2G3VA

Crystal structure of cags (hp0534, cag13) from helicobacter pylori
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
KLIESLQENELLNTDEKKKIIDQIKTMHDFFKQMHTNKGALDKVLRNYMKDYRAVIKSIGVDKFKKVYRLLESETMELLHAIAENPNFLFSKFDRSILGIFLPFFSKPIMFKMSIREMDSQIELYGTKLPLLKLFVMTDEEMNFYANLKTIEQYNDYVRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CagS from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Unknown function
molecule keywords CAG pathogenicity island protein 13
total genus 43
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16707 CagS Cag pathogenicity island protein S of Helicobacter pylori
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2g3vA00
2G3VA
chains in the Genus database with same CATH superfamily
3U5SA 1C17M 4DJ9A 3FOOA 4DVZA 1LI7A 1PD0A 2WZFA 4JIOA 5DQZA 5GPGB 4U5DE 4EHPA 1Y4CA 1OCOC 3JZ0A 3C18A 2R25A 4BG0A 4DVYP 1D0ZA 4XPXA 1ORJA 4U9EA 3A9CA 3AG3C 3SYNA 3LUTB 2PNOA 4YL3A 2Y3GA 3ASOC 4W8PA 4GYTA 1U0BB 5FZTA 2XL4A 4U5HA 3KL4A 4C7OB 1BR1A 1MNEA 2LD6A 4CDAA 3L8IA 4YN0B 2UUHA 5TJ5E 2YVKA 1YZCA 3QZCA 1ZU4A 3U8PA 3V7OA 5L0CA 4FESA 1V74B 4JCHA 2L81A 3ZQYA 1HW2A 3TJ6A 1TKNA 4OIQF 1NU7D 2CGEA 1AEPA 4EBBA 3GODA 2FAPB 3E70C 1WN0A 2J8WA 4MNDA 5COGA 4BEMJ 2W9YA 4L6RA 4C3EA 3QW1A 3R2PA 4J30B 2QY9A 2QTVA 4XPWA 1RKCA 2XLDA 3QVZA 1OKKA 2UUIA 3IQ6A 4BJ1A 2OKUA 4ZLCA 2HV7A 3I5QA 5HSWA 4D4NA 4C3BA 1IZMA 1Q0MA 5AC5A 4PJMA 2B0JA 4AK9A 2PF4E 2J9WA 4LLCA 4P9FA 3IQTA 4U5GA 5DLJA 3C62A 2XXAA 1XZQA 2LP4A 2MWQA 1JPNA 1T01A 2ZXPA 2BC5A 2NG1A 1M56C 3JSZA 3AQCA 3MX3A 1BZ4A 5T3TA 4BEJA 1JOGA 2NUTA 1D1AA 2HV6A 2R7QA 3C8ZA 3RF3A 3SXMA 2M4EA 3BEHA 5JVEA 5L3QA 3HNJA 2VCCA 3KYIA 1ZHZA 3WAQA 2YZSA 1YYJA 4ULVA 4XEVA 3CAXA 5A6BA 3S90A 2M64A 3EFOB 4X0RA 1LS1A 3DZAA 3UMKA 3ITFA 5KYNA 2VB6A 1I4ZA 3DM5A 1QSPA 3JSEO 4XLNF 5EGYA 1OCZC 1SR2A 5L0GA 1WOLA 2ZD9A 5KYXA 1S7ZA 1TFOB 4YK5A 2ZXWC 1D0XA 3ASNC 4ANJA 4EWCA 1OXKA 5B3IA 2Y39A 1WASA 2P1AA 1U6HA 2NSFA 4JJGA 4KBLA 2Y3HA 2HJ3A 3GM1A 4PACA 1NLXA 2A1DD 4JTCB 2AVKA 4N6HA 2FGYA 3VYWA 4CS9A 2GDCA 1A41A 4DRJB 3KPHA 1V4AA 2YL3A 3EJNA 5KYYB 2I8BA 3RFYA 3B0VC 1TQGA 1EQ1A 2A69F 3ZTMA 5CIVA 4EBJA 4AE4A 5JP7A 3MYFA 1MMGA 5A6JA 1FNTc 3U8VA 5CI8A 3L1MA 3MFNA 3N2ZB 3NKEA 3GEIA 4LDQA 4D4XA 4E0HA 2KW3C 5K0IA 1LE4A 2OQMA 3PCVA 5JUAA 2IXNA 5JLIA 4C7OA 3UGOA 1Z5ZA 2HFIA 1A7VA 2WVNA 4JTAB 3U3FA 1JPJA 1M57C 3JCUQ 4IAOA 4IJJA 2TMVP 1MMDA 4Z9JA 4BJ5A 1BBHA 2O9XA 3AJMA 3SNHA 4PFPA 4ONSA 1Z6AA 2R7VA 2EPKX 4CS7A 3JRTA 4JURI 3DMDA 1QQ3A 4K7BA 2CCYA 3HLZA 1Q0DA 1OCCC 5AGFA 1J8YF 2XLOA 4GEHA 4Q7CA 1LI5A 2GA0A 3AOUA 2RSEB 1LKXA 2Y3BA 2ICWG 1H9GA 2R03A 3Q6MA 2AU5A 4JRZA 5E33A 4BPMA 4B6IA 4JC7A 2CNWA 1Q0KA 3FOPA 2GWWA 4QI0A 2HZ8A 3EPVA 5JT4A 3B9QA 2Q9AA 3LEVA 4JZAA 4U5BE 3EGXB 3RVYA 4AE4B 2ZXRA 4NTAA 3DKAA 4BJ5C 2XS1A 1HE9A 4OD5A 5BQGA 4LDKA 2J45A 3S0XA 2A68F 3M79A 3RYLA 4ZLDA 3KKBA 1EI7A 1WATA 2LQGA 4IWBA 3WG7C 5DS5A 4CSAC 1WWPA 2XLMA 4I1MA 1R4TA 3HNKA 4WJ0A 5E3AA 4BJ6A 2G3VA 3VAYA 2XRHA 1HE1A 2P6VA 2DI3A 2VC9A 4YL0A 2EPOA 2YLGA 3DXJF 3VRCA 4QI2A 4OIOF 1JRAA 3U2MA 2X0CA 4J32B 1M2OA 3WHNA 4MQ9F 3Q7LA 1RXQA 5DQTA 2EPMX 4CJOA 2LSEA 3Q7GA 4M63A 3FVYA 4PJLA 4XWJA 3DE9A 2W4MA 2YHSA 4U5FE 3T4RA 2Q9BA 3R7CA 3LLIA 3IPMO 2IOQA 5COMA 1T5OA 1TR2A 1LM3B 1ZW2A 2OOCA 4AL1A 3ZIBA 1ST6A 1YA7O 3AGTA 4MTFA 3O6XA 3UR3C 1G4US 1YVIA 1YZAA 2Q3TA 3IQCA 2CYDA 4NQFA 5E2QA 2IXPA 2VCBA 4I1OB 1HMOA 2HMZA 1BDJB 1KU2A 3ZWIA 2YWAA 3I5PA 3UGPA 1LS4A 3W8IA 2Q00A 2VASA 2PFDA 3GEHA 2KSFA 1FTSA 4N4WA 3VF0A 2YEVA 3C8GB 4MVOA 2HS5A 2YLIA 1N1CA 4JW1A 3DD7A 4LLEA 3ZG1A 3JT1A 4E7SA 3S84A 2C03A 3DAFA 3EGDB 1YARO 2EPLX 3L8JA 4NTFA 3L0IA 3ZTZA 3LESA 3PHF2 4HE8D 3S27A 1NU9C 5E3CA 1RJ9A 2A0UA 4R32A 5L0DA 4KI2A 4UDVA 1FMWA 1FAPB 2OCCC 1F1MA 2OU6A 2VCAA 5B3SC 1RCPA 4MW8A 3M4CA 4LDRA 2PBEA 4F4BA 2J9UA 3NMIA 4MVSA 2I15A 2MYSA 1TFKB 5BUOA 3L34A 4W8KA 4OINF 2G62A 4IARA 4XQ1A 3V5XA 2WVQA 5DS6A 2FFHA 5B1AC 2DB4A 1RJ9B 2EIKC 4NC3A 3WODF 4IAQA 2XL6A 3E9VA 4XEKA 5EK0A 1YDIA 3O39A 1G8XA 5KYWA 3AG2C 2XLVA 3K1IC 1ZZPA 1R5ID 3G4XA 4MS2A 3T6JA 3J06A 1J8MF 3DWWA 4PR9A 1Z23A 3QW0A 1T6QA 5F5HA 3UNGC 5HV9A 3S9OA 3ATPA 3SXZA 4ER9A 2XM4A 4CSAA 2J46A 2JX0A 1Q0FA 4P6IC 1OCRC 4J7YA 3Q6NA 2W4BA 1BR2A 4JKVA 2RD9A 3GWNA 2DGJA 4O6NA 1VYIA 1S05A 5L0HA 2KYHA 1U89A 2GFHA 1TWGA 1O3UA 5KYYA 2VH3A 2EIJC 1MQVA 1RKEA 4LACB 5L3VA 3GM2A 3LS0A 1FFHA 4NTBA 1B68A 1BR4A 3EGDA 4RBNA 1C02A 1PV3A 1V55C 1CPQA 1SMYF 2C04A 3GORA 3NG1A 3RQFA 5DS4A 4U5CE 2V3CC 1ZVZA 2NUPB 3CZ6A 1MMAA 1YA9A 3NYLA 2P0NA 3EGXA 4N06A 5DVWA 5T3WA 3U3BA 4XEFA 5KYXB 4JVSA 1H9TA 3LEOA 1Z3IX 3N0TA 2EPNA 2WZGA 1CGME 2CW0F 1LE2A 4N6CA 1YLMA 4XPYA 1SF8A 3KYJA 2AWCA 3NRHA 4K0DA 3K7DA 5F28E 4AL0A 4FWVA 3OA1A 3OWTA 1RMVA 1LPEA 4HFKB 2XM0A 3QTHA 4MVZA 2AP3A 1UFBA 1DOWA 1QPUA 1K05A 4XTKA 3HTKC 5L0FA 5BQIA 4MTOA 3K1IA 4MVQA 1TWHA 3AQBA 2R7WA 4OIRF 1OXBA 2L6GA 4O6YA 4PJJA 1E86A 3DAGA 1VLSA 1V54C 1C03A 3T6GB 2HKVA 5A6BD 2HSBA 1T6UA 3RVZA 3NKDA 3S29A 3SZRA 5JS5A 1LVKA 4G7ZF 2OJQA 3RH3A 1DOVA 5IY5C 1ZHXA 2H7BA 4BJ6C 2ASRA 1VMAA 4YJWA 3C63A 1M6TA 1W2WA 1XWJA 2P7VA 1Q0GA 4JCZA 3M1CB 1NSGB 3DE8A 3SXYA 3EHMA 4AX2A 5KYUA 4A2NB 1K04A 2IM8A 256BA 2NPUA 4CDYA 4E7ZA 3ECSA 2JD3A 4EUKB 1E84A 3U0CA 3LLKA 2J7PA 1ZHWA 2L7AA 2LCHA 4NCQA 2Q4FA 1Z63A 3S28A 3TK0A 4DRIB 2P61A 4RDAA 5EHHA 5KYUB 1MMNA 4O79A 2XS8A 2R9RB 4CS8A 4EIYA 4JJFA 1HW1A 4DBQA 4NY3A 1JR8A 4QDLA 5AC4A 4JEBA 3FXHA 3FAPB 3TJ5A 3ABLC 3DJNB 2EIMC 1VLTA 3AG4C 3HNLA 3F46A 3MLGA 1CPRA 1L3PA 2Y3DA 3U2LA 1GM5A 3O10A 4CBEA 1EKYA 2EILC 1ORSC 2KK1A 2J0WA 3ZVRA 3MYIA 3IHUA 4YT2A 4JE9A 4CX9A 3JTLO 4RD9A 2A6HF 4YT4A 2CNWD 4WABA 2J9BA 2YKZA 1GQAA 2L9JA 3EH2A 3TOMA 2WB7A 5L0JA 3W2WA 1VB5A 3FDQA 2NSGA 3GEEA 3FHDA 3QMKA 3RKOF 2Q9CA 1XZPA 5L0IA 4KC9A 2HSQA 2KNHA 3B71A 2R7RA 4FX5A 3DM9B 3K6BA 3NYMA 1NG1A 1OR3A 3C8GD 4K1OA 1H7IA 1G5ZA 2D4UA 1O87A 1SZIA 3PDMP 3JRMO 1A0BA 3EHNA 3LAYA 2L6HA 2DYRC 4YL1A 1FMVA 1KTMA 1VTMP 1OR2A 2H7OA 2OEVA 1E85A 1I4YA 3FMSA 2LK4A 1YYXA 5D91A 5A6KA 4U9DA 3RIPA 3H65A 2YRFA 1NBBA 1AVOB 1PCXA 1YAUO 2R05A 2ETSA 3JYHA 4ULWA 2PX0A 3I4UA 1HY5A 3EG9A 2XSEA 2YQYA 3W8HA 3F47A 2R7XA 3TQOA 3HJCA 2D5RB 4MVUA 3OEOA 3W2VA 3B29A 1T6IA 3SXKA 1K40A 5B1BC 3RW0A 4CDVA 4KNWA 3EQLF 2ZXOA 4WGYA 3TOLA 3TULA 2Z15A 3B0PA 2XXAB 3NYJA 4MVRA 3EZHA 3M4BA 2NUPA 3EH1A 1D0YA 2QUPA 2PX3A 4GQHA 2Y69C 4IGGA 3T6BA 3K66A 1ORYA 1T9KA 2JPUA 3IQ5A 4DBRA 5A6AA 1FR0A 1PD1A 1NFNA 3BRJA 3ABKC 2OJED 3K1HA 1JAFA 2W45A 2XL8A 2YL0A 3RQEA 3IEEA 4DXWA 4E18A 2KQ9A 4MTGA 2R7UA 2R7SA 4Q4ZF 2XLEA 3DI5A 2LFFA 3ZSUA 4G78A 2WZLA 3LNRA 1YJGA 1D1CA 2HMQA 2PP4A 4CS8C 1TWCA 2XLWA 3KMIA 3LS1A 3O55A 1CGNA 2WVOA 4P9TA 1Z7Qc 1OKKD 4U5EE 3SP1A 4HEAJ 2OG2A 2QLAA 4OIPF 2J7PD 2XLHA 2X51A 2J9VA 2HJMA 5T1DB 5KYWB 4DOZA 2B0HA 2G3KA 4WGZA 1FFTC 2Q7RA 1WTYA 2DYSC 2R7OA 4Z9IA 1NFOA 4LERA 2R02A 1OW6A 2F22A 2H7VC 3M15A 3CSKA 3V5YA 1HMDA 3VM6A 5JRAA 2L6FA 4MW3A 3HKKA 5JSLA 3U9JA 2BE5F 3NDBB 4BJTA 1LIHA 3POVA 1JMWA 4KNVA 1M2VA 2J0XA 2LFDA 4YWQA 4C3DA 4XLPF 4PK4A 1WGWA 2GAQA 4PJNA 4O7GA 4H54A 1A7EA 3SEOA 4JEAA 1KNYA 3U9MA 3LJBA 1VK5A 1Y6DA 2CDQA 3HNIA 1CGOA 3K33A 2EINC 4HFFB 3US6A 1VYKA 2E87A 1QKRA 3AG1C 5F5FA 4G0HA 3W4YA 3X2QC 1IW7F 3C7JA 1ZHTA 2A0BA 2MHRA 3EG9B 4OD4A 1EA8A 5COFA 3X1OA 3NMJA 1E2XA 2KC3A 4MVMA 1ZU5A 4CJGA 3C8GA 3N24A 1I5NA 1L7CA 4E0IA 4IRUA 3ZQVA 3UMIA 1NZEA 1APCA 2HUJA 3MBGA 1D1BA 1G4WR 3AGUA 2OEXA 1QZXA 4H4KC 4IB4A 3EFOA 4JTDB 3V5ZA 4EKWA 1UG7A 3JYYA 3DJUB 3H2UA 4I3MA 1O5HA 3A11A 2LIGA 4E17A 1QLEC 2WL8A 2YLDA 3KH2A 4J7TA 1VOMA 3EZIA 3ABMC 2A6EF 2YL1A 4DRHB 1OW8A 2H8AA 3NMKA 2R7TA 4G7HF 4G7OF 2IYLD 1GS9A 4Q5SF 1A7DA 1AUEA 1SYQA 3RQGA 4A4AA 4I44A 3UMHA 1OW7A 4CIPA 3GM3A 2ZPAA 1ZW3A 4Z9HA 3H2VA 4CS9C 3FAJA 1H6GA 1GGQA 2YL7A 1M2VB 2IXOA 4O6MA 4PFOA 4CIHA 3T9OA 5A69A 1MNDA 1RKEB 2QE9A 2KJGA 2IXMA 1QVXA 2QNLA 5CI9A 4FAPB 3GANA 3LNMB 1TWAA 2V26A 1E83A 1ZYRF 2KGOA 2AWYA 3G4ZA 3ZC4A 5FCLA 4EBKA 3TD7A 2BL2A 4YT5A 3G50A 3ZDLA 3B0UX 2NUTB 3QVYA 4YT8A 5BQHA 3CQZA 3GWLA 3CEXA 1OQCA 1ZHYA 5D92A 2IBFA 3PMRA
chains in the Genus database with same CATH topology
4DVZA 1PD0A 2WZFA 5DQZA 4U5DE 1OCOC 4BG0A 4DVYP 1D0ZA 3AG3C 3SYNA 2Y3GA 3ASOC 4GYTA 2XL4A 4U5HA 3KL4A 4C7OB 1BR1A 1MNEA 3V7OA 4YN0B 3QZCA 1ZU4A 4FESA 4JCHA 2L81A 1TKNA 4OIQF 1NU7D 2CGEA 4EBBA 3GODA 4MNDA 3E70C 2W9YA 4C3EA 4J30B 2QY9A 2QTVA 1OKKA 4BJ1A 4ZLCA 2HV7A 3I5QA 5HSWA 4C3BA 1IZMA 4PJMA 2B0JA 4AK9A 2PF4E 2J9WA 4LLCA 4U5GA 5DLJA 2XXAA 2MWQA 1JPNA 2ZXPA 3JSZA 2NG1A 1M56C 3MX3A 3AQCA 5T3TA 4BEJA 2NUTA 1D1AA 2HV6A 2R7QA 2M4EA 5L3QA 1ZHZA 2YZSA 3UMKA 3EFOB 4X0RA 1LS1A 3DZAA 3ITFA 5KYNA 2VB6A 3DM5A 4XLNF 5EGYA 1OCZC 5KYXA 1S7ZA 2ZXWC 1D0XA 3ASNC 4ANJA 4EWCA 2Y39A 4JJGA 4KBLA 2Y3HA 2A1DD 3VYWA 2FGYA 4CS9A 5KYYB 3EJNA 2I8BA 3RFYA 3B0VC 2A69F 4AE4A 1MMGA 5CI8A 3N2ZB 3NKEA 2KW3C 2IXNA 4C7OA 3UGOA 1Z5ZA 2WVNA 1JPJA 1M57C 3JCUQ 4IAOA 4IJJA 1MMDA 4BJ5A 2O9XA 3SNHA 4PFPA 1Z6AA 2R7VA 4CS7A 3JRTA 4JURI 3DMDA 4K7BA 3HLZA 1OCCC 1J8YF 4GEHA 4Q7CA 5E3AA 4YT8A 2Y3BA 1LKXA 3Q6MA 5E33A 4B6IA 2CNWA 4QI0A 3EPVA 3B9QA 2Q9AA 3LEVA 4JZAA 4U5BE 3EGXB 4AE4B 2ZXRA 4BJ5C 4OD5A 3S0XA 2J45A 2A68F 4ZLDA 3RYLA 3KKBA 4IWBA 3WG7C 5DS5A 4CSAC 4I1MA 4WJ0A 4BJ6A 2G3VA 3VAYA 2XRHA 2P6VA 3DXJF 4QI2A 4OIOF 4J32B 1M2OA 4MQ9F 3Q7LA 5DQTA 2LSEA 3Q7GA 4M63A 3FVYA 4PJLA 4XWJA 2W4MA 2YHSA 4U5FE 3T4RA 2Q9BA 3LLIA 2IOQA 1TR2A 3ZIBA 1ST6A 3O6XA 3UR3C 2Q3TA 5E2QA 2IXPA 4I1OB 1KU2A 3I5PA 3UGPA 3W8IA 2VASA 2PFDA 1FTSA 2YEVA 4JW1A 4LLEA 1N1CA 4E7SA 3DD7A 3ZG1A 3JT1A 2C03A 3DAFA 3EGDB 3L0IA 3LESA 3PHF2 4HE8D 3S27A 1NU9C 5E3CA 1RJ9A 4KI2A 1FMWA 2OCCC 5B3SC 4F4BA 2J9UA 2MYSA 5BUOA 3L34A 4W8KA 4OINF 2G62A 5DS6A 2WVQA 2FFHA 5B1AC 2EIKC 1RJ9B 3WODF 3E9VA 3O39A 1G8XA 5KYWA 3AG2C 3K1IC 3T6JA 1J8MF 1Z23A 3UNGC 5F5HA 4CSAA 2J46A 4P6IC 1OCRC 3Q6NA 2W4BA 1BR2A 2DGJA 4O6NA 1VYIA 2GFHA 1TWGA 5KYYA 2VH3A 2EIJC 4LACB 5L3VA 3LS0A 1FFHA 1BR4A 3EGDA 4RBNA 1V55C 5DS4A 2C04A 1SMYF 3NG1A 2V3CC 4U5CE 2NUPB 3CZ6A 1MMAA 3NYLA 3EGXA 4N06A 5DVWA 5T3WA 5KYXB 4JVSA 1Z3IX 3N0TA 2WZGA 2CW0F 1SF8A 3NRHA 4K0DA 3K7DA 4FWVA 3OA1A 3OWTA 4HFKB 4XTKA 3HTKC 1TWHA 3AQBA 2R7WA 4OIRF 4PJJA 4O6YA 3DAGA 1V54C 3S29A 3NKDA 3SZRA 4G7ZF 1LVKA 3RH3A 5IY5C 1ZHXA 2H7BA 4BJ6C 1VMAA 4YJWA 1W2WA 2P7VA 3M1CB 3EHMA 4AX2A 5KYUA 4A2NB 4E7ZA 3ECSA 2JD3A 3LLKA 2J7PA 1ZHWA 1Z63A 3S28A 4RDAA 5EHHA 5KYUB 1MMNA 4O79A 4CS8A 4JJFA 4DBQA 4NY3A 4QDLA 3ABLC 3DJNB 2EIMC 3AG4C 3F46A 3MLGA 2Y3DA 4CBEA 2EILC 2J0WA 3ZVRA 4YT2A 4RD9A 2A6HF 4YT4A 2CNWD 3EH2A 2L9JA 2WB7A 3W2WA 3FDQA 3FHDA 3QMKA 3RKOF 2Q9CA 4KC9A 2KNHA 2R7RA 4FX5A 3DM9B 3K6BA 3NYMA 1NG1A 1O87A 1SZIA 3LAYA 3EHNA 2DYRC 1FMVA 2H7OA 5D91A 3RIPA 3H65A 1PCXA 4ULWA 3JYHA 2PX0A 3I4UA 3EG9A 2XSEA 3W8HA 3F47A 2R7XA 3HJCA 2D5RB 3OEOA 3W2VA 5B1BC 4KNWA 3EQLF 2ZXOA 2XXAB 2Z15A 3B0PA 3NYJA 3EZHA 2NUPA 3EH1A 1D0YA 2PX3A 2Y69C 3T6BA 3K66A 4DBRA 1PD1A 3ABKC 3K1HA 2W45A 3IEEA 2KQ9A 2R7UA 2R7SA 4Q4ZF 3ZSUA 2WZLA 3LNRA 1D1CA 2PP4A 4CS8C 1TWCA 3KMIA 3LS1A 2WVOA 1OKKD 4U5EE 3SP1A 4HEAJ 2OG2A 4OIPF 2J7PD 2X51A 2J9VA 5T1DB 5KYWB 2G3KA 1FFTC 2DYSC 2R7OA 4LERA 2H7VC 3CSKA 2BE5F 3NDBB 4BJTA 3POVA 4KNVA 1M2VA 2J0XA 4YWQA 4C3DA 4XLPF 4PK4A 1WGWA 4PJNA 4O7GA 3SEOA 3LJBA 1VK5A 2CDQA 3K33A 4HFFB 4DOZA 2EINC 5F5FA 1VYKA 2E87A 3AG1C 4G0HA 3X2QC 1IW7F 1ZHTA 3EG9B 4OD4A 3X1OA 1ZU5A 3N24A 4IRUA 3UMIA 1NZEA 4H4KC 1D1BA 1QZXA 3EFOA 4I3MA 3DJUB 1O5HA 1QLEC 2WL8A 3KH2A 1VOMA 3EZIA 3ABMC 2A6EF 2R7TA 4G7HF 4G7OF 2IYLD 4Q5SF 4I44A 3UMHA 2ZPAA 4CS9C 3FAJA 4O6MA 4CIHA 1M2VB 2IXOA 4PFOA 1MNDA 2KJGA 2IXMA 5CI9A 3GANA 1TWAA 2V26A 1ZYRF 2KGOA 3ZC4A 5FCLA 3TD7A 4YT5A 3B0UX 2NUTB 3CQZA 1ZHYA 5D92A 3PMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3V A; 
#chains in the Genus database with same CATH topology
 3U5S A;  1C17 M;  4DJ9 A;  3FOO A;  4DVZ A;  1LI7 A;  1PD0 A;  2WZF A;  4JIO A;  5DQZ A;  5GPG B;  4U5D E;  4EHP A;  1Y4C A;  1OCO C;  3JZ0 A;  3C18 A;  2R25 A;  4BG0 A;  4DVY P;  1D0Z A;  4XPX A;  1ORJ A;  4U9E A;  3A9C A;  3AG3 C;  3SYN A;  3LUT B;  2PNO A;  4YL3 A;  2Y3G A;  3ASO C;  4W8P A;  4GYT A;  1U0B B;  5FZT A;  2XL4 A;  4U5H A;  3KL4 A;  4C7O B;  1BR1 A;  1MNE A;  2LD6 A;  4CDA A;  3L8I A;  4YN0 B;  2UUH A;  5TJ5 E;  2YVK A;  1YZC A;  3QZC A;  1ZU4 A;  3U8P A;  3V7O A;  5L0C A;  4FES A;  1V74 B;  4JCH A;  2L81 A;  3ZQY A;  1HW2 A;  3TJ6 A;  1TKN A;  4OIQ F;  1NU7 D;  2CGE A;  1AEP A;  4EBB A;  3GOD A;  2FAP B;  3E70 C;  1WN0 A;  2J8W A;  4MND A;  5COG A;  4BEM J;  2W9Y A;  4L6R A;  4C3E A;  3QW1 A;  3R2P A;  4J30 B;  2QY9 A;  2QTV A;  4XPW A;  1RKC A;  2XLD A;  3QVZ A;  1OKK A;  2UUI A;  3IQ6 A;  4BJ1 A;  2OKU A;  4ZLC A;  2HV7 A;  3I5Q A;  5HSW A;  4D4N A;  4C3B A;  1IZM A;  1Q0M A;  5AC5 A;  4PJM A;  2B0J A;  4AK9 A;  2PF4 E;  2J9W A;  4LLC A;  4P9F A;  3IQT A;  4U5G A;  5DLJ A;  3C62 A;  2XXA A;  1XZQ A;  2LP4 A;  2MWQ A;  1JPN A;  1T01 A;  2ZXP A;  2BC5 A;  2NG1 A;  1M56 C;  3JSZ A;  3AQC A;  3MX3 A;  1BZ4 A;  5T3T A;  4BEJ A;  1JOG A;  2NUT A;  1D1A A;  2HV6 A;  2R7Q A;  3C8Z A;  3RF3 A;  3SXM A;  2M4E A;  3BEH A;  5JVE A;  5L3Q A;  3HNJ A;  2VCC A;  3KYI A;  1ZHZ A;  3WAQ A;  2YZS A;  1YYJ A;  4ULV A;  4XEV A;  3CAX A;  5A6B A;  3S90 A;  2M64 A;  3EFO B;  4X0R A;  1LS1 A;  3DZA A;  3UMK A;  3ITF A;  5KYN A;  2VB6 A;  1I4Z A;  3DM5 A;  1QSP A;  3JSE O;  4XLN F;  5EGY A;  1OCZ C;  1SR2 A;  5L0G A;  1WOL A;  2ZD9 A;  5KYX A;  1S7Z A;  1TFO B;  4YK5 A;  2ZXW C;  1D0X A;  3ASN C;  4ANJ A;  4EWC A;  1OXK A;  5B3I A;  2Y39 A;  1WAS A;  2P1A A;  1U6H A;  2NSF A;  4JJG A;  4KBL A;  2Y3H A;  2HJ3 A;  3GM1 A;  4PAC A;  1NLX A;  2A1D D;  4JTC B;  2AVK A;  4N6H A;  2FGY A;  3VYW A;  4CS9 A;  2GDC A;  1A41 A;  4DRJ B;  3KPH A;  1V4A A;  2YL3 A;  3EJN A;  5KYY B;  2I8B A;  3RFY A;  3B0V C;  1TQG A;  1EQ1 A;  2A69 F;  3ZTM A;  5CIV A;  4EBJ A;  4AE4 A;  5JP7 A;  3MYF A;  1MMG A;  5A6J A;  1FNT c;  3U8V A;  5CI8 A;  3L1M A;  3MFN A;  3N2Z B;  3NKE A;  3GEI A;  4LDQ A;  4D4X A;  4E0H A;  2KW3 C;  5K0I A;  1LE4 A;  2OQM A;  3PCV A;  5JUA A;  2IXN A;  5JLI A;  4C7O A;  3UGO A;  1Z5Z A;  2HFI A;  1A7V A;  2WVN A;  4JTA B;  3U3F A;  1JPJ A;  1M57 C;  3JCU Q;  4IAO A;  4IJJ A;  2TMV P;  1MMD A;  4Z9J A;  4BJ5 A;  1BBH A;  2O9X A;  3AJM A;  3SNH A;  4PFP A;  4ONS A;  1Z6A A;  2R7V A;  2EPK X;  4CS7 A;  3JRT A;  4JUR I;  3DMD A;  1QQ3 A;  4K7B A;  2CCY A;  3HLZ A;  1Q0D A;  1OCC C;  5AGF A;  1J8Y F;  2XLO A;  4GEH A;  4Q7C A;  1LI5 A;  2GA0 A;  3AOU A;  2RSE B;  1LKX A;  2Y3B A;  2ICW G;  1H9G A;  2R03 A;  3Q6M A;  2AU5 A;  4JRZ A;  5E33 A;  4BPM A;  4B6I A;  4JC7 A;  2CNW A;  1Q0K A;  3FOP A;  2GWW A;  4QI0 A;  2HZ8 A;  3EPV A;  5JT4 A;  3B9Q A;  2Q9A A;  3LEV A;  4JZA A;  4U5B E;  3EGX B;  3RVY A;  4AE4 B;  2ZXR A;  4NTA A;  3DKA A;  4BJ5 C;  2XS1 A;  1HE9 A;  4OD5 A;  5BQG A;  4LDK A;  2J45 A;  3S0X A;  2A68 F;  3M79 A;  3RYL A;  4ZLD A;  3KKB A;  1EI7 A;  1WAT A;  2LQG A;  4IWB A;  3WG7 C;  5DS5 A;  4CSA C;  1WWP A;  2XLM A;  4I1M A;  1R4T A;  3HNK A;  4WJ0 A;  5E3A A;  4BJ6 A;  2G3V A;  3VAY A;  2XRH A;  1HE1 A;  2P6V A;  2DI3 A;  2VC9 A;  4YL0 A;  2EPO A;  2YLG A;  3DXJ F;  3VRC A;  4QI2 A;  4OIO F;  1JRA A;  3U2M A;  2X0C A;  4J32 B;  1M2O A;  3WHN A;  4MQ9 F;  3Q7L A;  1RXQ A;  5DQT A;  2EPM X;  4CJO A;  2LSE A;  3Q7G A;  4M63 A;  3FVY A;  4PJL A;  4XWJ A;  3DE9 A;  2W4M A;  2YHS A;  4U5F E;  3T4R A;  2Q9B A;  3R7C A;  3LLI A;  3IPM O;  2IOQ A;  5COM A;  1T5O A;  1TR2 A;  1LM3 B;  1ZW2 A;  2OOC A;  4AL1 A;  3ZIB A;  1ST6 A;  1YA7 O;  3AGT A;  4MTF A;  3O6X A;  3UR3 C;  1G4U S;  1YVI A;  1YZA A;  2Q3T A;  3IQC A;  2CYD A;  4NQF A;  5E2Q A;  2IXP A;  2VCB A;  4I1O B;  1HMO A;  2HMZ A;  1BDJ B;  1KU2 A;  3ZWI A;  2YWA A;  3I5P A;  3UGP A;  1LS4 A;  3W8I A;  2Q00 A;  2VAS A;  2PFD A;  3GEH A;  2KSF A;  1FTS A;  4N4W A;  3VF0 A;  2YEV A;  3C8G B;  4MVO A;  2HS5 A;  2YLI A;  1N1C A;  4JW1 A;  3DD7 A;  4LLE A;  3ZG1 A;  3JT1 A;  4E7S A;  3S84 A;  2C03 A;  3DAF A;  3EGD B;  1YAR O;  2EPL X;  3L8J A;  4NTF A;  3L0I A;  3ZTZ A;  3LES A;  3PHF 2;  4HE8 D;  3S27 A;  1NU9 C;  5E3C A;  1RJ9 A;  2A0U A;  4R32 A;  5L0D A;  4KI2 A;  4UDV A;  1FMW A;  1FAP B;  2OCC C;  1F1M A;  2OU6 A;  2VCA A;  5B3S C;  1RCP A;  4MW8 A;  3M4C A;  4LDR A;  2PBE A;  4F4B A;  2J9U A;  3NMI A;  4MVS A;  2I15 A;  2MYS A;  1TFK B;  5BUO A;  3L34 A;  4W8K A;  4OIN F;  2G62 A;  4IAR A;  4XQ1 A;  3V5X A;  2WVQ A;  5DS6 A;  2FFH A;  5B1A C;  2DB4 A;  1RJ9 B;  2EIK C;  4NC3 A;  3WOD F;  4IAQ A;  2XL6 A;  3E9V A;  4XEK A;  5EK0 A;  1YDI A;  3O39 A;  1G8X A;  5KYW A;  3AG2 C;  2XLV A;  3K1I C;  1ZZP A;  1R5I D;  3G4X A;  4MS2 A;  3T6J A;  3J06 A;  1J8M F;  3DWW A;  4PR9 A;  1Z23 A;  3QW0 A;  1T6Q A;  5F5H A;  3UNG C;  5HV9 A;  3S9O A;  3ATP A;  3SXZ A;  4ER9 A;  2XM4 A;  4CSA A;  2J46 A;  2JX0 A;  1Q0F A;  4P6I C;  1OCR C;  4J7Y A;  3Q6N A;  2W4B A;  1BR2 A;  4JKV A;  2RD9 A;  3GWN A;  2DGJ A;  4O6N A;  1VYI A;  1S05 A;  5L0H A;  2KYH A;  1U89 A;  2GFH A;  1TWG A;  1O3U A;  5KYY A;  2VH3 A;  2EIJ C;  1MQV A;  1RKE A;  4LAC B;  5L3V A;  3GM2 A;  3LS0 A;  1FFH A;  4NTB A;  1B68 A;  1BR4 A;  3EGD A;  4RBN A;  1C02 A;  1PV3 A;  1V55 C;  1CPQ A;  1SMY F;  2C04 A;  3GOR A;  3NG1 A;  3RQF A;  5DS4 A;  4U5C E;  2V3C C;  1ZVZ A;  2NUP B;  3CZ6 A;  1MMA A;  1YA9 A;  3NYL A;  2P0N A;  3EGX A;  4N06 A;  5DVW A;  5T3W A;  3U3B A;  4XEF A;  5KYX B;  4JVS A;  1H9T A;  3LEO A;  1Z3I X;  3N0T A;  2EPN A;  2WZG A;  1CGM E;  2CW0 F;  1LE2 A;  4N6C A;  1YLM A;  4XPY A;  1SF8 A;  3KYJ A;  2AWC A;  3NRH A;  4K0D A;  3K7D A;  5F28 E;  4AL0 A;  4FWV A;  3OA1 A;  3OWT A;  1RMV A;  1LPE A;  4HFK B;  2XM0 A;  3QTH A;  4MVZ A;  2AP3 A;  1UFB A;  1DOW A;  1QPU A;  1K05 A;  4XTK A;  3HTK C;  5L0F A;  5BQI A;  4MTO A;  3K1I A;  4MVQ A;  1TWH A;  3AQB A;  2R7W A;  4OIR F;  1OXB A;  2L6G A;  4O6Y A;  4PJJ A;  1E86 A;  3DAG A;  1VLS A;  1V54 C;  1C03 A;  3T6G B;  2HKV A;  5A6B D;  2HSB A;  1T6U A;  3RVZ A;  3NKD A;  3S29 A;  3SZR A;  5JS5 A;  1LVK A;  4G7Z F;  2OJQ A;  3RH3 A;  1DOV A;  5IY5 C;  1ZHX A;  2H7B A;  4BJ6 C;  2ASR A;  1VMA A;  4YJW A;  3C63 A;  1M6T A;  1W2W A;  1XWJ A;  2P7V A;  1Q0G A;  4JCZ A;  3M1C B;  1NSG B;  3DE8 A;  3SXY A;  3EHM A;  4AX2 A;  5KYU A;  4A2N B;  1K04 A;  2IM8 A;  256B A;  2NPU A;  4CDY A;  4E7Z A;  3ECS A;  2JD3 A;  4EUK B;  1E84 A;  3U0C A;  3LLK A;  2J7P A;  1ZHW A;  2L7A A;  2LCH A;  4NCQ A;  2Q4F A;  1Z63 A;  3S28 A;  3TK0 A;  4DRI B;  2P61 A;  4RDA A;  5EHH A;  5KYU B;  1MMN A;  4O79 A;  2XS8 A;  2R9R B;  4CS8 A;  4EIY A;  4JJF A;  1HW1 A;  4DBQ A;  4NY3 A;  1JR8 A;  4QDL A;  5AC4 A;  4JEB A;  3FXH A;  3FAP B;  3TJ5 A;  3ABL C;  3DJN B;  2EIM C;  1VLT A;  3AG4 C;  3HNL A;  3F46 A;  3MLG A;  1CPR A;  1L3P A;  2Y3D A;  3U2L A;  1GM5 A;  3O10 A;  4CBE A;  1EKY A;  2EIL C;  1ORS C;  2KK1 A;  2J0W A;  3ZVR A;  3MYI A;  3IHU A;  4YT2 A;  4JE9 A;  4CX9 A;  3JTL O;  4RD9 A;  2A6H F;  4YT4 A;  2CNW D;  4WAB A;  2J9B A;  2YKZ A;  1GQA A;  2L9J A;  3EH2 A;  3TOM A;  2WB7 A;  5L0J A;  3W2W A;  1VB5 A;  3FDQ A;  2NSG A;  3GEE A;  3FHD A;  3QMK A;  3RKO F;  2Q9C A;  1XZP A;  5L0I A;  4KC9 A;  2HSQ A;  2KNH A;  3B71 A;  2R7R A;  4FX5 A;  3DM9 B;  3K6B A;  3NYM A;  1NG1 A;  1OR3 A;  3C8G D;  4K1O A;  1H7I A;  1G5Z A;  2D4U A;  1O87 A;  1SZI A;  3PDM P;  3JRM O;  1A0B A;  3EHN A;  3LAY A;  2L6H A;  2DYR C;  4YL1 A;  1FMV A;  1KTM A;  1VTM P;  1OR2 A;  2H7O A;  2OEV A;  1E85 A;  1I4Y A;  3FMS A;  2LK4 A;  1YYX A;  5D91 A;  5A6K A;  4U9D A;  3RIP A;  3H65 A;  2YRF A;  1NBB A;  1AVO B;  1PCX A;  1YAU O;  2R05 A;  2ETS A;  3JYH A;  4ULW A;  2PX0 A;  3I4U A;  1HY5 A;  3EG9 A;  2XSE A;  2YQY A;  3W8H A;  3F47 A;  2R7X A;  3TQO A;  3HJC A;  2D5R B;  4MVU A;  3OEO A;  3W2V A;  3B29 A;  1T6I A;  3SXK A;  1K40 A;  5B1B C;  3RW0 A;  4CDV A;  4KNW A;  3EQL F;  2ZXO A;  4WGY A;  3TOL A;  3TUL A;  2Z15 A;  3B0P A;  2XXA B;  3NYJ A;  4MVR A;  3EZH A;  3M4B A;  2NUP A;  3EH1 A;  1D0Y A;  2QUP A;  2PX3 A;  4GQH A;  2Y69 C;  4IGG A;  3T6B A;  3K66 A;  1ORY A;  1T9K A;  2JPU A;  3IQ5 A;  4DBR A;  5A6A A;  1FR0 A;  1PD1 A;  1NFN A;  3BRJ A;  3ABK C;  2OJE D;  3K1H A;  1JAF A;  2W45 A;  2XL8 A;  2YL0 A;  3RQE A;  3IEE A;  4DXW A;  4E18 A;  2KQ9 A;  4MTG A;  2R7U A;  2R7S A;  4Q4Z F;  2XLE A;  3DI5 A;  2LFF A;  3ZSU A;  4G78 A;  2WZL A;  3LNR A;  1YJG A;  1D1C A;  2HMQ A;  2PP4 A;  4CS8 C;  1TWC A;  2XLW A;  3KMI A;  3LS1 A;  3O55 A;  1CGN A;  2WVO A;  4P9T A;  1Z7Q c;  1OKK D;  4U5E E;  3SP1 A;  4HEA J;  2OG2 A;  2QLA A;  4OIP F;  2J7P D;  2XLH A;  2X51 A;  2J9V A;  2HJM A;  5T1D B;  5KYW B;  4DOZ A;  2B0H A;  2G3K A;  4WGZ A;  1FFT C;  2Q7R A;  1WTY A;  2DYS C;  2R7O A;  4Z9I A;  1NFO A;  4LER A;  2R02 A;  1OW6 A;  2F22 A;  2H7V C;  3M15 A;  3CSK A;  3V5Y A;  1HMD A;  3VM6 A;  5JRA A;  2L6F A;  4MW3 A;  3HKK A;  5JSL A;  3U9J A;  2BE5 F;  3NDB B;  4BJT A;  1LIH A;  3POV A;  1JMW A;  4KNV A;  1M2V A;  2J0X A;  2LFD A;  4YWQ A;  4C3D A;  4XLP F;  4PK4 A;  1WGW A;  2GAQ A;  4PJN A;  4O7G A;  4H54 A;  1A7E A;  3SEO A;  4JEA A;  1KNY A;  3U9M A;  3LJB A;  1VK5 A;  1Y6D A;  2CDQ A;  3HNI A;  1CGO A;  3K33 A;  2EIN C;  4HFF B;  3US6 A;  1VYK A;  2E87 A;  1QKR A;  3AG1 C;  5F5F A;  4G0H A;  3W4Y A;  3X2Q C;  1IW7 F;  3C7J A;  1ZHT A;  2A0B A;  2MHR A;  3EG9 B;  4OD4 A;  1EA8 A;  5COF A;  3X1O A;  3NMJ A;  1E2X A;  2KC3 A;  4MVM A;  1ZU5 A;  4CJG A;  3C8G A;  3N24 A;  1I5N A;  1L7C A;  4E0I A;  4IRU A;  3ZQV A;  3UMI A;  1NZE A;  1APC A;  2HUJ A;  3MBG A;  1D1B A;  1G4W R;  3AGU A;  2OEX A;  1QZX A;  4H4K C;  4IB4 A;  3EFO A;  4JTD B;  3V5Z A;  4EKW A;  1UG7 A;  3JYY A;  3DJU B;  3H2U A;  4I3M A;  1O5H A;  3A11 A;  2LIG A;  4E17 A;  1QLE C;  2WL8 A;  2YLD A;  3KH2 A;  4J7T A;  1VOM A;  3EZI A;  3ABM C;  2A6E F;  2YL1 A;  4DRH B;  1OW8 A;  2H8A A;  3NMK A;  2R7T A;  4G7H F;  4G7O F;  2IYL D;  1GS9 A;  4Q5S F;  1A7D A;  1AUE A;  1SYQ A;  3RQG A;  4A4A A;  4I44 A;  3UMH A;  1OW7 A;  4CIP A;  3GM3 A;  2ZPA A;  1ZW3 A;  4Z9H A;  3H2V A;  4CS9 C;  3FAJ A;  1H6G A;  1GGQ A;  2YL7 A;  1M2V B;  2IXO A;  4O6M A;  4PFO A;  4CIH A;  3T9O A;  5A69 A;  1MND A;  1RKE B;  2QE9 A;  2KJG A;  2IXM A;  1QVX A;  2QNL A;  5CI9 A;  4FAP B;  3GAN A;  3LNM B;  1TWA A;  2V26 A;  1E83 A;  1ZYR F;  2KGO A;  2AWY A;  3G4Z A;  3ZC4 A;  5FCL A;  4EBK A;  3TD7 A;  2BL2 A;  4YT5 A;  3G50 A;  3ZDL A;  3B0U X;  2NUT B;  3QVY A;  4YT8 A;  5BQH A;  3CQZ A;  3GWL A;  3CEX A;  1OQC A;  1ZHY A;  5D92 A;  2IBF A;  3PMR A; 
#chains in the Genus database with same CATH homology
 4DVZ A;  1PD0 A;  2WZF A;  5DQZ A;  4U5D E;  1OCO C;  4BG0 A;  4DVY P;  1D0Z A;  3AG3 C;  3SYN A;  2Y3G A;  3ASO C;  4GYT A;  2XL4 A;  4U5H A;  3KL4 A;  4C7O B;  1BR1 A;  1MNE A;  3V7O A;  4YN0 B;  3QZC A;  1ZU4 A;  4FES A;  4JCH A;  2L81 A;  1TKN A;  4OIQ F;  1NU7 D;  2CGE A;  4EBB A;  3GOD A;  4MND A;  3E70 C;  2W9Y A;  4C3E A;  4J30 B;  2QY9 A;  2QTV A;  1OKK A;  4BJ1 A;  4ZLC A;  2HV7 A;  3I5Q A;  5HSW A;  4C3B A;  1IZM A;  4PJM A;  2B0J A;  4AK9 A;  2PF4 E;  2J9W A;  4LLC A;  4U5G A;  5DLJ A;  2XXA A;  2MWQ A;  1JPN A;  2ZXP A;  3JSZ A;  2NG1 A;  1M56 C;  3MX3 A;  3AQC A;  5T3T A;  4BEJ A;  2NUT A;  1D1A A;  2HV6 A;  2R7Q A;  2M4E A;  5L3Q A;  1ZHZ A;  2YZS A;  3UMK A;  3EFO B;  4X0R A;  1LS1 A;  3DZA A;  3ITF A;  5KYN A;  2VB6 A;  3DM5 A;  4XLN F;  5EGY A;  1OCZ C;  5KYX A;  1S7Z A;  2ZXW C;  1D0X A;  3ASN C;  4ANJ A;  4EWC A;  2Y39 A;  4JJG A;  4KBL A;  2Y3H A;  2A1D D;  3VYW A;  2FGY A;  4CS9 A;  5KYY B;  3EJN A;  2I8B A;  3RFY A;  3B0V C;  2A69 F;  4AE4 A;  1MMG A;  5CI8 A;  3N2Z B;  3NKE A;  2KW3 C;  2IXN A;  4C7O A;  3UGO A;  1Z5Z A;  2WVN A;  1JPJ A;  1M57 C;  3JCU Q;  4IAO A;  4IJJ A;  1MMD A;  4BJ5 A;  2O9X A;  3SNH A;  4PFP A;  1Z6A A;  2R7V A;  4CS7 A;  3JRT A;  4JUR I;  3DMD A;  4K7B A;  3HLZ A;  1OCC C;  1J8Y F;  4GEH A;  4Q7C A;  5E3A A;  4YT8 A;  2Y3B A;  1LKX A;  3Q6M A;  5E33 A;  4B6I A;  2CNW A;  4QI0 A;  3EPV A;  3B9Q A;  2Q9A A;  3LEV A;  4JZA A;  4U5B E;  3EGX B;  4AE4 B;  2ZXR A;  4BJ5 C;  4OD5 A;  3S0X A;  2J45 A;  2A68 F;  4ZLD A;  3RYL A;  3KKB A;  4IWB A;  3WG7 C;  5DS5 A;  4CSA C;  4I1M A;  4WJ0 A;  4BJ6 A;  2G3V A;  3VAY A;  2XRH A;  2P6V A;  3DXJ F;  4QI2 A;  4OIO F;  4J32 B;  1M2O A;  4MQ9 F;  3Q7L A;  5DQT A;  2LSE A;  3Q7G A;  4M63 A;  3FVY A;  4PJL A;  4XWJ A;  2W4M A;  2YHS A;  4U5F E;  3T4R A;  2Q9B A;  3LLI A;  2IOQ A;  1TR2 A;  3ZIB A;  1ST6 A;  3O6X A;  3UR3 C;  2Q3T A;  5E2Q A;  2IXP A;  4I1O B;  1KU2 A;  3I5P A;  3UGP A;  3W8I A;  2VAS A;  2PFD A;  1FTS A;  2YEV A;  4JW1 A;  4LLE A;  1N1C A;  4E7S A;  3DD7 A;  3ZG1 A;  3JT1 A;  2C03 A;  3DAF A;  3EGD B;  3L0I A;  3LES A;  3PHF 2;  4HE8 D;  3S27 A;  1NU9 C;  5E3C A;  1RJ9 A;  4KI2 A;  1FMW A;  2OCC C;  5B3S C;  4F4B A;  2J9U A;  2MYS A;  5BUO A;  3L34 A;  4W8K A;  4OIN F;  2G62 A;  5DS6 A;  2WVQ A;  2FFH A;  5B1A C;  2EIK C;  1RJ9 B;  3WOD F;  3E9V A;  3O39 A;  1G8X A;  5KYW A;  3AG2 C;  3K1I C;  3T6J A;  1J8M F;  1Z23 A;  3UNG C;  5F5H A;  4CSA A;  2J46 A;  4P6I C;  1OCR C;  3Q6N A;  2W4B A;  1BR2 A;  2DGJ A;  4O6N A;  1VYI A;  2GFH A;  1TWG A;  5KYY A;  2VH3 A;  2EIJ C;  4LAC B;  5L3V A;  3LS0 A;  1FFH A;  1BR4 A;  3EGD A;  4RBN A;  1V55 C;  5DS4 A;  2C04 A;  1SMY F;  3NG1 A;  2V3C C;  4U5C E;  2NUP B;  3CZ6 A;  1MMA A;  3NYL A;  3EGX A;  4N06 A;  5DVW A;  5T3W A;  5KYX B;  4JVS A;  1Z3I X;  3N0T A;  2WZG A;  2CW0 F;  1SF8 A;  3NRH A;  4K0D A;  3K7D A;  4FWV A;  3OA1 A;  3OWT A;  4HFK B;  4XTK A;  3HTK C;  1TWH A;  3AQB A;  2R7W A;  4OIR F;  4PJJ A;  4O6Y A;  3DAG A;  1V54 C;  3S29 A;  3NKD A;  3SZR A;  4G7Z F;  1LVK A;  3RH3 A;  5IY5 C;  1ZHX A;  2H7B A;  4BJ6 C;  1VMA A;  4YJW A;  1W2W A;  2P7V A;  3M1C B;  3EHM A;  4AX2 A;  5KYU A;  4A2N B;  4E7Z A;  3ECS A;  2JD3 A;  3LLK A;  2J7P A;  1ZHW A;  1Z63 A;  3S28 A;  4RDA A;  5EHH A;  5KYU B;  1MMN A;  4O79 A;  4CS8 A;  4JJF A;  4DBQ A;  4NY3 A;  4QDL A;  3ABL C;  3DJN B;  2EIM C;  3AG4 C;  3F46 A;  3MLG A;  2Y3D A;  4CBE A;  2EIL C;  2J0W A;  3ZVR A;  4YT2 A;  4RD9 A;  2A6H F;  4YT4 A;  2CNW D;  3EH2 A;  2L9J A;  2WB7 A;  3W2W A;  3FDQ A;  3FHD A;  3QMK A;  3RKO F;  2Q9C A;  4KC9 A;  2KNH A;  2R7R A;  4FX5 A;  3DM9 B;  3K6B A;  3NYM A;  1NG1 A;  1O87 A;  1SZI A;  3LAY A;  3EHN A;  2DYR C;  1FMV A;  2H7O A;  5D91 A;  3RIP A;  3H65 A;  1PCX A;  4ULW A;  3JYH A;  2PX0 A;  3I4U A;  3EG9 A;  2XSE A;  3W8H A;  3F47 A;  2R7X A;  3HJC A;  2D5R B;  3OEO A;  3W2V A;  5B1B C;  4KNW A;  3EQL F;  2ZXO A;  2XXA B;  2Z15 A;  3B0P A;  3NYJ A;  3EZH A;  2NUP A;  3EH1 A;  1D0Y A;  2PX3 A;  2Y69 C;  3T6B A;  3K66 A;  4DBR A;  1PD1 A;  3ABK C;  3K1H A;  2W45 A;  3IEE A;  2KQ9 A;  2R7U A;  2R7S A;  4Q4Z F;  3ZSU A;  2WZL A;  3LNR A;  1D1C A;  2PP4 A;  4CS8 C;  1TWC A;  3KMI A;  3LS1 A;  2WVO A;  1OKK D;  4U5E E;  3SP1 A;  4HEA J;  2OG2 A;  4OIP F;  2J7P D;  2X51 A;  2J9V A;  5T1D B;  5KYW B;  2G3K A;  1FFT C;  2DYS C;  2R7O A;  4LER A;  2H7V C;  3CSK A;  2BE5 F;  3NDB B;  4BJT A;  3POV A;  4KNV A;  1M2V A;  2J0X A;  4YWQ A;  4C3D A;  4XLP F;  4PK4 A;  1WGW A;  4PJN A;  4O7G A;  3SEO A;  3LJB A;  1VK5 A;  2CDQ A;  3K33 A;  4HFF B;  4DOZ A;  2EIN C;  5F5F A;  1VYK A;  2E87 A;  3AG1 C;  4G0H A;  3X2Q C;  1IW7 F;  1ZHT A;  3EG9 B;  4OD4 A;  3X1O A;  1ZU5 A;  3N24 A;  4IRU A;  3UMI A;  1NZE A;  4H4K C;  1D1B A;  1QZX A;  3EFO A;  4I3M A;  3DJU B;  1O5H A;  1QLE C;  2WL8 A;  3KH2 A;  1VOM A;  3EZI A;  3ABM C;  2A6E F;  2R7T A;  4G7H F;  4G7O F;  2IYL D;  4Q5S F;  4I44 A;  3UMH A;  2ZPA A;  4CS9 C;  3FAJ A;  4O6M A;  4CIH A;  1M2V B;  2IXO A;  4PFO A;  1MND A;  2KJG A;  2IXM A;  5CI9 A;  3GAN A;  1TWA A;  2V26 A;  1ZYR F;  2KGO A;  3ZC4 A;  5FCL A;  3TD7 A;  4YT5 A;  3B0U X;  2NUT B;  3CQZ A;  1ZHY A;  5D92 A;  3PMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...