2G3VA

Crystal structure of cags (hp0534, cag13) from helicobacter pylori
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
b'KLIESLQENELLNTDEKKKIIDQIKTMHDFFKQMHTNKGALDKVLRNYMKDYRAVIKSIGVDKFKKVYRLLESETMELLHAIAENPNFLFSKFDRSILGIFLPFFSKPIMFKMSIREMDSQIELYGTKLPLLKLFVMTDEEMNFYANLKTIEQYNDYVRDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAG pathogenicity island protein 13
publication title Crystal structure of CagS from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Unknown function
total genus 43
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16707 CagS Cag pathogenicity island protein S of Helicobacter pylori
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2g3vA00
2G3VA
chains in the Genus database with same CATH superfamily
1TWGA 2MYSA 2JD3A 3JTLO 5DVWA 4J7YA 3E9VA 3F47A 3CQZA 2DGJA 1K04A 3GM1A 1B68A 3U9JA 4MVRA 2R7QA 4R32A 4QI2A 3M1CB 2HSBA 3EGDA 1ZW3A 5L0GA 4DRIB 1D1CA 2W4BA 3HJCA 1XZQA 4JIOA 3S28A 5B1BC 3Q6MA 4M63A 3SXKA 1D0XA 3OWTA 4PJMA 2DYRC 1VOMA 1PD0A 4D4XA 2J7PA 3TQOA 3AOUA 1RJ9B 2AWCA 1APCA 2HZ8A 5GPGB 3RVZA 2G62A 1Z6AA 3GWLA 4OIRF 1Z5ZA 1VK5A 2ZXPA 4KC9A 4AE4A 1MMGA 3FAJA 1YA7O 2XLDA 4FWVA 1A41A 3GEHA 2R05A 3UNGC 1AUEA 256BA 2R7UA 3FHDA 3B0PA 3BRJA 4RDAA 4YK5A 5CIVA 1OQCA 2XXAB 1OR2A 3V5ZA 2P1AA 1BR2A 4MTFA 1YARO 1JAFA 1T01A 3LEOA 3JZ0A 2NPUA 1U89A 3T4RA 2R7VA 3I5PA 3ZSUA 2FFHA 4G7OF 4U5DE 1FMVA 1WTYA 3TK0A 3EHMA 3U5SA 5B3IA 4CIHA 1OW6A 4CDAA 4P6IC 2J0WA 3ITFA 3M15A 3NMKA 4PK4A 3NG1A 2QE9A 1WATA 2IXPA 3FOPA 4JVSA 3ECSA 3SP1A 3RH3A 5EGYA 3RYLA 1E85A 2PBEA 4LLCA 4YL3A 3FAPB 4G78A 4DRJB 3TOMA 1H6GA 2VASA 3QVZA 4QDLA 4IARA 2X51A 2RSEB 2J9BA 3ATPA 4DOZA 1PV3A 4HFFB 1K05A 3ABMC 3JSEO 5T3WA 4BEMJ 2IBFA 3IEEA 3DE8A 4LLEA 4NCQA 4JZAA 1RMVA 2HUJA 4MVSA 4JJGA 1KTMA 3LJBA 5JRAA 3QZCA 1MMAA 1OXKA 1Q0KA 1Q0GA 3FXHA 3JYHA 4MTOA 2L6HA 1M57C 1MNEA 3UMIA 1M6TA 1A0BA 2ZXRA 2AP3A 5KYXB 4ER9A 1BDJB 1OXBA 2B0JA 4MW8A 4KNVA 2VCCA 2WVNA 3WODF 3W2VA 1TWCA 4Z9HA 4EKWA 4NTAA 3U8PA 2OJED 4PFOA 2YL3A 5E2QA 2NSFA 5F28E 4A2NB 1Z23A 2A68F 1A7DA 2JPUA 4MVQA 2Q3TA 3V5YA 2NUPA 4N6CA 2L7AA 5JSLA 1WOLA 1HY5A 3Q6NA 1YVIA 4XEKA 1V74B 1NZEA 4J7TA 3M4CA 4O6YA 1FTSA 1YA9A 3A9CA 1OCCC 1FAPB 1UFBA 1YDIA 1NBBA 4CDVA 1M2VA 3C8ZA 4JURI 3NKDA 3LNMB 5DS6A 3SZRA 4I44A 3HNIA 4PR9A 3AG2C 3EG9B 3ZC4A 3DKAA 5BQGA 1AVOB 5KYWB 1OW7A 2PFDA 5D92A 4BPMA 3DM9B 3B29A 2HV6A 4CS9A 5A6JA 3PHF2 3W4YA 4DVZA 2XL8A 4YL1A 3C8GA 1XWJA 3EJNA 4DRHB 3JRMO 4FESA 5TJ5E 5HV9A 3WAQA 2EPNA 4JE9A 1M56C 2CDQA 3NMIA 4AL1A 3I4UA 3E70C 1TWHA 3GODA 1J8MF 4XTKA 2A6HF 2FGYA 1BR4A 3CAXA 3L8IA 2WZFA 1RKEB 4EBBA 1JRAA 3JYYA 5FZTA 1QKRA 4MVMA 1PD1A 3I5QA 1E86A 5AGFA 2YL1A 2YEVA 1ORYA 3O6XA 2XRHA 2C03A 4IWBA 3RIPA 2BC5A 3LS1A 4YWQA 2A0UA 2CW0F 2YRFA 3US6A 3EGDB 4OINF 3ZTMA 1Q0DA 3ASOC 4PJLA 4U9DA 4D4NA 4MS2A 4C3BA 4YJWA 2GFHA 4WGYA 1J8YF 3U9MA 4XLPF 2Q9BA 1KU2A 2IOQA 5EHHA 4CSAA 1YAUO 2ASRA 4O6MA 1TFKB 3NYMA 1T9KA 3QTHA 2J7PD 3U2LA 5L3VA 1OR3A 2Q00A 3DM5A 4BJTA 1O87A 1WGWA 1A7VA 3NYJA 3DE9A 1HE9A 1HW1A 3OEOA 3KKBA 2F22A 1EQ1A 3RKOF 4AE4B 1ZHTA 4F4BA 3LLKA 3CSKA 2E87A 2R9RB 2LSEA 3ZVRA 1HMDA 1QVXA 4NQFA 5JS5A 5KYYA 3B9QA 4H4KC 1MQVA 1OCRC 1XZPA 1A7EA 3EZHA 2DYSC 2KK1A 1RXQA 5L3QA 3LAYA 2OU6A 3RQEA 4BJ6C 1JPNA 2HJ3A 1F1MA 1OKKD 2YZSA 4MTGA 1D1AA 5HSWA 2VCBA 4J32B 1T6IA 4O6NA 5E3CA 5JLIA 4QI0A 2OG2A 3KPHA 3FDQA 3VM6A 2Q7RA 4U9EA 1V54C 3T6JA 1SR2A 3KH2A 1T6QA 4JTAB 3RW0A 4AX2A 5DQTA 4E0IA 3O39A 1KNYA 1Y6DA 2H7BA 2P7VA 2QNLA 3CEXA 4PJNA 1ZU5A 1D0ZA 4G0HA 5K0IA 3PMRA 3O55A 4MQ9F 1WASA 2TMVP 3U3FA 1TKNA 4E17A 1NU9C 1RCPA 3LEVA 3V5XA 1QLEC 4XQ1A 4LACB 3NDBB 1ZHWA 1U6HA 3SEOA 1Q0FA 4O79A 4EHPA 2Y3HA 1VYIA 2A1DD 1OKKA 1GQAA 1ZW2A 4HE8D 4JC7A 4O7GA 5L0IA 3UMKA 3A11A 3S90A 1HW2A 3LS0A 2KW3C 2XS8A 3GEEA 2L81A 1R5ID 2ZXWC 1MMNA 1D0YA 3AQCA 1RKCA 3AGUA 2YKZA 4BJ1A 2LD6A 5L0FA 4L6RA 3JSZA 4ZLCA 3NRHA 2EILC 3KMIA 2J8WA 1VYKA 1E83A 2HMZA 2BL2A 3K1HA 2YWAA 4RBNA 3W8IA 4I1MA 4CX9A 3TULA 1UG7A 2OQMA 1NG1A 3ASNC 3HNJA 4JEAA 1G8XA 5COGA 1BZ4A 1OCZC 4JEBA 4UDVA 3U3BA 4C3DA 5KYNA 4G7ZF 1YZAA 2NUPB 1NFNA 4H54A 1G4US 3DAGA 3T9OA 1BR1A 3MFNA 5E33A 2IM8A 4WJ0A 5JT4A 3EH1A 1IZMA 4LDKA 4JW1A 3BEHA 3AQBA 5T3TA 1FR0A 2MHRA 4EIYA 3HNKA 1L7CA 2M64A 1M2VB 4OD4A 1FNTc 3LESA 1Z7Qc 4YL0A 5F5HA 2H7VC 3C18A 3IPMO 3F46A 5JVEA 3UMHA 2R7XA 1LS4A 4E18A 1GS9A 1TR2A 2KJGA 3PCVA 4OIQF 2HMQA 4XWJA 3AJMA 1YJGA 2LIGA 1DOVA 3C8GB 1MMDA 2XLOA 3C8GD 3K6BA 4FAPB 5BUOA 1CGNA 4EUKB 5L0DA 3VAYA 1MNDA 1Q0MA 5A6AA 1ZHXA 2I8BA 2WZGA 1JOGA 3S9OA 2ICWG 3ZG1A 4JKVA 1K40A 4MVUA 2XM0A 4NTFA 2J0XA 2P61A 4DBQA 5F5FA 4HEAJ 4AL0A 4LDRA 5CI8A 2O9XA 2B0HA 1LI5A 5CI9A 2J46A 4ULVA 3K7DA 2IXNA 3R7CA 3ZIBA 4K0DA 4U5HA 1LS1A 4K1OA 4XPXA 1W2WA 4JTDB 3DMDA 2D5RB 2YQYA 3HTKC 4W8KA 3ABLC 3UR3C 1TQGA 2GA0A 4OIPF 1EKYA 2LFDA 2H8AA 3DI5A 4BEJA 3K1IA 4NY3A 1VB5A 5L0HA 3NKEA 2HV7A 3DD7A 2A0BA 3LUTB 3OA1A 3UGPA 4Q7CA 3EGXA 5BQIA 4U5BE 4YT5A 2LP4A 4CS8A 2Z15A 3EFOA 4BJ5A 3LLIA 1DOWA 2OOCA 2GAQA 2KC3A 2UUHA 3AGTA 3EH2A 3ZQYA 5KYYB 3QW0A 4CJOA 1NFOA 3JCUQ 3MYFA 4C7OA 3U8VA 2ZD9A 1PCXA 4E7ZA 3G4ZA 3N0TA 2Q9AA 4EBJA 2Y3DA 3B0UX 3H2UA 1NU7D 2G3VA 2XM4A 3RVYA 3KYJA 4BG0A 4GQHA 4DBRA 1QQ3A 2H7OA 2L9JA 3S27A 1L3PA 1O5HA 1YZCA 3W8HA 1LKXA 1EI7A 2IXMA 1ORSC 4CS9C 1Y4CA 1ZZPA 2X0CA 3PDMP 1OCOC 3KL4A 1ZYRF 2EPOA 5DQZA 4HFKB 2IYLD 3S0XA 3IQTA 2CYDA 2NG1A 1H7IA 4N6HA 2J9VA 1V4AA 2EIKC 1IW7F 3TD7A 4LDQA 3SNHA 1FFHA 2P6VA 5IY5C 1I5NA 3KYIA 3RQGA 4XLNF 4IAQA 2AU5A 2YVKA 1H9TA 5A6KA 3QW1A 2XSEA 5KYUA 3EPVA 4Z9JA 4B6IA 2KYHA 3AG4C 4KNWA 1YLMA 2VC9A 3L0IA 4WGZA 1HE1A 4K7BA 5T1DB 1LPEA 3NYLA 3H2VA 3MX3A 2YLIA 4ONSA 3TJ5A 4YN0B 1BBHA 2Y39A 1EA8A 2QUPA 3QMKA 4JCHA 5A69A 3ZDLA 2CNWD 3X1OA 4IRUA 4CSAC 2L6FA 2D4UA 4MNDA 4Z9IA 2HKVA 1AEPA 1U0BB 2KSFA 2J9WA 2DB4A 5A6BD 3FOOA 1CGME 1YYJA 2XLMA 1TWAA 3G50A 2UUIA 2HS5A 2NSGA 2OKUA 1E2XA 2W9YA 1VLSA 3U2MA 2YLDA 2J9UA 1LM3B 1GGQA 2GWWA 2QLAA 3IQ6A 5AC5A 2R7OA 4N06A 5E3AA 1LI7A 5FCLA 2ZPAA 1FMWA 5JP7A 1R4TA 2QTVA 1CGOA 2A69F 2YHSA 3ZWIA 3DJUB 2FAPB 3JRTA 5EK0A 3S84A 2V26A 1E84A 5D91A 4MW3A 1I4ZA 1QZXA 3B71A 2Y69C 2VB6A 3C63A 4LERA 1ZHYA 2CNWA 2OJQA 3Q7LA 3DJNB 2Y3GA 2ZXOA 2R03A 3GWNA 3X2QC 2KNHA 5A6BA 2KQ9A 1LVKA 4X0RA 1YYXA 4KI2A 1SF8A 3DWWA 1C03A 3L34A 4AK9A 1JPJA 2J45A 2W45A 4CBEA 4DJ9A 4XPWA 3GANA 2Q9CA 3QVYA 1V55C 4IAOA 1G4WR 4OIOF 4ZLDA 4I1OB 1SYQA 3VYWA 4IJJA 2RD9A 4E7SA 1QSPA 2ETSA 2NUTB 2YL0A 1O3UA 4XPYA 1HMOA 4PFPA 3B0VC 1RJ9A 4ULWA 4U5CE 2W4MA 1JR8A 2LK4A 3HLZA 3S29A 4YT8A 2WB7A 3AG1C 2MWQA 3AG3C 3ZTZA 1T5OA 2AWYA 2XL6A 1I4YA 2A6EF 4XEVA 1T6UA 2IXOA 3FVYA 3SYNA 1NLXA 4GYTA 2PX0A 3LNRA 2PF4E 3EZIA 2XXAA 1QPUA 2KGOA 2WZLA 4C3EA 2L6GA 2EIJC 3RF3A 2G3KA 3TOLA 4W8PA 2WVOA 3CZ6A 2CCYA 5BQHA 3O10A 1WN0A 4U5EE 2JX0A 3EGXB 1ZVZA 3U0CA 3DZAA 5JUAA 4EWCA 1CPQA 3EFOB 1ST6A 3DAFA 2NUTA 4ANJA 1Z3IX 2WVQA 1H9GA 2HSQA 4JJFA 1ZHZA 4U5FE 5DS4A 4CDYA 2I15A 2BE5F 2OCCC 2Y3BA 4NC3A 4C7OB 3MLGA 3VF0A 4E0HA 1FFTC 3N24A 2HJMA 4CJGA 3WG7C 5L0CA 2EINC 3T6BA 3ABKC 4WABA 1VLTA 3JT1A 3FMSA 3R2PA 2LQGA 3SXYA 4DXWA 5COFA 4CS7A 1VTMP 2DI3A 3EQLF 1SMYF 3L8JA 2PX3A 3IQCA 3IQ5A 5AC4A 2M4EA 2R7WA 2EIMC 4JTCB 1JMWA 4I3MA 4XEFA 4DVYP 4YT2A 1GM5A 4N4WA 1OW8A 4JCZA 2XS1A 3POVA 4PACA 2AVKA 1C02A 1TFOB 2Q4FA 3C62A 3DXJF 4JRZA 4U5GA 1G5ZA 4A4AA 4PJJA 5KYXA 3K66A 4GEHA 2EPLX 2WL8A 4P9TA 4J30B 3M4BA 3RQFA 4EBKA 2XL4A 2VH3A 2R02A 4CIPA 5KYUB 2C04A 1VMAA 5DS5A 3L1MA 3Q7GA 3M79A 4YT4A 2VCAA 5B1AC 4IB4A 4IGGA 4FX5A 2QY9A 2P0NA 1C17M 3MBGA 3GORA 3SXMA 2R7SA 1LE2A 2CGEA 1S05A 3H65A 3K1IC 4P9FA 2V3CC 4BJ6A 3G4XA 3W2WA 2LFFA 3V7OA 5L0JA 1LIHA 3MYIA 1WWPA 3HNLA 2HFIA 4RD9A 3SXZA 3T6GB 3EG9A 3TJ6A 3ZQVA 2XLVA 2YL7A 4MVZA 5DLJA 4CS8C 3GEIA 1ZU4A 5KYWA 1CPRA 4BJ5C 4G7HF 2R7TA 2XLEA 1Z63A 1NSGB 2YLGA 2R7RA 5COMA 2PP4A 2EPKX 2GDCA 3IHUA 1M2OA 2OEVA 3GM2A 1N1CA 3RFYA 5B3SC 3J06A 3GM3A 1S7ZA 3UGOA 4OD5A 2EPMX 1ORJA 1D1BA 3K33A 3NMJA 3VRCA 2R25A 1LE4A 2PNOA 4Q5SF 1SZIA 2LCHA 1RKEA 2XLWA 3WHNA 3C7JA 4KBLA 4MVOA 2XLHA 3EHNA 3HKKA 3N2ZB 4NTBA 4Q4ZF 2OEXA
chains in the Genus database with same CATH topology
1TWGA 2MYSA 2JD3A 5DVWA 3E9VA 3F47A 3CQZA 2DGJA 2R7QA 4QI2A 3M1CB 3EGDA 1D1CA 2W4BA 3HJCA 3S28A 5B1BC 3Q6MA 4M63A 1D0XA 3OWTA 4PJMA 2DYRC 1VOMA 1PD0A 2J7PA 1RJ9B 2G62A 1Z6AA 4OIRF 1Z5ZA 1VK5A 2ZXPA 4KC9A 4AE4A 1MMGA 3FAJA 4FWVA 3UNGC 2R7UA 3FHDA 3B0PA 4RDAA 2XXAB 1BR2A 3T4RA 2R7VA 3I5PA 3ZSUA 2FFHA 4G7OF 4U5DE 1FMVA 3EHMA 4CIHA 4P6IC 2J0WA 3ITFA 4PK4A 3NG1A 2IXPA 5EGYA 3SP1A 4JVSA 3ECSA 3RH3A 3RYLA 4LLCA 2VASA 4QDLA 2X51A 4DOZA 4HFFB 3ABMC 5T3WA 3IEEA 4LLEA 4JZAA 4JJGA 3LJBA 3QZCA 1MMAA 3JYHA 3UMIA 1M57C 1MNEA 2ZXRA 5KYXB 2B0JA 4KNVA 2WVNA 3WODF 3W2VA 1TWCA 4PFOA 4A2NB 5E2QA 1Z23A 2A68F 2Q3TA 2NUPA 3Q6NA 1NZEA 4O6YA 1FTSA 1OCCC 1M2VA 4JURI 3NKDA 5DS6A 3SZRA 4I44A 3AG2C 3EG9B 3ZC4A 5KYWB 2PFDA 5D92A 4CS9A 3DM9B 3PHF2 2HV6A 4DVZA 3EJNA 4FESA 1M56C 2CDQA 3I4UA 3E70C 1TWHA 3GODA 1J8MF 4XTKA 2A6HF 2FGYA 1BR4A 2WZFA 4EBBA 1PD1A 3I5QA 2YEVA 3O6XA 2XRHA 2C03A 4IWBA 3RIPA 3LS1A 4YWQA 2CW0F 3EGDB 4OINF 3ASOC 4PJLA 4C3BA 4YJWA 2GFHA 1J8YF 4XLPF 2Q9BA 1KU2A 2IOQA 5EHHA 4CSAA 4O6MA 3NYMA 5L3VA 2J7PD 3DM5A 4BJTA 1O87A 1WGWA 3NYJA 3OEOA 3KKBA 3RKOF 4AE4B 1ZHTA 4F4BA 3LLKA 3CSKA 2E87A 2LSEA 3ZVRA 5KYYA 3B9QA 4H4KC 1OCRC 3EZHA 2DYSC 5L3QA 3LAYA 4BJ6C 1JPNA 2YZSA 5HSWA 1OKKD 1D1AA 4J32B 4O6NA 5E3CA 3FDQA 4QI0A 2OG2A 1V54C 3T6JA 3KH2A 4AX2A 5DQTA 3O39A 2H7BA 2P7VA 4PJNA 1ZU5A 1D0ZA 4G0HA 3PMRA 4MQ9F 1TKNA 1NU9C 3LEVA 1QLEC 4LACB 3NDBB 1ZHWA 3SEOA 4O79A 2Y3HA 1VYIA 2A1DD 1OKKA 4HE8D 4O7GA 3UMKA 3LS0A 2KW3C 2L81A 2ZXWC 1MMNA 1D0YA 3AQCA 4BJ1A 3JSZA 4ZLCA 3NRHA 2EILC 3KMIA 1VYKA 3K1HA 4RBNA 3W8IA 4I1MA 1NG1A 3ASNC 1G8XA 1OCZC 4C3DA 5KYNA 4G7ZF 2NUPB 3DAGA 1BR1A 5E33A 4WJ0A 3EH1A 1IZMA 4JW1A 3AQBA 5T3TA 4OD4A 1M2VB 3LESA 5F5HA 2H7VC 3F46A 3UMHA 2R7XA 2KJGA 1TR2A 4OIQF 4XWJA 1MMDA 3K6BA 5BUOA 3VAYA 1MNDA 2I8BA 1ZHXA 2WZGA 3ZG1A 4DBQA 2J0XA 5F5FA 4HEAJ 5CI8A 2O9XA 5CI9A 2J46A 3K7DA 2IXNA 3ZIBA 4K0DA 4U5HA 1LS1A 1W2WA 3DMDA 2D5RB 3HTKC 4W8KA 3ABLC 3UR3C 4OIPF 4BEJA 4NY3A 3NKEA 2HV7A 3DD7A 3OA1A 3UGPA 4Q7CA 3EGXA 4U5BE 4YT5A 4CS8A 2Z15A 3EFOA 4BJ5A 3LLIA 5KYYB 3EH2A 3JCUQ 4C7OA 1PCXA 4E7ZA 3B0UX 3N0TA 2Q9AA 2Y3DA 1NU7D 2G3VA 4BG0A 4DBRA 2H7OA 2L9JA 3S27A 1O5HA 3W8HA 1LKXA 2IXMA 4CS9C 1OCOC 3KL4A 1ZYRF 5DQZA 4HFKB 2IYLD 3S0XA 2NG1A 2J9VA 2EIKC 1IW7F 3TD7A 3SNHA 1FFHA 2P6VA 5IY5C 4XLNF 4B6IA 2XSEA 5KYUA 3EPVA 3AG4C 4KNWA 3L0IA 4K7BA 5T1DB 3NYLA 3MX3A 4YN0B 2Y39A 3QMKA 4JCHA 2CNWD 3X1OA 4IRUA 4CSAC 4MNDA 2J9WA 1TWAA 2W9YA 2J9UA 2R7OA 4N06A 5E3AA 5FCLA 2ZPAA 1FMWA 2QTVA 2YHSA 2A69F 3DJUB 3JRTA 2V26A 5D91A 1QZXA 2Y69C 2VB6A 4LERA 1ZHYA 2CNWA 3Q7LA 3DJNB 2Y3GA 2ZXOA 3X2QC 2KNHA 2KQ9A 1LVKA 4X0RA 4KI2A 1SF8A 3L34A 4AK9A 1JPJA 2J45A 2W45A 4CBEA 3GANA 2Q9CA 1V55C 4IAOA 4OIOF 4ZLDA 4I1OB 3VYWA 4IJJA 4E7SA 2NUTB 4PFPA 3B0VC 1RJ9A 4ULWA 4U5CE 2W4MA 3HLZA 3S29A 4YT8A 2WB7A 3AG1C 2MWQA 3AG3C 2A6EF 2IXOA 3FVYA 3SYNA 4GYTA 2PX0A 3LNRA 2PF4E 3EZIA 2XXAA 2KGOA 2WZLA 4C3EA 2EIJC 2G3KA 2WVOA 3CZ6A 4U5EE 3EGXB 3DZAA 4EWCA 3EFOB 1ST6A 3DAFA 2NUTA 4ANJA 1Z3IX 2WVQA 4JJFA 1ZHZA 4U5FE 5DS4A 2BE5F 2OCCC 2Y3BA 4C7OB 3MLGA 1FFTC 3N24A 3WG7C 2EINC 3T6BA 3ABKC 3JT1A 4CS7A 3EQLF 1SMYF 2PX3A 2R7WA 2M4EA 2EIMC 4I3MA 4YT2A 4DVYP 3POVA 3DXJF 4U5GA 4PJJA 5KYXA 3K66A 4GEHA 2WL8A 4J30B 2XL4A 2VH3A 5KYUB 2C04A 1VMAA 5DS5A 3Q7GA 4YT4A 5B1AC 4FX5A 2QY9A 2R7SA 2CGEA 3H65A 3K1IC 2V3CC 4BJ6A 3W2WA 3V7OA 4RD9A 3EG9A 5DLJA 4CS8C 5KYWA 1ZU4A 2R7TA 4BJ5C 4G7HF 1Z63A 2R7RA 2PP4A 1M2OA 5B3SC 1N1CA 3RFYA 1S7ZA 3UGOA 4OD5A 1D1BA 3K33A 4Q5SF 1SZIA 4KBLA 3EHNA 3N2ZB 4Q4ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3V A; 
#chains in the Genus database with same CATH topology
 1TWG A;  2MYS A;  2JD3 A;  3JTL O;  5DVW A;  4J7Y A;  3E9V A;  3F47 A;  3CQZ A;  2DGJ A;  1K04 A;  3GM1 A;  1B68 A;  3U9J A;  4MVR A;  2R7Q A;  4R32 A;  4QI2 A;  3M1C B;  2HSB A;  3EGD A;  1ZW3 A;  5L0G A;  4DRI B;  1D1C A;  2W4B A;  3HJC A;  1XZQ A;  4JIO A;  3S28 A;  5B1B C;  3Q6M A;  4M63 A;  3SXK A;  1D0X A;  3OWT A;  4PJM A;  2DYR C;  1VOM A;  1PD0 A;  4D4X A;  2J7P A;  3TQO A;  3AOU A;  1RJ9 B;  2AWC A;  1APC A;  2HZ8 A;  5GPG B;  3RVZ A;  2G62 A;  1Z6A A;  3GWL A;  4OIR F;  1Z5Z A;  1VK5 A;  2ZXP A;  4KC9 A;  4AE4 A;  1MMG A;  3FAJ A;  1YA7 O;  2XLD A;  4FWV A;  1A41 A;  3GEH A;  2R05 A;  3UNG C;  1AUE A;  256B A;  2R7U A;  3FHD A;  3B0P A;  3BRJ A;  4RDA A;  4YK5 A;  5CIV A;  1OQC A;  2XXA B;  1OR2 A;  3V5Z A;  2P1A A;  1BR2 A;  4MTF A;  1YAR O;  1JAF A;  1T01 A;  3LEO A;  3JZ0 A;  2NPU A;  1U89 A;  3T4R A;  2R7V A;  3I5P A;  3ZSU A;  2FFH A;  4G7O F;  4U5D E;  1FMV A;  1WTY A;  3TK0 A;  3EHM A;  3U5S A;  5B3I A;  4CIH A;  1OW6 A;  4CDA A;  4P6I C;  2J0W A;  3ITF A;  3M15 A;  3NMK A;  4PK4 A;  3NG1 A;  2QE9 A;  1WAT A;  2IXP A;  3FOP A;  4JVS A;  3ECS A;  3SP1 A;  3RH3 A;  5EGY A;  3RYL A;  1E85 A;  2PBE A;  4LLC A;  4YL3 A;  3FAP B;  4G78 A;  4DRJ B;  3TOM A;  1H6G A;  2VAS A;  3QVZ A;  4QDL A;  4IAR A;  2X51 A;  2RSE B;  2J9B A;  3ATP A;  4DOZ A;  1PV3 A;  4HFF B;  1K05 A;  3ABM C;  3JSE O;  5T3W A;  4BEM J;  2IBF A;  3IEE A;  3DE8 A;  4LLE A;  4NCQ A;  4JZA A;  1RMV A;  2HUJ A;  4MVS A;  4JJG A;  1KTM A;  3LJB A;  5JRA A;  3QZC A;  1MMA A;  1OXK A;  1Q0K A;  1Q0G A;  3FXH A;  3JYH A;  4MTO A;  2L6H A;  1M57 C;  1MNE A;  3UMI A;  1M6T A;  1A0B A;  2ZXR A;  2AP3 A;  5KYX B;  4ER9 A;  1BDJ B;  1OXB A;  2B0J A;  4MW8 A;  4KNV A;  2VCC A;  2WVN A;  3WOD F;  3W2V A;  1TWC A;  4Z9H A;  4EKW A;  4NTA A;  3U8P A;  2OJE D;  4PFO A;  2YL3 A;  5E2Q A;  2NSF A;  5F28 E;  4A2N B;  1Z23 A;  2A68 F;  1A7D A;  2JPU A;  4MVQ A;  2Q3T A;  3V5Y A;  2NUP A;  4N6C A;  2L7A A;  5JSL A;  1WOL A;  1HY5 A;  3Q6N A;  1YVI A;  4XEK A;  1V74 B;  1NZE A;  4J7T A;  3M4C A;  4O6Y A;  1FTS A;  1YA9 A;  3A9C A;  1OCC C;  1FAP B;  1UFB A;  1YDI A;  1NBB A;  4CDV A;  1M2V A;  3C8Z A;  4JUR I;  3NKD A;  3LNM B;  5DS6 A;  3SZR A;  4I44 A;  3HNI A;  4PR9 A;  3AG2 C;  3EG9 B;  3ZC4 A;  3DKA A;  5BQG A;  1AVO B;  5KYW B;  1OW7 A;  2PFD A;  5D92 A;  4BPM A;  3DM9 B;  3B29 A;  2HV6 A;  4CS9 A;  5A6J A;  3PHF 2;  3W4Y A;  4DVZ A;  2XL8 A;  4YL1 A;  3C8G A;  1XWJ A;  3EJN A;  4DRH B;  3JRM O;  4FES A;  5TJ5 E;  5HV9 A;  3WAQ A;  2EPN A;  4JE9 A;  1M56 C;  2CDQ A;  3NMI A;  4AL1 A;  3I4U A;  3E70 C;  1TWH A;  3GOD A;  1J8M F;  4XTK A;  2A6H F;  2FGY A;  1BR4 A;  3CAX A;  3L8I A;  2WZF A;  1RKE B;  4EBB A;  1JRA A;  3JYY A;  5FZT A;  1QKR A;  4MVM A;  1PD1 A;  3I5Q A;  1E86 A;  5AGF A;  2YL1 A;  2YEV A;  1ORY A;  3O6X A;  2XRH A;  2C03 A;  4IWB A;  3RIP A;  2BC5 A;  3LS1 A;  4YWQ A;  2A0U A;  2CW0 F;  2YRF A;  3US6 A;  3EGD B;  4OIN F;  3ZTM A;  1Q0D A;  3ASO C;  4PJL A;  4U9D A;  4D4N A;  4MS2 A;  4C3B A;  4YJW A;  2GFH A;  4WGY A;  1J8Y F;  3U9M A;  4XLP F;  2Q9B A;  1KU2 A;  2IOQ A;  5EHH A;  4CSA A;  1YAU O;  2ASR A;  4O6M A;  1TFK B;  3NYM A;  1T9K A;  3QTH A;  2J7P D;  3U2L A;  5L3V A;  1OR3 A;  2Q00 A;  3DM5 A;  4BJT A;  1O87 A;  1WGW A;  1A7V A;  3NYJ A;  3DE9 A;  1HE9 A;  1HW1 A;  3OEO A;  3KKB A;  2F22 A;  1EQ1 A;  3RKO F;  4AE4 B;  1ZHT A;  4F4B A;  3LLK A;  3CSK A;  2E87 A;  2R9R B;  2LSE A;  3ZVR A;  1HMD A;  1QVX A;  4NQF A;  5JS5 A;  5KYY A;  3B9Q A;  4H4K C;  1MQV A;  1OCR C;  1XZP A;  1A7E A;  3EZH A;  2DYS C;  2KK1 A;  1RXQ A;  5L3Q A;  3LAY A;  2OU6 A;  3RQE A;  4BJ6 C;  1JPN A;  2HJ3 A;  1F1M A;  1OKK D;  2YZS A;  4MTG A;  1D1A A;  5HSW A;  2VCB A;  4J32 B;  1T6I A;  4O6N A;  5E3C A;  5JLI A;  4QI0 A;  2OG2 A;  3KPH A;  3FDQ A;  3VM6 A;  2Q7R A;  4U9E A;  1V54 C;  3T6J A;  1SR2 A;  3KH2 A;  1T6Q A;  4JTA B;  3RW0 A;  4AX2 A;  5DQT A;  4E0I A;  3O39 A;  1KNY A;  1Y6D A;  2H7B A;  2P7V A;  2QNL A;  3CEX A;  4PJN A;  1ZU5 A;  1D0Z A;  4G0H A;  5K0I A;  3PMR A;  3O55 A;  4MQ9 F;  1WAS A;  2TMV P;  3U3F A;  1TKN A;  4E17 A;  1NU9 C;  1RCP A;  3LEV A;  3V5X A;  1QLE C;  4XQ1 A;  4LAC B;  3NDB B;  1ZHW A;  1U6H A;  3SEO A;  1Q0F A;  4O79 A;  4EHP A;  2Y3H A;  1VYI A;  2A1D D;  1OKK A;  1GQA A;  1ZW2 A;  4HE8 D;  4JC7 A;  4O7G A;  5L0I A;  3UMK A;  3A11 A;  3S90 A;  1HW2 A;  3LS0 A;  2KW3 C;  2XS8 A;  3GEE A;  2L81 A;  1R5I D;  2ZXW C;  1MMN A;  1D0Y A;  3AQC A;  1RKC A;  3AGU A;  2YKZ A;  4BJ1 A;  2LD6 A;  5L0F A;  4L6R A;  3JSZ A;  4ZLC A;  3NRH A;  2EIL C;  3KMI A;  2J8W A;  1VYK A;  1E83 A;  2HMZ A;  2BL2 A;  3K1H A;  2YWA A;  4RBN A;  3W8I A;  4I1M A;  4CX9 A;  3TUL A;  1UG7 A;  2OQM A;  1NG1 A;  3ASN C;  3HNJ A;  4JEA A;  1G8X A;  5COG A;  1BZ4 A;  1OCZ C;  4JEB A;  4UDV A;  3U3B A;  4C3D A;  5KYN A;  4G7Z F;  1YZA A;  2NUP B;  1NFN A;  4H54 A;  1G4U S;  3DAG A;  3T9O A;  1BR1 A;  3MFN A;  5E33 A;  2IM8 A;  4WJ0 A;  5JT4 A;  3EH1 A;  1IZM A;  4LDK A;  4JW1 A;  3BEH A;  3AQB A;  5T3T A;  1FR0 A;  2MHR A;  4EIY A;  3HNK A;  1L7C A;  2M64 A;  1M2V B;  4OD4 A;  1FNT c;  3LES A;  1Z7Q c;  4YL0 A;  5F5H A;  2H7V C;  3C18 A;  3IPM O;  3F46 A;  5JVE A;  3UMH A;  2R7X A;  1LS4 A;  4E18 A;  1GS9 A;  1TR2 A;  2KJG A;  3PCV A;  4OIQ F;  2HMQ A;  4XWJ A;  3AJM A;  1YJG A;  2LIG A;  1DOV A;  3C8G B;  1MMD A;  2XLO A;  3C8G D;  3K6B A;  4FAP B;  5BUO A;  1CGN A;  4EUK B;  5L0D A;  3VAY A;  1MND A;  1Q0M A;  5A6A A;  1ZHX A;  2I8B A;  2WZG A;  1JOG A;  3S9O A;  2ICW G;  3ZG1 A;  4JKV A;  1K40 A;  4MVU A;  2XM0 A;  4NTF A;  2J0X A;  2P61 A;  4DBQ A;  5F5F A;  4HEA J;  4AL0 A;  4LDR A;  5CI8 A;  2O9X A;  2B0H A;  1LI5 A;  5CI9 A;  2J46 A;  4ULV A;  3K7D A;  2IXN A;  3R7C A;  3ZIB A;  4K0D A;  4U5H A;  1LS1 A;  4K1O A;  4XPX A;  1W2W A;  4JTD B;  3DMD A;  2D5R B;  2YQY A;  3HTK C;  4W8K A;  3ABL C;  3UR3 C;  1TQG A;  2GA0 A;  4OIP F;  1EKY A;  2LFD A;  2H8A A;  3DI5 A;  4BEJ A;  3K1I A;  4NY3 A;  1VB5 A;  5L0H A;  3NKE A;  2HV7 A;  3DD7 A;  2A0B A;  3LUT B;  3OA1 A;  3UGP A;  4Q7C A;  3EGX A;  5BQI A;  4U5B E;  4YT5 A;  2LP4 A;  4CS8 A;  2Z15 A;  3EFO A;  4BJ5 A;  3LLI A;  1DOW A;  2OOC A;  2GAQ A;  2KC3 A;  2UUH A;  3AGT A;  3EH2 A;  3ZQY A;  5KYY B;  3QW0 A;  4CJO A;  1NFO A;  3JCU Q;  3MYF A;  4C7O A;  3U8V A;  2ZD9 A;  1PCX A;  4E7Z A;  3G4Z A;  3N0T A;  2Q9A A;  4EBJ A;  2Y3D A;  3B0U X;  3H2U A;  1NU7 D;  2G3V A;  2XM4 A;  3RVY A;  3KYJ A;  4BG0 A;  4GQH A;  4DBR A;  1QQ3 A;  2H7O A;  2L9J A;  3S27 A;  1L3P A;  1O5H A;  1YZC A;  3W8H A;  1LKX A;  1EI7 A;  2IXM A;  1ORS C;  4CS9 C;  1Y4C A;  1ZZP A;  2X0C A;  3PDM P;  1OCO C;  3KL4 A;  1ZYR F;  2EPO A;  5DQZ A;  4HFK B;  2IYL D;  3S0X A;  3IQT A;  2CYD A;  2NG1 A;  1H7I A;  4N6H A;  2J9V A;  1V4A A;  2EIK C;  1IW7 F;  3TD7 A;  4LDQ A;  3SNH A;  1FFH A;  2P6V A;  5IY5 C;  1I5N A;  3KYI A;  3RQG A;  4XLN F;  4IAQ A;  2AU5 A;  2YVK A;  1H9T A;  5A6K A;  3QW1 A;  2XSE A;  5KYU A;  3EPV A;  4Z9J A;  4B6I A;  2KYH A;  3AG4 C;  4KNW A;  1YLM A;  2VC9 A;  3L0I A;  4WGZ A;  1HE1 A;  4K7B A;  5T1D B;  1LPE A;  3NYL A;  3H2V A;  3MX3 A;  2YLI A;  4ONS A;  3TJ5 A;  4YN0 B;  1BBH A;  2Y39 A;  1EA8 A;  2QUP A;  3QMK A;  4JCH A;  5A69 A;  3ZDL A;  2CNW D;  3X1O A;  4IRU A;  4CSA C;  2L6F A;  2D4U A;  4MND A;  4Z9I A;  2HKV A;  1AEP A;  1U0B B;  2KSF A;  2J9W A;  2DB4 A;  5A6B D;  3FOO A;  1CGM E;  1YYJ A;  2XLM A;  1TWA A;  3G50 A;  2UUI A;  2HS5 A;  2NSG A;  2OKU A;  1E2X A;  2W9Y A;  1VLS A;  3U2M A;  2YLD A;  2J9U A;  1LM3 B;  1GGQ A;  2GWW A;  2QLA A;  3IQ6 A;  5AC5 A;  2R7O A;  4N06 A;  5E3A A;  1LI7 A;  5FCL A;  2ZPA A;  1FMW A;  5JP7 A;  1R4T A;  2QTV A;  1CGO A;  2A69 F;  2YHS A;  3ZWI A;  3DJU B;  2FAP B;  3JRT A;  5EK0 A;  3S84 A;  2V26 A;  1E84 A;  5D91 A;  4MW3 A;  1I4Z A;  1QZX A;  3B71 A;  2Y69 C;  2VB6 A;  3C63 A;  4LER A;  1ZHY A;  2CNW A;  2OJQ A;  3Q7L A;  3DJN B;  2Y3G A;  2ZXO A;  2R03 A;  3GWN A;  3X2Q C;  2KNH A;  5A6B A;  2KQ9 A;  1LVK A;  4X0R A;  1YYX A;  4KI2 A;  1SF8 A;  3DWW A;  1C03 A;  3L34 A;  4AK9 A;  1JPJ A;  2J45 A;  2W45 A;  4CBE A;  4DJ9 A;  4XPW A;  3GAN A;  2Q9C A;  3QVY A;  1V55 C;  4IAO A;  1G4W R;  4OIO F;  4ZLD A;  4I1O B;  1SYQ A;  3VYW A;  4IJJ A;  2RD9 A;  4E7S A;  1QSP A;  2ETS A;  2NUT B;  2YL0 A;  1O3U A;  4XPY A;  1HMO A;  4PFP A;  3B0V C;  1RJ9 A;  4ULW A;  4U5C E;  2W4M A;  1JR8 A;  2LK4 A;  3HLZ A;  3S29 A;  4YT8 A;  2WB7 A;  3AG1 C;  2MWQ A;  3AG3 C;  3ZTZ A;  1T5O A;  2AWY A;  2XL6 A;  1I4Y A;  2A6E F;  4XEV A;  1T6U A;  2IXO A;  3FVY A;  3SYN A;  1NLX A;  4GYT A;  2PX0 A;  3LNR A;  2PF4 E;  3EZI A;  2XXA A;  1QPU A;  2KGO A;  2WZL A;  4C3E A;  2L6G A;  2EIJ C;  3RF3 A;  2G3K A;  3TOL A;  4W8P A;  2WVO A;  3CZ6 A;  2CCY A;  5BQH A;  3O10 A;  1WN0 A;  4U5E E;  2JX0 A;  3EGX B;  1ZVZ A;  3U0C A;  3DZA A;  5JUA A;  4EWC A;  1CPQ A;  3EFO B;  1ST6 A;  3DAF A;  2NUT A;  4ANJ A;  1Z3I X;  2WVQ A;  1H9G A;  2HSQ A;  4JJF A;  1ZHZ A;  4U5F E;  5DS4 A;  4CDY A;  2I15 A;  2BE5 F;  2OCC C;  2Y3B A;  4NC3 A;  4C7O B;  3MLG A;  3VF0 A;  4E0H A;  1FFT C;  3N24 A;  2HJM A;  4CJG A;  3WG7 C;  5L0C A;  2EIN C;  3T6B A;  3ABK C;  4WAB A;  1VLT A;  3JT1 A;  3FMS A;  3R2P A;  2LQG A;  3SXY A;  4DXW A;  5COF A;  4CS7 A;  1VTM P;  2DI3 A;  3EQL F;  1SMY F;  3L8J A;  2PX3 A;  3IQC A;  3IQ5 A;  5AC4 A;  2M4E A;  2R7W A;  2EIM C;  4JTC B;  1JMW A;  4I3M A;  4XEF A;  4DVY P;  4YT2 A;  1GM5 A;  4N4W A;  1OW8 A;  4JCZ A;  2XS1 A;  3POV A;  4PAC A;  2AVK A;  1C02 A;  1TFO B;  2Q4F A;  3C62 A;  3DXJ F;  4JRZ A;  4U5G A;  1G5Z A;  4A4A A;  4PJJ A;  5KYX A;  3K66 A;  4GEH A;  2EPL X;  2WL8 A;  4P9T A;  4J30 B;  3M4B A;  3RQF A;  4EBK A;  2XL4 A;  2VH3 A;  2R02 A;  4CIP A;  5KYU B;  2C04 A;  1VMA A;  5DS5 A;  3L1M A;  3Q7G A;  3M79 A;  4YT4 A;  2VCA A;  5B1A C;  4IB4 A;  4IGG A;  4FX5 A;  2QY9 A;  2P0N A;  1C17 M;  3MBG A;  3GOR A;  3SXM A;  2R7S A;  1LE2 A;  2CGE A;  1S05 A;  3H65 A;  3K1I C;  4P9F A;  2V3C C;  4BJ6 A;  3G4X A;  3W2W A;  2LFF A;  3V7O A;  5L0J A;  1LIH A;  3MYI A;  1WWP A;  3HNL A;  2HFI A;  4RD9 A;  3SXZ A;  3T6G B;  3EG9 A;  3TJ6 A;  3ZQV A;  2XLV A;  2YL7 A;  4MVZ A;  5DLJ A;  4CS8 C;  3GEI A;  1ZU4 A;  5KYW A;  1CPR A;  4BJ5 C;  4G7H F;  2R7T A;  2XLE A;  1Z63 A;  1NSG B;  2YLG A;  2R7R A;  5COM A;  2PP4 A;  2EPK X;  2GDC A;  3IHU A;  1M2O A;  2OEV A;  3GM2 A;  1N1C A;  3RFY A;  5B3S C;  3J06 A;  3GM3 A;  1S7Z A;  3UGO A;  4OD5 A;  2EPM X;  1ORJ A;  1D1B A;  3K33 A;  3NMJ A;  3VRC A;  2R25 A;  1LE4 A;  2PNO A;  4Q5S F;  1SZI A;  2LCH A;  1RKE A;  2XLW A;  3WHN A;  3C7J A;  4KBL A;  4MVO A;  2XLH A;  3EHN A;  3HKK A;  3N2Z B;  4NTB A;  4Q4Z F;  2OEX A; 
#chains in the Genus database with same CATH homology
 1TWG A;  2MYS A;  2JD3 A;  5DVW A;  3E9V A;  3F47 A;  3CQZ A;  2DGJ A;  2R7Q A;  4QI2 A;  3M1C B;  3EGD A;  1D1C A;  2W4B A;  3HJC A;  3S28 A;  5B1B C;  3Q6M A;  4M63 A;  1D0X A;  3OWT A;  4PJM A;  2DYR C;  1VOM A;  1PD0 A;  2J7P A;  1RJ9 B;  2G62 A;  1Z6A A;  4OIR F;  1Z5Z A;  1VK5 A;  2ZXP A;  4KC9 A;  4AE4 A;  1MMG A;  3FAJ A;  4FWV A;  3UNG C;  2R7U A;  3FHD A;  3B0P A;  4RDA A;  2XXA B;  1BR2 A;  3T4R A;  2R7V A;  3I5P A;  3ZSU A;  2FFH A;  4G7O F;  4U5D E;  1FMV A;  3EHM A;  4CIH A;  4P6I C;  2J0W A;  3ITF A;  4PK4 A;  3NG1 A;  2IXP A;  5EGY A;  3SP1 A;  4JVS A;  3ECS A;  3RH3 A;  3RYL A;  4LLC A;  2VAS A;  4QDL A;  2X51 A;  4DOZ A;  4HFF B;  3ABM C;  5T3W A;  3IEE A;  4LLE A;  4JZA A;  4JJG A;  3LJB A;  3QZC A;  1MMA A;  3JYH A;  3UMI A;  1M57 C;  1MNE A;  2ZXR A;  5KYX B;  2B0J A;  4KNV A;  2WVN A;  3WOD F;  3W2V A;  1TWC A;  4PFO A;  4A2N B;  5E2Q A;  1Z23 A;  2A68 F;  2Q3T A;  2NUP A;  3Q6N A;  1NZE A;  4O6Y A;  1FTS A;  1OCC C;  1M2V A;  4JUR I;  3NKD A;  5DS6 A;  3SZR A;  4I44 A;  3AG2 C;  3EG9 B;  3ZC4 A;  5KYW B;  2PFD A;  5D92 A;  4CS9 A;  3DM9 B;  3PHF 2;  2HV6 A;  4DVZ A;  3EJN A;  4FES A;  1M56 C;  2CDQ A;  3I4U A;  3E70 C;  1TWH A;  3GOD A;  1J8M F;  4XTK A;  2A6H F;  2FGY A;  1BR4 A;  2WZF A;  4EBB A;  1PD1 A;  3I5Q A;  2YEV A;  3O6X A;  2XRH A;  2C03 A;  4IWB A;  3RIP A;  3LS1 A;  4YWQ A;  2CW0 F;  3EGD B;  4OIN F;  3ASO C;  4PJL A;  4C3B A;  4YJW A;  2GFH A;  1J8Y F;  4XLP F;  2Q9B A;  1KU2 A;  2IOQ A;  5EHH A;  4CSA A;  4O6M A;  3NYM A;  5L3V A;  2J7P D;  3DM5 A;  4BJT A;  1O87 A;  1WGW A;  3NYJ A;  3OEO A;  3KKB A;  3RKO F;  4AE4 B;  1ZHT A;  4F4B A;  3LLK A;  3CSK A;  2E87 A;  2LSE A;  3ZVR A;  5KYY A;  3B9Q A;  4H4K C;  1OCR C;  3EZH A;  2DYS C;  5L3Q A;  3LAY A;  4BJ6 C;  1JPN A;  2YZS A;  5HSW A;  1OKK D;  1D1A A;  4J32 B;  4O6N A;  5E3C A;  3FDQ A;  4QI0 A;  2OG2 A;  1V54 C;  3T6J A;  3KH2 A;  4AX2 A;  5DQT A;  3O39 A;  2H7B A;  2P7V A;  4PJN A;  1ZU5 A;  1D0Z A;  4G0H A;  3PMR A;  4MQ9 F;  1TKN A;  1NU9 C;  3LEV A;  1QLE C;  4LAC B;  3NDB B;  1ZHW A;  3SEO A;  4O79 A;  2Y3H A;  1VYI A;  2A1D D;  1OKK A;  4HE8 D;  4O7G A;  3UMK A;  3LS0 A;  2KW3 C;  2L81 A;  2ZXW C;  1MMN A;  1D0Y A;  3AQC A;  4BJ1 A;  3JSZ A;  4ZLC A;  3NRH A;  2EIL C;  3KMI A;  1VYK A;  3K1H A;  4RBN A;  3W8I A;  4I1M A;  1NG1 A;  3ASN C;  1G8X A;  1OCZ C;  4C3D A;  5KYN A;  4G7Z F;  2NUP B;  3DAG A;  1BR1 A;  5E33 A;  4WJ0 A;  3EH1 A;  1IZM A;  4JW1 A;  3AQB A;  5T3T A;  4OD4 A;  1M2V B;  3LES A;  5F5H A;  2H7V C;  3F46 A;  3UMH A;  2R7X A;  2KJG A;  1TR2 A;  4OIQ F;  4XWJ A;  1MMD A;  3K6B A;  5BUO A;  3VAY A;  1MND A;  2I8B A;  1ZHX A;  2WZG A;  3ZG1 A;  4DBQ A;  2J0X A;  5F5F A;  4HEA J;  5CI8 A;  2O9X A;  5CI9 A;  2J46 A;  3K7D A;  2IXN A;  3ZIB A;  4K0D A;  4U5H A;  1LS1 A;  1W2W A;  3DMD A;  2D5R B;  3HTK C;  4W8K A;  3ABL C;  3UR3 C;  4OIP F;  4BEJ A;  4NY3 A;  3NKE A;  2HV7 A;  3DD7 A;  3OA1 A;  3UGP A;  4Q7C A;  3EGX A;  4U5B E;  4YT5 A;  4CS8 A;  2Z15 A;  3EFO A;  4BJ5 A;  3LLI A;  5KYY B;  3EH2 A;  3JCU Q;  4C7O A;  1PCX A;  4E7Z A;  3B0U X;  3N0T A;  2Q9A A;  2Y3D A;  1NU7 D;  2G3V A;  4BG0 A;  4DBR A;  2H7O A;  2L9J A;  3S27 A;  1O5H A;  3W8H A;  1LKX A;  2IXM A;  4CS9 C;  1OCO C;  3KL4 A;  1ZYR F;  5DQZ A;  4HFK B;  2IYL D;  3S0X A;  2NG1 A;  2J9V A;  2EIK C;  1IW7 F;  3TD7 A;  3SNH A;  1FFH A;  2P6V A;  5IY5 C;  4XLN F;  4B6I A;  2XSE A;  5KYU A;  3EPV A;  3AG4 C;  4KNW A;  3L0I A;  4K7B A;  5T1D B;  3NYL A;  3MX3 A;  4YN0 B;  2Y39 A;  3QMK A;  4JCH A;  2CNW D;  3X1O A;  4IRU A;  4CSA C;  4MND A;  2J9W A;  1TWA A;  2W9Y A;  2J9U A;  2R7O A;  4N06 A;  5E3A A;  5FCL A;  2ZPA A;  1FMW A;  2QTV A;  2YHS A;  2A69 F;  3DJU B;  3JRT A;  2V26 A;  5D91 A;  1QZX A;  2Y69 C;  2VB6 A;  4LER A;  1ZHY A;  2CNW A;  3Q7L A;  3DJN B;  2Y3G A;  2ZXO A;  3X2Q C;  2KNH A;  2KQ9 A;  1LVK A;  4X0R A;  4KI2 A;  1SF8 A;  3L34 A;  4AK9 A;  1JPJ A;  2J45 A;  2W45 A;  4CBE A;  3GAN A;  2Q9C A;  1V55 C;  4IAO A;  4OIO F;  4ZLD A;  4I1O B;  3VYW A;  4IJJ A;  4E7S A;  2NUT B;  4PFP A;  3B0V C;  1RJ9 A;  4ULW A;  4U5C E;  2W4M A;  3HLZ A;  3S29 A;  4YT8 A;  2WB7 A;  3AG1 C;  2MWQ A;  3AG3 C;  2A6E F;  2IXO A;  3FVY A;  3SYN A;  4GYT A;  2PX0 A;  3LNR A;  2PF4 E;  3EZI A;  2XXA A;  2KGO A;  2WZL A;  4C3E A;  2EIJ C;  2G3K A;  2WVO A;  3CZ6 A;  4U5E E;  3EGX B;  3DZA A;  4EWC A;  3EFO B;  1ST6 A;  3DAF A;  2NUT A;  4ANJ A;  1Z3I X;  2WVQ A;  4JJF A;  1ZHZ A;  4U5F E;  5DS4 A;  2BE5 F;  2OCC C;  2Y3B A;  4C7O B;  3MLG A;  1FFT C;  3N24 A;  3WG7 C;  2EIN C;  3T6B A;  3ABK C;  3JT1 A;  4CS7 A;  3EQL F;  1SMY F;  2PX3 A;  2R7W A;  2M4E A;  2EIM C;  4I3M A;  4YT2 A;  4DVY P;  3POV A;  3DXJ F;  4U5G A;  4PJJ A;  5KYX A;  3K66 A;  4GEH A;  2WL8 A;  4J30 B;  2XL4 A;  2VH3 A;  5KYU B;  2C04 A;  1VMA A;  5DS5 A;  3Q7G A;  4YT4 A;  5B1A C;  4FX5 A;  2QY9 A;  2R7S A;  2CGE A;  3H65 A;  3K1I C;  2V3C C;  4BJ6 A;  3W2W A;  3V7O A;  4RD9 A;  3EG9 A;  5DLJ A;  4CS8 C;  5KYW A;  1ZU4 A;  2R7T A;  4BJ5 C;  4G7H F;  1Z63 A;  2R7R A;  2PP4 A;  1M2O A;  5B3S C;  1N1C A;  3RFY A;  1S7Z A;  3UGO A;  4OD5 A;  1D1B A;  3K33 A;  4Q5S F;  1SZI A;  4KBL A;  3EHN A;  3N2Z B;  4Q4Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...