3IQCA

Crystal structure of flis from h. pylori
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
119
Chain Sequence
YANAYQAYQHESPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
molecule keywords Flagellar protein
total genus 47
structure length 119
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3iqcA00
3K1IA 1ORJA 3IQCA 1ORYA 1SZIA
chains in the Genus database with same CATH superfamily
1D1CA 1ZU5A 3UMIA 1XWJA 1KU2A 1YYJA 4U5CE 5COMA 3LLIA 1SZIA 1QZXA 4JKVA 1QVXA 1ZHTA 3AOUA 2YL1A 4QDLA 2QLAA 4JZAA 3DMDA 1OXBA 2PF4E 1WGWA 2QUPA 1LI7A 3IQ6A 3LJBA 4MVSA 2VCCA 1NU7D 1OW8A 4JJFA 4WGZA 2UUIA 3SZRA 3N2ZB 3UNGC 4E17A 5L0JA 3HNIA 1VLTA 4P6IC 3HTKC 2HJMA 3RQEA 4MQ9F 1H9TA 4JEAA 3QW1A 1D0ZA 3K1HA 2H7OA 2WVQA 4MW8A 2LP4A 2J7PD 3EZHA 1ZHXA 1BR2A 2LSEA 2TMVP 4DOZA 2ZXPA 2YKZA 1VB5A 3N24A 3K6BA 1KNYA 1D0XA 1CPRA 2EPMX 4PK4A 5AGFA 2XLMA 1H7IA 2OEXA 2ZPAA 3O39A 5GPGB 4CJGA 4ZLCA 2ICWG 1LVKA 2XL4A 2DGJA 3S29A 1Q0FA 4DVYP 3LAYA 3NKDA 4EBKA 3NRHA 3GANA 1Z23A 4AL1A 4DRIB 2H7VC 5L0FA 1FMWA 2Q00A 3MYFA 3H2VA 2WZGA 4MVOA 5JUAA 1XZPA 4K7BA 1QPUA 3ZWIA 2J9BA 3EFOA 4N6HA 4NCQA 4XQ1A 3EQLF 3EGDB 3EH1A 1FMVA 5KYUA 3T6BA 1G4WR 3PDMP 3FHDA 2GWWA 2YZSA 3ABLC 3GM2A 3HJCA 3I5PA 1BR4A 4OIRF 4GYTA 1BDJB 2IXMA 1XZQA 4BJ5A 4XPXA 5COGA 5B1BC 2Y3GA 4OD4A 1NFOA 3EJNA 4YJWA 3EG9A 2J8WA 3ABKC 3SYNA 1LE4A 3JSZA 4G0HA 4E7ZA 2L9JA 4U5BE 2AVKA 5JVEA 1HW2A 1MMAA 3Q7LA 3ZQYA 4MVUA 5K0IA 5T1DB 3L8JA 5KYYB 1T6UA 2R9RB 2A0UA 2Q4FA 3IQCA 4JC7A 3S28A 2YLIA 4MTGA 3FAJA 2P61A 3BRJA 4EHPA 2EILC 4DBRA 4WJ0A 2DYSC 3L34A 2JPUA 4LDQA 1I5NA 4B6IA 4RD9A 4I44A 4YL1A 1VTMP 1AUEA 3DE9A 1WATA 2J9WA 4FESA 4JCZA 2XRHA 1S7ZA 4Z9JA 1OW6A 2D5RB 4AL0A 1IZMA 1WWPA 3GWLA 2GFHA 4PACA 1ORSC 4BJ6A 2R7XA 4U5EE 3AJMA 2CNWA 1OQCA 4J7YA 5AC5A 2J7PA 4NQFA 1K04A 1VK5A 3S0XA 1H6GA 3V5XA 1A7VA 1R4TA 2MWQA 4CS7A 4KC9A 4QI2A 1TWGA 2CYDA 3VYWA 2M4EA 4R32A 1QKRA 2O9XA 2KC3A 4CS9C 1RKCA 2LQGA 3KPHA 1WOLA 5JLIA 4K1OA 4MVQA 4FX5A 4N4WA 5KYNA 3HNKA 4YT4A 3TK0A 3AQBA 4CSAC 1MMGA 4O6NA 3AG4C 3S27A 5HV9A 1D1BA 2YEVA 3GEHA 1M56C 5TJ5E 1YAUO 4G7ZF 2PP4A 2Q9CA 1Q0KA 3JTLO 1J8YF 3C8ZA 4C3BA 2OQMA 3ZVRA 4D4NA 1ORJA 1M2VA 2EPNA 4LLEA 1MMNA 3UMKA 4JCHA 3NMKA 3G4XA 2XLHA 3MX3A 5D92A 1YZAA 3RQFA 1Y4CA 4QI0A 3C18A 4JJGA 3UMHA 5L3VA 3FAPB 1U0BB 1TWHA 3GEIA 3K7DA 3U9MA 2JX0A 4BPMA 3RYLA 3DAFA 3EGXB 1OCRC 1W2WA 2JD3A 2ZXRA 4PJNA 4YK5A 3TJ5A 2LIGA 1TWAA 4YT2A 1Z63A 2CGEA 3G50A 4LERA 3JT1A 5AC4A 2XLEA 4JTCB 3AGTA 1YJGA 4RDAA 2Z15A 2LFDA 1RJ9A 4PFOA 2YL7A 4AK9A 4DRJB 2YL3A 3NKEA 3TULA 3W2WA 3SP1A 4A4AA 5B3SC 5KYXB 3SXZA 1QLEC 3NYLA 1V74B 4XEFA 2WZLA 3HNJA 2HV7A 3QVZA 1M57C 4JVSA 4MS2A 4E7SA 2R7OA 1YA7O 2KQ9A 4YWQA 2L6GA 3BEHA 3C8GA 5D91A 1DOVA 2IBFA 1LPEA 2R7WA 1OCCC 1FTSA 1Y6DA 3O6XA 2I15A 1SYQA 3IQTA 1G8XA 4YL3A 3Q6NA 4HEAJ 4IGGA 4OINF 3ZTZA 4MTFA 1CGNA 2VB6A 3C7JA 2D4UA 5CI9A 4KNVA 4PJMA 4EIYA 5KYUB 3AG1C 1Q0GA 4W8KA 4L6RA 3ZIBA 3NYJA 4CDYA 2Q9AA 1FNTc 3AQCA 3AG3C 1A41A 2EIJC 5E33A 5DS4A 1D0YA 3K1IA 3C63A 2DYRC 5A6KA 1JRAA 5BQIA 1U6HA 5KYWA 3K1IC 3E9VA 2AP3A 5CI8A 1JPNA 1NZEA 2Y3DA 2YQYA 3CEXA 2RSEB 3LS1A 1YARO 1MQVA 4E0HA 2OKUA 4N6CA 1RKEB 2NUPB 3V5YA 2OEVA 1Q0DA 4AE4A 4I3MA 4CBEA 1J8MF 1VMAA 4HFKB 5F5FA 1VLSA 3GORA 1BR1A 1V54C 2Y3HA 2R7RA 1CPQA 4C3DA 2J9VA 3TOMA 4JW1A 5CIVA 3SNHA 2B0HA 1MNEA 1OR2A 5F5HA 3U5SA 4KI2A 3EHNA 3T9OA 3UGOA 2YLDA 5DS5A 4JEBA 5T3TA 1T9KA 3FOPA 1NG1A 4P9FA 3RKOF 1K05A 2G62A 2VCBA 3Q6MA 5IY5C 3FMSA 4PJLA 1WN0A 2XS8A 3CAXA 1PD1A 2AWYA 4HE8D 2IYLD 2HSQA 3WG7C 3A11A 1OR3A 3J06A 3UGPA 1OXKA 1O3UA 4IAQA 2VH3A 2YLGA 3GM3A 4I1OB 2CNWD 3GM1A 2A6EF 5A6AA 1PCXA 1HMDA 2LCHA 3C8GB 4NTBA 5DLJA 1EQ1A 1ZU4A 5L0DA 1HW1A 1I4YA 2KYHA 3U9JA 5L0IA 2NUTA 1JPJA 2HZ8A 4BEMJ 1M6TA 4DVZA 4H54A 2R7TA 1I4ZA 3EZIA 3FXHA 5DQZA 4H4KC 1IW7F 2XLOA 3EFOB 1LM3B 1BZ4A 2OU6A 2WVNA 4YT5A 4ONSA 3KMIA 3NYMA 2W45A 2P1AA 3M1CB 4JTAB 4YL0A 4MVMA 2ASRA 3TQOA 3US6A 1HY5A 1MMDA 2PX0A 1E85A 1SMYF 2QY9A 3KYJA 3DI5A 3H65A 2NG1A 1C02A 3DWWA 2XL6A 3DZAA 2VASA 2V26A 4ULWA 3EGXA 1FR0A 2L81A 3ASNC 1JR8A 4BEJA 1AVOB 4IWBA 1ST6A 3DKAA 3ZC4A 1NBBA 4YN0B 5FZTA 1YZCA 3TJ6A 3HKKA 3KL4A 4AE4B 4CX9A 3EG9B 1V55C 2HMZA 2VC9A 3FOOA 3JYHA 1T6QA 5E3AA 3KH2A 1T6IA 3U2LA 3WODF 3AGUA 2QTVA 3CSKA 2HSBA 5EHHA 4E18A 3L0IA 2HFIA 2XLWA 2I8BA 3C62A 4EUKB 4U9DA 1ZVZA 5L0HA 4X0RA 5B3IA 2J0WA 3HNLA 4U5DE 3RF3A 1ZW2A 3RQGA 1HE9A 1ZZPA 2P0NA 5A6BA 1Z5ZA 2KSFA 2Y69C 4XWJA 3EPVA 2HS5A 1AEPA 2KNHA 1JOGA 1K40A 1QSPA 2KW3C 2NSGA 3DM5A 3F47A 4IJJA 1GQAA 4RBNA 1C17M 3POVA 2MYSA 1RXQA 3JSEO 3CZ6A 3DE8A 1G4US 1PV3A 3C8GD 4LLCA 4E0IA 5DS6A 2KGOA 1ZHWA 3B29A 5JSLA 1WASA 2W4MA 3NG1A 4C7OA 1PD0A 2IOQA 5EGYA 4JE9A 2IXOA 1TFKB 3MBGA 4MNDA 1OCOC 2J0XA 1YVIA 2NPUA 2HJ3A 3DM9B 4KBLA 3RFYA 3W8HA 1U89A 4CJOA 2PBEA 5KYWB 4CIPA 3M4BA 2MHRA 3AG2C 3RIPA 3VF0A 5L3QA 4XLPF 2XS1A 2Y39A 2L7AA 2J45A 2OJED 4GQHA 1EA8A 3QMKA 1A0BA 3DD7A 2CCYA 3B0UX 4CSAA 1NU9C 2C04A 3JRMO 1VYKA 2DB4A 1E86A 2VCAA 4G7OF 3FVYA 2L6HA 2LFFA 3SXMA 1LS4A 3SXYA 2HKVA 4F4BA 3G4ZA 4N06A 1APCA 2R7UA 1NFNA 4DJ9A 2GAQA 3IEEA 4O6MA 5DQTA 4ER9A 1M2VB 2IXNA 4AX2A 3U3BA 3JRTA 4Q4ZF 1ZYRF 4G7HF 1C03A 3S9OA 2F22A 4LACB 5A69A 4LDKA 3GWNA 5F28E 1ZHZA 3O55A 1Z3IX 1FFTC 4CS8C 4IARA 4K0DA 3ZQVA 2PX3A 4IRUA 1KTMA 1OCZC 1JAFA 1L7CA 5BQGA 3V7OA 2OCCC 4CDVA 5B1AC 2FAPB 4OIPF 1VOMA 2X0CA 2XL8A 3TD7A 2XXAA 3W2VA 3T6JA 3IHUA 4JURI 3O10A 2NSFA 4CS8A 3M79A 1OW7A 2ZXWC 3SXKA 5BUOA 3EH2A 3Q7GA 1M2OA 2M64A 3I4UA 3U8VA 3QVYA 1SR2A 1TWCA 3ITFA 4XEVA 2UUHA 4Q5SF 3W4YA 3U0CA 4JTDB 2XSEA 2R25A 2WVOA 5BQHA 4CDAA 1OKKA 3PCVA 3QZCA 1WTYA 2WZFA 1ORYA 3OWTA 2G3KA 4Z9IA 3LS0A 3R7CA 2ZXOA 3EGDA 1E84A 4ULVA 4A2NB 2XLDA 2A0BA 2FFHA 4WABA 2A69F 1EI7A 3WHNA 1Z6AA 3ASOC 2E87A 1O5HA 2A1DD 4YT8A 4ZLDA 4OIOF 3L8IA 4Q7CA 3NDBB 1NLXA 3S90A 3E70C 2G3VA 2YWAA 4P9TA 2Q7RA 3V5ZA 2HMQA 5EK0A 2QNLA 4EWCA 1R5ID 2EIKC 4MTOA 4GEHA 3HLZA 3CQZA 2WB7A 3MYIA 1NSGB 1OKKD 4XEKA 3RVYA 1JMWA 1HMOA 2R03A 2YL0A 4PJJA 1YYXA 4U5HA 4J7TA 2J46A 5KYXA 2YRFA 1GM5A 1E83A 4NC3A 1L3PA 2LK4A 3I5QA 4MVZA 2ZD9A 1S05A 2OJQA 1YA9A 2EINC 2A6HF 4J32B 2ETSA 4PR9A 3RH3A 3RW0A 2IXPA 5JT4A 2P7VA 2XM0A 1DOWA 1EKYA 1N1CA 3KKBA 1CGME 1GS9A 1LE2A 4LDRA 3X1OA 1RJ9B 1T01A 3U3FA 4D4XA 4XLNF 3M4CA 1UFBA 2FGYA 2PNOA 3LEVA 4C3EA 4NTAA 1Q0MA 3JYYA 1FAPB 2GDCA 4WGYA 3X2QC 2QE9A 2J9UA 3N0TA 2OG2A 1T5OA 2X51A 3IPMO 4MW3A 4O7GA 5DVWA 1Z7Qc 3TOLA 4BG0A 3FDQA 3ZTMA 3R2PA 1YLMA 3ABMC 3JCUQ 1TQGA 1UG7A 4U5FE 2KJGA 2NUPA 3B71A 1BBHA 3SEOA 1A7DA 2Y3BA 4EBBA 4W8PA 3ZSUA 2BC5A 5T3WA 2CDQA 2L6FA 1LS1A 2YHSA 3GEEA 5JP7A 2RD9A 2C03A 3LNMB 5L0CA 3U2MA 2XLVA 1LI5A 3M15A 2CW0F 3B0PA 3RVZA 1TR2A 4HFFB 3MLGA 1V4AA 1YDIA 4KNWA 2R05A 4O79A 2Q3TA 256BA 2V3CC 4XTKA 3L1MA 2H8AA 3UR3C 2KK1A 3MFNA 2YVKA 2W9YA 5E2QA 1HE1A 1TFOB 1FFHA 2AU5A 2DI3A 4U5GA 3PHF2 3VM6A 3S84A 3K33A 1B68A 2PFDA 3GODA 3K66A 3NMIA 3PMRA 4FAPB 1GGQA 4NY3A 1RKEA 3WAQA 1SF8A 3LEOA 1VYIA 4I1MA 1E2XA 1A7EA 3KYIA 4BJ5C 4U9EA 2R7VA 3A9CA 3DJNB 2XXAB 3LUTB 4PFPA 2GA0A 3B0VC 1MNDA 4G78A 1D1AA 2P6VA 1CGOA 3DXJF 3ECSA 4OD5A 3W8IA 2LD6A 2XM4A 3B9QA 2EPOA 3VAYA 5KYYA 3T4RA 4MVRA 3ATPA 2HUJA 3DAGA 3OA1A 2A68F 3OEOA 3EHMA 4JIOA 2BE5F 4EKWA 3QTHA 5L0GA 2W4BA 1ZHYA 1TKNA 4IB4A 3F46A 3IQ5A 5HSWA 1LIHA 4C7OB 2AWCA 2R02A 2R7QA 3LESA 2H7BA 4IAOA 4EBJA 1H9GA 1RCPA 4XPWA 3T6GB 4UDVA 2IM8A 4Z9HA 5COFA 3NMJA 4XPYA 2Q9BA 2OOCA 3LLKA 4ANJA 4NTFA 3ZG1A 1F1MA 3U8PA 4DXWA 1G5ZA 4BJTA 4BJ1A 5JS5A 4BJ6C 4CIHA 2BL2A 3LNRA 4M63A 1QQ3A 2R7SA 3ZDLA 3JZ0A 3DJUB 4O6YA 1O87A 5JRAA 2B0JA 1ZW3A 1RMVA 2EPKX 2EPLX 5A6BD 3H2UA 4JRZA 2EIMC 4DRHB 2HV6A 4FWVA 5A6JA 3VRCA 3QW0A 4OIQF 4CS9A 5E3CA 4DBQA 2WL8A 2NUTB 1LKXA 5FCLA 4J30B
chains in the Genus database with same CATH topology
3K1IA 1ORJA 3IQCA 1ORYA 1SZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I A;  1ORJ A;  3IQC A;  1ORY A;  1SZI A; 
#chains in the Genus database with same CATH topology
 1D1C A;  1ZU5 A;  3UMI A;  1XWJ A;  1KU2 A;  1YYJ A;  4U5C E;  5COM A;  3LLI A;  1SZI A;  1QZX A;  4JKV A;  1QVX A;  1ZHT A;  3AOU A;  2YL1 A;  4QDL A;  2QLA A;  4JZA A;  3DMD A;  1OXB A;  2PF4 E;  1WGW A;  2QUP A;  1LI7 A;  3IQ6 A;  3LJB A;  4MVS A;  2VCC A;  1NU7 D;  1OW8 A;  4JJF A;  4WGZ A;  2UUI A;  3SZR A;  3N2Z B;  3UNG C;  4E17 A;  5L0J A;  3HNI A;  1VLT A;  4P6I C;  3HTK C;  2HJM A;  3RQE A;  4MQ9 F;  1H9T A;  4JEA A;  3QW1 A;  1D0Z A;  3K1H A;  2H7O A;  2WVQ A;  4MW8 A;  2LP4 A;  2J7P D;  3EZH A;  1ZHX A;  1BR2 A;  2LSE A;  2TMV P;  4DOZ A;  2ZXP A;  2YKZ A;  1VB5 A;  3N24 A;  3K6B A;  1KNY A;  1D0X A;  1CPR A;  2EPM X;  4PK4 A;  5AGF A;  2XLM A;  1H7I A;  2OEX A;  2ZPA A;  3O39 A;  5GPG B;  4CJG A;  4ZLC A;  2ICW G;  1LVK A;  2XL4 A;  2DGJ A;  3S29 A;  1Q0F A;  4DVY P;  3LAY A;  3NKD A;  4EBK A;  3NRH A;  3GAN A;  1Z23 A;  4AL1 A;  4DRI B;  2H7V C;  5L0F A;  1FMW A;  2Q00 A;  3MYF A;  3H2V A;  2WZG A;  4MVO A;  5JUA A;  1XZP A;  4K7B A;  1QPU A;  3ZWI A;  2J9B A;  3EFO A;  4N6H A;  4NCQ A;  4XQ1 A;  3EQL F;  3EGD B;  3EH1 A;  1FMV A;  5KYU A;  3T6B A;  1G4W R;  3PDM P;  3FHD A;  2GWW A;  2YZS A;  3ABL C;  3GM2 A;  3HJC A;  3I5P A;  1BR4 A;  4OIR F;  4GYT A;  1BDJ B;  2IXM A;  1XZQ A;  4BJ5 A;  4XPX A;  5COG A;  5B1B C;  2Y3G A;  4OD4 A;  1NFO A;  3EJN A;  4YJW A;  3EG9 A;  2J8W A;  3ABK C;  3SYN A;  1LE4 A;  3JSZ A;  4G0H A;  4E7Z A;  2L9J A;  4U5B E;  2AVK A;  5JVE A;  1HW2 A;  1MMA A;  3Q7L A;  3ZQY A;  4MVU A;  5K0I A;  5T1D B;  3L8J A;  5KYY B;  1T6U A;  2R9R B;  2A0U A;  2Q4F A;  3IQC A;  4JC7 A;  3S28 A;  2YLI A;  4MTG A;  3FAJ A;  2P61 A;  3BRJ A;  4EHP A;  2EIL C;  4DBR A;  4WJ0 A;  2DYS C;  3L34 A;  2JPU A;  4LDQ A;  1I5N A;  4B6I A;  4RD9 A;  4I44 A;  4YL1 A;  1VTM P;  1AUE A;  3DE9 A;  1WAT A;  2J9W A;  4FES A;  4JCZ A;  2XRH A;  1S7Z A;  4Z9J A;  1OW6 A;  2D5R B;  4AL0 A;  1IZM A;  1WWP A;  3GWL A;  2GFH A;  4PAC A;  1ORS C;  4BJ6 A;  2R7X A;  4U5E E;  3AJM A;  2CNW A;  1OQC A;  4J7Y A;  5AC5 A;  2J7P A;  4NQF A;  1K04 A;  1VK5 A;  3S0X A;  1H6G A;  3V5X A;  1A7V A;  1R4T A;  2MWQ A;  4CS7 A;  4KC9 A;  4QI2 A;  1TWG A;  2CYD A;  3VYW A;  2M4E A;  4R32 A;  1QKR A;  2O9X A;  2KC3 A;  4CS9 C;  1RKC A;  2LQG A;  3KPH A;  1WOL A;  5JLI A;  4K1O A;  4MVQ A;  4FX5 A;  4N4W A;  5KYN A;  3HNK A;  4YT4 A;  3TK0 A;  3AQB A;  4CSA C;  1MMG A;  4O6N A;  3AG4 C;  3S27 A;  5HV9 A;  1D1B A;  2YEV A;  3GEH A;  1M56 C;  5TJ5 E;  1YAU O;  4G7Z F;  2PP4 A;  2Q9C A;  1Q0K A;  3JTL O;  1J8Y F;  3C8Z A;  4C3B A;  2OQM A;  3ZVR A;  4D4N A;  1ORJ A;  1M2V A;  2EPN A;  4LLE A;  1MMN A;  3UMK A;  4JCH A;  3NMK A;  3G4X A;  2XLH A;  3MX3 A;  5D92 A;  1YZA A;  3RQF A;  1Y4C A;  4QI0 A;  3C18 A;  4JJG A;  3UMH A;  5L3V A;  3FAP B;  1U0B B;  1TWH A;  3GEI A;  3K7D A;  3U9M A;  2JX0 A;  4BPM A;  3RYL A;  3DAF A;  3EGX B;  1OCR C;  1W2W A;  2JD3 A;  2ZXR A;  4PJN A;  4YK5 A;  3TJ5 A;  2LIG A;  1TWA A;  4YT2 A;  1Z63 A;  2CGE A;  3G50 A;  4LER A;  3JT1 A;  5AC4 A;  2XLE A;  4JTC B;  3AGT A;  1YJG A;  4RDA A;  2Z15 A;  2LFD A;  1RJ9 A;  4PFO A;  2YL7 A;  4AK9 A;  4DRJ B;  2YL3 A;  3NKE A;  3TUL A;  3W2W A;  3SP1 A;  4A4A A;  5B3S C;  5KYX B;  3SXZ A;  1QLE C;  3NYL A;  1V74 B;  4XEF A;  2WZL A;  3HNJ A;  2HV7 A;  3QVZ A;  1M57 C;  4JVS A;  4MS2 A;  4E7S A;  2R7O A;  1YA7 O;  2KQ9 A;  4YWQ A;  2L6G A;  3BEH A;  3C8G A;  5D91 A;  1DOV A;  2IBF A;  1LPE A;  2R7W A;  1OCC C;  1FTS A;  1Y6D A;  3O6X A;  2I15 A;  1SYQ A;  3IQT A;  1G8X A;  4YL3 A;  3Q6N A;  4HEA J;  4IGG A;  4OIN F;  3ZTZ A;  4MTF A;  1CGN A;  2VB6 A;  3C7J A;  2D4U A;  5CI9 A;  4KNV A;  4PJM A;  4EIY A;  5KYU B;  3AG1 C;  1Q0G A;  4W8K A;  4L6R A;  3ZIB A;  3NYJ A;  4CDY A;  2Q9A A;  1FNT c;  3AQC A;  3AG3 C;  1A41 A;  2EIJ C;  5E33 A;  5DS4 A;  1D0Y A;  3K1I A;  3C63 A;  2DYR C;  5A6K A;  1JRA A;  5BQI A;  1U6H A;  5KYW A;  3K1I C;  3E9V A;  2AP3 A;  5CI8 A;  1JPN A;  1NZE A;  2Y3D A;  2YQY A;  3CEX A;  2RSE B;  3LS1 A;  1YAR O;  1MQV A;  4E0H A;  2OKU A;  4N6C A;  1RKE B;  2NUP B;  3V5Y A;  2OEV A;  1Q0D A;  4AE4 A;  4I3M A;  4CBE A;  1J8M F;  1VMA A;  4HFK B;  5F5F A;  1VLS A;  3GOR A;  1BR1 A;  1V54 C;  2Y3H A;  2R7R A;  1CPQ A;  4C3D A;  2J9V A;  3TOM A;  4JW1 A;  5CIV A;  3SNH A;  2B0H A;  1MNE A;  1OR2 A;  5F5H A;  3U5S A;  4KI2 A;  3EHN A;  3T9O A;  3UGO A;  2YLD A;  5DS5 A;  4JEB A;  5T3T A;  1T9K A;  3FOP A;  1NG1 A;  4P9F A;  3RKO F;  1K05 A;  2G62 A;  2VCB A;  3Q6M A;  5IY5 C;  3FMS A;  4PJL A;  1WN0 A;  2XS8 A;  3CAX A;  1PD1 A;  2AWY A;  4HE8 D;  2IYL D;  2HSQ A;  3WG7 C;  3A11 A;  1OR3 A;  3J06 A;  3UGP A;  1OXK A;  1O3U A;  4IAQ A;  2VH3 A;  2YLG A;  3GM3 A;  4I1O B;  2CNW D;  3GM1 A;  2A6E F;  5A6A A;  1PCX A;  1HMD A;  2LCH A;  3C8G B;  4NTB A;  5DLJ A;  1EQ1 A;  1ZU4 A;  5L0D A;  1HW1 A;  1I4Y A;  2KYH A;  3U9J A;  5L0I A;  2NUT A;  1JPJ A;  2HZ8 A;  4BEM J;  1M6T A;  4DVZ A;  4H54 A;  2R7T A;  1I4Z A;  3EZI A;  3FXH A;  5DQZ A;  4H4K C;  1IW7 F;  2XLO A;  3EFO B;  1LM3 B;  1BZ4 A;  2OU6 A;  2WVN A;  4YT5 A;  4ONS A;  3KMI A;  3NYM A;  2W45 A;  2P1A A;  3M1C B;  4JTA B;  4YL0 A;  4MVM A;  2ASR A;  3TQO A;  3US6 A;  1HY5 A;  1MMD A;  2PX0 A;  1E85 A;  1SMY F;  2QY9 A;  3KYJ A;  3DI5 A;  3H65 A;  2NG1 A;  1C02 A;  3DWW A;  2XL6 A;  3DZA A;  2VAS A;  2V26 A;  4ULW A;  3EGX A;  1FR0 A;  2L81 A;  3ASN C;  1JR8 A;  4BEJ A;  1AVO B;  4IWB A;  1ST6 A;  3DKA A;  3ZC4 A;  1NBB A;  4YN0 B;  5FZT A;  1YZC A;  3TJ6 A;  3HKK A;  3KL4 A;  4AE4 B;  4CX9 A;  3EG9 B;  1V55 C;  2HMZ A;  2VC9 A;  3FOO A;  3JYH A;  1T6Q A;  5E3A A;  3KH2 A;  1T6I A;  3U2L A;  3WOD F;  3AGU A;  2QTV A;  3CSK A;  2HSB A;  5EHH A;  4E18 A;  3L0I A;  2HFI A;  2XLW A;  2I8B A;  3C62 A;  4EUK B;  4U9D A;  1ZVZ A;  5L0H A;  4X0R A;  5B3I A;  2J0W A;  3HNL A;  4U5D E;  3RF3 A;  1ZW2 A;  3RQG A;  1HE9 A;  1ZZP A;  2P0N A;  5A6B A;  1Z5Z A;  2KSF A;  2Y69 C;  4XWJ A;  3EPV A;  2HS5 A;  1AEP A;  2KNH A;  1JOG A;  1K40 A;  1QSP A;  2KW3 C;  2NSG A;  3DM5 A;  3F47 A;  4IJJ A;  1GQA A;  4RBN A;  1C17 M;  3POV A;  2MYS A;  1RXQ A;  3JSE O;  3CZ6 A;  3DE8 A;  1G4U S;  1PV3 A;  3C8G D;  4LLC A;  4E0I A;  5DS6 A;  2KGO A;  1ZHW A;  3B29 A;  5JSL A;  1WAS A;  2W4M A;  3NG1 A;  4C7O A;  1PD0 A;  2IOQ A;  5EGY A;  4JE9 A;  2IXO A;  1TFK B;  3MBG A;  4MND A;  1OCO C;  2J0X A;  1YVI A;  2NPU A;  2HJ3 A;  3DM9 B;  4KBL A;  3RFY A;  3W8H A;  1U89 A;  4CJO A;  2PBE A;  5KYW B;  4CIP A;  3M4B A;  2MHR A;  3AG2 C;  3RIP A;  3VF0 A;  5L3Q A;  4XLP F;  2XS1 A;  2Y39 A;  2L7A A;  2J45 A;  2OJE D;  4GQH A;  1EA8 A;  3QMK A;  1A0B A;  3DD7 A;  2CCY A;  3B0U X;  4CSA A;  1NU9 C;  2C04 A;  3JRM O;  1VYK A;  2DB4 A;  1E86 A;  2VCA A;  4G7O F;  3FVY A;  2L6H A;  2LFF A;  3SXM A;  1LS4 A;  3SXY A;  2HKV A;  4F4B A;  3G4Z A;  4N06 A;  1APC A;  2R7U A;  1NFN A;  4DJ9 A;  2GAQ A;  3IEE A;  4O6M A;  5DQT A;  4ER9 A;  1M2V B;  2IXN A;  4AX2 A;  3U3B A;  3JRT A;  4Q4Z F;  1ZYR F;  4G7H F;  1C03 A;  3S9O A;  2F22 A;  4LAC B;  5A69 A;  4LDK A;  3GWN A;  5F28 E;  1ZHZ A;  3O55 A;  1Z3I X;  1FFT C;  4CS8 C;  4IAR A;  4K0D A;  3ZQV A;  2PX3 A;  4IRU A;  1KTM A;  1OCZ C;  1JAF A;  1L7C A;  5BQG A;  3V7O A;  2OCC C;  4CDV A;  5B1A C;  2FAP B;  4OIP F;  1VOM A;  2X0C A;  2XL8 A;  3TD7 A;  2XXA A;  3W2V A;  3T6J A;  3IHU A;  4JUR I;  3O10 A;  2NSF A;  4CS8 A;  3M79 A;  1OW7 A;  2ZXW C;  3SXK A;  5BUO A;  3EH2 A;  3Q7G A;  1M2O A;  2M64 A;  3I4U A;  3U8V A;  3QVY A;  1SR2 A;  1TWC A;  3ITF A;  4XEV A;  2UUH A;  4Q5S F;  3W4Y A;  3U0C A;  4JTD B;  2XSE A;  2R25 A;  2WVO A;  5BQH A;  4CDA A;  1OKK A;  3PCV A;  3QZC A;  1WTY A;  2WZF A;  1ORY A;  3OWT A;  2G3K A;  4Z9I A;  3LS0 A;  3R7C A;  2ZXO A;  3EGD A;  1E84 A;  4ULV A;  4A2N B;  2XLD A;  2A0B A;  2FFH A;  4WAB A;  2A69 F;  1EI7 A;  3WHN A;  1Z6A A;  3ASO C;  2E87 A;  1O5H A;  2A1D D;  4YT8 A;  4ZLD A;  4OIO F;  3L8I A;  4Q7C A;  3NDB B;  1NLX A;  3S90 A;  3E70 C;  2G3V A;  2YWA A;  4P9T A;  2Q7R A;  3V5Z A;  2HMQ A;  5EK0 A;  2QNL A;  4EWC A;  1R5I D;  2EIK C;  4MTO A;  4GEH A;  3HLZ A;  3CQZ A;  2WB7 A;  3MYI A;  1NSG B;  1OKK D;  4XEK A;  3RVY A;  1JMW A;  1HMO A;  2R03 A;  2YL0 A;  4PJJ A;  1YYX A;  4U5H A;  4J7T A;  2J46 A;  5KYX A;  2YRF A;  1GM5 A;  1E83 A;  4NC3 A;  1L3P A;  2LK4 A;  3I5Q A;  4MVZ A;  2ZD9 A;  1S05 A;  2OJQ A;  1YA9 A;  2EIN C;  2A6H F;  4J32 B;  2ETS A;  4PR9 A;  3RH3 A;  3RW0 A;  2IXP A;  5JT4 A;  2P7V A;  2XM0 A;  1DOW A;  1EKY A;  1N1C A;  3KKB A;  1CGM E;  1GS9 A;  1LE2 A;  4LDR A;  3X1O A;  1RJ9 B;  1T01 A;  3U3F A;  4D4X A;  4XLN F;  3M4C A;  1UFB A;  2FGY A;  2PNO A;  3LEV A;  4C3E A;  4NTA A;  1Q0M A;  3JYY A;  1FAP B;  2GDC A;  4WGY A;  3X2Q C;  2QE9 A;  2J9U A;  3N0T A;  2OG2 A;  1T5O A;  2X51 A;  3IPM O;  4MW3 A;  4O7G A;  5DVW A;  1Z7Q c;  3TOL A;  4BG0 A;  3FDQ A;  3ZTM A;  3R2P A;  1YLM A;  3ABM C;  3JCU Q;  1TQG A;  1UG7 A;  4U5F E;  2KJG A;  2NUP A;  3B71 A;  1BBH A;  3SEO A;  1A7D A;  2Y3B A;  4EBB A;  4W8P A;  3ZSU A;  2BC5 A;  5T3W A;  2CDQ A;  2L6F A;  1LS1 A;  2YHS A;  3GEE A;  5JP7 A;  2RD9 A;  2C03 A;  3LNM B;  5L0C A;  3U2M A;  2XLV A;  1LI5 A;  3M15 A;  2CW0 F;  3B0P A;  3RVZ A;  1TR2 A;  4HFF B;  3MLG A;  1V4A A;  1YDI A;  4KNW A;  2R05 A;  4O79 A;  2Q3T A;  256B A;  2V3C C;  4XTK A;  3L1M A;  2H8A A;  3UR3 C;  2KK1 A;  3MFN A;  2YVK A;  2W9Y A;  5E2Q A;  1HE1 A;  1TFO B;  1FFH A;  2AU5 A;  2DI3 A;  4U5G A;  3PHF 2;  3VM6 A;  3S84 A;  3K33 A;  1B68 A;  2PFD A;  3GOD A;  3K66 A;  3NMI A;  3PMR A;  4FAP B;  1GGQ A;  4NY3 A;  1RKE A;  3WAQ A;  1SF8 A;  3LEO A;  1VYI A;  4I1M A;  1E2X A;  1A7E A;  3KYI A;  4BJ5 C;  4U9E A;  2R7V A;  3A9C A;  3DJN B;  2XXA B;  3LUT B;  4PFP A;  2GA0 A;  3B0V C;  1MND A;  4G78 A;  1D1A A;  2P6V A;  1CGO A;  3DXJ F;  3ECS A;  4OD5 A;  3W8I A;  2LD6 A;  2XM4 A;  3B9Q A;  2EPO A;  3VAY A;  5KYY A;  3T4R A;  4MVR A;  3ATP A;  2HUJ A;  3DAG A;  3OA1 A;  2A68 F;  3OEO A;  3EHM A;  4JIO A;  2BE5 F;  4EKW A;  3QTH A;  5L0G A;  2W4B A;  1ZHY A;  1TKN A;  4IB4 A;  3F46 A;  3IQ5 A;  5HSW A;  1LIH A;  4C7O B;  2AWC A;  2R02 A;  2R7Q A;  3LES A;  2H7B A;  4IAO A;  4EBJ A;  1H9G A;  1RCP A;  4XPW A;  3T6G B;  4UDV A;  2IM8 A;  4Z9H A;  5COF A;  3NMJ A;  4XPY A;  2Q9B A;  2OOC A;  3LLK A;  4ANJ A;  4NTF A;  3ZG1 A;  1F1M A;  3U8P A;  4DXW A;  1G5Z A;  4BJT A;  4BJ1 A;  5JS5 A;  4BJ6 C;  4CIH A;  2BL2 A;  3LNR A;  4M63 A;  1QQ3 A;  2R7S A;  3ZDL A;  3JZ0 A;  3DJU B;  4O6Y A;  1O87 A;  5JRA A;  2B0J A;  1ZW3 A;  1RMV A;  2EPK X;  2EPL X;  5A6B D;  3H2U A;  4JRZ A;  2EIM C;  4DRH B;  2HV6 A;  4FWV A;  5A6J A;  3VRC A;  3QW0 A;  4OIQ F;  4CS9 A;  5E3C A;  4DBQ A;  2WL8 A;  2NUT B;  1LKX A;  5FCL A;  4J30 B; 
#chains in the Genus database with same CATH homology
 3K1I A;  1ORJ A;  3IQC A;  1ORY A;  1SZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...