3IQCA

Crystal structure of flis from h. pylori
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
119
Chain Sequence
YANAYQAYQHESPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 47
structure length 119
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3iqcA00
1ORJA 3IQCA 1SZIA 1ORYA 3K1IA
chains in the Genus database with same CATH superfamily
2P1AA 3LS1A 3M4BA 1HMOA 2A0BA 2QNLA 2Y39A 1SMYF 2MWQA 4FESA 4X0RA 3JSZA 1T01A 3LLKA 3MFNA 3EG9B 4EBJA 1R4TA 4CIHA 5KYXB 3G4ZA 5KYWA 4O6MA 3B0UX 3X2QC 2HKVA 3CEXA 1OKKA 1XZPA 4MVMA 4XTKA 4GQHA 1QKRA 1BDJB 3K1IC 2LK4A 4G7ZF 2GWWA 4JVSA 2WVNA 4ANJA 1HY5A 2Q9BA 4JE9A 3G4XA 1J8MF 2KYHA 1Z23A 1L7CA 1N1CA 2A68F 2EINC 2YL0A 1OR2A 3K66A 3MX3A 4AL0A 1YVIA 2YZSA 3FDQA 1UG7A 2JD3A 1G4US 3IQ6A 2NG1A 5E3CA 2XM4A 3HNKA 3GEIA 4FAPB 2OJQA 4MVQA 2PP4A 4YJWA 1CGME 3DI5A 1QQ3A 2QLAA 2CDQA 2DYSC 2X51A 3AQCA 3GM2A 3NDBB 1XZQA 1RJ9B 4ULVA 3UMHA 2J9VA 2OEVA 4LACB 3E9VA 2XXAB 3K1IA 5E2QA 3RQGA 4U5HA 2B0HA 2J9WA 3VF0A 1YZAA 3CSKA 5AC4A 3C7JA 1LKXA 1FAPB 1LS1A 1SR2A 3KYJA 2KGOA 2Y3DA 4O79A 3DJUB 3S9OA 3S0XA 2R7SA 2YRFA 1V54C 2QY9A 4L6RA 1NBBA 2R7WA 5EK0A 4I3MA 3PDMP 2IBFA 4MTOA 4I44A 3IQCA 5COMA 1JOGA 4YWQA 4J7YA 3U2LA 4IAOA 3EGDA 4JEBA 1BR4A 4OIRF 3R2PA 3RH3A 3ZC4A 3AGUA 4C7OB 4XPYA 2I15A 3F47A 4P9FA 1MMDA 5CI9A 3HJCA 3SEOA 3ZDLA 2BC5A 3U3FA 1OCCC 2J7PA 2KQ9A 4MVRA 4RBNA 3ZWIA 2BE5F 3Q7GA 3LESA 2Q00A 4AE4A 3HLZA 2AWCA 1FFTC 5BUOA 2EPNA 4J32B 2PNOA 2F22A 1TFOB 4IWBA 4YT4A 1ZHZA 5JSLA 4YT5A 3TJ6A 2H8AA 2DB4A 3O6XA 3GODA 2AU5A 1K40A 3B9QA 1VLTA 3K6BA 1IZMA 3LS0A 4PJJA 1OW8A 3DXJF 4MVZA 2XS8A 1OW7A 1VTMP 2Q4FA 2NPUA 5L0IA 1WN0A 3SYNA 3EHMA 3BEHA 4PK4A 4B6IA 3RVZA 2ASRA 2J9UA 4K1OA 2IXMA 4LERA 1M2VA 1OCZC 1AUEA 3TJ5A 3UGPA 4PFOA 3JSEO 1FR0A 3GEHA 4IAQA 3U8PA 2OKUA 1JR8A 4A4AA 3EFOA 3O10A 4N4WA 4MQ9F 1ZYRF 1WASA 1O3UA 3NKEA 1BBHA 4WABA 2R7TA 4LDKA 1E2XA 3WAQA 3C62A 4FX5A 5K0IA 4O7GA 3DE8A 1ZHXA 4W8PA 2OOCA 3C8GD 4JTAB 2NUTA 1RKEA 4GYTA 4MW3A 4HE8D 5KYUA 3RKOF 2XM0A 2J0XA 4G7HF 2A0UA 2HFIA 2OG2A 2XLHA 4E0HA 1JPNA 1T5OA 3KL4A 1W2WA 3V5YA 1OQCA 3T4RA 1LVKA 5A6BA 4JC7A 5IY5C 5GPGB 4ONSA 2YL3A 4JCHA 4Q7CA 1ZVZA 4R32A 3HTKC 3K1HA 5D91A 4E17A 4WGZA 5KYWB 3ABLC 1TWCA 2RD9A 1I4ZA 3JRTA 2R7UA 1S7ZA 3QMKA 2A6HF 3ATPA 1VYKA 2P6VA 3EHNA 4NCQA 1YDIA 2A1DD 4DOZA 2WZGA 4XEFA 2OEXA 2ZXRA 4LDQA 1ORYA 1T6QA 2NSFA 3DKAA 3NMIA 4P9TA 4YK5A 1PCXA 3BRJA 1DOWA 3R7CA 5DS4A 2ZXOA 5A6KA 3VRCA 1K04A 1RKCA 1OR3A 1TWHA 1M2OA 2EIMC 2YHSA 1RMVA 4N6CA 5BQIA 2EPKX 1U6HA 2LP4A 4EWCA 4CSAC 3WODF 2G3KA 5KYNA 1CGNA 2KNHA 1BZ4A 3W2WA 3U9JA 2KK1A 4NTFA 5B3SC 5CIVA 2AWYA 3AG4C 4JTDB 3Q6MA 2L6FA 1L3PA 3TQOA 3QW1A 2GAQA 4Q4ZF 1BR2A 3S29A 3KPHA 1VK5A 2GDCA 3FAJA 4U5GA 5L3VA 5DVWA 5T3TA 1WTYA 3HNIA 3L0IA 5B3IA 3IHUA 4MW8A 4YT8A 4A2NB 2CYDA 4CSAA 1M6TA 4U5BE 5COFA 1D0ZA 4BEJA 1TQGA 1YJGA 1VMAA 5KYYA 2CGEA 4DBQA 2QTVA 3EGDB 2W45A 4G0HA 4LLCA 1ST6A 4XWJA 1FTSA 4DRIB 2HV7A 3SNHA 3U2MA 2Q7RA 5L0DA 4K0DA 5L3QA 256BA 2HV6A 1Z5ZA 2E87A 1HMDA 2UUHA 3MLGA 3W8HA 1TWAA 2ZPAA 2C04A 4E18A 3OA1A 4U5DE 1YARO 4AE4B 3ITFA 5L0HA 4YL1A 4AK9A 4HEAJ 5BQGA 3AG2C 4H4KC 1A41A 4CJGA 2VASA 1QLEC 4DVYP 1T9KA 1TR2A 4XEVA 3U9MA 4PACA 2R7XA 3W8IA 4JJGA 1NU7D 1EKYA 2PF4E 1I4YA 3ASOC 4CJOA 2D4UA 1Q0FA 5TJ5E 3RVYA 2R7OA 1VLSA 1ZU4A 5JRAA 4PR9A 3B71A 3QVZA 4CDVA 2XL8A 2HMQA 1M2VB 4Z9HA 4NTBA 4E0IA 3EGXA 2WZFA 4U9DA 1LS4A 2UUIA 5F5HA 3ZG1A 4AL1A 3H2UA 3O39A 3MYIA 4PJMA 1E83A 1VYIA 2J0WA 1TWGA 3LNRA 1TKNA 2YEVA 3EFOB 3M4CA 1C17M 1OCOC 4QDLA 4ULWA 3K33A 4MVUA 3ECSA 4OIOF 2Y69C 4IB4A 4C3DA 2R03A 1YYJA 1ZW3A 1H9TA 2V26A 2AVKA 3A11A 2NUTB 1RKEB 3T6BA 3ZIBA 2LSEA 3DMDA 5DQTA 4DBRA 2O9XA 5KYUB 4NY3A 1HW1A 1SZIA 4KNWA 1U0BB 4JZAA 2EIJC 1GGQA 4J30B 4MTGA 1A0BA 4Z9IA 3SZRA 1Q0MA 3B0PA 3U5SA 2YQYA 3UMIA 2EPMX 2ZD9A 3DAFA 5HSWA 2W4BA 3TD7A 1HW2A 3SXYA 2GFHA 1V55C 2R25A 3C8GA 3QVYA 3S84A 4JTCB 3F46A 5L0JA 2XSEA 3VAYA 4ER9A 1OCRC 1AEPA 1A7DA 2EPOA 1EA8A 3W4YA 3IPMO 2H7VC 5L0GA 4IGGA 3MBGA 1D0YA 1JMWA 4U5CE 1ORSC 4N06A 1OXBA 3Q7LA 5EGYA 3NG1A 2WL8A 1LI5A 2TMVP 3UR3C 1CPRA 2XLEA 3L34A 3OWTA 4Z9JA 2ZXPA 4XPWA 4CIPA 4CBEA 2XLVA 2Q9CA 4IJJA 2B0JA 2J45A 1M57C 1WGWA 1YAUO 2P7VA 2XLMA 4XQ1A 3RQEA 4CS9C 3S90A 2XLOA 5FCLA 3ABMC 4LDRA 3UNGC 3L8IA 5T1DB 1NFOA 2M4EA 2R02A 2WZLA 3N24A 4HFFB 1T6IA 1XWJA 1Q0DA 3T6GB 1MMNA 5JVEA 4JRZA 2PFDA 3J06A 3KH2A 3IQ5A 4HFKB 3JRMO 4MNDA 2WVQA 5F5FA 4C3BA 4EHPA 2I8BA 3GEEA 3RF3A 1WOLA 4BEMJ 1MMAA 3H2VA 3HNLA 4XEKA 3US6A 2HJ3A 1UFBA 3EH1A 4BJ6A 2CW0F 1ORJA 3DWWA 4EIYA 4KI2A 4EUKB 3U3BA 3KKBA 4CS9A 3V7OA 3MYFA 2LQGA 3N2ZB 1AVOB 5KYYB 1PD1A 4YL0A 2PBEA 3EQLF 2ETSA 2OCCC 3LLIA 3RQFA 2HZ8A 3AOUA 3I5PA 3DAGA 2J46A 1NFNA 3ZSUA 4C3EA 4CS7A 3NYMA 4XLNF 4OD5A 3O55A 1D0XA 2YWAA 3KMIA 4FWVA 1WWPA 2YLGA 3JCUQ 3V5ZA 3W2VA 5DS6A 1O5HA 5AGFA 5E33A 1EQ1A 3DM5A 2CNWD 2R9RB 2FGYA 3JT1A 3B29A 3GANA 3LEVA 3I5QA 4WJ0A 2L81A 2VB6A 3T9OA 2DI3A 4RDAA 1YA7O 1LM3B 3GWLA 4ZLDA 1NU9C 3NMJA 4G7OF 1DOVA 1C03A 2OQMA 5COGA 5L0FA 2CCYA 1O87A 1Q0GA 1E86A 3LJBA 4IRUA 2G62A 1R5ID 2R7RA 4W8KA 3RYLA 4BPMA 2FAPB 3EGXB 3C63A 1VB5A 1CGOA 2LCHA 3PCVA 5DS5A 1F1MA 1ZU5A 2J9BA 3GM3A 2WVOA 3QW0A 4U5EE 4WGYA 5T3WA 2EILC 4EBBA 3T6JA 3TULA 3GM1A 4D4NA 4YL3A 4DVZA 4G78A 1H7IA 4MVSA 2GA0A 2PX3A 4I1OB 1Q0KA 1ZHYA 2RSEB 2VCBA 3LAYA 3POVA 1S05A 3AJMA 4NQFA 2VCAA 4JKVA 1Z3IX 1V74B 4JIOA 1WATA 2HSQA 3OEOA 4UDVA 3AQBA 1VOMA 3TOMA 4DJ9A 2JX0A 3FOOA 1YYXA 4OD4A 3C8ZA 2NUPA 1FMWA 2HMZA 5DQZA 4CDYA 1HE9A 3EPVA 2ICWG 3M79A 3DE9A 3VM6A 1QVXA 4QI2A 3B0VC 5D92A 5JUAA 2R7QA 1GQAA 2IM8A 2VCCA 3C8GB 2R05A 3SP1A 2LFFA 3SXKA 3NMKA 2X0CA 3U0CA 1MQVA 2W9YA 5B1BC 3I4UA 2H7OA 4QI0A 2XRHA 1LIHA 1NZEA 4KNVA 4LLEA 4DRHB 3V5XA 2KSFA 3WHNA 1YZCA 2YVKA 2XL4A 3CQZA 3HNJA 3NKDA 4MTFA 2EPLX 1A7VA 1OKKD 1TFKB 1ZHWA 3LUTB 3CZ6A 1SF8A 3S28A 4U5FE 2XLWA 3QTHA 2JPUA 1Z7Qc 2D5RB 2Z15A 5E3AA 5JS5A 4BJ1A 3NYJA 2HJMA 1E85A 4O6NA 3TOLA 1D1BA 2LIGA 1JRAA 4E7SA 2IYLD 3CAXA 3EG9A 5KYXA 1D1CA 1LE4A 3FMSA 5EHHA 1ZW2A 3ABKC 3IQTA 4PJLA 2QE9A 2IOQA 4YT2A 1APCA 2OU6A 3DJNB 4IARA 3FXHA 1NG1A 5B1AC 3WG7C 4EKWA 3FOPA 5A6AA 3IEEA 1K05A 4M63A 2A6EF 1ZZPA 2MHRA 2C03A 4BG0A 5A6JA 4MVOA 3ASNC 4OIPF 4BJTA 3GORA 5L0CA 1KNYA 1GS9A 3K7DA 2M64A 3GWNA 3LNMB 1LPEA 3AG3C 3KYIA 4DXWA 4JW1A 2KJGA 3FAPB 1FFHA 1YLMA 3LEOA 4NTAA 2J8WA 1MNDA 1G8XA 3ZVRA 2HSBA 2DGJA 1PV3A 1QPUA 1Z6AA 4JEAA 3NRHA 2XS1A 2G3VA 4BJ5C 1RJ9A 2PX0A 4MS2A 3U8VA 3Q6NA 4U9EA 2YL7A 2XXAA 4F4BA 4BJ6C 3A9CA 2XL6A 3PMRA 1QZXA 3AG1C 3HKKA 3PHF2 2KW3C 2YL1A 5A69A 1H6GA 4CDAA 2DYRC 4JCZA 1YA9A 1JAFA 4I1MA 1KU2A 1OW6A 5BQHA 1U89A 3AGTA 3X1OA 1MMGA 1G5ZA 4AX2A 1GM5A 3FVYA 2Y3BA 3SXMA 1BR1A 3DM9B 2J7PD 3DZAA 4OINF 3JYHA 3QZCA 2IXNA 3M1CB 4JURI 4E7ZA 3JTLO 4K7BA 5JT4A 2H7BA 3G50A 3ZQVA 3TK0A 4BJ5A 2ZXWC 4CS8C 4ZLCA 4O6YA 4GEHA 4J7TA 4KC9A 4C7OA 2CNWA 3ZQYA 3SXZA 1C02A 1MNEA 2A69F 5CI8A 1T6UA 1I5NA 4JJFA 3UMKA 1CPQA 2YLIA 2P61A 3VYWA 2VH3A 2LFDA 2NSGA 3E70C 3JYYA 1E84A 1FNTc 2XLDA 4NC3A 1OXKA 2LD6A 5F28E 3EZHA 1D1AA 1M56C 4PJNA 2VC9A 5AC5A 4XLPF 3N0TA 2KC3A 1SYQA 5JP7A 4N6HA 2IXPA 2L6GA 1PD0A 2Y3HA 4YN0B 2L7AA 2OJED 2QUPA 1KTMA 4CS8A 1HE1A 5HV9A 3C18A 1J8YF 3EH2A 2P0NA 3ZTMA 1G4WR 3DD7A 1LE2A 1ZHTA 2FFHA 2YLDA 3FHDA 2L9JA 2NUPB 3JZ0A 5FZTA 1IW7F 3EJNA 3ZTZA 4DRJB 2R7VA 1A7EA 2V3CC 1JPJA 1Y4CA 5JLIA 1H9GA 4XPXA 2Y3GA 4RD9A 4H54A 2YKZA 1RXQA 2AP3A 4OIQF 3NYLA 3EZIA 2EIKC 2W4MA 3RFYA 3S27A 2IXOA 2L6HA 2HUJA 4EBKA 2Q9AA 5A6BD 1LI7A 2WB7A 3RW0A 3RIPA 4PFPA 5DLJA 1Z63A 2HS5A 3UGOA 1B68A 3H65A 1FMVA 3L8JA 2BL2A 1QSPA 4Q5SF 4D4XA 2MYSA 1RCPA 1NLXA 1EI7A 3M15A 3L1MA 1V4AA 2Q3TA 4P6IC 4CX9A 1NSGB 1Y6DA 4KBLA
chains in the Genus database with same CATH topology
1ORJA 3IQCA 1SZIA 1ORYA 3K1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORJ A;  3IQC A;  1SZI A;  1ORY A;  3K1I A; 
#chains in the Genus database with same CATH topology
 2P1A A;  3LS1 A;  3M4B A;  1HMO A;  2A0B A;  2QNL A;  2Y39 A;  1SMY F;  2MWQ A;  4FES A;  4X0R A;  3JSZ A;  1T01 A;  3LLK A;  3MFN A;  3EG9 B;  4EBJ A;  1R4T A;  4CIH A;  5KYX B;  3G4Z A;  5KYW A;  4O6M A;  3B0U X;  3X2Q C;  2HKV A;  3CEX A;  1OKK A;  1XZP A;  4MVM A;  4XTK A;  4GQH A;  1QKR A;  1BDJ B;  3K1I C;  2LK4 A;  4G7Z F;  2GWW A;  4JVS A;  2WVN A;  4ANJ A;  1HY5 A;  2Q9B A;  4JE9 A;  3G4X A;  1J8M F;  2KYH A;  1Z23 A;  1L7C A;  1N1C A;  2A68 F;  2EIN C;  2YL0 A;  1OR2 A;  3K66 A;  3MX3 A;  4AL0 A;  1YVI A;  2YZS A;  3FDQ A;  1UG7 A;  2JD3 A;  1G4U S;  3IQ6 A;  2NG1 A;  5E3C A;  2XM4 A;  3HNK A;  3GEI A;  4FAP B;  2OJQ A;  4MVQ A;  2PP4 A;  4YJW A;  1CGM E;  3DI5 A;  1QQ3 A;  2QLA A;  2CDQ A;  2DYS C;  2X51 A;  3AQC A;  3GM2 A;  3NDB B;  1XZQ A;  1RJ9 B;  4ULV A;  3UMH A;  2J9V A;  2OEV A;  4LAC B;  3E9V A;  2XXA B;  3K1I A;  5E2Q A;  3RQG A;  4U5H A;  2B0H A;  2J9W A;  3VF0 A;  1YZA A;  3CSK A;  5AC4 A;  3C7J A;  1LKX A;  1FAP B;  1LS1 A;  1SR2 A;  3KYJ A;  2KGO A;  2Y3D A;  4O79 A;  3DJU B;  3S9O A;  3S0X A;  2R7S A;  2YRF A;  1V54 C;  2QY9 A;  4L6R A;  1NBB A;  2R7W A;  5EK0 A;  4I3M A;  3PDM P;  2IBF A;  4MTO A;  4I44 A;  3IQC A;  5COM A;  1JOG A;  4YWQ A;  4J7Y A;  3U2L A;  4IAO A;  3EGD A;  4JEB A;  1BR4 A;  4OIR F;  3R2P A;  3RH3 A;  3ZC4 A;  3AGU A;  4C7O B;  4XPY A;  2I15 A;  3F47 A;  4P9F A;  1MMD A;  5CI9 A;  3HJC A;  3SEO A;  3ZDL A;  2BC5 A;  3U3F A;  1OCC C;  2J7P A;  2KQ9 A;  4MVR A;  4RBN A;  3ZWI A;  2BE5 F;  3Q7G A;  3LES A;  2Q00 A;  4AE4 A;  3HLZ A;  2AWC A;  1FFT C;  5BUO A;  2EPN A;  4J32 B;  2PNO A;  2F22 A;  1TFO B;  4IWB A;  4YT4 A;  1ZHZ A;  5JSL A;  4YT5 A;  3TJ6 A;  2H8A A;  2DB4 A;  3O6X A;  3GOD A;  2AU5 A;  1K40 A;  3B9Q A;  1VLT A;  3K6B A;  1IZM A;  3LS0 A;  4PJJ A;  1OW8 A;  3DXJ F;  4MVZ A;  2XS8 A;  1OW7 A;  1VTM P;  2Q4F A;  2NPU A;  5L0I A;  1WN0 A;  3SYN A;  3EHM A;  3BEH A;  4PK4 A;  4B6I A;  3RVZ A;  2ASR A;  2J9U A;  4K1O A;  2IXM A;  4LER A;  1M2V A;  1OCZ C;  1AUE A;  3TJ5 A;  3UGP A;  4PFO A;  3JSE O;  1FR0 A;  3GEH A;  4IAQ A;  3U8P A;  2OKU A;  1JR8 A;  4A4A A;  3EFO A;  3O10 A;  4N4W A;  4MQ9 F;  1ZYR F;  1WAS A;  1O3U A;  3NKE A;  1BBH A;  4WAB A;  2R7T A;  4LDK A;  1E2X A;  3WAQ A;  3C62 A;  4FX5 A;  5K0I A;  4O7G A;  3DE8 A;  1ZHX A;  4W8P A;  2OOC A;  3C8G D;  4JTA B;  2NUT A;  1RKE A;  4GYT A;  4MW3 A;  4HE8 D;  5KYU A;  3RKO F;  2XM0 A;  2J0X A;  4G7H F;  2A0U A;  2HFI A;  2OG2 A;  2XLH A;  4E0H A;  1JPN A;  1T5O A;  3KL4 A;  1W2W A;  3V5Y A;  1OQC A;  3T4R A;  1LVK A;  5A6B A;  4JC7 A;  5IY5 C;  5GPG B;  4ONS A;  2YL3 A;  4JCH A;  4Q7C A;  1ZVZ A;  4R32 A;  3HTK C;  3K1H A;  5D91 A;  4E17 A;  4WGZ A;  5KYW B;  3ABL C;  1TWC A;  2RD9 A;  1I4Z A;  3JRT A;  2R7U A;  1S7Z A;  3QMK A;  2A6H F;  3ATP A;  1VYK A;  2P6V A;  3EHN A;  4NCQ A;  1YDI A;  2A1D D;  4DOZ A;  2WZG A;  4XEF A;  2OEX A;  2ZXR A;  4LDQ A;  1ORY A;  1T6Q A;  2NSF A;  3DKA A;  3NMI A;  4P9T A;  4YK5 A;  1PCX A;  3BRJ A;  1DOW A;  3R7C A;  5DS4 A;  2ZXO A;  5A6K A;  3VRC A;  1K04 A;  1RKC A;  1OR3 A;  1TWH A;  1M2O A;  2EIM C;  2YHS A;  1RMV A;  4N6C A;  5BQI A;  2EPK X;  1U6H A;  2LP4 A;  4EWC A;  4CSA C;  3WOD F;  2G3K A;  5KYN A;  1CGN A;  2KNH A;  1BZ4 A;  3W2W A;  3U9J A;  2KK1 A;  4NTF A;  5B3S C;  5CIV A;  2AWY A;  3AG4 C;  4JTD B;  3Q6M A;  2L6F A;  1L3P A;  3TQO A;  3QW1 A;  2GAQ A;  4Q4Z F;  1BR2 A;  3S29 A;  3KPH A;  1VK5 A;  2GDC A;  3FAJ A;  4U5G A;  5L3V A;  5DVW A;  5T3T A;  1WTY A;  3HNI A;  3L0I A;  5B3I A;  3IHU A;  4MW8 A;  4YT8 A;  4A2N B;  2CYD A;  4CSA A;  1M6T A;  4U5B E;  5COF A;  1D0Z A;  4BEJ A;  1TQG A;  1YJG A;  1VMA A;  5KYY A;  2CGE A;  4DBQ A;  2QTV A;  3EGD B;  2W45 A;  4G0H A;  4LLC A;  1ST6 A;  4XWJ A;  1FTS A;  4DRI B;  2HV7 A;  3SNH A;  3U2M A;  2Q7R A;  5L0D A;  4K0D A;  5L3Q A;  256B A;  2HV6 A;  1Z5Z A;  2E87 A;  1HMD A;  2UUH A;  3MLG A;  3W8H A;  1TWA A;  2ZPA A;  2C04 A;  4E18 A;  3OA1 A;  4U5D E;  1YAR O;  4AE4 B;  3ITF A;  5L0H A;  4YL1 A;  4AK9 A;  4HEA J;  5BQG A;  3AG2 C;  4H4K C;  1A41 A;  4CJG A;  2VAS A;  1QLE C;  4DVY P;  1T9K A;  1TR2 A;  4XEV A;  3U9M A;  4PAC A;  2R7X A;  3W8I A;  4JJG A;  1NU7 D;  1EKY A;  2PF4 E;  1I4Y A;  3ASO C;  4CJO A;  2D4U A;  1Q0F A;  5TJ5 E;  3RVY A;  2R7O A;  1VLS A;  1ZU4 A;  5JRA A;  4PR9 A;  3B71 A;  3QVZ A;  4CDV A;  2XL8 A;  2HMQ A;  1M2V B;  4Z9H A;  4NTB A;  4E0I A;  3EGX A;  2WZF A;  4U9D A;  1LS4 A;  2UUI A;  5F5H A;  3ZG1 A;  4AL1 A;  3H2U A;  3O39 A;  3MYI A;  4PJM A;  1E83 A;  1VYI A;  2J0W A;  1TWG A;  3LNR A;  1TKN A;  2YEV A;  3EFO B;  3M4C A;  1C17 M;  1OCO C;  4QDL A;  4ULW A;  3K33 A;  4MVU A;  3ECS A;  4OIO F;  2Y69 C;  4IB4 A;  4C3D A;  2R03 A;  1YYJ A;  1ZW3 A;  1H9T A;  2V26 A;  2AVK A;  3A11 A;  2NUT B;  1RKE B;  3T6B A;  3ZIB A;  2LSE A;  3DMD A;  5DQT A;  4DBR A;  2O9X A;  5KYU B;  4NY3 A;  1HW1 A;  1SZI A;  4KNW A;  1U0B B;  4JZA A;  2EIJ C;  1GGQ A;  4J30 B;  4MTG A;  1A0B A;  4Z9I A;  3SZR A;  1Q0M A;  3B0P A;  3U5S A;  2YQY A;  3UMI A;  2EPM X;  2ZD9 A;  3DAF A;  5HSW A;  2W4B A;  3TD7 A;  1HW2 A;  3SXY A;  2GFH A;  1V55 C;  2R25 A;  3C8G A;  3QVY A;  3S84 A;  4JTC B;  3F46 A;  5L0J A;  2XSE A;  3VAY A;  4ER9 A;  1OCR C;  1AEP A;  1A7D A;  2EPO A;  1EA8 A;  3W4Y A;  3IPM O;  2H7V C;  5L0G A;  4IGG A;  3MBG A;  1D0Y A;  1JMW A;  4U5C E;  1ORS C;  4N06 A;  1OXB A;  3Q7L A;  5EGY A;  3NG1 A;  2WL8 A;  1LI5 A;  2TMV P;  3UR3 C;  1CPR A;  2XLE A;  3L34 A;  3OWT A;  4Z9J A;  2ZXP A;  4XPW A;  4CIP A;  4CBE A;  2XLV A;  2Q9C A;  4IJJ A;  2B0J A;  2J45 A;  1M57 C;  1WGW A;  1YAU O;  2P7V A;  2XLM A;  4XQ1 A;  3RQE A;  4CS9 C;  3S90 A;  2XLO A;  5FCL A;  3ABM C;  4LDR A;  3UNG C;  3L8I A;  5T1D B;  1NFO A;  2M4E A;  2R02 A;  2WZL A;  3N24 A;  4HFF B;  1T6I A;  1XWJ A;  1Q0D A;  3T6G B;  1MMN A;  5JVE A;  4JRZ A;  2PFD A;  3J06 A;  3KH2 A;  3IQ5 A;  4HFK B;  3JRM O;  4MND A;  2WVQ A;  5F5F A;  4C3B A;  4EHP A;  2I8B A;  3GEE A;  3RF3 A;  1WOL A;  4BEM J;  1MMA A;  3H2V A;  3HNL A;  4XEK A;  3US6 A;  2HJ3 A;  1UFB A;  3EH1 A;  4BJ6 A;  2CW0 F;  1ORJ A;  3DWW A;  4EIY A;  4KI2 A;  4EUK B;  3U3B A;  3KKB A;  4CS9 A;  3V7O A;  3MYF A;  2LQG A;  3N2Z B;  1AVO B;  5KYY B;  1PD1 A;  4YL0 A;  2PBE A;  3EQL F;  2ETS A;  2OCC C;  3LLI A;  3RQF A;  2HZ8 A;  3AOU A;  3I5P A;  3DAG A;  2J46 A;  1NFN A;  3ZSU A;  4C3E A;  4CS7 A;  3NYM A;  4XLN F;  4OD5 A;  3O55 A;  1D0X A;  2YWA A;  3KMI A;  4FWV A;  1WWP A;  2YLG A;  3JCU Q;  3V5Z A;  3W2V A;  5DS6 A;  1O5H A;  5AGF A;  5E33 A;  1EQ1 A;  3DM5 A;  2CNW D;  2R9R B;  2FGY A;  3JT1 A;  3B29 A;  3GAN A;  3LEV A;  3I5Q A;  4WJ0 A;  2L81 A;  2VB6 A;  3T9O A;  2DI3 A;  4RDA A;  1YA7 O;  1LM3 B;  3GWL A;  4ZLD A;  1NU9 C;  3NMJ A;  4G7O F;  1DOV A;  1C03 A;  2OQM A;  5COG A;  5L0F A;  2CCY A;  1O87 A;  1Q0G A;  1E86 A;  3LJB A;  4IRU A;  2G62 A;  1R5I D;  2R7R A;  4W8K A;  3RYL A;  4BPM A;  2FAP B;  3EGX B;  3C63 A;  1VB5 A;  1CGO A;  2LCH A;  3PCV A;  5DS5 A;  1F1M A;  1ZU5 A;  2J9B A;  3GM3 A;  2WVO A;  3QW0 A;  4U5E E;  4WGY A;  5T3W A;  2EIL C;  4EBB A;  3T6J A;  3TUL A;  3GM1 A;  4D4N A;  4YL3 A;  4DVZ A;  4G78 A;  1H7I A;  4MVS A;  2GA0 A;  2PX3 A;  4I1O B;  1Q0K A;  1ZHY A;  2RSE B;  2VCB A;  3LAY A;  3POV A;  1S05 A;  3AJM A;  4NQF A;  2VCA A;  4JKV A;  1Z3I X;  1V74 B;  4JIO A;  1WAT A;  2HSQ A;  3OEO A;  4UDV A;  3AQB A;  1VOM A;  3TOM A;  4DJ9 A;  2JX0 A;  3FOO A;  1YYX A;  4OD4 A;  3C8Z A;  2NUP A;  1FMW A;  2HMZ A;  5DQZ A;  4CDY A;  1HE9 A;  3EPV A;  2ICW G;  3M79 A;  3DE9 A;  3VM6 A;  1QVX A;  4QI2 A;  3B0V C;  5D92 A;  5JUA A;  2R7Q A;  1GQA A;  2IM8 A;  2VCC A;  3C8G B;  2R05 A;  3SP1 A;  2LFF A;  3SXK A;  3NMK A;  2X0C A;  3U0C A;  1MQV A;  2W9Y A;  5B1B C;  3I4U A;  2H7O A;  4QI0 A;  2XRH A;  1LIH A;  1NZE A;  4KNV A;  4LLE A;  4DRH B;  3V5X A;  2KSF A;  3WHN A;  1YZC A;  2YVK A;  2XL4 A;  3CQZ A;  3HNJ A;  3NKD A;  4MTF A;  2EPL X;  1A7V A;  1OKK D;  1TFK B;  1ZHW A;  3LUT B;  3CZ6 A;  1SF8 A;  3S28 A;  4U5F E;  2XLW A;  3QTH A;  2JPU A;  1Z7Q c;  2D5R B;  2Z15 A;  5E3A A;  5JS5 A;  4BJ1 A;  3NYJ A;  2HJM A;  1E85 A;  4O6N A;  3TOL A;  1D1B A;  2LIG A;  1JRA A;  4E7S A;  2IYL D;  3CAX A;  3EG9 A;  5KYX A;  1D1C A;  1LE4 A;  3FMS A;  5EHH A;  1ZW2 A;  3ABK C;  3IQT A;  4PJL A;  2QE9 A;  2IOQ A;  4YT2 A;  1APC A;  2OU6 A;  3DJN B;  4IAR A;  3FXH A;  1NG1 A;  5B1A C;  3WG7 C;  4EKW A;  3FOP A;  5A6A A;  3IEE A;  1K05 A;  4M63 A;  2A6E F;  1ZZP A;  2MHR A;  2C03 A;  4BG0 A;  5A6J A;  4MVO A;  3ASN C;  4OIP F;  4BJT A;  3GOR A;  5L0C A;  1KNY A;  1GS9 A;  3K7D A;  2M64 A;  3GWN A;  3LNM B;  1LPE A;  3AG3 C;  3KYI A;  4DXW A;  4JW1 A;  2KJG A;  3FAP B;  1FFH A;  1YLM A;  3LEO A;  4NTA A;  2J8W A;  1MND A;  1G8X A;  3ZVR A;  2HSB A;  2DGJ A;  1PV3 A;  1QPU A;  1Z6A A;  4JEA A;  3NRH A;  2XS1 A;  2G3V A;  4BJ5 C;  1RJ9 A;  2PX0 A;  4MS2 A;  3U8V A;  3Q6N A;  4U9E A;  2YL7 A;  2XXA A;  4F4B A;  4BJ6 C;  3A9C A;  2XL6 A;  3PMR A;  1QZX A;  3AG1 C;  3HKK A;  3PHF 2;  2KW3 C;  2YL1 A;  5A69 A;  1H6G A;  4CDA A;  2DYR C;  4JCZ A;  1YA9 A;  1JAF A;  4I1M A;  1KU2 A;  1OW6 A;  5BQH A;  1U89 A;  3AGT A;  3X1O A;  1MMG A;  1G5Z A;  4AX2 A;  1GM5 A;  3FVY A;  2Y3B A;  3SXM A;  1BR1 A;  3DM9 B;  2J7P D;  3DZA A;  4OIN F;  3JYH A;  3QZC A;  2IXN A;  3M1C B;  4JUR I;  4E7Z A;  3JTL O;  4K7B A;  5JT4 A;  2H7B A;  3G50 A;  3ZQV A;  3TK0 A;  4BJ5 A;  2ZXW C;  4CS8 C;  4ZLC A;  4O6Y A;  4GEH A;  4J7T A;  4KC9 A;  4C7O A;  2CNW A;  3ZQY A;  3SXZ A;  1C02 A;  1MNE A;  2A69 F;  5CI8 A;  1T6U A;  1I5N A;  4JJF A;  3UMK A;  1CPQ A;  2YLI A;  2P61 A;  3VYW A;  2VH3 A;  2LFD A;  2NSG A;  3E70 C;  3JYY A;  1E84 A;  1FNT c;  2XLD A;  4NC3 A;  1OXK A;  2LD6 A;  5F28 E;  3EZH A;  1D1A A;  1M56 C;  4PJN A;  2VC9 A;  5AC5 A;  4XLP F;  3N0T A;  2KC3 A;  1SYQ A;  5JP7 A;  4N6H A;  2IXP A;  2L6G A;  1PD0 A;  2Y3H A;  4YN0 B;  2L7A A;  2OJE D;  2QUP A;  1KTM A;  4CS8 A;  1HE1 A;  5HV9 A;  3C18 A;  1J8Y F;  3EH2 A;  2P0N A;  3ZTM A;  1G4W R;  3DD7 A;  1LE2 A;  1ZHT A;  2FFH A;  2YLD A;  3FHD A;  2L9J A;  2NUP B;  3JZ0 A;  5FZT A;  1IW7 F;  3EJN A;  3ZTZ A;  4DRJ B;  2R7V A;  1A7E A;  2V3C C;  1JPJ A;  1Y4C A;  5JLI A;  1H9G A;  4XPX A;  2Y3G A;  4RD9 A;  4H54 A;  2YKZ A;  1RXQ A;  2AP3 A;  4OIQ F;  3NYL A;  3EZI A;  2EIK C;  2W4M A;  3RFY A;  3S27 A;  2IXO A;  2L6H A;  2HUJ A;  4EBK A;  2Q9A A;  5A6B D;  1LI7 A;  2WB7 A;  3RW0 A;  3RIP A;  4PFP A;  5DLJ A;  1Z63 A;  2HS5 A;  3UGO A;  1B68 A;  3H65 A;  1FMV A;  3L8J A;  2BL2 A;  1QSP A;  4Q5S F;  4D4X A;  2MYS A;  1RCP A;  1NLX A;  1EI7 A;  3M15 A;  3L1M A;  1V4A A;  2Q3T A;  4P6I C;  4CX9 A;  1NSG B;  1Y6D A;  4KBL A; 
#chains in the Genus database with same CATH homology
 1ORJ A;  3IQC A;  1SZI A;  1ORY A;  3K1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...