6A 3HE3A 5EINA 3E8XA 2VHVA 4IMPA 4ALLA 1Q0HA 1VE9A 1GUFA 2D59A 4CUZA 2D1YA 4L75A 3QA9A 4EJ6A 1KEVA 4DPLA 3E03A 3LYLA 1AUPA 2JD1A 1A5ZA 5JMPA 1F12A 1ADBA 1IZ0A 4JJIA 2DC1A 4NHEA 4BNWA 2R2GA 5CDYA 4ZQBA 3MJ4A 5T64A 3QWHA 3GRPA 2O3QA 1ADGA 2O4UX 2Y66A 1YJ8A 3O03A 1H2HA 5ADHA 1Z45A 4J4TA 4K1LA 3VPSA 3JQ9C 3UCFA 4A7PA 3TSCA 2H5LA 4P8RA 1C14A 3BMCB 3WGOA 3NT2A 1ML3A 3JD1A 3RUAA 3HDQA 1SAYA 2R00A 3PEFA 2YQ5A 1NFFA 3INTA 3NTOA 4CLRB 1V35A 2RH8A 3IMFA 2YYYA 4HFNA 2I67A 2Y1CA 4MOWA 4EI2A 4H3VA 4IJKA 5A3JA 4BNFA 1GQQA 2V7PA 3VDQA 1YO6A 2YJZA 3ZCXA 4WNIA 2VHWA 4PLYA 2OOSA 2AHRA 2D5CA 4IDGA 2DBZA 2NU8A 3WX0A 1J4AA 4JJFA 1CEQA 3K30A 4FDAA 4II2A 2I3GA 2O50A 4DYDA 4YJDA 5GZ3A 2NVUA 4WLFA 3MTGA 5L45A 3DL2A 2DUWA 3NGLA 4BNKA 3VAZA 2XXBA 2YZ7A 3KYCA 3WB9A 3F46A 2RCYA 3TNLA 4ID9A 4H7PA 4BGIA 4IDBA 3UHAA 4CR7A 1NM5A 1WZEA 2C20A 4MIOA 5L4LA 3IQDB 1E5LA 3DO5A 5K9ZA 1NWCA 2G5CA 3T7EA 2C2XA 2YY7A 2QZZA 2POQX 1ONNA 3BTOA 4BKRA 2ZTMA 4OHUA 3WWZA 1ZFNA 3PQFA 4GMGA 3IAHA 2W2KA 1B26A 1HYGA 3I9MA 3QRWA 4JX8A 3KSZO 2VTDA 3V1TC 1ZXLA 3OETA 2EGGA 4GI2A 3VDRA 4BGUA 3BTUA 1E6WA 3I1JA 1PGPA 4TRJA 2JHFA 5F1OA 2PD6A 1IPFA 4CMIB 3FR8A 4CMIA 4MVJG 3MZ0A 4HP8A 1GZ4A 1V6AA 4NIMA 2D4AA 1P0FA 1WDLA 2J3HA 2C29D 3OIDA 4P4NA 4UEJA 4NFYA 5EJ2A 2X5KO 4BNLA 2ZKLA 1C0IA 1KERA 1FXSA 1PZHA 4J2OA 1PGJA 1PIWA 5DDIP 1PS0A 5L95A 1GZ6A 2YHIB 1KY5A 5IFLA 4S3MA 4IIUA 3STHA 3O26A 5U1PA 1GADO 1NQ5A 4IMRA 4L4XA 1ZZEA 5JC1A 1YS4A 5KIAA 4BQPA 4DYVA 5FI5A 1KYQA 3JD4A 1DC4A 4WOJA 1LBEA 1C3VA 1LQTA 4R54A 3K73O 1EUZA 5JAMA 3GNTA 2DVMA 3UH1A 3DC2A 3M1LA 5HA5A 1ZBQA 4IDFA 4K28A 3AU8A 1QKIA 1R4MB 1R15A 4J9UE 4PG8A 1D4FA 4LGVA 3PYLA 4FPXA 1HZZA 4E3ZA 2DKNA 4CM8B 2P91A 3WTCA 2BGMA 3U3XA 2X0RA 5KCZA 5C5IA 2X9VA 3JQ8A 1VSVA 2HSDA 2ZTVA 2BH9A 1RYEA 2WYVA 2X9NA 4R51A 3TZQA 2C59A 4HFMA 3K6JA 3ICCA 1W8DA 4KUEA 1GYPA 1N92A 1ULSA 3JQDA 2P68A 4I5DA 3C1OA 4F46A 2Y0EA 4DXHA 1KC3A 4EITA 3WLFA 1R4MA 1UP7A 1XYGA 4XJSA 1YKFA 4GX1A 4CM1A 2QX7A 1NX6A 2FOIA 1U5CA 3ADPA 1BXKA 5CG2A 5EQDA 4ZQFA 4BKPA 3GDFA 4D3SA 3ST7A 5IZ4A 4L76A 1DIBA 3IS3A 2P9GA 2PD3A 2SCUA 4IQ0A 3KYDB 1DXYA 3GRKA 4E13A 1O95A 5ITVA 4I9UA 4GKVA 4M1QA 1KY4A 3JQ6A 4JROA 1YBVA 1G6KA 3PIDA 3RU7A 3DBLA 1UZMA 4P4GA 1MFPA 5JS6A 3DWFA 2Y68A 1Z73A 4R68A 2WEKA 1HDOA 5I9NA 1OFGA 2X9GA 5TC4A 2GCGA 2C2YA 4DL9A 3H2SA 4YAKA 4MIEA 4CMEC 1GEGA 2JCVA 4I8XA 2X1HA 1QV6A 4ZA2A 3BZUA 3KETA 1SCUA 5CDSA 2HJSA 3NEPX 2AEJA 3H7AA 3ON5A 3PFFA 2FP4A 4G65A 3RFTA 4BB6A 1WDKA 1HDRA 3PHHA 4E6PA 1PJ3A 4BMVA 1N8KA 4DC1A 2GERA 5L7YA 3MWEB 4OQYA 1YDEA 3BYZA 3H9QA 2O3SA 3EZYA 3W4JA 1JDJA 3WWYA 2PZKA 2OP1A 5COQA 4OKNA 4JNKA 2DBVO 4E21A 5B1YA 3SC6A 1X1TA 5EPOA 4B4WA 2G1UA 3WNVA 2X7HA 2AEMA 2Z95A 1QYVA 1XQ6A 3INRA 1YB1A 4D43A 3Q6IA 2V6MA 3B1JA 2Q1UA 4A5OA 2HUNA 4YQZA 1QLHA 2VYVD 5JXWA 4Z9XA 1BDBA 3IUSA 3NAQA 4NR0A 1I3LA 4O0LA 1LLQA 4XJTA 1E7RA 4XWYA 8ADHA 1W0CA 3OF2A 4NFHA 1NASA 2QHXA 1ZK4A 3LF1A 5FEUA 5DNAA 4MVJA 4XGKA 2ZCVA 3EAGA 4PG4A 2HK9A 4XQGA 5AVOA 4KQXA 1ENOA 4IXTA 3PPIA 3QHAA 4GQAA 1E0DA 4JLWA 1LEHA 3U49A 3EHEA 3H5NA 5HTOA 2C0CA 3ONEA 5IN4A 1UXIA 1E5QA 5IG2A 2J3JA 5J23A 4FS3A 1UAGA 5KOIA 1J6UA 4WK6A 4HY3A 2NQTA 2WE7A 3OHSX 4IJVA 1GR0A 2PTGA 4J9VA 3RU9A 1VKOA 1ZSNA 2AMFA 3Q2KA 3WYBA 4D7AA 4L8VA 3P2YA 4O63O 4CPDA 3AUUA 4W9NC 5G4KB 3SXPA 2VWQA 1A4IA 1A72A 3E5RA 4ILKA 2X86A 5K6AA 2H1SA 1NAHA 4AFNA 2ZATA 4D0SA 1HE3A 1EFKA 1P33A 3W1VA 4UVEA 4WOKA 4UUPA 2LDXA 4BO4A 4IS3A 3C7DB 3AUTA 3CZMA 3FNGA 3NX4A 1ZSYA 1IPEA 3CH6A 1RKXA 3DAFA 2DM6A 5TNXA 4E2WA 2Y0DA 2FR8A 1LSOA 2CVQA 3QVSA 1SMKA 1I8TA 4UVHA 4CM3A 3DONA 1OC4A 1Y1PA 1LRKA 4OOFA 4GKBA 1PS8A 2HK7A 2DAPA 3AWDA 2WYWA 4KDFA 2D3TA 5EQFA 2JFGA 4JP3A 3LT0A 3AUAA 2A9FA 2DFVA 1NPYA 3FNEA 3O9ZA 1D7OA 3I3OA 1KEUA 1C0KA 2CF6A 4OYRA 2X0IA 4PG6A 4TWRA 4XA8A 4E12A 2VUTA 2O3RA 3HB4X 4R4JA 4ZRNA 3W4IA 3DMTC 1PQUA 3FNHA 4O5OA 4DMLA 1NPDA 2O23A 4CL3A 3HQ4O 1HRDA 1DRVA 4GWKA 3I52A 4CLOB 1ZK1A 2HU2A 5H83A 4CLOA 1HF3A 4CMBA 4N5MA 4DREA 1A9YA 4XB2A 4TRMA 3ABIA 4XX0A 3W6ZA 5TX7A 2NTVA 4R1TA 3ZHYA 3LT4A 3ZWWA 4YJHA 2TMGA 1LSJA 5TJ9A 3IDSA 3VH1A 5G0TA 4QO7A 4GAEA 4XCVA 2EEZA 3BTVA 1LRJA 1PZFA 4QFDA 1GYRA 2ZTLA 4J0FA 5DCYA 3K2BA 2BRUA 2C54A 3VOSA 4BNUA 4CMHA 3AOEA 4CV1A 4NBTA 3B70A 1LNQA 3TZCA 5IDQA 4EZBA 1O5IA 2V6FA 3Q1LA 4UVDA 1WNTA 5B4TA 3HB5X 4YJFB 3UGKA 3WYCA 4X54A 3GUCA 4HBGA 4F3YA 5B4UA 2WD8A 4RO0A 2RBEA 1LSUA 4DMMA 2AEFA 4YT4A 1UP6A 1GEEA 4E2XA 4YAGA 2B83A 3BMNB 2JD2A 3FR7A 1DDOA 4NPCA 2H9IA 3N58A 1UDAA 1ZVMA 4XB1A 2X4GA 5BSEA 2J3IA 3GFGA 1Z75A 1CRWG 1EBUA 4HFRA 1OZAA 2WE8A 3ADOA 3AFMA 4U0JA 5CFZA 1ISGA 3H8VA 5DCUA 5TGDA 4BVAA 3E48A 2OORA 1U3TA 4FN4A 4OSOA 3SX2A 3FTPA 2IXAA 1KVTA 3PLRA 4E30A 3V2HA 1T2EA 1HE5A 3RASA 4YPOA 4I5FA 1T2AA 2Y67A 3VH2A 2O2SA 1ZCJA 5ER6A 2ZCUA 2A92A 4MVJD 1WMBA 3H3FA 1I3NA 1U2GA 4UREA 2BLLA 5BSFA 5BSHA 1XR3A 2Y0CA 3DB2A 4M89A 4U5QA 4NMHA 4YACA 1E3SA 1A7AA 1YQXA 2FPIA 2PZLA 1ULUA 4E4YA 5A9SB 1F14A 1SBYA 1H5QA 1VJTA 2E4AA 2VN8A 3DAPA 3JQ7A 1FDUA 1L1FA 4MINA 1TXGA 3F5QA 3VTZA 4IINA 4J91A 2G0TA 1O89A 3Q9NA 1LDNA 1ZUD1 2BKAA 3QVOA 3WLEA 1E7MA 3E9MA 3MOGA 3QE3A 2E48A 4AJ2A 1Y8QA 4CM4B 5FFFA 4F45A 3D5QA 3D3WA 2QG4A 1U3VA 3L6DA 3VPFA 4BNZA 4Q3AA 3L6OO 1M2WA 2BI7A 4DBVO 1H6BA 1WMAA 4J4HA 2CFCA 4UEKA 4PVCA 3FI9A 3LF2A 4W7HA 1KS9A 4OM8A 3JQAB 2CDBA 3GVPA 2EKLA 1B8PA 3EY4A 3RUIA 3VZPA 1HDXA 4WGGA 4CQLA 1VLLA 1E1LA 2EG9A 1F8GA 3C3XA 2DPGA 1DEHA 1NQAO 3OIFA 5DP2A 5LC1A 5COAA 3MOIA 3M6IA 3BHJA 1C1DA 4CODB 4CMEA 1I30A 3UCEA 1LQUA 4XYGA 4M8SA 5AXBA 3MJVA 3DZIA 4NJMB 4AICA 3HN2A 4FR5A 2GD1O 1VJ0A 4B8ZA 1GUZA 1E7QA 1CF2O 1YE3A 4LCEA 5JDCA 1UUFA 2RIRA 2AQHA 4ITUA 1H9AA 4Y9DA 4D79A 1K2WA 1HLPA 5EMHA 2NSDA 4XR4A 3TFOA 1AN9A 2BELA 2C7GA 3H2ZA 3AU9A 4U6SA 2HMTA 2ZYGA 3L4BA 3BMQB 4RGBA 3VHRA 1UZLA 3PHJA 4FFRA 3LC2O 1ONOA 3OMLA 1ZW1A 4AJ4A 5L7WA 3H9UA 3FN4A 1HE2A 4N5NA 3JQFC 4DLAA 3MCVA 3KSDO 4IM7A 4LISA 4M55A 4RL6A 4IQ8A 1QORA 2O3JA 3LLVA 4WE3A 4AJOA 5L4SA 1JQBA 1WXDA 3DZFA 3KTDA 3OQBA 2Q49A 3ZV6A 1MLDA 2D0IA 3GUYA 5JFOA 1DRUA 1JVBA 1DC5A 1P1IA 4CM8A 5JO0A 2VT2A 5I7VA 4F6LA 4HFJA 4PGFA 4NU6A 3C1AA 1M76A 2WJPA 4YJHB 1N5DA 3RJ9A 3RJ5A 4HKTA 1E3WA 2JAPA 1HETA 1EMDA 1GFSA 1VM6A 2CNBA 3IKVA 4HWKA 5MDHA 2NWQA 4QUKA 1RM4A 1XELA 4YRAA 3AOEC 1ISHA 1YB4A 4RVFA 1X13A 5I8WA 3QP9A 2QRKA 2CVOA 1E1KA 3HUDA 4XYMA 4D46A 1ZJZA 2BFPA 2PA3A 4PVDA 1RJWA 4WCFB 2NVUB 4N18A 1IE3A 4FGSA 1NHWA 4KOAA 3G3EA 1S6YA 2Q1TA 4IPTA 3NT5A 4GMFA 1N7HA 4AJIA 1JAYA 3RC2A 5T6BA 4UUNA 3WIDA 3DOCA 3GA0A 3NRCA 1GU7A 5GY7A 3M1AA 1EQ2A 1B8UA 1YDWA 4KDEA 1LDGA 1DAOA 5HM8A 1B15A 2Q46A 3PI7A 4GLOA 3BHMA 2PKQP 4KP7A 4U7WA 1Q1NA 3RFVA 2EXXA 3CMCO 1I10A 2F1KA 2VHYA 4NDNE 4OJNA 5A4DA 1LDMA 1Y9EA 2I5PO 4RDIA 5CEEA 2NU9A 1I3KA 2ZJ0A 4CV3A 1R37A 4PZEA 4WUVA 4YXFA 2DTXA 5A02A 2HAEA 1M75A 3D7LA 3F4LA 2OL4A 3OJEA 3SEFA 1X14A 2CMDA 5H81A 3DMTA 4J0EA 3PLNA 3T4EA 2FZEA 3ZW8A 5JCXA 4E31A 1NWHA 1D1SA 1A71A 2X0NA 1TVEA 3WICA 1IY8A 5EESA 4CL8A 1OBFO 1DSSG 4MVJP 4U6QA 4CUKA 3LK7A 3NDIA 4B4VA 2GO1A 4NG5A 5TIIA 2NNLD 3ZWBA 3MJEA 2RAFA 4KMSA 1CERA 1IHXA 4J2HA 5DOZA 3P19A 1DIHA 3WBFA 4BNGA 4FC6A 2JL1A 1BWSA 1PZGA 3E82A 3GG9A 3KBOA 4NQZA 2I65A 2W98A 3DHYA 5IDWA 1ZSVA 1PJBA 3DBRB 3FCOA 3JYNA 1CIVA 1PJSA 3LC7O 5ILGA 4BQRA 1IUKA 5DULA 1Y8QB 3SJUA 2Q2WA 5FYDA 4GH5A 3ZGYA 4M49A 2P9CA 2J5QA 3KVOA 1X1EA 1EUCA 1N7GA 1U1IA 3TL3A 4W6ZA 1NHGA 1WZIA 3R3JA 3V1YA 1T2CA 3H9GA 4EUEA 3BMCA 1E1MA 3NV9A 4J3FA 4L9RA 1CQIA 2A4KA 1NR1A 5B4VA 5AXCA 2GF2A 4YB8A 1HXHA 2PKRA 1NQTA 3AM5A 5KVVA 5JW6A 1PJQA 3OEWA 4JK3A 3JQBC 1Z6ZA 2V6BA 2DBQA 4LMPA 3PTZA 1X7GA 4J1TA 3UUWA 3OQ1A 4YEDA 5L40A 1P1JA 4BKUA 5JAIA 4EGFA 1GYQA 1KVSA 1V9LA 2VNSA 4AVYA 4W4TA 5A9SA 2VRCD 5ICSA 2X0JA 3QWFA 4PZCA 1D8AA 4BO8A 3OECA 1N1GA 4J4BA 4AG3A 4J16A 1DBVO 1SEPA 1XA0A 1I2CA 2P5UA 1DHTA 1P1HA 4RORA 2EW2A 4PLGA 4L0QA 4E5KA 4OXNA 4NBRA 1EE2A 4OL9A 8LDHA 5LDHA 5BR7A 5BT9A 2CDCA 1O9BA 3OJOA 4CQMA 1P77A 4R1SA 2FY8A 2VZ9A 4KWIA 4IDAA 2PGJA 4YT2A 1NPTO 2OUIA 5EERA 5U9CA 1PGOA 1QYXA 3JQGA 4HV4A 3GGPA 3JSAA 1ZIDA 4QSMA 1ZMTA 4PIVA 1RM0A 1UH5A 4WCDA 4NBUA 1H94A 4DBZA 4AL4A 4XIJA 1P74A 4EJ0A 3LDHA 1E3LA 1PJ4A 3MJSA 3PZBA 4O1MA 4XQEA 1EDZA 4XQ9A 3TL2A 5IZCC 1LSSA 3PVZA 1ENPA 4GPD1 1KEPA 4OOEA 3VTFA 4ND3A 1U8FO 4G5HA 5TSDA 1E92A 5CEFA 4JJGA 4AJLA 1B0AA 2GRAA 4LVCA 2FN7A 3RUFA 4FFOA 3NT4A 4XYLA 1L7EA 5TT0A 2EJWA 3ETGA 3WNQA 2D5AA 3S2GA 4A10A 4D42A 2Y05A 1JWAB 1T2FA 2YHIA 3JYPA 3ZHXA 5JYEA 3L6EA 2VUSA 1ONPA 1Z7EA 1P1RA 3B1KA 2I99A 1WVGA 1K6IA 1E3EA 3IUPA 2DLDA 4J1SA 4MVJE 4EUHA 1LDEA 4I9NA 4H15A 3N74A 3ZW9A 1HYEA 4IZHA 4NJOA 2B4TO 1JN0A 1VKNA 3DTYA 3PFWO 3QWIA 1R0KA 2ZB8A 3KYCB 4O59O 4QECA 3SC4A 4PLPA 4CR8A 2NUAA 1PWZA 2WTBA 3GEMA 1I0ZA 4XD2A 2GZ3A 1FDTA 5EN4A 4RJTA 3EGOA 4I08A 4B3IA 5KNLA 1YL7A 2O7SA 3E9QA 3OP4A 2GN4A 1X7HA 4DA9A 4PN3A 3DAGA 1VL0A 1P45A 3G17A 2DT5A 5KKAA 4NK4A 2HKIA 1UXKA 2P4QA 4YTEA 1LXCA 1LU9A 4KUGA 1IL0A 4IBOA 5JY1A 3K96A 1G0NA 4CM6A 1H0KA 4IJUA 3VH4A 1U7TA 2C82A 4UUMA 1YL6A 4A2CA 1PGQA 3B1FA 3QSGA 1UXHA 1SB9A 3CTMA 1XDWA 3KHUA 3AK4A 4PLZA 5AYVA 1VC2A 1QV7A 3UICA 3LZ6A 3FPCA 3GLQA 3VZSA 5F1PA 4IGFA 5G4KA 4WNCA 1X0XA 5A5EA 3T4XA 2NQ8A 4TVBA 5IAAA 1Q0LA 3OJ0A 3IKTA 2JHGA 1G0OA 2WMDA 2Y99A 1TT5A 1MC5A 4R5HA 3ZU5A 1JKIA 3E9NA 4W7IA 4A26A 3WGHA 5CDUA 1FDVA 2UUPA 4J7XA 5GMOA 4DLBA 1GDHA 3PJEA 5CDGA 4CM5A 2YV3A 3F1LA 4ZD6A 5CHEA 3CSDA 2B4RO 4MDHA 3U09A 5TS3A 4XRGA 5THKA 3DBRA 1M6WA 3OJLA 4UEOA 1BXGB 5KWEA 3AI2A 2VOJA 1BXGA 3AI1A 1R0SA 2VQ3A 1DIAA 2X22A 1Q7CA 2EW8A 2Q99A 4M86A 3AJRA 1WWKA 2WDZA 4ALKA 4BV8A 1QYWA 5B12A 2X5OA 1TT7A 4ND4A 3I9LA 5K0ZA 2J5KA 4AJJA 1QG6A 1Y7TA 4EW6A 3KZVA 3QWAA 4E2YA 5JY6A 3AUSA 3CPSA
chains in the Genus database with same CATH superfamily
1NTOA 5AVWA 4O4JB 1TJPB 3HG7A 4BMNA 2IHKA 1JPNA 5HG0A 1Q1ZA 3IVRA 1BO6A 1J33A 3O8NA 3S28A 1F2UA 1EE1A 2DSNA 2KPOA 3Q2IA 5IUKC 3RRMA 3SZOA 2P8SA 3PRJA 4TQGA 5C9ZA 3OLQA 4J6FA 3L7OA 3FPHA 4E33A 4OJTA 3HUFA 1OB2A 1U8CB 2FUCA 4GBJA 4EZEA 2UUCB 1NYTA 3JSEO 1W75A 4RQBA 5CU7A 3WG9A 3V7OA 4DR1B 1YARO 1YV9A 1K7SN 5EE1A 4RJIA 4F3KA 2W71A 2E37A 4EI7A 3GLGA 3TTTA 1L6IA 4MVMA 2YBDA 2XH8A 4TTIA 1OGYA 1PQ4A 2QTRA 4TL8A 5L0FA 1D0ZA 3AH8A 4B2IA 3UANA 2EJVA 1RC0A 2IZ1A 2RGUA 2IV3A 4HXEB 4B83A 1WS6A 1KMQA 3PD0A 2OYRA 1SUBA 2XL8A 1M6TA 4RVDA 1E1YA 3TKLA 4IQGA 4CQMB 3H5AA 4DV3B 2RSEB 5EZYB 3RKUA 4DJ9A 4ISBA 1VP9A 1CEYA 4AE4B 3LW7A 3JW8A 4NFSA 3AIKA 2PFSA 3UJ6A 2RARA 1JTEA 3LBNA 1W29A 2DSTA 5DBIA 3HJHA 5YASA 2N1BA 1D1QA 4MUBA 4DJAA 4B5KA 5KTSA 4Y6PA 2AJLI 2OTCA 4M83A 3PRKE 1CPQA 1UOQA 1V3UA 2PUFA 3KUDA 3Q5DA 3ED5A 3RSHA 3OX1A 2CMKA 4ALMA 4PO9A 4RF5A 2PGDA 3A4VA 1LDYA 4F21A 1NF3A 5KKCA 2P40A 3V00A 4GLJA 3GLGE 3FZNA 4QQNA 4QU5A 1SK9A 2EQAA 2YBEA 3UKOA 2A9OA 3VR6H 2GK4A 3M79A 2A59A 4AXXA 1M74A 2ZUVA 1RRVA 4DQVA 1V3TA 1UDBA 1ISJA 4GXNA 1NW7A 3UUFA 2RBGA 3IERA 1SKMA 1EGMB 4ZVRA 1DWPA 3I9KA 3K33A 2JGRA 6NULA 5KDDA 1XRSB 3CH7A 3OPYI 1BMQA 1WHTA 2ZE5A 5DV9A 2QM7A 5JHGB 1N0IA 2FRDA 5FBHA 5TS2A 4BRSA 4EEZA 1Q1EA 2AI3A 4EY8A 4AMYA 5BR8B 1ZINA 2VK8A 4EYEA 1XROA 1A9QA 2CE7A 4FYVA 4IEIA 2QGZA 4D74A 4C2TA 1YFKA 1AHHA 1L5QA 2NTNA 1TO2E 2E21A 1I1HA 5JCJD 2C7RA 4CJXA 1EGQA 3TLGA 2NXJA 3DW1X 1RBYA 2REQA 3GHYA 2P6MA 4Y6RA 2AXEA 3BK1A 5FR2A 4DE5A 3QPDA 3DB1A 4MKGA 4NZ9A 4B79A 3U4HA 2L6HA 3LBHA 4HNAB 3ZU4A 2ZXUA 4K7BA 2QQGA 1D2CA 1KSGA 5KYGA 1SQ6A 3QUAA 1GUBA 4NMMA 1U4OA 1PF7E 2J3DA 4KAAA 3EXIA 3R5KA 1SXJA 5TGTA 2PMEA 1T36B 3IAAA 3PRHA 5I8ZA 4YRNA 4TT3A 3RWOA 1B6TA 1R0BA 1U3WA 2XYPA 3KKKA 3OA1A 3UWOA 3VGJA 4MTLA 4AJNA 2BJVA 4QG3A 3UA4A 3HDVA 5IDYA 4IUYA 4ZYUA 5JSHA 4JI8B 4WA8A 3ZCVA 2H1HA 3I4LA 4G09A 4KFSA 4UMDA 5J4VA 1VIMA 3OFKA 4FLFA 2VJAA 5DXJA 4ZCLA 3VDMA 4V1CI 2XX3A 3AT1A 3L0BA 1E2GA 1QHGA 2CLKB 1FNCA 1YBHA 2AKYA 4QUHA 3LC1O 3DAHA 4FR0A 5JNUA 1UBCA 3RK4A 2RDMA 1M67A 4MW9A 4K3UA 5AKGA 1QTRA 3VHXB 1AXGA 4K88A 7REQB 1M0SA 4IKEA 5KKNB 2Z6QA 4K9DA 1BDJA 1X94A 3OY7A 4ZVMA 4CS9A 3P32A 5G40A 1V47A 3UV3A 3VC7A 2JI6A 5COGA 3L49A 5K3DA 2XTJA 1O3YA 3TGLA 4MYDA 2BGGA 1RXVA 2RHBA 2G83A 1WCV1 2IQIA 1JHVA 2R66A 2OP0A 4IOJA 1OQCA 1UAYA 2ZJ4A 1HDIA 1PFGA 2FZCA 4CIBA 3S5JA 4FEAA 4RWZA 1E99A 3LY9A 3L8FA 1I01A 5J1TB 3Q40A 4G7ZF 4K6FA 5CX1A 1EFTA 2VCHA 2HF2A 1PL7A 1I6MA 4IYJA 1YZVA 2QRMA 5J9FA 3J7AC 3FIJA 3BDAA 2D7DA 1U8EA 4FBMA 3NCTA 4CTKA 4LX0A 1MAVA 1TEZA 4LPSA 2GXAA 2XGJA 1E5TA 1UC8A 3VTAA 1ZONA 3BGWA 4IIGA 4MWTA 3D81A 2ZBPA 3JQAA 3K0KA 4LV6A 2L69A 2GUWA 3B6ZA 2FEWB 2Q7OE 4I3HA 1R2QA 1W5BA 3BWEA 3DJUB 4EHJA 3K1IA 1N3BA 1P9LA 2P9YA 5E7IA 2G63A 1TAHA 4QDOA 4DEVA 4RULA 2BKVA 4QBIA 1KZGB 1W4CA 3CINA 2NYAA 2IH2A 3MERA 2QMZA 2WFZA 2J3QA 2Q45A 2YW9A 4GL4A 1JEAA 4GM4A 3WS7A 3JR7A 1Q1AA 4GU5A 2Z6UA 2KHZA 4NU5A 2VBCA 5I8PA 4Q3EA 3DJFA 3A6DA 3FM9A 4MP3A 1ECPA 2EIJC 2NGRA 3MS4A 4WY2A 1CQJB 5GJWC 2OQVA 2WHXA 3C45A 3CCBA 3I2KA 4OQQA 2ZUEA 1G20E 1KDTA 4N48A 1CULC 4XFDA 1GPWB 5A5FA 4X1KA 3IQFA 3I2FA 5K0NA 3TI9A 3N8HA 5HIKA 3M2TA 1G3RA 1PRYA 4YUVA 1NC1A 3ELWA 4HWSA 2WSMA 4FC7A 2AOUA 1KO8A 5KNCH 5DBHX 1UMCB 4BLTA 3EUFA 4US1R 2YCBA 1KZ9A 4DRXA 4GBED 4FB5A 2EPMX 4JZYA 3U3MA 2QTLA 4YWQA 1KS2A 2PRSA 1BZYA 2F1IA 4WN3A 3RYHA 5AM3A 4OL0A 2V7EA 3QOYA 1X7ZA 4QGGA 4TKMA 1RRCA 3GUZA 4Z7JA 4US2R 3ETDA 4FJ2A 1Y1QA 1LWNA 1ILWA 4ZVOA 2OPHA 2I33A 2DPYA 1IONA 3NGMA 4II7A 4BFVA 5D87A 3C5VA 4C3ZA 3AM1A 2QQ5A 1GFZA 4CKXA 2FOXA 3ECAA 3ZI0A 1AMUA 1J49A 2X7XA 4HX5A 2KQUA 3T1NA 4BL5A 1XRJA 1W4AA 1X0VA 3FSRA 4H08A 2V0NA 4UDXX 5G0SA 1CBUA 1L5HA 3ZWDA 3LDGA 2JLUA 1FP1D 4B76A 1NP3A 3K0FB 1P6UA 2FK7A 3SLGA 3T3OA 5E6SA 1PG0A 3DL0A 4PAWA 4J90A 3BJRA 4PAQA 1NBME 2VP6A 2KYRA 4ZGGA 4IIXA 2H59A 4M54A 1X7XB 1EM8A 4U7TB 4CBVA 1RWMA 4IGGA 1BDIA 4ZOBA 3WQBA 1NC3A 4L6CA 4FWBA 1B41A 1YVIA 4N5HX 1UDXA 3W3AH 4AG6A 1VJCA 1G4AE 5HJ5A 4TM8A 4YAJA 5GAJA 1JR6A 3U3JA 4FSHA 2DWOA 3RYCB 5AQ1A 5A1JA 2J31A 1D03A 1X80A 3TMYA 4E1AA 3HGMA 2YDYA 5H1YA 3FZYA 2XF8A 4I55A 1PQWA 4FXPA 1WHSB 3AOGA 3FDIA 2PH7A 3FKSD 4LUCA 4Y9UA 5K3SA 4IS2A 2RHWA 5A04A 5AVUA 1U2EA 2ZU0C 3UVEA 2NPOA 2PH5A 3ZGNA 4GX0A 4R01A 5F3RA 4Z6KA 3IAM1 5LR6A 4NZZA 1PV1A 4B71A 3PUWA 3PUHA 1R8SA 2O2YA 3LXXA 1XI2A 3QX7A 3AF3A 3TKYA 4F96A 3NHAA 5JR3A 5KTTA 2FUG6 2YXEA 2ZJ2A 4CQJA 2ZJ8A 1I7QB 3PC2A 3RARA 1NBMA 5IANA 2ZP1A 5FAXA 4HUJA 1N5KA 4GVLA 1GSIA 4K9SA 4M7RA 1EYZA 1MQ8B 3M6XA 3W5CA 1JKFA 4F2WA 1E9BA 1W6UA 1ZK2A 2E9SA 3E3AA 3SIXA 1OXVA 5DYNA 5TQ2B 4WDRA 4L95C 3AM3A 1PHRA 1WVMA 3D02A 3M4CA 3S5UA 1G7RA 4UHJA 2VSXA 3UYLA 1DHRA 1PWXA 1VG0B 3GZNA 4KU4A 3WKDA 2YNMD 3RQFA 1SH7A 3OEYA 1E1CB 2Q4OA 4OXXA 3D0KA 4Z0PA 2V74B 3V7WA 3UGQA 2R62A 5IEJA 4YAEA 2X76A 5IUJC 5C1DA 1B2RA 1X86B 1RC1A 1T0UA 3QE9Y 1IMJA 1IJKA 3JQ7B 5BV8A 3MCUA 5K2OA 1YS1X 2AG8A 3SR3A 3THOA 1N2BA 3ABZA 2PBRA 1N6PA 2G36A 2GFHA 2J9GA 3K0BA 2PD4A 4G81A 3FVYA 4Y67A 4BHTA 2IPMA 1HYHA 3H65A 3R9WA 5BOVA 3TH5A 1J07A 1JHOA 2EP5A 2IIQA 4JGBA 1FCJA 4Y1GA 3N3BC 1PX2A 4G78A 2B2CA 5ICMA 4KN9S 3UJBA 1E8MA 3IE2A 3PE4A 4IF4A 3P26A 1W5FA 2AK3A 4AZSA 4DRYA 13PKA 1GCOA 4I1IA 3C3PA 3H2KA 4BQEA 4G4IA 2GKOA 4C3VA 5D86A 3TR0A 3OOSA 1KU0A 3A10A 4LJAA 1E18A 2RIPA 2P69A 2HO5A 2W2LA 4QBHA 3TJMA 4JP2A 1HE1C 1QFJA 3ORSA 3D5TA 2DFTA 4DQXA 1WIWA 3ZZNA 4XCXA 3EGCA 2HWUA 2P1ZA 1HL7A 4GS5A 4Q19A 4NK5A 1IULA 2P11A 2BD0A 4BFTA 1NNEA 1TUBA 4U00A 4LGYA 2VPYA 3HSKA 3M6WA 3L82B 1GPJA 1QFSA 5BV1A 2PIAA 3JCZA 1RJDA 1X6VA 3NHBA 3OVMA 1LX6A 4GE3A 4QLAA 4PQGA 5EJMA 3HWWA 4G41A 1K05A 4KEAA 3KM0A 3BMOB 3BUSA 1UZNA 1EQUA 1XDBA 4KOEC 5IXYA 4Q4JB 1PEDA 3H1BA 3RAJA 1A9ZA 3OD1A 4HH4A 1KFJB 2XCQA 5ED4A 4HN2A 2PBEA 3MYFA 1X8LA 2EJUA 4FWIB 4WW0A 1Q7RA 2MYUA 4Q9DA 3A1NA 1QIJA 1K6JA 4MS1A 1XU7A 2CJPA 3D31A 3QY0A 2H1OA 1XJWA 4R6WA 4FT2A 4UARA 4BTVA 1UBTS 2W2OA 1TE2A 2JK0A 3KJEA 3DTNA 2OV4A 3GGOA 4JP1A 1YVDA 4MJ3A 2ADFA 4S1TA 4C9BA 2HLDA 2ZI4A 3S68A 1FK8A 4UZEA 5L53A 3C7TA 1OU4A 3ZNNA 2R44A 3AG4C 1IJBA 1FSFA 2R00C 2VVTA 1CUYA 3E84A 4PWYA 1RLIA 4FGKA 4JB8A 1V5FA 2W58A 4N6GA 3WK7A 3CWZA 3B51X 3AINA 3JQPA 4WLNA 2M1XA 1RAAA 3RS2A 4R71A 4WQMA 1L7RA 1AGPA 1DVRA 4Y7DA 2I2DA 3BJZA 4DMGA 1SUPA 4ZJPA 5AGFA 1QANA 4ZU6X 3G89A 3UN1A 3VOBA 3ZGZA 2VYNA 4MUGA 5C37A 1AVTA 1AUQA 4H27A 2J4DA 5EUBA 3LYUA 1FUKA 4H60A 5AHRA 5EHGA 5IJ0A 1M7HA 2OOCA 3MRSA 2P9HA 2YHBA 4ESHA 2O2GA 2VK1A 2E6UX 1WCXA 3TKAA 3IUNA 3UMSA 2CNWA 4Q37A 3GJ8A 3M82A 2FFQA 4JL6A 4YO7A 5AXDA 4E5VA 2WB4A 2EAUA 3N2NA 4OXYA 3ZHZA 4PFQA 4BX9A 3NHYA 3MGBA 4EW1A 4TLLB 3WL5A 3THXB 3FPLA 5ALTA 1BAPA 4N0QA 4ZICA 3TEFA 4LW8A 1XF1A 3KK0A 5G3ZA 1N6IA 5LA6A 4C2BA 3TJ5A 4Z4HA 1ZAYA 4BLSA 3K0FA 3KLPX 3OZBA 5EMKA 4GWLA 5E3CA 4H16A 1Y89A 2Q6KA 2VJPA 5EIHA 3G13A 7YASA 1VDZA 2I6GA 2Y1EA 3RAGA 2OAP1 2Z1DA 2XNJA 2C2BA 2C42A 2ZRFA 2W22A 4WZBA 5A5VA 5B30A 1A27A 2C77A 5ALHA 5KOHA 1GDDA 3OM8A 4Q6WA 1W35A 3UT5B 3TVDA 1L4LA 1XSEA 1U2DA 4CEIA 2OHGA 3SDBA 1PNOA 5FPTA 1WZCA 2V03A 2D1FA 2XCOA 2GN2A 1G42A 1R5JA 3NDBB 3QQPA 4NBKA 4PANA 3KPHA 1P1FA 1N1EA 1SPXA 2YC2C 1ORYA 3Q11A 4MHOA 1OBOA 4S2UA 2B1RA 4J94A 4PLCA 1BMFD 2VYVA 3ZHBA 5BY2A 2X3UA 3C6KA 1PNQA 2KW5A 3DBHB 4QJ4A 5LOVA 1A9XB 5EJGA 3AY0A 1JFLA 1LI4A 3K15A 3B0UX 1H2ZA 4JIMA 2E4XA 1L4GA 4BNNA 2BFMA 4Q1AA 2WVQA 1RWNA 4EUNA 2GYVA 4O4IF 1JLRA 2GFQA 1QHIA 2NPIA 2XDQA 1IWOA 1FDWA 3GRUA 4DS3A 1R6UA 3IUEA 3O31A 2WT9A 2IUUA 1P5ZB 2FCRA 1E58A 2JBHA 3OZXA 4OJYA 4EJ2A 2I15A 3GK3A 2OV8A 3CA8A 4G63A 2NO7A 1YAJA 3TZLA 3OZIA 4PX5A 4B3XA 3GOHA 3DT8A 3NZEA 2WZQA 3FLAA 4Y7CA 5E6RA 4B2LA 4IB4A 3CEMA 4TRRA 1PZXA 3R7NA 4CEJB 2FEPA 3IIMA 5JQGF 4BQOA 2IGBA 3CF4A 4DLSA 4GGMX 2B36A 1ZGAA 4R8KA 3STYA 4LYFA 3W5HA 2X6RA 3P9KA 2O2CA 4AUNA 2DMRA 3GAMA 3DE7X 5LB2A 1P4RA 2JLXA 2YY6A 1G7CA 3C87A 2QSZA 4U39A 5KYTA 3S9OA 2IV2X 3S2FA 2EDAA 4IJWA 3JQEA 1QH1A 1FDRA 1FUIA 3EIXA 3GH3A 2Z0MA 3CNEA 3AQBA 3CVWA 3HZOA 1WSDA 2VXYA 2UVDA 3T9EA 2HQRA 2NO0A 3OZGA 1JI3A 3U4GA 3B3AA 1OKKA 4I50F 3MCAA 3V1KA 1EX1A 4Z7OB 5TPWA 5JAQA 3U0VA 3HO8A 2I78A 2XA1A 1ZCZA 1NQOA 3LIIA 4MV0A 1W36D 4URUR 3GEIA 5HKBA 1S1MA 4EUFA 3FCEA 5CAEB 4NHOA 2CE2X 3AR2A 2Z1MA 4QAJA 1WGWA 4DLPA 4HF7A 5FH9A 2VPZA 2WKQA 1T0IA 4OLAA 3P0RA 1CP2A 4WEOA 4RVNA 4G26A 1RMVA 1WF6A 2QPOA 2Z5FA 2JIZD 4O0MA 4QOEA 3S55A 3L07A 3M5WA 4RD9A 3ECCA 3V4FA 4L85A 3QPCA 3PIRA 4O6VA 3ZPXA 1CIPA 3HWX1 4W9NA 4EDFA 3KXPA 1YRBA 1GLGA 1NNUA 1V8PA 4FZRA 1NSTA 4LOAA 2YVUA 4K9LA 1YZLA 2BM1A 2GEUA 4XLPF 4IV5A 4QUAA 4DZZA 4NH0A 5JVDA 4L9AA 3KIPA 3IEIA 1MOQA 3CUKA 1BKDR 4UATA 4UUOA 4V3CA 3E9CA 3ROKA 2L6GA 3OE7A 4MWSA 1CGME 3A1DA 3NFYA 3RVQA 4UPEA 3P9IA 2RH4A 4M87A 1GRNA 2C2MA 4YBZA 2CW5A 3G6KA 1Y80A 2P9QA 1Z7BA 2JFFA 2JGNA 1TLFA 2F8LA 3IMKA 3H1GA 3RH3A 5D51S 1T0JB 4RV5A 2C7VA 1GGMA 2X3FA 3AB8A 1OXKA 1V16A 3SZLA 1J0BA 1QOQB 2C07A 2J0EA 4MGEA 2VCBA 1KYXA 1Z5UA 1C7RA 3GP3A 4XGNA 1IXSB 5KINB 5B37A 1NXXA 3UGTA 4A3SA 3HA2A 4LTMA 3RSZA 1XKQA 5IAJA 3DS8A 3RVLA 2R48A 1YMUA 3PQ2A 3CWCA 1DNPA 4XSHA 3V33A 5BN3A 3E2PA 4WASA 1EJ2A 3I72A 2C3MA 4BFXA 1OW7A 1E2HA 2YYZA 3KV3O 4CCYB 5KTYA 3EF1A 2ZFUA 2GI4A 3LT2A 5EEGA 2JH9A 3ORRA 1QNLA 1GARA 3HVIA 4Z9YA 2YYAA 1V1RB 1N3YA 3F9IA 1BFUA 3IJRA 4GMKA 4DA7A 1XCPA 2HHLA 5AESA 3M4JA 5EJ5A 1L7MA 3ILHA 4AAYA 3GA5A 1BJTA 1OW8A 4DDUA 3VPCA 3EDOA 3FKJA 3E70C 3REQA 3INGA 1CX9B 2JGDA 3DOJA 3H4TA 3SNHA 4NCJA 4M9UA 4YRMA 4NTZA 5H7XA 1NUUA 4N3AA 4O29A 2CGEA 2QX6A 3VX4A 4DVJA 2O8BB 3OFSA 2F3TA 4OFBA 5HJ7A 1PTKA 3WMGA 2J41A 3WSWA 5EXTA 4E5NA 4JTAB 1ZIPA 1VRVA 1WSWA 1ECGA 2FLWA 2JLVA 4RAOA 3OE7D 4QGFA 2ZI3A 2C5EA 3ADKA 3QJYA 4MVJI 2Z4RA 3I73A 5LXTF 2FMTA 1VJGA 3C16C 4JKOA 1C1DB 1GDTA 2P3LA 1XZGA 4KLZA 3N7AA 4EA8A 4UZSA 1L5NA 5G1PA 1GITA 1CQJA 1AKEA 2WPNA 2C8LA 1ORVA 2NOAA 3PFKA 2BM0A 4HNRA 4CRWB 3WLPA 2PRKA 2V6GA 1JWBB 2GK6A 3LL7A 5CJJA 4NBLA 1UXJA 5BQPA 4DWJA 4BG0A 4RHYA 2HRZA 2BYTA 1P4JA 5LYJF 5BUZA 3H2GA 1XWFA 4A16A 4L5CA 1PBTA 1TKAA 5JSZB 4MQFB 3FHTA 3MBGA 2ZTUA 4D4HA 2QN1A 4YRQA 2C2ZA 2JLRA 3ML1A 4GVXA 3AMVA 1NJSA 3R4CA 1Q7GA 3ZBPA 3L9WA 1CGNA 3AVVA 2IWRA 2XMDA 3M5PA 1T24A 3TCXB 4J1NA 1NBWB 3NBUA 4MWOA 3UW1A 4YAUA 2J6IA 1SVOA 3QXXA 1GRCA 2H2HA 1OKKD 4P7JA 3UMRA 5IM4A 3LXRA 4I3MA 3AO0B 2R4QA 1FMTA 2YLDA 2FSGA 2Z04A 3D8RA 4C21A 1KY3A 1XIVA 2AIRA 2QP3A 3CVVA 1HYQA 3GO4A 2HMZA 3I0MA 1K4YA 4RC9A 3GFBA 3TWOA 4W5TA 1T13A 3U48A 3V8EA 8OHMA 3QW2A 1VQ1A 3CW8X 2I6QA 1HG0A 3O10A 3IC5A 1JDVA 1D5WA 4ZI7B 1WMSA 2RD9A 2O7QA 3SXYA 5HCIA 5J2TF 3K9WA 5KVQA 2HPZA 3QEMA 3PDJA 4BDSA 4CDMA 1F3LA 5BNZA 1H93A 4YHBA 2YINC 1JAHA 4EVRA 2O54A 4LAFA 1YS2X 1OILA 4FFPA 3VI4B 2W4MA 4KHPB 1AEPA 5DX1A 3U4MA 1G60A 3PENA 1OCZC 1W52X 5CH5A 1TJ4A 5BQIA 4L15A 3W1WA 1SEVA 3EGEA 2PX5A 4YQFA 1NQUA 4PQEA 1GSOA 1D6JA 1IQPA 4KE7A 2R4TA 2ZQYA 4TXLA 5E1OA 4MV7A 5EOVA 4BPBA 1T43A 3OD5A 3QVXA 1NBIA 5L0IA 3ZBTA 4DLUA 4BCDA 3ITFA 4YJGB 3JATB 3TVTA 1XTQA 1D09A 2OMEA 3HLYA 3MWLA 4QTYA 2HQ1A 1J39A 4PZYA 2WINI 1Y7IA 2IBFA 4BJ6C 1ZD3A 2NO4A 2JHAA 1ZVZA 4FNGA 3QBDA 1FX1A 2OZLA 1T2UA 4JYPA 4LNHA 3Q7SA 2ACKA 4ARZA 3DMFA 2PA0A 2HCRA 2ORWA 3GNSA 4RXTA 5SV2A 3QBVA 5AW1A 1JJIA 2XJ4A 5P8WA 1VLMA 3ID6C 3L7AA 1G4WR 1YASA 1LBHA 2CXPA 4YP6A 1GAXA 5C7OO 2EYUA 1ZH8A 2I87A 2IT1A 4XOIA 4JE9A 1AMNA 1VMIA 3E9EA 3SS8A 2FZWA 4ARCA 5AJXA 2H2FA 3C3WA 4XM0A 4MS3A 5ESWA 8ATCA 1Z74A 3S3TA 3IP3A 3IILA 3UMHA 3DDNA 4OQLA 2ZR7A 4P54A 4YJGA 2YXNA 4UASA 4C6HA 1Z5VA 3M4YA 4TXNA 2C04A 2DFDA 2NV6A 1XTSA 2ZDHA 1RWWA 4MR7B 1PFUA 2JI7A 3E1KA 1JW9B 2LCIA 3M0EA 4YREA 1LUAA 1V7ZA 4Q1FA 1B6RA 3DG9A 4IY1A 1KO7A 1Y7PA 2VCYA 4RK5A 3WLNA 2C99A 3PGVA 2EIMC 3IEEA 2WF5A 4TVOA 3KXLA 3D8UA 1MZPA 4Z0HO 2R7VA 3ZWXA 3MYIA 5HW0A 3MELA 1FFYA 3EQLF 3QPWA 1Z82A 4XIYA 4BECA 3FSGA 2OA0A 1V7QA 3HXMA 4QSHA 5DBGA 1RJ9B 4RF2A 3NONA 3H5OA 3PXXA 2G9UA 1J2RA 1L7VC 3VNRA 4FESA 2YXPX 1X1CA 1FC0A 1UODA 4KO3S 4NOMA 3ANXA 3PFGA 2W6IA 7ABPA 2OFXA 1HTTA 1DLJA 5MN4A 1BFDA 3IOCA 1EDOA 3BRSA 4FE7A 4ONEA 5TRTA 1JTFA 4IIVA 4ETWA 3SS9X 5KC9A 1JA0A 2V97A 3EZNA 3U3FA 1HLDA 2F48A 2P0YA 4H2DA 4LECA 3WB2A 1JL3A 4TMFA 5EMLA 2BE5F 3KFXA 5FTMA 3L4KA 1LS1A 3PHGA 5B1AC 4EJSB 2HK8A 2MOKA 3L02A 3RUCA 5JNWA 4EPTA 1G8MA 4QXPA 4ZTBA 3JYLA 2XITA 2ZEJA 2GX6A 2CC2A 3O75A 3F1KA 3EIEA 4ZVVA 4TTSA 3TX2A 1QYDA 3O8QA 1HL3A 2XHEA 4J0CA 4KZPA 1NAIA 4M1TA 5KNDD 1V1RA 1KDPA 3QEOA 1ZM9A 2ZZKA 5TF4A 4EGSA 4DIKA 4OQZA 5GONB 1XXHE 3W8FA 4CYMA 1QAOA 1RQLA 4O02B 4YPVA 4GMDA 2R11A 2XTZA 3QKRA 4B3JA 3H5WA 1JKMA 3I58A 1IQUA 4HCJA 4K9KA 4WBSA 1NZDA 1SQ0A 3JQGB 2FSSA 4A8PA 5EHQA 4ZI2A 4C14A 5MFPA 4I1OB 2IIBA 2Q4DA 4ND7A 4N3GA 4DCTA 1HYBA 1E3IA 1QGDA 2C8KA 3BQMB 2Q28A 3KLMX 5C3MA 2FWIA 3JYYA 3CZ5A 2PUVA 3BULA 1U1GA 4N7BA 3ELDA 2QRUA 2QNLA 5T8KA 4XUEA 1SMYF 1ULBA 3ROMA 3WGQA 4DG8A 2N1MA 1Q0FA 1UT5A 4FU0A 2IA5A 1UBOS 3ANMA 3FUVA 1R4NB 3DVAB 2X8WA 4W99A 1EZZA 5G2OA 3L04A 4YL1A 4B4UA 1CUJA 1C80A 1C81A 4YDHB 1JJ7A 2QWXA 3MINA 3EC1A 1JVNA 5BWNA 4HNGA 4WUTA 4AJHA 4CM9A 4RA9B 1B2LA 3HEMA 3GD7A 3X2EA 2NO6A 2HMUA 3KNZA 4EG1A 1PLLA 4RQUA 4A1OA 1LS6A 1YI0A 3IQTA 2BZGA 2ZSBA 3BCUA 3MJFA 3N8DA 2CMFA 3DEYX 5F4BA 3AZOA 3MTIA 1CFZA 3GZNB 1PZEA 1IK6A 2MDTA 2V9CA 2WSSA 3DDSA 3EUWA 3PXEA 4Q7LA 1DAEA 3DKPA 2VDLB 3AVYA 3EMKA 2Q0HA 2WJIA 3HFGA 1K5DA 3PC3A 3I5MA 3WJ7A 4RACA 3HKEB 2XXJA 2J67A 2JCBA 2YW2A 2R7SA 1GZUA 1QMGA 3CZPA 2R6FA 1RHUA 2XL4A 1UMDA 2VRNA 3HKBB 4WH0A 3VPAA 4AO6A 4Q9HA 4BOYA 4DILA 1QONA 5KVCA 1UWKA 1ZNQO 1MOZA 4AI6A 5IC5A 2ZSFA 1B16A 2GK3A 3ZZUA 4YMIA 4NDAA 3S81A 2HZ8A 4POOA 4UQOA 2CNKA 2W42A 3EBPA 1L5OA 4TXMA 5IWAB 3EULA 3TO5A 4MVRA 2FQXA 1AZWA 3BFJA 3NALA 4PAMA 3B60A 3RC7A 2WJ3A 1OAKA 3KMIA 2G0NA 4GDMA 1XL1A 3WLLA 3RS9A 1A5TA 3UT6A 1XC7A 1DJNA 1KDOA 1UMCA 2DTEA 2ZJYA 3MAGA 4DA6A 1FQOA 4E11A 1IN7A 2WG2A 4E1BA 4EDHA 3HK2A 4MVWA 4A6XA 5ALJA 1LE4A 1OYWA 3HKBA 1LWOA 2X3YA 3AL3A 4KG7A 4MVJM 3PU6A 4QFCA 5CTAA 4E51A 2ZI9A 2O8DB 1KH3A 1ILEA 3V8BA 2ECFA 3IOYA 1FQKA 3KFVA 2EKBA 5ESXA 4E2ZA 4M0PA 1WY7A 1QB8A 4OP1A 3AIOA 2FMIA 1MG5A 5B5SA 2DUUA 2EP8A 3CRRA 2ASEA 3EXFB 3ESYA 2I1QA 5DN6A 2O5EA 4JBXA 3FJ1A 3R3VA 4RTMA 1XTPA 4R7TA 3HABA 2HT1A 3F2VA 4QAQA 2H4YA 2ZXRA 2W2NA 2Z2XA 4PCVA 3SVTA 3VNSA 4DR5B 3WYEA 2WWRA 4QHSA 2XXAB 2KNHA 2VWPA 2WJ6A 4PG5A 1KTVA 5HS4A 5FZTA 3I5PA 4NI5A 3IFSA 3EG9B 3C41J 3SSNA 3U80A 4ZMSA 4HQKA 5A9RA 2HFIA 3IIEA 1UBHS 4H7KA 4M99A 4MNTA 1BCSB 4OJQA 4WCFA 3TIFA 3UTDA 4DJFC 2CY0A 4MA0A 4U5XA 3QG5A 5H3CA 1XDZA 3ICOA 1Z06A 3LE8A 4RW0A 4XGIA 1VHJA 4C4RA 3G88A 4IGEA 3RYFB 5BMVA 1BS2A 5KYWB 4KIUA 7MDHA 4RPCA 3A31A 4P3YA 3TD9A 3D2CA 2UZ1A 3A4IA 3X2QC 3P0IA 3QU5A 1K3FA 2A2ZA 1WU7A 4XYEA 1U1EA 3CQZA 4D6YA 1RWOA 2NTEA 2HFKA 5EJ9A 5L4NA 5A7HA 2YUTA 3EVCA 2PWPA 2R47A 5JZSA 2FPPA 4IIHA 1COWD 2CXHA 1IWBB 2Z9CA 4FFVA 4ILEA 1ZN2A 3K1ZA 3UG7A 2DZDA 4C4SA 2EARA 4D26A 3N2EA 1OR3A 2NN3C 4FJ1A 4KLNA 2GYYA 1J0XO 2IP2A 4L02A 4RD0A 5EAIA 5BNWA 1EFDN 1C3LA 1ZH6A 5EUQB 4WECA 3SM9A 3NBAA 4UBIA 3H0KA 1XMXA 4Z3DA 3UEOA 4DMKA 1MJFA 4YK7A 1X2BA 2BI8A 1XMIA 2VPPA 4G24A 4QX6A 4XRRA 4Z4FA 3U1TA 1YHZA 2QIOA 3QOFA 2YHUA 4BLPA 1NRXA 4HRXA 1QX4A 4AKGA 3QE4A 4CM9D 3O83A 1N2ZA 2D2VA 2B35A 3SHTA 1Z68A 3WLQA 4C7KA 4CGYA 2PLAA 1RIFA 1T0HB 3WI7A 4C6TB 4E5UA 2WM9B 3LI2A 4MKRA 4MW8A 1YKGA 2IODA 1FW8A 3DOOA 4GMXA 1ZESA 1WXWA 3JVEA 4UKDA 4WBXC 3TOVA 1Y4ZA 4BC1A 4I6JA 4ZEVA 1CUEA 3CUYA 2C58A 3TUJC 1CR1A 2GCEA 2PUHA 1W36B 4DLRA 4CXMA 1PFYA 2W93A 4FB4A 3ZK7A 1MOPA 3KRTA 3WSVA 2H17A 4GOMD 5JTUA 3BRCA 3ZVRA 2G1KA 3OWHA 2BC9A 2FWBA 4DG9A 1U99A 1N9GB 2ZAIA 2CJWA 1XRQA 3HADA 4G86A 4XPYA 1JF8A 3QNUA 3L0PA 5ES3A 1I2DA 5HZGA 3QBJA 4LXQA 5F73A 4H4KC 3IT1A 4R9RA 3O2NA 1KQOA 2WJWA 3VV2A 2HS5A 2X0EA 3MBOA 2IHYA 4TGLA 1N2GA 3OPNA 3V1LA 4ARAA 1SVLA 4D81A 4QD3A 4MRNA 4ZOQI 2ACVA 2WIAA 1Y4CA 2ZI6A 4BVFA 3K1YA 4XWJA 2YEVA 2BHRA 2ZRDA 4EFNA 4XVQA 3HCFA 4Y2JA 1JMKC 4E2FA 3HB9A 4P1ZA 5KI6A 4IWYA 5BYBA 3CN9A 2C78A 2X8JA 5B1BC 3V3KA 5CDFE 3P2EA 1TQ6A 3NKEA 3UT0A 4HUTA 2ID9A 4XVRA 5JFTA 1TEHA 2J8ZA 1SUDA 4EMBA 1S3IA 4W82A 4D4LA 3CR8A 3RC3A 4OMDA 4NONA 5ALSA 2OE2A 3K1AB 3E18A 3WWPA 1X7YB 4NZOA 2LKDA 3W1EA 4L7VA 2BH2A 2MMCA 3INNA 2C5GA 5LQRA 3PC7A 2UYGA 4RY0A 3HV0A 1ZH4A 1NOJA 2FUKA 3MINB 2XOKD 3KOYA 4TXHA 4D4XA 4UTXA 3MWGA 1JA9A 1KQ3A 4HUQA 5K05A 2P4UA 5B2FA 4L6IA 3HCNA 2X8JB 2C1ZA 1M6HA 4D8WA 1ADCA 4B6EA 3DFFA 1W5AA 3KC2A 4LZOA 4ND2A 5CIYA 3IB6A 3AHHA 5LZ5A 1FSGA 2GZSA 1OW6A 3D8TA 4G01B 1E4OA 1KHHA 2I6UA 4RTRA 3DTVD 1QZZA 2BLNA 1WXIA 2Q07A 2Y4NA 4P31A 1FY2A 5EIWA 5J63A 2FG6C 3CTPA 1VZ2A 1GFWA 1GA4A 4EEKA 4F4HA 1U2GC 3I05A 2BPOA 4LKOA 2QZ4A 4ZCPA 2IYFA 3CF6R 1XOIA 4KPUA 2R7TA 5EXDA 3STTA 5EP2A 4QC2A 2RJ3A 3DNMA 4MCJA 4F4BA 4HAZA 3JQCA 4C30A 3U39A 3URMA 3WL8A 4R16A 4PRZA 1UANA 1DTWA 3KAKA 3DJNB 2X23A 2HSGA 5AC5A 3FVQA 4WI1A 5DI3A 4B7XA 2IYOA 1TEVA 3KLBA 4KSYA 1CEEA 3DE8A 3LEOA 4OFWA 2GEDA 4IMPA 3ADDA 3G2MA 1G5RA 2F4VB 1DBRA 2ONYA 4LEIA 2R1TB 3HJRA 2PNJA 5J1SB 2F9MA 1OI3A 1A77A 1KI6A 2D1YA 4CUZA 4DABA 2O8EB 3ER9A 1RQ7A 4DPLA 3DLBA 1GT91 5J2UB 1SHJA 4Z51A 1L7CA 2VDKB 1JG2A 3HA3A 1XKLA 2QL5A 2JD1A 3EA5A 3IV7A 3QFRA 4WV3A 4ETMA 3N05A 1IZ0A 2CLDX 1I94B 1ZC4A 4NHEA 4EP1A 8AT1A 2H5EA 3O3OB 4P4SB 3PTLA 2IHZA 5KU7A 4ZQBA 2C3OA 3QWHA 1LZKA 3GRPA 1T8RA 1ADGA 4CCWA 1HM5A 2A3NA 3CNLA 2Y66A 2PRYA 3OFND 2V7WA 4I66A 4PIPA 4YP0A 4U5DE 3SJBA 1FNNA 1WPXA 4TL7A 2GD6A 1TGYA 2I1LA 3TQRA 1WB6A 3AR9A 5EIBC 3FOEC 3P27A 1ZD8A 1T5DX 1V7CA 3LQKA 4UHCA 3WE7A 1P5FA 2VAVA 3O8CA 1C14A 2VIIA 1ZLXA 4NEQA 4C7XA 1L4UA 3RUAA 1IEWA 4PJLA 2HCJB 1GG5A 2Z4TA 1WX1A 1ZI6A 4X71A 1X19A 1TFUA 2J9UA 2DB4A 1AUXA 1YR1A 5SY4A 4CLRB 2VAMA 4I7EA 2I67A 4MVXA 1ACLA 4WXMA 4UJ3A 5EKXA 3KQVA 1YZKA 3TLZA 2H31A 5A3JA 2WHPB 3L7NA 4IHQA 2K7ZA 1CCWA 4M37A 1L8QA 1W8IA 2CKDA 1HQCA 5IAKA 3ZCXA 3JRNA 5T3TA 2VHWA 4M0KA 4DDWA 2AHRA 4RKQA 3M1YA 3WX0A 2Q4TA 5B6JA 1J4AA 1A7DA 4CNBA 3V5ZA 1MMAA 1PD0A 1CEQA 2H4JA 3L5KA 2B4AA 2O50A 4II2A 4DYDA 3ATPA 3IJ5A 4F2GA 2NVUA 2BI4A 1SM4A 1E6MA 4HRAA 4LYHA 2DUWA 4J0QA 5LOVB 3TNJA 4BNKA 3GARA 3CRMA 5A3VA 2XXBA 5SZHB 4ZT7A 4NBSA 3DWGA 4PCUA 3RYLA 4PXYA 4YRKA 1IEQA 2WWYA 3M49A 4DKXA 1CZLA 1WZEA 1FZQA 1NM5A 3IGFA 5DBEX 5DTQA 5FOSA 1EG2A 5IBPA 2OY0A 1XTVA 1XV5A 1YHNA 3Q7LA 3QJGA 4BNDB 1RWKA 3T4PA 3R24A 1NWCA 2G5CA 4IGIA 4OYLA 2YY7A 2QZZA 4I8IA 1ONNA 3BTOA 3ZBQA 4IL5A 3AV0B 3OT5A 1HX7A 3OIYA 4OHUA 4DLKA 1LF0A 2ORIA 2WUGA 2UUBB 1B26A 2SKCA 2IXGA 5FNVB 3TQSA 1JB9A 3I9MA 5ILQA 1OFVA 3QRWA 3DBOB 1U63A 1DOWA 1W30A 1SKQA 2WD9A 3V1TC 3VKWA 3WC4A 1PFVA 4GI2A 4LXUA 3VXKA 6Q21A 4RTNA 2FPXA 1PGPA 4EGQA 2ZRBA 3JASA 5F28E 3EXHC 4EPVA 4RKWA 5F1OA 5I47A 1N25A 3JAKB 3BD6A 1N8NA 5EJEA 5HSGA 4CMIA 3JZFA 1NJ6A 2IELA 1EJBA 3MZ0A 4H1UA 3K0CC 4MVJG 1E85A 1N2IA 3PNKA 2D4AA 2GAOA 2Z3ZA 3M6VA 3WAQA 1ZA1A 1YJBA 2C29D 2WV7A 4P4NA 2X5KO 4TSFA 3PFCA 2VB6A 4RYDA 4AF6A 4FMCB 4DUGA 4S05A 2OLEA 1T1GA 1NW5A 3EC2A 3K70C 1PGJA 3FYTA 4Q47A 2CDRA 5K0JA 3EPHA 2AFVA 4IIUA 2AJ8A 3STHA 4H3KB 3O26A 1NF2A 5U1PA 3TNFA 1GADO 1D7AA 2V3VA 3TD6A 1H1DA 2YWBA 4E1VA 1Q22A 2YWGA 4M8LA 1E84A 4L4XA 1Z7GA 4ZOLA 3SZMA 1AX9A 5JC1A 3OIUA 3D7SA 2V96A 4BQPA 1VSQA 1E8DA 1Y6ZA 2PMWB 1ULTA 5HJ2A 4YCLA 3LK6A 5FI5A 3OTGA 3ET5A 4WOJA 2F9LA 3WB1A 3W05A 2K4MA 3SQNA 5JZMA 1AV7A 2C61A 5BQOA 1TK2A 3PL5A 3DEFA 5JAMA 4C07A 1B8NA 1OWPA 1GNPA 2DVMA 1YYXA 4YDQA 3JU3A 3QE2A 1QPUA 2O2DA 2H4XA 4IDFA 3V55A 4DV4B 3PEUA 4CS8C 1R15A 2GJSA