3IQCA

Crystal structure of flis from h. pylori
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
119
Chain Sequence
YANAYQAYQHESPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
molecule keywords Flagellar protein
total genus 47
structure length 119
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3iqcA00
3K1IA 3IQCA 1ORJA 1SZIA 1ORYA
chains in the Genus database with same CATH superfamily
3LS0A 4MVSA 1SR2A 1OQCA 2X0CA 3GEIA 1U6HA 5CIVA 1ZYRF 3GWLA 5E3AA 2Y3BA 1MNDA 2HKVA 2IOQA 2XL6A 3F46A 4AE4B 3U3BA 4DRJB 3B71A 3HLZA 3G50A 3LLIA 1ZHXA 1I5NA 2L9JA 3DI5A 3F47A 4HFFB 1NU9C 2XRHA 3UR3C 4ULWA 1LI7A 2P7VA 2M4EA 4OIQF 5JSLA 2HV6A 1CPRA 2R03A 4MVQA 2J0XA 3GWNA 3H2VA 1EI7A 4PJJA 4OINF 4EUKB 3U9MA 5EHHA 3IQCA 1DOVA 4JURI 2J9VA 3DD7A 3MX3A 5KYWB 4PFOA 5L0IA 3U8VA 2J0WA 3SXMA 1TR2A 3U2MA 1JR8A 1XZPA 3SYNA 3VM6A 2XXAB 1NLXA 3DWWA 1QQ3A 2YWAA 2DYSC 1ZW3A 2XLDA 4FWVA 5KYXB 4XEVA 4H54A 1S7ZA 4PJMA 2L7AA 1M56C 3Q7GA 2WZLA 2HV7A 3UGPA 2R7SA 1EKYA 3ABMC 3HKKA 4FX5A 2DYRC 3T6BA 4BJ5A 5AC4A 3GEEA 5F5HA 1G8XA 5GPGB 5DS5A 4G7ZF 1K04A 1YYJA 4MVRA 4I1MA 3E70C 3RQFA 1QSPA 1IZMA 2R7TA 1YAUO 1YJGA 4U9EA 3EG9A 3RVYA 3DXJF 1MMAA 3SNHA 4O6MA 1FAPB 4IAOA 3T6GB 3S84A 4DBQA 4PK4A 2OKUA 4BG0A 4DXWA 1ORSC 2F22A 3DAGA 3BEHA 5D91A 1WN0A 1Y6DA 4E18A 5T1DB 1GM5A 4BJ6A 2WB7A 3LJBA 3TOLA 3AG3C 4CS7A 3IHUA 2IXOA 2XM4A 2FAPB 2IXPA 3VYWA 4C3BA 4MQ9F 1V54C 2NSGA 2OEXA 3I4UA 2NG1A 3U5SA 1TFKB 2GDCA 1NG1A 2QE9A 3AG4C 4JJGA 3R7CA 1NFOA 4DJ9A 1VYKA 4XEFA 2HZ8A 3QVZA 3T9OA 5BQIA 4OIOF 3I5QA 3W8HA 2XL4A 1FFHA 2Y3DA 4U5DE 1YZAA 4JVSA 2R02A 3AGTA 4U5EE 3RH3A 5E33A 3B0PA 2R25A 1W2WA 5A6BD 3LNRA 4JEBA 3ZQVA 2KSFA 3JSZA 1WGWA 3S27A 1ZHWA 2KYHA 2LSEA 4EKWA 2R7WA 5A69A 3TULA 3L1MA 2YL1A 5L0JA 1L7CA 1KU2A 2R7OA 2PFDA 4P6IC 5F5FA 1MMDA 1VLSA 2PX0A 4LLCA 3EH1A 3U8PA 1YZCA 2A6HF 2J9UA 2KGOA 1FTSA 2XLVA 3LLKA 3HNIA 3NMJA 4X0RA 3TQOA 2BC5A 1JMWA 1OXKA 2AWCA 4C7OB 3FDQA 3EH2A 2JPUA 2W9YA 2YLDA 2EINC 2Y69C 5B3IA 2CW0F 4XEKA 4N6HA 1Z5ZA 1RKCA 2PX3A 3GODA 2EPKX 1Z63A 1OCRC 1YDIA 1R5ID 2G3KA 4MVMA 3EHNA 2NSFA 3K66A 4YL0A 1LM3B 2QUPA 3LESA 2J7PA 4MTFA 2ZXRA 1VOMA 1ZVZA 2Y3GA 3MLGA 2B0JA 4E7SA 3OEOA 3ZG1A 4CDAA 4EWCA 1TWHA 5F28E 4AL0A 3M79A 4K1OA 1FNTc 4G7HF 3B0UX 4Z9HA 3S29A 256BA 2J45A 2YEVA 1M2OA 3FHDA 2ICWG 4JTAB 2X51A 4P9TA 3IQTA 1BR1A 2E87A 4JRZA 4MVZA 3L0IA 4C3EA 4CDYA 4D4XA 1TWCA 2GAQA 2LIGA 4Q7CA 3DE8A 4NY3A 3NRHA 1RKEA 4OIRF 4DRHB 2LQGA 1LS1A 2OJQA 4FESA 3W4YA 4JCHA 3RFYA 3GM1A 1BR4A 1GGQA 3UNGC 3US6A 3FAJA 4XPYA 4HFKB 3X2QC 3K1IC 1O3UA 2EILC 5T3TA 3OWTA 1ZZPA 2TMVP 1PV3A 3PCVA 4J30B 2Q4FA 1UFBA 2PNOA 2WVNA 4BJ5C 4CS8C 2XLWA 1M2VB 3EFOA 3EQLF 5DS4A 1Q0FA 4ZLDA 5B3SC 2HJ3A 3TOMA 1O87A 1BZ4A 1KNYA 1JAFA 2QY9A 4XWJA 3NMKA 3T6JA 5L0FA 3LS1A 3G4XA 1ZU4A 2XLMA 3JYYA 5KYUA 2JX0A 3LNMB 1A7EA 2XLHA 5KYNA 4J7TA 1BBHA 4LDKA 3C63A 2I15A 1QLEC 3O55A 1QVXA 3NDBB 4IGGA 1MMNA 4YT4A 5EK0A 3WHNA 4P9FA 3QVYA 2HMQA 3AQCA 2CDQA 3V5XA 2YLIA 1D0XA 1Q0MA 3EZHA 3L34A 3N24A 4GEHA 1BDJB 2KK1A 3ZTZA 4NTBA 3NKEA 5HSWA 1CGOA 1RJ9B 3I5PA 4MVUA 1ZW2A 1YYXA 3AQBA 2A69F 2XLOA 2R7UA 1IW7F 1VYIA 3C7JA 1CGNA 3EHMA 3HNLA 3J06A 2JD3A 4BPMA 1V74B 2YKZA 3NG1A 1EA8A 4JEAA 2HJMA 2VCAA 2Y3HA 4NTAA 4QI0A 3K7DA 1JPNA 5AC5A 4YL3A 1B68A 1WWPA 4Z9IA 5E3CA 3KKBA 3SXYA 3DE9A 3Q7LA 4JIOA 4O6YA 2J7PD 2QNLA 2G62A 2YQYA 1CGME 1C03A 1N1CA 4IARA 3B0VC 2IM8A 4U9DA 5A6BA 1LPEA 2AVKA 4WABA 3VRCA 3S28A 1H9GA 5HV9A 2OJED 1M57C 2GFHA 3ZWIA 2VC9A 4XPWA 1M6TA 4I3MA 4CS9C 5JS5A 4YK5A 5KYUB 4NTFA 2XXAA 3GEHA 3SP1A 2PBEA 2CGEA 3DM5A 4LACB 3RYLA 2Q3TA 3SZRA 2R7QA 3DKAA 1RJ9A 1NZEA 2XS8A 1LI5A 3CEXA 3GANA 3KPHA 1ORJA 2A0UA 3HJCA 3RQGA 2AWYA 2IXNA 4U5BE 3W8IA 3WODF 3NYMA 2YZSA 4I44A 1TWGA 4JTDB 4CSAC 1G4US 1NBBA 2LK4A 3AJMA 1OW7A 5T3WA 2YHSA 3A11A 5AGFA 1Z3IX 3N2ZB 3RVZA 1LS4A 3T4RA 4CS9A 3FOPA 2J46A 4E0HA 2OQMA 3FXHA 2YLGA 4U5CE 1Z7Qc 5JLIA 5JVEA 3M4CA 3M4BA 4PACA 4C3DA 2XS1A 2RD9A 1WATA 1YA7O 4IJJA 4BJTA 3C8GA 5CI8A 1T5OA 2KW3C 4Q4ZF 2VCCA 4O6NA 5KYXA 2NPUA 3HTKC 2VH3A 4N6CA 5D92A 4RDAA 3FVYA 1ST6A 3PDMP 4A2NB 1VK5A 4IWBA 2OEVA 1OW8A 2HS5A 5COGA 1OCOC 1QPUA 3SXZA 1KTMA 4PR9A 2EIJC 4JZAA 3WG7C 4EBBA 3EGXA 4EBKA 1PD0A 3E9VA 4BEJA 1SF8A 4JJFA 1FMVA 1XZQA 2O9XA 4CSAA 3V7OA 4D4NA 1EQ1A 3KYIA 4CBEA 3JRMO 1O5HA 3V5YA 1E84A 4C7OA 1QKRA 2EIKC 4OIPF 3RKOF 5A6JA 3X1OA 2WZGA 3JSEO 3ZSUA 5DQZA 2FGYA 1T6IA 2EPLX 2DGJA 3ASOC 5DQTA 1T9KA 4KI2A 4DVZA 3ZIBA 4B6IA 3TD7A 2BL2A 3JCUQ 5FZTA 4LERA 2HFIA 5L0DA 2V3CC 3ZDLA 4EBJA 2ZXPA 1QZXA 1HMOA 3EZIA 4G78A 3UMKA 4CJOA 1U89A 2A68F 3ABLC 3CSKA 4MS2A 5TJ5E 1CPQA 3IPMO 1C17M 1AEPA 2LFFA 4O79A 1Q0KA 2WL8A 3U9JA 3QW0A 5L0HA 1TWAA 3N0TA 4RBNA 4AX2A 4CIPA 3S9OA 3HNJA 2OCCC 4PJLA 1HMDA 3C62A 3LAYA 4N4WA 3ZQYA 1GS9A 1OCCC 5JP7A 2YRFA 2Q9AA 3C18A 3MFNA 2RSEB 3NKDA 4KBLA 1SMYF 4MNDA 4WGZA 3EGXB 2Q7RA 4CS8A 4M63A 4DBRA 3SXKA 1LVKA 4MTGA 1HY5A 3EPVA 4NCQA 3JRTA 5COFA 2P1AA 3K1IA 1G5ZA 2D4UA 2XLEA 2P61A 3EGDB 3NYJA 4QDLA 1H7IA 3ASNC 4EIYA 4LDRA 1NSGB 1E86A 1LIHA 1MMGA 2LFDA 5A6AA 3DMDA 2ASRA 2NUPB 2KQ9A 3AOUA 4ONSA 3DZAA 3L8JA 3QTHA 4YJWA 3C8GB 1E83A 2A6EF 4MTOA 5B1BC 1T6UA 3KYJA 4BEMJ 2XSEA 3ZTMA 3G4ZA 4W8PA 1ZHYA 2QLAA 4I1OB 3DJNB 2L6GA 1NFNA 3HNKA 3NYLA 1HE9A 3RW0A 1RCPA 1Q0GA 1J8YF 1OXBA 4DRIB 2VCBA 5IY5C 2D5RB 2UUIA 2G3VA 2UUHA 3WAQA 4E7ZA 3LUTB 2C03A 2GA0A 3POVA 5KYYB 1OR2A 2XL8A 5EGYA 3FOOA 3QMKA 2Y39A 3M15A 1VLTA 3LEOA 5E2QA 4CDVA 1TQGA 2FFHA 4ER9A 4MW3A 2XM0A 4XQ1A 4PFPA 5JRAA 4H4KC 3ATPA 2DI3A 4AE4A 5L3QA 4W8KA 3H2UA 4ULVA 3KMIA 2LD6A 4IB4A 3QZCA 3GM2A 4U5HA 2CNWD 1DOWA 1OW6A 2YVKA 1D1BA 4XTKA 3O39A 4JE9A 4A4AA 4DVYP 2C04A 1PD1A 5BQGA 1XWJA 3UMHA 3BRJA 1T01A 4WJ0A 1WOLA 4XLNF 3NMIA 4PJNA 3RF3A 1Q0DA 4K7BA 3S0XA 3AG1C 1TFOB 3FMSA 1YVIA 4HE8D 4YN0B 3ZC4A 2J9BA 3O10A 5KYWA 3UMIA 2B0HA 2IXMA 1LKXA 1V55C 1JPJA 2L81A 3TK0A 4XLPF 1I4ZA 3DJUB 2NUTB 5JUAA 1VMAA 1E2XA 1MNEA 2ETSA 1RXQA 4JTCB 3RIPA 2P0NA 2HMZA 1SZIA 3EGDA 5DVWA 5BQHA 3W2VA 2OU6A 2Q9BA 3B9QA 5KYYA 2H7OA 5BUOA 3EG9B 4BJ6C 2HUJA 4J32B 1ZHZA 2HSQA 3RQEA 2V26A 5DLJA 4CX9A 4F4BA 4CIHA 4BJ1A 2HSBA 5JT4A 3C8ZA 2Q00A 1WTYA 2PP4A 1BR2A 4KNVA 3TJ5A 1SYQA 3W2WA 1ZHTA 1C02A 2EPNA 2J9WA 3IQ6A 3S90A 2DB4A 1VB5A 1Z6AA 2BE5F 4HEAJ 2IYLD 2ZD9A 3JYHA 4EHPA 1OCZC 2YL7A 3H65A 1G4WR 4YL1A 3DM9B 1J8MF 1OKKD 5COMA 2LCHA 4Z9JA 2H8AA 1U0BB 4MW8A 2ZXWC 2MHRA 2VASA 1A0BA 2W4MA 3AGUA 4R32A 5A6KA 2CYDA 2IBFA 3A9CA 3Q6MA 3OA1A 5L3VA 3ABKC 1T6QA 4IRUA 2NUTA 2YL0A 1VTMP 2L6HA 4AL1A 2KNHA 1AVOB 3JT1A 2ZPAA 3MBGA 4JW1A 1F1MA 1V4AA 3U2LA 2M64A 3JTLO 4IAQA 5B1AC 4JC7A 1I4YA 2WVQA 3V5ZA 3AG2C 1YARO 2R7RA 3IQ5A 3R2PA 2MYSA 5L0CA 4LLEA 1HW2A 4G0HA 4K0DA 2ZXOA 3LEVA 2PF4E 1R4TA 3IEEA 4YT8A 3L8IA 2EIMC 4N06A 4QI2A 1UG7A 4RD9A 1OKKA 4E0IA 1E85A 3U0CA 2OG2A 3ECSA 1S05A 4KC9A 1APCA 3DAFA 3EFOB 1L3PA 2WVOA 4WGYA 3K33A 4OD5A 3FAPB 2Q9CA 1JRAA 4YT5A 3CQZA 1WASA 2AU5A 2H7BA 2MWQA 3M1CB 1MQVA 3PMRA 2VB6A 1LE4A 4O7GA 4E17A 1TKNA 4UDVA 1GQAA 1K40A 2CCYA 4MVOA 1FR0A 4NQFA 1D1CA 2AP3A 2P6VA 4CJGA 4ANJA 1HE1A 1RKEB 1FFTC 4YT2A 4NC3A 5FCLA 1A41A 2R9RB 3VF0A 3PHF2 1HW1A 1JOGA 3O6XA 3CZ6A 3GORA 4JKVA 2W45A 2KJGA 3K6BA 4DOZA 5DS6A 3C8GD 4OD4A 2L6FA 5CI9A 2H7VC 4Q5SF 3MYFA 2CNWA 4FAPB 1PCXA 1D0ZA 1A7VA 3QW1A 2A0BA 1YA9A 2WZFA 1ORYA 4U5FE 3VAYA 4GQHA 4ZLCA 2KC3A 1OR3A 4G7OF 3EJNA 3KL4A 4GYTA 1H9TA 2NUPA 1H6GA 4U5GA 1YLMA 3SEOA 3K1HA 3UGOA 5L0GA 2EPMX 2R7VA 3JZ0A 2R05A 1FMWA 4AK9A 1M2VA 4J7YA 4KNWA 3CAXA 2GWWA 4LDQA 2LP4A 2QTVA 3MYIA 3ZVRA 3TJ6A 1D1AA 1K05A 2YL3A 3ITFA 2Z15A 2OOCA 3B29A 4JCZA 3GM3A 1A7DA 1NU7D 1D0YA 1Y4CA 2W4BA 4XPXA 4YWQA 2I8BA 2J8WA 3U3FA 1RMVA 5K0IA 1AUEA 2A1DD 2EPOA 3KH2A 1Z23A 2R7XA 1LE2A 4L6RA 3Q6NA 1ZU5A
chains in the Genus database with same CATH topology
3K1IA 3IQCA 1ORJA 1SZIA 1ORYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I A;  3IQC A;  1ORJ A;  1SZI A;  1ORY A; 
#chains in the Genus database with same CATH topology
 3LS0 A;  4MVS A;  1SR2 A;  1OQC A;  2X0C A;  3GEI A;  1U6H A;  5CIV A;  1ZYR F;  3GWL A;  5E3A A;  2Y3B A;  1MND A;  2HKV A;  2IOQ A;  2XL6 A;  3F46 A;  4AE4 B;  3U3B A;  4DRJ B;  3B71 A;  3HLZ A;  3G50 A;  3LLI A;  1ZHX A;  1I5N A;  2L9J A;  3DI5 A;  3F47 A;  4HFF B;  1NU9 C;  2XRH A;  3UR3 C;  4ULW A;  1LI7 A;  2P7V A;  2M4E A;  4OIQ F;  5JSL A;  2HV6 A;  1CPR A;  2R03 A;  4MVQ A;  2J0X A;  3GWN A;  3H2V A;  1EI7 A;  4PJJ A;  4OIN F;  4EUK B;  3U9M A;  5EHH A;  3IQC A;  1DOV A;  4JUR I;  2J9V A;  3DD7 A;  3MX3 A;  5KYW B;  4PFO A;  5L0I A;  3U8V A;  2J0W A;  3SXM A;  1TR2 A;  3U2M A;  1JR8 A;  1XZP A;  3SYN A;  3VM6 A;  2XXA B;  1NLX A;  3DWW A;  1QQ3 A;  2YWA A;  2DYS C;  1ZW3 A;  2XLD A;  4FWV A;  5KYX B;  4XEV A;  4H54 A;  1S7Z A;  4PJM A;  2L7A A;  1M56 C;  3Q7G A;  2WZL A;  2HV7 A;  3UGP A;  2R7S A;  1EKY A;  3ABM C;  3HKK A;  4FX5 A;  2DYR C;  3T6B A;  4BJ5 A;  5AC4 A;  3GEE A;  5F5H A;  1G8X A;  5GPG B;  5DS5 A;  4G7Z F;  1K04 A;  1YYJ A;  4MVR A;  4I1M A;  3E70 C;  3RQF A;  1QSP A;  1IZM A;  2R7T A;  1YAU O;  1YJG A;  4U9E A;  3EG9 A;  3RVY A;  3DXJ F;  1MMA A;  3SNH A;  4O6M A;  1FAP B;  4IAO A;  3T6G B;  3S84 A;  4DBQ A;  4PK4 A;  2OKU A;  4BG0 A;  4DXW A;  1ORS C;  2F22 A;  3DAG A;  3BEH A;  5D91 A;  1WN0 A;  1Y6D A;  4E18 A;  5T1D B;  1GM5 A;  4BJ6 A;  2WB7 A;  3LJB A;  3TOL A;  3AG3 C;  4CS7 A;  3IHU A;  2IXO A;  2XM4 A;  2FAP B;  2IXP A;  3VYW A;  4C3B A;  4MQ9 F;  1V54 C;  2NSG A;  2OEX A;  3I4U A;  2NG1 A;  3U5S A;  1TFK B;  2GDC A;  1NG1 A;  2QE9 A;  3AG4 C;  4JJG A;  3R7C A;  1NFO A;  4DJ9 A;  1VYK A;  4XEF A;  2HZ8 A;  3QVZ A;  3T9O A;  5BQI A;  4OIO F;  3I5Q A;  3W8H A;  2XL4 A;  1FFH A;  2Y3D A;  4U5D E;  1YZA A;  4JVS A;  2R02 A;  3AGT A;  4U5E E;  3RH3 A;  5E33 A;  3B0P A;  2R25 A;  1W2W A;  5A6B D;  3LNR A;  4JEB A;  3ZQV A;  2KSF A;  3JSZ A;  1WGW A;  3S27 A;  1ZHW A;  2KYH A;  2LSE A;  4EKW A;  2R7W A;  5A69 A;  3TUL A;  3L1M A;  2YL1 A;  5L0J A;  1L7C A;  1KU2 A;  2R7O A;  2PFD A;  4P6I C;  5F5F A;  1MMD A;  1VLS A;  2PX0 A;  4LLC A;  3EH1 A;  3U8P A;  1YZC A;  2A6H F;  2J9U A;  2KGO A;  1FTS A;  2XLV A;  3LLK A;  3HNI A;  3NMJ A;  4X0R A;  3TQO A;  2BC5 A;  1JMW A;  1OXK A;  2AWC A;  4C7O B;  3FDQ A;  3EH2 A;  2JPU A;  2W9Y A;  2YLD A;  2EIN C;  2Y69 C;  5B3I A;  2CW0 F;  4XEK A;  4N6H A;  1Z5Z A;  1RKC A;  2PX3 A;  3GOD A;  2EPK X;  1Z63 A;  1OCR C;  1YDI A;  1R5I D;  2G3K A;  4MVM A;  3EHN A;  2NSF A;  3K66 A;  4YL0 A;  1LM3 B;  2QUP A;  3LES A;  2J7P A;  4MTF A;  2ZXR A;  1VOM A;  1ZVZ A;  2Y3G A;  3MLG A;  2B0J A;  4E7S A;  3OEO A;  3ZG1 A;  4CDA A;  4EWC A;  1TWH A;  5F28 E;  4AL0 A;  3M79 A;  4K1O A;  1FNT c;  4G7H F;  3B0U X;  4Z9H A;  3S29 A;  256B A;  2J45 A;  2YEV A;  1M2O A;  3FHD A;  2ICW G;  4JTA B;  2X51 A;  4P9T A;  3IQT A;  1BR1 A;  2E87 A;  4JRZ A;  4MVZ A;  3L0I A;  4C3E A;  4CDY A;  4D4X A;  1TWC A;  2GAQ A;  2LIG A;  4Q7C A;  3DE8 A;  4NY3 A;  3NRH A;  1RKE A;  4OIR F;  4DRH B;  2LQG A;  1LS1 A;  2OJQ A;  4FES A;  3W4Y A;  4JCH A;  3RFY A;  3GM1 A;  1BR4 A;  1GGQ A;  3UNG C;  3US6 A;  3FAJ A;  4XPY A;  4HFK B;  3X2Q C;  3K1I C;  1O3U A;  2EIL C;  5T3T A;  3OWT A;  1ZZP A;  2TMV P;  1PV3 A;  3PCV A;  4J30 B;  2Q4F A;  1UFB A;  2PNO A;  2WVN A;  4BJ5 C;  4CS8 C;  2XLW A;  1M2V B;  3EFO A;  3EQL F;  5DS4 A;  1Q0F A;  4ZLD A;  5B3S C;  2HJ3 A;  3TOM A;  1O87 A;  1BZ4 A;  1KNY A;  1JAF A;  2QY9 A;  4XWJ A;  3NMK A;  3T6J A;  5L0F A;  3LS1 A;  3G4X A;  1ZU4 A;  2XLM A;  3JYY A;  5KYU A;  2JX0 A;  3LNM B;  1A7E A;  2XLH A;  5KYN A;  4J7T A;  1BBH A;  4LDK A;  3C63 A;  2I15 A;  1QLE C;  3O55 A;  1QVX A;  3NDB B;  4IGG A;  1MMN A;  4YT4 A;  5EK0 A;  3WHN A;  4P9F A;  3QVY A;  2HMQ A;  3AQC A;  2CDQ A;  3V5X A;  2YLI A;  1D0X A;  1Q0M A;  3EZH A;  3L34 A;  3N24 A;  4GEH A;  1BDJ B;  2KK1 A;  3ZTZ A;  4NTB A;  3NKE A;  5HSW A;  1CGO A;  1RJ9 B;  3I5P A;  4MVU A;  1ZW2 A;  1YYX A;  3AQB A;  2A69 F;  2XLO A;  2R7U A;  1IW7 F;  1VYI A;  3C7J A;  1CGN A;  3EHM A;  3HNL A;  3J06 A;  2JD3 A;  4BPM A;  1V74 B;  2YKZ A;  3NG1 A;  1EA8 A;  4JEA A;  2HJM A;  2VCA A;  2Y3H A;  4NTA A;  4QI0 A;  3K7D A;  1JPN A;  5AC5 A;  4YL3 A;  1B68 A;  1WWP A;  4Z9I A;  5E3C A;  3KKB A;  3SXY A;  3DE9 A;  3Q7L A;  4JIO A;  4O6Y A;  2J7P D;  2QNL A;  2G62 A;  2YQY A;  1CGM E;  1C03 A;  1N1C A;  4IAR A;  3B0V C;  2IM8 A;  4U9D A;  5A6B A;  1LPE A;  2AVK A;  4WAB A;  3VRC A;  3S28 A;  1H9G A;  5HV9 A;  2OJE D;  1M57 C;  2GFH A;  3ZWI A;  2VC9 A;  4XPW A;  1M6T A;  4I3M A;  4CS9 C;  5JS5 A;  4YK5 A;  5KYU B;  4NTF A;  2XXA A;  3GEH A;  3SP1 A;  2PBE A;  2CGE A;  3DM5 A;  4LAC B;  3RYL A;  2Q3T A;  3SZR A;  2R7Q A;  3DKA A;  1RJ9 A;  1NZE A;  2XS8 A;  1LI5 A;  3CEX A;  3GAN A;  3KPH A;  1ORJ A;  2A0U A;  3HJC A;  3RQG A;  2AWY A;  2IXN A;  4U5B E;  3W8I A;  3WOD F;  3NYM A;  2YZS A;  4I44 A;  1TWG A;  4JTD B;  4CSA C;  1G4U S;  1NBB A;  2LK4 A;  3AJM A;  1OW7 A;  5T3W A;  2YHS A;  3A11 A;  5AGF A;  1Z3I X;  3N2Z B;  3RVZ A;  1LS4 A;  3T4R A;  4CS9 A;  3FOP A;  2J46 A;  4E0H A;  2OQM A;  3FXH A;  2YLG A;  4U5C E;  1Z7Q c;  5JLI A;  5JVE A;  3M4C A;  3M4B A;  4PAC A;  4C3D A;  2XS1 A;  2RD9 A;  1WAT A;  1YA7 O;  4IJJ A;  4BJT A;  3C8G A;  5CI8 A;  1T5O A;  2KW3 C;  4Q4Z F;  2VCC A;  4O6N A;  5KYX A;  2NPU A;  3HTK C;  2VH3 A;  4N6C A;  5D92 A;  4RDA A;  3FVY A;  1ST6 A;  3PDM P;  4A2N B;  1VK5 A;  4IWB A;  2OEV A;  1OW8 A;  2HS5 A;  5COG A;  1OCO C;  1QPU A;  3SXZ A;  1KTM A;  4PR9 A;  2EIJ C;  4JZA A;  3WG7 C;  4EBB A;  3EGX A;  4EBK A;  1PD0 A;  3E9V A;  4BEJ A;  1SF8 A;  4JJF A;  1FMV A;  1XZQ A;  2O9X A;  4CSA A;  3V7O A;  4D4N A;  1EQ1 A;  3KYI A;  4CBE A;  3JRM O;  1O5H A;  3V5Y A;  1E84 A;  4C7O A;  1QKR A;  2EIK C;  4OIP F;  3RKO F;  5A6J A;  3X1O A;  2WZG A;  3JSE O;  3ZSU A;  5DQZ A;  2FGY A;  1T6I A;  2EPL X;  2DGJ A;  3ASO C;  5DQT A;  1T9K A;  4KI2 A;  4DVZ A;  3ZIB A;  4B6I A;  3TD7 A;  2BL2 A;  3JCU Q;  5FZT A;  4LER A;  2HFI A;  5L0D A;  2V3C C;  3ZDL A;  4EBJ A;  2ZXP A;  1QZX A;  1HMO A;  3EZI A;  4G78 A;  3UMK A;  4CJO A;  1U89 A;  2A68 F;  3ABL C;  3CSK A;  4MS2 A;  5TJ5 E;  1CPQ A;  3IPM O;  1C17 M;  1AEP A;  2LFF A;  4O79 A;  1Q0K A;  2WL8 A;  3U9J A;  3QW0 A;  5L0H A;  1TWA A;  3N0T A;  4RBN A;  4AX2 A;  4CIP A;  3S9O A;  3HNJ A;  2OCC C;  4PJL A;  1HMD A;  3C62 A;  3LAY A;  4N4W A;  3ZQY A;  1GS9 A;  1OCC C;  5JP7 A;  2YRF A;  2Q9A A;  3C18 A;  3MFN A;  2RSE B;  3NKD A;  4KBL A;  1SMY F;  4MND A;  4WGZ A;  3EGX B;  2Q7R A;  4CS8 A;  4M63 A;  4DBR A;  3SXK A;  1LVK A;  4MTG A;  1HY5 A;  3EPV A;  4NCQ A;  3JRT A;  5COF A;  2P1A A;  3K1I A;  1G5Z A;  2D4U A;  2XLE A;  2P61 A;  3EGD B;  3NYJ A;  4QDL A;  1H7I A;  3ASN C;  4EIY A;  4LDR A;  1NSG B;  1E86 A;  1LIH A;  1MMG A;  2LFD A;  5A6A A;  3DMD A;  2ASR A;  2NUP B;  2KQ9 A;  3AOU A;  4ONS A;  3DZA A;  3L8J A;  3QTH A;  4YJW A;  3C8G B;  1E83 A;  2A6E F;  4MTO A;  5B1B C;  1T6U A;  3KYJ A;  4BEM J;  2XSE A;  3ZTM A;  3G4Z A;  4W8P A;  1ZHY A;  2QLA A;  4I1O B;  3DJN B;  2L6G A;  1NFN A;  3HNK A;  3NYL A;  1HE9 A;  3RW0 A;  1RCP A;  1Q0G A;  1J8Y F;  1OXB A;  4DRI B;  2VCB A;  5IY5 C;  2D5R B;  2UUI A;  2G3V A;  2UUH A;  3WAQ A;  4E7Z A;  3LUT B;  2C03 A;  2GA0 A;  3POV A;  5KYY B;  1OR2 A;  2XL8 A;  5EGY A;  3FOO A;  3QMK A;  2Y39 A;  3M15 A;  1VLT A;  3LEO A;  5E2Q A;  4CDV A;  1TQG A;  2FFH A;  4ER9 A;  4MW3 A;  2XM0 A;  4XQ1 A;  4PFP A;  5JRA A;  4H4K C;  3ATP A;  2DI3 A;  4AE4 A;  5L3Q A;  4W8K A;  3H2U A;  4ULV A;  3KMI A;  2LD6 A;  4IB4 A;  3QZC A;  3GM2 A;  4U5H A;  2CNW D;  1DOW A;  1OW6 A;  2YVK A;  1D1B A;  4XTK A;  3O39 A;  4JE9 A;  4A4A A;  4DVY P;  2C04 A;  1PD1 A;  5BQG A;  1XWJ A;  3UMH A;  3BRJ A;  1T01 A;  4WJ0 A;  1WOL A;  4XLN F;  3NMI A;  4PJN A;  3RF3 A;  1Q0D A;  4K7B A;  3S0X A;  3AG1 C;  1TFO B;  3FMS A;  1YVI A;  4HE8 D;  4YN0 B;  3ZC4 A;  2J9B A;  3O10 A;  5KYW A;  3UMI A;  2B0H A;  2IXM A;  1LKX A;  1V55 C;  1JPJ A;  2L81 A;  3TK0 A;  4XLP F;  1I4Z A;  3DJU B;  2NUT B;  5JUA A;  1VMA A;  1E2X A;  1MNE A;  2ETS A;  1RXQ A;  4JTC B;  3RIP A;  2P0N A;  2HMZ A;  1SZI A;  3EGD A;  5DVW A;  5BQH A;  3W2V A;  2OU6 A;  2Q9B A;  3B9Q A;  5KYY A;  2H7O A;  5BUO A;  3EG9 B;  4BJ6 C;  2HUJ A;  4J32 B;  1ZHZ A;  2HSQ A;  3RQE A;  2V26 A;  5DLJ A;  4CX9 A;  4F4B A;  4CIH A;  4BJ1 A;  2HSB A;  5JT4 A;  3C8Z A;  2Q00 A;  1WTY A;  2PP4 A;  1BR2 A;  4KNV A;  3TJ5 A;  1SYQ A;  3W2W A;  1ZHT A;  1C02 A;  2EPN A;  2J9W A;  3IQ6 A;  3S90 A;  2DB4 A;  1VB5 A;  1Z6A A;  2BE5 F;  4HEA J;  2IYL D;  2ZD9 A;  3JYH A;  4EHP A;  1OCZ C;  2YL7 A;  3H65 A;  1G4W R;  4YL1 A;  3DM9 B;  1J8M F;  1OKK D;  5COM A;  2LCH A;  4Z9J A;  2H8A A;  1U0B B;  4MW8 A;  2ZXW C;  2MHR A;  2VAS A;  1A0B A;  2W4M A;  3AGU A;  4R32 A;  5A6K A;  2CYD A;  2IBF A;  3A9C A;  3Q6M A;  3OA1 A;  5L3V A;  3ABK C;  1T6Q A;  4IRU A;  2NUT A;  2YL0 A;  1VTM P;  2L6H A;  4AL1 A;  2KNH A;  1AVO B;  3JT1 A;  2ZPA A;  3MBG A;  4JW1 A;  1F1M A;  1V4A A;  3U2L A;  2M64 A;  3JTL O;  4IAQ A;  5B1A C;  4JC7 A;  1I4Y A;  2WVQ A;  3V5Z A;  3AG2 C;  1YAR O;  2R7R A;  3IQ5 A;  3R2P A;  2MYS A;  5L0C A;  4LLE A;  1HW2 A;  4G0H A;  4K0D A;  2ZXO A;  3LEV A;  2PF4 E;  1R4T A;  3IEE A;  4YT8 A;  3L8I A;  2EIM C;  4N06 A;  4QI2 A;  1UG7 A;  4RD9 A;  1OKK A;  4E0I A;  1E85 A;  3U0C A;  2OG2 A;  3ECS A;  1S05 A;  4KC9 A;  1APC A;  3DAF A;  3EFO B;  1L3P A;  2WVO A;  4WGY A;  3K33 A;  4OD5 A;  3FAP B;  2Q9C A;  1JRA A;  4YT5 A;  3CQZ A;  1WAS A;  2AU5 A;  2H7B A;  2MWQ A;  3M1C B;  1MQV A;  3PMR A;  2VB6 A;  1LE4 A;  4O7G A;  4E17 A;  1TKN A;  4UDV A;  1GQA A;  1K40 A;  2CCY A;  4MVO A;  1FR0 A;  4NQF A;  1D1C A;  2AP3 A;  2P6V A;  4CJG A;  4ANJ A;  1HE1 A;  1RKE B;  1FFT C;  4YT2 A;  4NC3 A;  5FCL A;  1A41 A;  2R9R B;  3VF0 A;  3PHF 2;  1HW1 A;  1JOG A;  3O6X A;  3CZ6 A;  3GOR A;  4JKV A;  2W45 A;  2KJG A;  3K6B A;  4DOZ A;  5DS6 A;  3C8G D;  4OD4 A;  2L6F A;  5CI9 A;  2H7V C;  4Q5S F;  3MYF A;  2CNW A;  4FAP B;  1PCX A;  1D0Z A;  1A7V A;  3QW1 A;  2A0B A;  1YA9 A;  2WZF A;  1ORY A;  4U5F E;  3VAY A;  4GQH A;  4ZLC A;  2KC3 A;  1OR3 A;  4G7O F;  3EJN A;  3KL4 A;  4GYT A;  1H9T A;  2NUP A;  1H6G A;  4U5G A;  1YLM A;  3SEO A;  3K1H A;  3UGO A;  5L0G A;  2EPM X;  2R7V A;  3JZ0 A;  2R05 A;  1FMW A;  4AK9 A;  1M2V A;  4J7Y A;  4KNW A;  3CAX A;  2GWW A;  4LDQ A;  2LP4 A;  2QTV A;  3MYI A;  3ZVR A;  3TJ6 A;  1D1A A;  1K05 A;  2YL3 A;  3ITF A;  2Z15 A;  2OOC A;  3B29 A;  4JCZ A;  3GM3 A;  1A7D A;  1NU7 D;  1D0Y A;  1Y4C A;  2W4B A;  4XPX A;  4YWQ A;  2I8B A;  2J8W A;  3U3F A;  1RMV A;  5K0I A;  1AUE A;  2A1D D;  2EPO A;  3KH2 A;  1Z23 A;  2R7X A;  1LE2 A;  4L6R A;  3Q6N A;  1ZU5 A; 
#chains in the Genus database with same CATH homology
 3K1I A;  3IQC A;  1ORJ A;  1SZI A;  1ORY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...