3IQCA

Crystal structure of flis from h. pylori
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
119
Chain Sequence
YANAYQAYQHESPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
total genus 47
structure length 119
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3iqcA00
1ORJA 3K1IA 1SZIA 1ORYA 3IQCA
chains in the Genus database with same CATH superfamily
3S90A 3KYJA 4CBEA 3AG1C 4GQHA 1T5OA 3DAGA 1K05A 2HV7A 1M56C 4R32A 3O6XA 2Q9BA 1YDIA 3FMSA 3T6BA 2D4UA 1OCZC 2XRHA 1D0XA 2Y39A 2YLGA 5CIVA 3B9QA 1VTMP 5JP7A 3R2PA 3B71A 1J8MF 1HMOA 1AUEA 4Q7CA 3ASOC 3G4ZA 2MYSA 1A7VA 4BPMA 4XPWA 1A7EA 3T9OA 3M4BA 4AE4A 3C8GB 2HSQA 2IM8A 2WB7A 3RFYA 4P9TA 3IHUA 1M2VA 2J7PA 3GANA 3BEHA 1HMDA 4MW3A 2Q00A 1QVXA 3QW0A 3EG9A 3SXMA 2Q3TA 3HJCA 4BJ5C 1OKKD 2QNLA 5A69A 4MQ9F 1SMYF 2EILC 2OEVA 2Y69C 2ZXWC 1E83A 4JJGA 3EH2A 3KKBA 4N06A 1E2XA 3EZHA 4JCHA 1YYJA 2HFIA 5DVWA 4XEFA 3GWNA 4PJMA 5L3QA 2R7RA 3FVYA 1SYQA 5JUAA 5KYXB 3FHDA 3JSZA 1ZHZA 5A6BD 3IPMO 3JSEO 3LNRA 3JT1A 2EPKX 4HFFB 3JYHA 3UR3C 5EHHA 5L0JA 3K66A 1GQAA 3LEOA 3TOMA 3A11A 4Q4ZF 3Q6NA 4WGYA 3LEVA 2WVOA 5E3CA 2J9WA 3DM5A 4K7BA 3RQGA 1PV3A 5A6KA 5COFA 5L0IA 3POVA 3MYIA 3AGUA 3ZTMA 1AEPA 1IW7F 3X1OA 1L7CA 2ETSA 1OW8A 1RKCA 4YN0B 2W4BA 2YLIA 4U9DA 1BDJB 2GA0A 1Z23A 2MWQA 3FOPA 3CAXA 3LLIA 1CGME 1H7IA 1YVIA 4MTGA 1MMNA 2X51A 4U5FE 4PJNA 1B68A 2M4EA 1BR2A 3KYIA 2KQ9A 4BEJA 1LPEA 1VB5A 3U3FA 2VH3A 4E7SA 4XPYA 5F5HA 4QDLA 5COGA 3B0VC 1O87A 4IB4A 3DM9B 2RD9A 3U8PA 3U9MA 2AU5A 1UG7A 2H7VC 4XEKA 3RVYA 1OCCC 2LP4A 4RDAA 3IQ5A 3TQOA 4E17A 2JPUA 5F28E 5KYWA 3JRMO 1O5HA 3K1HA 2IXMA 5JVEA 2HJMA 2Z15A 4ZLCA 4AE4B 3ZG1A 3F47A 2C04A 2HUJA 2LIGA 4AK9A 3CZ6A 2D5RB 1CPQA 2HMZA 2P6VA 4IRUA 2QLAA 1OW7A 3UMKA 3UNGC 2H8AA 1R4TA 1UFBA 5CI8A 4J7YA 3EG9B 1QLEC 1I4YA 2J0XA 3A9CA 3EFOA 1H9GA 3O55A 1ZU5A 1ORJA 2NPUA 1OCRC 3C8GD 2OCCC 1WATA 4OIRF 3QVYA 2LCHA 1H9TA 1CPRA 2NG1A 1EKYA 3L0IA 4H54A 3W2VA 2G3VA 3U3BA 2V26A 3NKDA 4DXWA 4QI2A 1V74B 4MVOA 1QQ3A 4EUKB 3C18A 1CGNA 2IBFA 3HKKA 4DRHB 2Q4FA 2ICWG 5L0FA 2FAPB 1ZW2A 1C03A 2J0WA 3DMDA 3H2VA 1S05A 3SXZA 2F22A 2PBEA 2YL0A 4FX5A 2ZPAA 3Q6MA 2NUTA 3IEEA 1SR2A 4ZLDA 1BZ4A 4YT4A 1APCA 2KW3C 1PD1A 2L6FA 4W8KA 4I3MA 4IGGA 1KNYA 4N6HA 3ZWIA 2TMVP 1FTSA 2W4MA 5B1BC 2R03A 3EJNA 5JRAA 1QPUA 3VAYA 2EPMX 3U2MA 2J8WA 2C03A 4B6IA 1T9KA 3MX3A 1GS9A 1BR1A 1ZHTA 3L8IA 2OJED 3EHMA 3N0TA 1T6UA 2XL4A 5AGFA 2EPNA 5T3TA 2WZGA 3UMHA 4GYTA 2J46A 2HSBA 3PHF2 3M15A 5JT4A 1LM3B 4JURI 5TJ5E 4A2NB 3U0CA 3HNIA 2EIMC 3PMRA 2KYHA 4E0HA 4JZAA 1A41A 1NLXA 3TJ6A 2R7QA 1TWGA 4XLNF 4O7GA 2YRFA 4JJFA 1FFHA 3TOLA 4GEHA 1K40A 5JLIA 4K0DA 3ZSUA 1AVOB 5KYWB 1E86A 2DI3A 3B0PA 4IAQA 4PR9A 2XL6A 3G50A 2WZLA 4IJJA 3AQBA 4MVUA 2KK1A 1OW6A 2VCCA 3GEHA 3CQZA 3H65A 5KYNA 3T6GB 4MTFA 1V54C 2DGJA 2X0CA 3EFOB 4PK4A 3NMJA 4PACA 3W4YA 2IYLD 3M1CB 1JPNA 3NMIA 3C62A 3KH2A 1Z7Qc 1NFNA 3L34A 4MVMA 3R7CA 4EHPA 2YL7A 1QZXA 3BRJA 4FESA 1SZIA 4JEBA 4ONSA 3JTLO 1RKEB 5BQIA 1LI7A 5T3WA 3I5PA 1E85A 1DOVA 3ABLC 3EPVA 1JAFA 3I5QA 1S7ZA 2GWWA 4JE9A 1EI7A 2GDCA 2NUTB 4K1OA 1VK5A 2XM0A 4EIYA 2XS1A 2G3KA 2WVNA 4U5GA 3RVZA 2YHSA 1Z3IX 3DZAA 3GM1A 3LS1A 5COMA 3SXKA 1Q0FA 4G7OF 5A6AA 4M63A 2XLMA 2AWCA 1ZW3A 3FOOA 3M4CA 4QI0A 3F46A 4J7TA 3GODA 4YL3A 5B1AC 4G7ZF 5B3IA 3SP1A 4ER9A 3FDQA 2CNWA 1VYIA 4MVQA 1HW2A 4A4AA 2R7SA 3L8JA 1M6TA 3LUTB 3TD7A 3AG3C 2B0JA 1D1CA 4JW1A 4IWBA 2XXAB 1E84A 3GWLA 1FFTC 3DJNB 3E9VA 3O10A 4P9FA 4CDAA 1D0YA 1JPJA 1TWHA 2AP3A 3EGXA 1WN0A 4HFKB 4YK5A 4E7ZA 1R5ID 2QE9A 4OIQF 3Q7GA 1TWCA 5FCLA 3S84A 4EWCA 1J8YF 3C7JA 4BJ1A 2LQGA 2UUIA 4KC9A 4KI2A 5BUOA 2EINC 1OKKA 4G78A 4WGZA 2OJQA 3RYLA 4DRJB 2AVKA 3K1IC 2P0NA 1YZCA 4DRIB 5EGYA 2NUPA 4YT5A 3FXHA 3JRTA 3JYYA 4U5CE 2LFDA 2R7VA 1RJ9A 3QMKA 3LS0A 3WHNA 1Q0MA 5L0HA 2PNOA 5KYUA 2QUPA 3K1IA 4EKWA 5A6BA 4XLPF 2R7XA 2LFFA 3VRCA 4U5BE 2LK4A 4U5HA 4I44A 1VLTA 4RBNA 2R05A 2XLOA 4MVSA 2L7AA 2Y3GA 3OWTA 4BEMJ 3S28A 5KYYA 1WASA 1EA8A 1U89A 2XSEA 3K33A 2M64A 4JEAA 4LERA 1GGQA 2VCBA 3LJBA 4N6CA 2YL3A 3EGDA 2A69F 4OIOF 3EHNA 1M2VB 4LDRA 4CS8A 4NQFA 4X0RA 4JRZA 3H2UA 3DKAA 3WODF 2B0HA 3FAJA 1DOWA 1JR8A 2OKUA 3SYNA 1C02A 2CYDA 3VF0A 2YLDA 4JC7A 1Z63A 1YZAA 2E87A 4CS9A 1WOLA 2HS5A 2Y3DA 4XQ1A 2PX3A 3SNHA 4EBJA 2R25A 1N1CA 2A6HF 2Y3BA 2R7UA 1ZHXA 2MHRA 3LESA 4G7HF 5L0CA 1YA9A 4IAOA 3HTKC 1G4US 2KNHA 2HV6A 3HLZA 2R9RB 1A7DA 2OEXA 3DJUB 4LLEA 4U9EA 4NC3A 4NTBA 1VYKA 5BQGA 4EBBA 2XS8A 1HE1A 2LSEA 2NSFA 1JOGA 2IXOA 3AQCA 1MMGA 1TQGA 4RD9A 1OXKA 1Y6DA 1OCOC 3EGXB 3S27A 4FWVA 4D4NA 3IQCA 1NFOA 2YEVA 3DI5A 2R7TA 3MBGA 4O6NA 3RF3A 2YL1A 4BJ6C 1T01A 1MNDA 2XLHA 3UMIA 1HE9A 3EZIA 3J06A 2EIJC 3EH1A 3N2ZB 3C8GA 4YJWA 3NG1A 1ST6A 1XZQA 1VMAA 1Q0GA 3AJMA 3DAFA 4HEAJ 4BJ6A 5JS5A 5L0GA 2A6EF 1FR0A 3LLKA 4LDKA 1RJ9B 4YL1A 1KU2A 1CGOA 2OG2A 2CCYA 5JSLA 1M57C 5KYUB 3V5ZA 4MW8A 2AWYA 3W8IA 3FAPB 4O6MA 4N4WA 1OR2A 1FAPB 1QKRA 4NCQA 4OD5A 3MYFA 4Z9HA 2HJ3A 3HNKA 4EBKA 2H7BA 2A1DD 4JCZA 2YQYA 4UDVA 1JRAA 5KYYB 4MS2A 1NU9C 3GORA 4H4KC 2WZFA 2GAQA 2JD3A 3RQEA 1LKXA 5DS6A 2A0UA 1G8XA 3DWWA 4O6YA 4OD4A 1IZMA 5E2QA 3W8HA 3V5XA 4JVSA 3UGPA 4OINF 5DQTA 4WJ0A 4YT2A 5GPGB 5IY5C 3NYJA 2PF4E 1KTMA 2QY9A 3RW0A 3VYWA 1XWJA 2CGEA 2VB6A 3SZRA 4NTFA 4BJTA 1Z6AA 3E70C 4LACB 4CIPA 1MMDA 4C7OA 4YL0A 3WAQA 4CJOA 1BBHA 1GM5A 4CSAA 1LI5A 2J7PD 4C3EA 4OIPF 1LS1A 4Z9IA 2QTVA 2XL8A 4JTCB 4WABA 3RIPA 5F5FA 2O9XA 3DE8A 1VOMA 3L1MA 1NZEA 3KL4A 2GFHA 4YT8A 3V5YA 1T6IA 2KJGA 4XEVA 2ZXOA 5CI9A 5T1DB 1NG1A 1A0BA 2YVKA 4PFOA 4DVYP 4XWJA 1PD0A 1ZHWA 2I15A 1TWAA 4XTKA 4PJJA 1G4WR 1C17M 2CNWD 4CIHA 1O3UA 4JIOA 2J45A 3ITFA 3QZCA 1ZU4A 1NSGB 2ZXRA 3QW1A 4AX2A 3SEOA 3NRHA 1W2WA 2DB4A 1U6HA 3NYLA 5B3SC 1I4ZA 3CEXA 2HKVA 3TJ5A 1YAUO 2FFHA 3PCVA 3U2LA 3LAYA 1PCXA 3W2WA 3K7DA 1H6GA 4ANJA 1M2OA 1EQ1A 3Q7LA 3GM3A 4W8PA 3NMKA 2RSEB 3ZDLA 1D1BA 2R02A 3KPHA 1ORSC 5L3VA 2PFDA 2Y3HA 4G0HA 4C3DA 3AG4C 2L6GA 5D91A 3GM2A 4KNWA 3U9JA 2YZSA 3DXJF 3KMIA 4I1MA 3HNJA 4KNVA 2Q9CA 3S9OA 4BJ5A 2R7WA 2BL2A 2A68F 2A0BA 2I8BA 2OQMA 2P7VA 4DBRA 2IXPA 5AC5A 1RCPA 4CDYA 1LVKA 2P1AA 3NDBB 4XPXA 2WVQA 4E18A 2YKZA 2Q7RA 2IXNA 3RQFA 1YLMA 3TK0A 2P61A 5L0DA 3T6JA 2KSFA 2KC3A 1ORYA 4MVRA 1U0BB 3EQLF 3C63A 1D0ZA 1OXBA 2UUHA 4C7OB 2XLWA 3ZVRA 1RMVA 3K6BA 4E0IA 4CS8C 3S0XA 3RH3A 3JCUQ 2R7OA 1RXQA 3DD7A 1D1AA 2CDQA 5D92A 3AG2C 1FMWA 1LE2A 4LLCA 3IQ6A 3S29A 3JZ0A 1LE4A 4F4BA 1FNTc 4Z9JA 4CS9C 1L3PA 3AGTA 1Q0KA 4KBLA 5DQZA 3ABKC 2KGOA 1V4AA 2J9UA 5DS4A 2OU6A 1ZYRF 3ATPA 2PP4A 3RKOF 1OQCA 4ULWA 2L6HA 4FAPB 3AOUA 3ZIBA 2DYRC 4PFPA 3MFNA 3QTHA 2VASA 4I1OB 2ZXPA 2NSGA 1ZZPA 3WG7C 2W9YA 2DYSC 3QVZA 3ZTZA 3ABMC 4JKVA 1TR2A 3DE9A 1WGWA 3GEEA 4MNDA 3UGOA 5HSWA 5AC4A 3M79A 1YYXA 1WWPA 2EPLX 2EPOA 1YARO 2W45A 5DLJA 4U5DE 2CW0F 1MMAA 5FZTA 4DOZA 3ZQYA 4CS7A 1HW1A 3U8VA 4CJGA 3NKEA 2L9JA 1SF8A 2LD6A 4MTOA 2L81A 4LDQA 3CSKA 2ASRA 3HNLA 2ZD9A 2HMQA 5E3AA 3ASNC 3ZQVA 3OA1A 1F1MA 4D4XA 1BR4A 3SXYA 3IQTA 1Z5ZA 1LS4A 1RKEA 4HE8D 1G5ZA 1NU7D 3PDMP 4ULVA 256BA 3X2QC 3ECSA 1MQVA 2J9BA 4NTAA 2IOQA 2WL8A 1MNEA 4O79A 3I4UA 4MVZA 2YWAA 2PX0A 1FMVA 3V7OA 4DVZA 5E33A 2NUPB 3N24A 4DBQA 2HZ8A 2H7OA 1VLSA 2OOCA 4JTAB 1YA7O 1TKNA 3C8ZA 4YWQA 1TFKB 4NY3A 2XLDA 3G4XA 3NYMA 4J30B 1HY5A 4BG0A 4CDVA 3ZC4A 3T4RA 2Q9AA 5A6JA 3TULA 4P6IC 2XLEA 3B29A 3US6A 1V55C 5KYXA 1YJGA 4C3BA 2BC5A 2VCAA 4U5EE 4DJ9A 2XM4A 1JMWA 3EGDB 1T6QA 1NBBA 1XZPA 3GEIA 3MLGA 3OEOA 3O39A 3U5SA 5BQHA 2XXAA 4CSAC 4Q5SF 1ZHYA 5DS5A 2EIKC 1K04A 1WTYA 1LIHA 5HV9A 1OR3A 2V3CC 1ZVZA 2FGYA 1TFOB 2J9VA 3LNMB 4IARA 4JTDB 1I5NA 4CX9A 1Y4CA 1Q0DA 4J32B 4L6RA 5K0IA 4AL0A 5EK0A 2JX0A 3B0UX 4PJLA 2VC9A 2G62A 2XLVA 4AL1A 1QSPA 3VM6A 2BE5F
chains in the Genus database with same CATH topology
1ORJA 3K1IA 1SZIA 1ORYA 3IQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORJ A;  3K1I A;  1SZI A;  1ORY A;  3IQC A; 
#chains in the Genus database with same CATH topology
 3S90 A;  3KYJ A;  4CBE A;  3AG1 C;  4GQH A;  1T5O A;  3DAG A;  1K05 A;  2HV7 A;  1M56 C;  4R32 A;  3O6X A;  2Q9B A;  1YDI A;  3FMS A;  3T6B A;  2D4U A;  1OCZ C;  2XRH A;  1D0X A;  2Y39 A;  2YLG A;  5CIV A;  3B9Q A;  1VTM P;  5JP7 A;  3R2P A;  3B71 A;  1J8M F;  1HMO A;  1AUE A;  4Q7C A;  3ASO C;  3G4Z A;  2MYS A;  1A7V A;  4BPM A;  4XPW A;  1A7E A;  3T9O A;  3M4B A;  4AE4 A;  3C8G B;  2HSQ A;  2IM8 A;  2WB7 A;  3RFY A;  4P9T A;  3IHU A;  1M2V A;  2J7P A;  3GAN A;  3BEH A;  1HMD A;  4MW3 A;  2Q00 A;  1QVX A;  3QW0 A;  3EG9 A;  3SXM A;  2Q3T A;  3HJC A;  4BJ5 C;  1OKK D;  2QNL A;  5A69 A;  4MQ9 F;  1SMY F;  2EIL C;  2OEV A;  2Y69 C;  2ZXW C;  1E83 A;  4JJG A;  3EH2 A;  3KKB A;  4N06 A;  1E2X A;  3EZH A;  4JCH A;  1YYJ A;  2HFI A;  5DVW A;  4XEF A;  3GWN A;  4PJM A;  5L3Q A;  2R7R A;  3FVY A;  1SYQ A;  5JUA A;  5KYX B;  3FHD A;  3JSZ A;  1ZHZ A;  5A6B D;  3IPM O;  3JSE O;  3LNR A;  3JT1 A;  2EPK X;  4HFF B;  3JYH A;  3UR3 C;  5EHH A;  5L0J A;  3K66 A;  1GQA A;  3LEO A;  3TOM A;  3A11 A;  4Q4Z F;  3Q6N A;  4WGY A;  3LEV A;  2WVO A;  5E3C A;  2J9W A;  3DM5 A;  4K7B A;  3RQG A;  1PV3 A;  5A6K A;  5COF A;  5L0I A;  3POV A;  3MYI A;  3AGU A;  3ZTM A;  1AEP A;  1IW7 F;  3X1O A;  1L7C A;  2ETS A;  1OW8 A;  1RKC A;  4YN0 B;  2W4B A;  2YLI A;  4U9D A;  1BDJ B;  2GA0 A;  1Z23 A;  2MWQ A;  3FOP A;  3CAX A;  3LLI A;  1CGM E;  1H7I A;  1YVI A;  4MTG A;  1MMN A;  2X51 A;  4U5F E;  4PJN A;  1B68 A;  2M4E A;  1BR2 A;  3KYI A;  2KQ9 A;  4BEJ A;  1LPE A;  1VB5 A;  3U3F A;  2VH3 A;  4E7S A;  4XPY A;  5F5H A;  4QDL A;  5COG A;  3B0V C;  1O87 A;  4IB4 A;  3DM9 B;  2RD9 A;  3U8P A;  3U9M A;  2AU5 A;  1UG7 A;  2H7V C;  4XEK A;  3RVY A;  1OCC C;  2LP4 A;  4RDA A;  3IQ5 A;  3TQO A;  4E17 A;  2JPU A;  5F28 E;  5KYW A;  3JRM O;  1O5H A;  3K1H A;  2IXM A;  5JVE A;  2HJM A;  2Z15 A;  4ZLC A;  4AE4 B;  3ZG1 A;  3F47 A;  2C04 A;  2HUJ A;  2LIG A;  4AK9 A;  3CZ6 A;  2D5R B;  1CPQ A;  2HMZ A;  2P6V A;  4IRU A;  2QLA A;  1OW7 A;  3UMK A;  3UNG C;  2H8A A;  1R4T A;  1UFB A;  5CI8 A;  4J7Y A;  3EG9 B;  1QLE C;  1I4Y A;  2J0X A;  3A9C A;  3EFO A;  1H9G A;  3O55 A;  1ZU5 A;  1ORJ A;  2NPU A;  1OCR C;  3C8G D;  2OCC C;  1WAT A;  4OIR F;  3QVY A;  2LCH A;  1H9T A;  1CPR A;  2NG1 A;  1EKY A;  3L0I A;  4H54 A;  3W2V A;  2G3V A;  3U3B A;  2V26 A;  3NKD A;  4DXW A;  4QI2 A;  1V74 B;  4MVO A;  1QQ3 A;  4EUK B;  3C18 A;  1CGN A;  2IBF A;  3HKK A;  4DRH B;  2Q4F A;  2ICW G;  5L0F A;  2FAP B;  1ZW2 A;  1C03 A;  2J0W A;  3DMD A;  3H2V A;  1S05 A;  3SXZ A;  2F22 A;  2PBE A;  2YL0 A;  4FX5 A;  2ZPA A;  3Q6M A;  2NUT A;  3IEE A;  1SR2 A;  4ZLD A;  1BZ4 A;  4YT4 A;  1APC A;  2KW3 C;  1PD1 A;  2L6F A;  4W8K A;  4I3M A;  4IGG A;  1KNY A;  4N6H A;  3ZWI A;  2TMV P;  1FTS A;  2W4M A;  5B1B C;  2R03 A;  3EJN A;  5JRA A;  1QPU A;  3VAY A;  2EPM X;  3U2M A;  2J8W A;  2C03 A;  4B6I A;  1T9K A;  3MX3 A;  1GS9 A;  1BR1 A;  1ZHT A;  3L8I A;  2OJE D;  3EHM A;  3N0T A;  1T6U A;  2XL4 A;  5AGF A;  2EPN A;  5T3T A;  2WZG A;  3UMH A;  4GYT A;  2J46 A;  2HSB A;  3PHF 2;  3M15 A;  5JT4 A;  1LM3 B;  4JUR I;  5TJ5 E;  4A2N B;  3U0C A;  3HNI A;  2EIM C;  3PMR A;  2KYH A;  4E0H A;  4JZA A;  1A41 A;  1NLX A;  3TJ6 A;  2R7Q A;  1TWG A;  4XLN F;  4O7G A;  2YRF A;  4JJF A;  1FFH A;  3TOL A;  4GEH A;  1K40 A;  5JLI A;  4K0D A;  3ZSU A;  1AVO B;  5KYW B;  1E86 A;  2DI3 A;  3B0P A;  4IAQ A;  4PR9 A;  2XL6 A;  3G50 A;  2WZL A;  4IJJ A;  3AQB A;  4MVU A;  2KK1 A;  1OW6 A;  2VCC A;  3GEH A;  3CQZ A;  3H65 A;  5KYN A;  3T6G B;  4MTF A;  1V54 C;  2DGJ A;  2X0C A;  3EFO B;  4PK4 A;  3NMJ A;  4PAC A;  3W4Y A;  2IYL D;  3M1C B;  1JPN A;  3NMI A;  3C62 A;  3KH2 A;  1Z7Q c;  1NFN A;  3L34 A;  4MVM A;  3R7C A;  4EHP A;  2YL7 A;  1QZX A;  3BRJ A;  4FES A;  1SZI A;  4JEB A;  4ONS A;  3JTL O;  1RKE B;  5BQI A;  1LI7 A;  5T3W A;  3I5P A;  1E85 A;  1DOV A;  3ABL C;  3EPV A;  1JAF A;  3I5Q A;  1S7Z A;  2GWW A;  4JE9 A;  1EI7 A;  2GDC A;  2NUT B;  4K1O A;  1VK5 A;  2XM0 A;  4EIY A;  2XS1 A;  2G3K A;  2WVN A;  4U5G A;  3RVZ A;  2YHS A;  1Z3I X;  3DZA A;  3GM1 A;  3LS1 A;  5COM A;  3SXK A;  1Q0F A;  4G7O F;  5A6A A;  4M63 A;  2XLM A;  2AWC A;  1ZW3 A;  3FOO A;  3M4C A;  4QI0 A;  3F46 A;  4J7T A;  3GOD A;  4YL3 A;  5B1A C;  4G7Z F;  5B3I A;  3SP1 A;  4ER9 A;  3FDQ A;  2CNW A;  1VYI A;  4MVQ A;  1HW2 A;  4A4A A;  2R7S A;  3L8J A;  1M6T A;  3LUT B;  3TD7 A;  3AG3 C;  2B0J A;  1D1C A;  4JW1 A;  4IWB A;  2XXA B;  1E84 A;  3GWL A;  1FFT C;  3DJN B;  3E9V A;  3O10 A;  4P9F A;  4CDA A;  1D0Y A;  1JPJ A;  1TWH A;  2AP3 A;  3EGX A;  1WN0 A;  4HFK B;  4YK5 A;  4E7Z A;  1R5I D;  2QE9 A;  4OIQ F;  3Q7G A;  1TWC A;  5FCL A;  3S84 A;  4EWC A;  1J8Y F;  3C7J A;  4BJ1 A;  2LQG A;  2UUI A;  4KC9 A;  4KI2 A;  5BUO A;  2EIN C;  1OKK A;  4G78 A;  4WGZ A;  2OJQ A;  3RYL A;  4DRJ B;  2AVK A;  3K1I C;  2P0N A;  1YZC A;  4DRI B;  5EGY A;  2NUP A;  4YT5 A;  3FXH A;  3JRT A;  3JYY A;  4U5C E;  2LFD A;  2R7V A;  1RJ9 A;  3QMK A;  3LS0 A;  3WHN A;  1Q0M A;  5L0H A;  2PNO A;  5KYU A;  2QUP A;  3K1I A;  4EKW A;  5A6B A;  4XLP F;  2R7X A;  2LFF A;  3VRC A;  4U5B E;  2LK4 A;  4U5H A;  4I44 A;  1VLT A;  4RBN A;  2R05 A;  2XLO A;  4MVS A;  2L7A A;  2Y3G A;  3OWT A;  4BEM J;  3S28 A;  5KYY A;  1WAS A;  1EA8 A;  1U89 A;  2XSE A;  3K33 A;  2M64 A;  4JEA A;  4LER A;  1GGQ A;  2VCB A;  3LJB A;  4N6C A;  2YL3 A;  3EGD A;  2A69 F;  4OIO F;  3EHN A;  1M2V B;  4LDR A;  4CS8 A;  4NQF A;  4X0R A;  4JRZ A;  3H2U A;  3DKA A;  3WOD F;  2B0H A;  3FAJ A;  1DOW A;  1JR8 A;  2OKU A;  3SYN A;  1C02 A;  2CYD A;  3VF0 A;  2YLD A;  4JC7 A;  1Z63 A;  1YZA A;  2E87 A;  4CS9 A;  1WOL A;  2HS5 A;  2Y3D A;  4XQ1 A;  2PX3 A;  3SNH A;  4EBJ A;  2R25 A;  1N1C A;  2A6H F;  2Y3B A;  2R7U A;  1ZHX A;  2MHR A;  3LES A;  4G7H F;  5L0C A;  1YA9 A;  4IAO A;  3HTK C;  1G4U S;  2KNH A;  2HV6 A;  3HLZ A;  2R9R B;  1A7D A;  2OEX A;  3DJU B;  4LLE A;  4U9E A;  4NC3 A;  4NTB A;  1VYK A;  5BQG A;  4EBB A;  2XS8 A;  1HE1 A;  2LSE A;  2NSF A;  1JOG A;  2IXO A;  3AQC A;  1MMG A;  1TQG A;  4RD9 A;  1OXK A;  1Y6D A;  1OCO C;  3EGX B;  3S27 A;  4FWV A;  4D4N A;  3IQC A;  1NFO A;  2YEV A;  3DI5 A;  2R7T A;  3MBG A;  4O6N A;  3RF3 A;  2YL1 A;  4BJ6 C;  1T01 A;  1MND A;  2XLH A;  3UMI A;  1HE9 A;  3EZI A;  3J06 A;  2EIJ C;  3EH1 A;  3N2Z B;  3C8G A;  4YJW A;  3NG1 A;  1ST6 A;  1XZQ A;  1VMA A;  1Q0G A;  3AJM A;  3DAF A;  4HEA J;  4BJ6 A;  5JS5 A;  5L0G A;  2A6E F;  1FR0 A;  3LLK A;  4LDK A;  1RJ9 B;  4YL1 A;  1KU2 A;  1CGO A;  2OG2 A;  2CCY A;  5JSL A;  1M57 C;  5KYU B;  3V5Z A;  4MW8 A;  2AWY A;  3W8I A;  3FAP B;  4O6M A;  4N4W A;  1OR2 A;  1FAP B;  1QKR A;  4NCQ A;  4OD5 A;  3MYF A;  4Z9H A;  2HJ3 A;  3HNK A;  4EBK A;  2H7B A;  2A1D D;  4JCZ A;  2YQY A;  4UDV A;  1JRA A;  5KYY B;  4MS2 A;  1NU9 C;  3GOR A;  4H4K C;  2WZF A;  2GAQ A;  2JD3 A;  3RQE A;  1LKX A;  5DS6 A;  2A0U A;  1G8X A;  3DWW A;  4O6Y A;  4OD4 A;  1IZM A;  5E2Q A;  3W8H A;  3V5X A;  4JVS A;  3UGP A;  4OIN F;  5DQT A;  4WJ0 A;  4YT2 A;  5GPG B;  5IY5 C;  3NYJ A;  2PF4 E;  1KTM A;  2QY9 A;  3RW0 A;  3VYW A;  1XWJ A;  2CGE A;  2VB6 A;  3SZR A;  4NTF A;  4BJT A;  1Z6A A;  3E70 C;  4LAC B;  4CIP A;  1MMD A;  4C7O A;  4YL0 A;  3WAQ A;  4CJO A;  1BBH A;  1GM5 A;  4CSA A;  1LI5 A;  2J7P D;  4C3E A;  4OIP F;  1LS1 A;  4Z9I A;  2QTV A;  2XL8 A;  4JTC B;  4WAB A;  3RIP A;  5F5F A;  2O9X A;  3DE8 A;  1VOM A;  3L1M A;  1NZE A;  3KL4 A;  2GFH A;  4YT8 A;  3V5Y A;  1T6I A;  2KJG A;  4XEV A;  2ZXO A;  5CI9 A;  5T1D B;  1NG1 A;  1A0B A;  2YVK A;  4PFO A;  4DVY P;  4XWJ A;  1PD0 A;  1ZHW A;  2I15 A;  1TWA A;  4XTK A;  4PJJ A;  1G4W R;  1C17 M;  2CNW D;  4CIH A;  1O3U A;  4JIO A;  2J45 A;  3ITF A;  3QZC A;  1ZU4 A;  1NSG B;  2ZXR A;  3QW1 A;  4AX2 A;  3SEO A;  3NRH A;  1W2W A;  2DB4 A;  1U6H A;  3NYL A;  5B3S C;  1I4Z A;  3CEX A;  2HKV A;  3TJ5 A;  1YAU O;  2FFH A;  3PCV A;  3U2L A;  3LAY A;  1PCX A;  3W2W A;  3K7D A;  1H6G A;  4ANJ A;  1M2O A;  1EQ1 A;  3Q7L A;  3GM3 A;  4W8P A;  3NMK A;  2RSE B;  3ZDL A;  1D1B A;  2R02 A;  3KPH A;  1ORS C;  5L3V A;  2PFD A;  2Y3H A;  4G0H A;  4C3D A;  3AG4 C;  2L6G A;  5D91 A;  3GM2 A;  4KNW A;  3U9J A;  2YZS A;  3DXJ F;  3KMI A;  4I1M A;  3HNJ A;  4KNV A;  2Q9C A;  3S9O A;  4BJ5 A;  2R7W A;  2BL2 A;  2A68 F;  2A0B A;  2I8B A;  2OQM A;  2P7V A;  4DBR A;  2IXP A;  5AC5 A;  1RCP A;  4CDY A;  1LVK A;  2P1A A;  3NDB B;  4XPX A;  2WVQ A;  4E18 A;  2YKZ A;  2Q7R A;  2IXN A;  3RQF A;  1YLM A;  3TK0 A;  2P61 A;  5L0D A;  3T6J A;  2KSF A;  2KC3 A;  1ORY A;  4MVR A;  1U0B B;  3EQL F;  3C63 A;  1D0Z A;  1OXB A;  2UUH A;  4C7O B;  2XLW A;  3ZVR A;  1RMV A;  3K6B A;  4E0I A;  4CS8 C;  3S0X A;  3RH3 A;  3JCU Q;  2R7O A;  1RXQ A;  3DD7 A;  1D1A A;  2CDQ A;  5D92 A;  3AG2 C;  1FMW A;  1LE2 A;  4LLC A;  3IQ6 A;  3S29 A;  3JZ0 A;  1LE4 A;  4F4B A;  1FNT c;  4Z9J A;  4CS9 C;  1L3P A;  3AGT A;  1Q0K A;  4KBL A;  5DQZ A;  3ABK C;  2KGO A;  1V4A A;  2J9U A;  5DS4 A;  2OU6 A;  1ZYR F;  3ATP A;  2PP4 A;  3RKO F;  1OQC A;  4ULW A;  2L6H A;  4FAP B;  3AOU A;  3ZIB A;  2DYR C;  4PFP A;  3MFN A;  3QTH A;  2VAS A;  4I1O B;  2ZXP A;  2NSG A;  1ZZP A;  3WG7 C;  2W9Y A;  2DYS C;  3QVZ A;  3ZTZ A;  3ABM C;  4JKV A;  1TR2 A;  3DE9 A;  1WGW A;  3GEE A;  4MND A;  3UGO A;  5HSW A;  5AC4 A;  3M79 A;  1YYX A;  1WWP A;  2EPL X;  2EPO A;  1YAR O;  2W45 A;  5DLJ A;  4U5D E;  2CW0 F;  1MMA A;  5FZT A;  4DOZ A;  3ZQY A;  4CS7 A;  1HW1 A;  3U8V A;  4CJG A;  3NKE A;  2L9J A;  1SF8 A;  2LD6 A;  4MTO A;  2L81 A;  4LDQ A;  3CSK A;  2ASR A;  3HNL A;  2ZD9 A;  2HMQ A;  5E3A A;  3ASN C;  3ZQV A;  3OA1 A;  1F1M A;  4D4X A;  1BR4 A;  3SXY A;  3IQT A;  1Z5Z A;  1LS4 A;  1RKE A;  4HE8 D;  1G5Z A;  1NU7 D;  3PDM P;  4ULV A;  256B A;  3X2Q C;  3ECS A;  1MQV A;  2J9B A;  4NTA A;  2IOQ A;  2WL8 A;  1MNE A;  4O79 A;  3I4U A;  4MVZ A;  2YWA A;  2PX0 A;  1FMV A;  3V7O A;  4DVZ A;  5E33 A;  2NUP B;  3N24 A;  4DBQ A;  2HZ8 A;  2H7O A;  1VLS A;  2OOC A;  4JTA B;  1YA7 O;  1TKN A;  3C8Z A;  4YWQ A;  1TFK B;  4NY3 A;  2XLD A;  3G4X A;  3NYM A;  4J30 B;  1HY5 A;  4BG0 A;  4CDV A;  3ZC4 A;  3T4R A;  2Q9A A;  5A6J A;  3TUL A;  4P6I C;  2XLE A;  3B29 A;  3US6 A;  1V55 C;  5KYX A;  1YJG A;  4C3B A;  2BC5 A;  2VCA A;  4U5E E;  4DJ9 A;  2XM4 A;  1JMW A;  3EGD B;  1T6Q A;  1NBB A;  1XZP A;  3GEI A;  3MLG A;  3OEO A;  3O39 A;  3U5S A;  5BQH A;  2XXA A;  4CSA C;  4Q5S F;  1ZHY A;  5DS5 A;  2EIK C;  1K04 A;  1WTY A;  1LIH A;  5HV9 A;  1OR3 A;  2V3C C;  1ZVZ A;  2FGY A;  1TFO B;  2J9V A;  3LNM B;  4IAR A;  4JTD B;  1I5N A;  4CX9 A;  1Y4C A;  1Q0D A;  4J32 B;  4L6R A;  5K0I A;  4AL0 A;  5EK0 A;  2JX0 A;  3B0U X;  4PJL A;  2VC9 A;  2G62 A;  2XLV A;  4AL1 A;  1QSP A;  3VM6 A;  2BE5 F; 
#chains in the Genus database with same CATH homology
 1ORJ A;  3K1I A;  1SZI A;  1ORY A;  3IQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...