2G3VA

Crystal structure of cags (hp0534, cag13) from helicobacter pylori
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
KLIESLQENELLNTDEKKKIIDQIKTMHDFFKQMHTNKGALDKVLRNYMKDYRAVIKSIGVDKFKKVYRLLESETMELLHAIAENPNFLFSKFDRSILGIFLPFFSKPIMFKMSIREMDSQIELYGTKLPLLKLFVMTDEEMNFYANLKTIEQYNDYVRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords CAG pathogenicity island protein 13
publication title Crystal structure of CagS from helicobacter pylori
rcsb
source organism Helicobacter pylori
total genus 43
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16707 CagS Cag pathogenicity island protein S of Helicobacter pylori
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2g3vA00
2G3VA
chains in the Genus database with same CATH superfamily
4N6HA 3K1IA 3NMJA 2EINC 4XQ1A 4H54A 1YZCA 5F28E 1I4YA 1A7VA 3AQCA 4KNWA 1MNDA 3VF0A 2OQMA 1T9KA 2P0NA 3LS1A 5FCLA 3S28A 1PD1A 1EA8A 3GANA 3X1OA 5B3SC 3AG4C 1CGOA 4PFPA 2Y3BA 2PX3A 3LEVA 1Q0FA 4Z9IA 2HFIA 4FWVA 3LJBA 1MMGA 3JRTA 1ZW2A 3K6BA 4EKWA 4IWBA 4BEJA 4PJNA 2IM8A 1GM5A 3FHDA 3PMRA 4MTFA 4EUKB 2HJMA 2M64A 3AGTA 5DS6A 1XZPA 1CGNA 2BC5A 3FVYA 3V5ZA 3R2PA 1NU7D 2W4MA 1T6UA 2QY9A 1T5OA 2IXPA 3M79A 3RQGA 5A6BA 5A6AA 3ABKC 3L34A 1TWGA 2WVNA 3JTLO 1O3UA 1BR2A 2X0CA 3UR3C 1QVXA 3HKKA 4MQ9F 4DOZA 3A11A 3H2VA 3IEEA 1WATA 3V5XA 1BBHA 2LSEA 3LNRA 5A6KA 2NUPA 5A6JA 4ZLCA 2XM0A 1DOVA 2NPUA 3M4BA 4DXWA 1ZHZA 3ASNC 2GDCA 3EZIA 3K1HA 4N06A 3U5SA 2PBEA 4AK9A 4CSAC 4E0IA 4J32B 3L1MA 2MYSA 2YKZA 2EIJC 1M6TA 3EFOA 2KSFA 3LESA 4IARA 4NTBA 4ER9A 1SMYF 1LI7A 3JYHA 2YL0A 256BA 1Q0GA 3FOPA 2W4BA 3RVYA 3AJMA 2OEVA 4H4KC 2IXOA 4LDQA 3HNKA 4NY3A 3UMIA 3DKAA 4XWJA 3ZIBA 1KU2A 1FAPB 3UGOA 4WABA 4MVZA 2HMQA 2LFFA 1T6QA 4NQFA 1WGWA 3DM5A 2HJ3A 3QVZA 2Y3DA 3V7OA 1EI7A 2R05A 2ZXWC 2OJQA 2B0JA 2FAPB 2KK1A 4PJJA 4AE4A 4CDYA 4DBQA 1Q0MA 2G3VA 5E3CA 5KYWA 1CPQA 1FTSA 2HSQA 1K04A 3EQLF 3GORA 3NMKA 2EPLX 4AX2A 5KYUB 3M1CB 3Q7GA 4B6IA 2YL3A 3JSEO 2XLEA 5T1DB 2LK4A 3L8JA 3LEOA 4JEBA 2WZGA 3US6A 3S27A 2KJGA 2KNHA 4EBJA 2Q3TA 4DRHB 1YAUO 3WAQA 2R7SA 1Z3IX 2DGJA 3F47A 4RD9A 1I5NA 3HNIA 4WGYA 1ORSC 2XLWA 1G5ZA 2Q7RA 4F4BA 1A7EA 2XLMA 3CAXA 1LE4A 4CS8A 1IZMA 1Z5ZA 1D1BA 1D1CA 4I1MA 3L8IA 5L3QA 1U6HA 4OINF 1QKRA 4NCQA 4PK4A 2Q9AA 3M15A 4CS9C 2XRHA 3E9VA 1YDIA 3CEXA 1S05A 3JSZA 2M4EA 2L6FA 4JC7A 2J7PA 5L0IA 3EG9A 1M57C 2ZXRA 5FZTA 2YLIA 3DJUB 4C3BA 5COMA 1VYIA 3NKEA 4EWCA 1TFKB 3F46A 2JX0A 2R25A 2G3KA 3J06A 4MTOA 4YT8A 1ST6A 3C18A 4U5GA 1GS9A 4XLNF 1L3PA 2Q9BA 1QLEC 2H7VC 3EPVA 3KKBA 4Q4ZF 1NBBA 2OJED 2H7OA 3H2UA 2MHRA 1V4AA 1XWJA 3MX3A 2HS5A 4YL3A 2IXMA 1SZIA 1D0ZA 1MNEA 2XS1A 2Y69C 1E83A 1VTMP 2R02A 2EPKX 2VCAA 1KNYA 1OKKD 2R7OA 3AG3C 1ZVZA 3JRMO 2XM4A 3MYIA 2QNLA 1TKNA 3NYMA 4BPMA 2O9XA 1BZ4A 4HE8D 1OXBA 1WASA 3B71A 3I5PA 3IPMO 5JS5A 2AWYA 3G4XA 3I4UA 2CNWA 4JTDB 1Z6AA 2I8BA 4JEAA 1LKXA 3X2QC 1RJ9A 3ABMC 4LERA 1N1CA 1BR4A 3M4CA 3O55A 3BRJA 3T6BA 3ZWIA 2PX0A 4YWQA 1MMDA 4QI0A 3V5YA 1C17M 2FFHA 1SYQA 2J8WA 3HTKC 3GWNA 2IOQA 1L7CA 2YQYA 3C8GB 4E18A 4BJ6A 2NSFA 4JJGA 4I44A 3PCVA 1H7IA 2E87A 3AG2C 2TMVP 2GFHA 2CYDA 3C8ZA 2J9BA 1MMNA 4ANJA 3WG7C 4E7SA 1JRAA 2Y3HA 4E7ZA 2G62A 2J46A 1VLSA 2QUPA 2J0XA 4PACA 3U3BA 4YT2A 1HY5A 2EPOA 3QZCA 1TQGA 5EK0A 3RW0A 5CIVA 3DJNB 4XPXA 1BDJB 1LE2A 1BR1A 5L0DA 4U5CE 1SF8A 3FDQA 4EBKA 1K40A 3E70C 1VMAA 2LFDA 4U5BE 1OR2A 1U0BB 4UDVA 3EG9B 4G7HF 4JCHA 4LLCA 3Q7LA 4GQHA 2UUIA 4KBLA 3L0IA 2L81A 5L0JA 3GEEA 1NU9C 3EGDA 2AVKA 5F5HA 4JCZA 1R4TA 4R32A 5E33A 3HNJA 1W2WA 1M56C 1RMVA 3U8PA 2HKVA 1H9GA 3DMDA 3GM2A 5D91A 4CS8C 5DS4A 5EHHA 4BEMJ 2NSGA 3IQ5A 2J9VA 3PDMP 4YL1A 1ORYA 3UNGC 3ASOC 2PP4A 2RSEB 2YLGA 3C63A 3VM6A 3U0CA 2OEXA 4JIOA 1OW8A 1Y6DA 2GAQA 4BJ5A 1LS1A 1MQVA 2KGOA 2Q4FA 4MVQA 1JAFA 2KC3A 3RYLA 2EPMX 4K1OA 4MW3A 3SYNA 1LS4A 3RF3A 5KYYA 1EQ1A 2LQGA 3RIPA 1RKEA 1PD0A 1T01A 1LI5A 3EZHA 4MVRA 3AOUA 2NUTA 2XSEA 3EGXA 3UMHA 3ZC4A 1FNTc 3ZDLA 2W45A 5DLJA 2LD6A 3S84A 2Z15A 2XLVA 1DOWA 4MNDA 2OCCC 1WTYA 3GEIA 3GEHA 4M63A 3T4RA 3DZAA 1RJ9B 3TQOA 2R7XA 3UMKA 4MVMA 1FMWA 2FGYA 1I4ZA 3C8GD 3RH3A 3SP1A 3ZTMA 5BQHA 1O5HA 2YEVA 3Q6MA 2Q00A 1JR8A 1VB5A 3IQ6A 4HFFB 2AWCA 5CI8A 3HNLA 5JUAA 1J8MF 3ZSUA 3EH2A 4MS2A 4A2NB 2XLOA 3BEHA 4PJLA 4AE4B 3UGPA 3ATPA 3GODA 2XLHA 5KYXB 1D1AA 2WZFA 4CDVA 5L0HA 4XLPF 1OXKA 2DYRC 2DYSC 3NG1A 3WODF 1K05A 4XTKA 3CQZA 4CJGA 2IXNA 2Y39A 1V55C 2L6HA 3C62A 1ZU4A 3OWTA 1A41A 2R9RB 3U2MA 3TK0A 5HV9A 2YHSA 1Q0KA 1VK5A 1OQCA 1Z7Qc 4BJ6C 5L0GA 3CSKA 1TFOB 3JYYA 3VRCA 1LM3B 2A6EF 4CS7A 3H65A 1MMAA 5B1AC 3K1IC 1HW1A 1XZQA 1F1MA 2H7BA 2HV6A 1CPRA 1HMOA 1VOMA 1H6GA 2YZSA 4JVSA 4C3DA 4C7OA 5EGYA 1FFHA 4YT4A 1E84A 5JSLA 2L7AA 1ZHWA 3QMKA 4G7ZF 4XPYA 3S90A 1VYKA 4HEAJ 5DS5A 4OIQF 4JKVA 2HSBA 2XL6A 3IQCA 4RBNA 4BJTA 1OR3A 2V3CC 1O87A 2A68F 2I15A 1A7DA 2NUPB 4OIPF 2R7TA 2V26A 3AQBA 3U9JA 2EIKC 1JPNA 3LLKA 4LDKA 1D0XA 4GYTA 4WJ0A 3DXJF 4JTCB 1YARO 1S7ZA 4CJOA 2NUTB 4ULVA 3U9MA 3CZ6A 3DAFA 3EFOB 1G4US 4DVZA 2B0HA 4CIHA 1G4WR 3ABLC 3SXZA 2RD9A 3TULA 1VLTA 2P7VA 3HLZA 3C7JA 3RQFA 2X51A 1ORJA 1H9TA 4K0DA 3JCUQ 4U5EE 5T3WA 1APCA 4LLEA 4CSAA 3QTHA 3T6JA 3TOLA 3G4ZA 4BJ5C 4MTGA 2L6GA 1NZEA 4JURI 1WOLA 2KQ9A 3NRHA 1C02A 4GEHA 4DRJB 4JW1A 1NG1A 3T6GB 2IYLD 5KYWB 1C03A 1JPJA 1AVOB 1V74B 3RVZA 2YVKA 3RQEA 1AEPA 2WZLA 3AGUA 2VB6A 3G50A 4KC9A 2GWWA 4RDAA 2AP3A 2HZ8A 2ZXPA 2CDQA 3KYIA 1JMWA 2P61A 3NMIA 1A0BA 4ULWA 1YYJA 3S29A 3ZVRA 1M2VA 3HJCA 2YL7A 3MFNA 2C04A 4PR9A 5E2QA 5E3AA 3U3FA 3W8HA 4QI2A 2VCBA 2XLDA 4Z9JA 2PNOA 2EIMC 3AG1C 1OCRC 2MWQA 2D5RB 3MLGA 1HMDA 4XEKA 1TR2A 5DQTA 1UG7A 2A69F 4ZLDA 1OKKA 4E0HA 3NYJA 5L0CA 5COGA 3S0XA 5COFA 1AUEA 2VCCA 5A6BD 4ONSA 3VAYA 4L6RA 3B9QA 4FAPB 3U8VA 3EHNA 3DE8A 3RFYA 3SXMA 3WHNA 1ZHYA 4O7GA 1ZHTA 1RXQA 1TWCA 3K33A 1OW6A 1TWAA 4DVYP 4OIRF 5KYUA 3FAJA 1R5ID 4W8PA 4CS9A 1Z23A 2HMZA 5BUOA 3GWLA 1GQAA 1NFOA 4O6MA 2HV7A 2P1AA 3ZTZA 2YL1A 4J7YA 4K7BA 1NLXA 3B0UX 1ZU5A 2LP4A 3B0PA 4P6IC 3W8IA 4FESA 2ZPAA 2P6VA 5F5FA 3SZRA 1YJGA 3EJNA 3ITFA 5L3VA 3POVA 2ZXOA 3A9CA 4DJ9A 2ETSA 2EPNA 3GM1A 3N24A 2YWAA 3W4YA 4U5DE 2LIGA 4IGGA 3FXHA 4Z9HA 5D92A 1RCPA 2H8AA 1PV3A 2LCHA 4IAQA 1FFTC 4J7TA 3S9OA 4JZAA 3LUTB 3NKDA 4G78A 4U5HA 4EHPA 2J45A 2XL4A 3LS0A 1NSGB 3I5QA 4AL1A 5A69A 3B29A 4XPWA 1OCZC 2WL8A 3O10A 4WGZA 1YA7O 4U9DA 4CIPA 2ZD9A 2JPUA 4NC3A 5AGFA 2VH3A 4BJ1A 1FR0A 1V54C 2PFDA 3Q6NA 3TD7A 3DI5A 5JVEA 3MBGA 3SNHA 2BL2A 4XEFA 4OIOF 1YLMA 3K7DA 1OW7A 4IJJA 5CI9A 2J9UA 5DVWA 1E85A 1LVKA 2GA0A 1PCXA 1B68A 3W2WA 4EBBA 4IRUA 2PF4E 3T9OA 4BG0A 4JE9A 4X0RA 2XXAA 2OKUA 3JZ0A 3SXYA 5BQGA 2CGEA 3LNMB 4PJMA 4YJWA 3RKOF 4EIYA 3ZG1A 5BQIA 1QQ3A 1M2VB 1WWPA 4YK5A 3SXKA 1WN0A 4O6NA 2CW0F 4O79A 4YT5A 4O6YA 1HW2A 1GGQA 4W8KA 5K0IA 3N0TA 2J9WA 3W2VA 1YYXA 3EHMA 5IY5C 3TOMA 1CGME 2J7PD 3IHUA 4FX5A 1HE9A 1Q0DA 2J0WA 4JTAB 2XS8A 1FMVA 3N2ZB 3SEOA 5GPGB 1Z63A 1NFNA 2QE9A 3FMSA 4P9TA 4C3EA 3QVYA 3KL4A 2VASA 3NDBB 3DM9B 2R7VA 4JRZA 4CBEA 3EGDB 2YRFA 4I3MA 3PHF2 3IQTA 4D4NA 4XEVA 2EILC 2R7RA 3C8GA 3U2LA 4MVSA 1YA9A 1YZAA 1E2XA 1QZXA 3B0VC 1EKYA 3OA1A 5T3TA 3KMIA 4G7OF 4D4XA 4LACB 2YLDA 1LIHA 3QW0A 4N4WA 4MVUA 3VYWA 4OD5A 2OU6A 5JLIA 1HE1A 4JJFA 3DE9A 4N6CA 4CDAA 1Y4CA 4DRIB 2DB4A 3R7CA 3MYFA 2VC9A 1D0YA 1E86A 1ZZPA 3GM3A 5HSWA 5KYYB 2WB7A 3NYLA 5KYXA 2CNWD 3KYJA 2UUHA 5AC5A 1RKEB 1ZHXA 3K66A 3EGXB 2ICWG 2OOCA 5TJ5E 2DI3A 4HFKB 3ZQVA 5B3IA 2R7WA 4YL0A 4U9EA 5DQZA 3FOOA 1ZYRF 2QLAA 1UFBA 3FAPB 4MW8A 1QPUA 2Y3GA 4P9FA 2WVOA 5B1BC 4AL0A 4KI2A 2CCYA 4U5FE 2IBFA 1U89A 2JD3A 1OCCC 5JT4A 1YVIA 4I1OB 1OCOC 3JT1A 4DBRA 1ZW3A 5JP7A 1QSPA 4E17A 4PFOA 3OEOA 2AU5A 2XXAB 5KYNA 2W9YA 2R7QA 4Q7CA 1KTMA 2HUJA 3KH2A 1SR2A 3TJ5A 4MVOA 3DD7A 2QTVA 2A1DD 2L9JA 4A4AA 3DWWA 2WVQA 1IW7F 4NTFA 5AC4A 2NG1A 1G8XA 4NTAA 2KYHA 4Q5SF 1T6IA 3KPHA 3LLIA 2A6HF 4IAOA 4CX9A 2F22A 2OG2A 3ECSA 2KW3C 3QW1A 3TJ6A 2R7UA 2A0BA 3DAGA 4YN0B 2C03A 1RKCA 2BE5F 5L0FA 1JOGA 3O6XA 3O39A 1M2OA 3LAYA 3EH1A 4OD4A 3ZQYA 4LDRA 4G0HA 4C7OB 1LPEA 4IB4A 2ASRA 4KNVA 4QDLA 2A0UA 2Q9CA 1J8YF 2D4UA 5JRAA 2XL8A 1TWHA 4J30B 2R03A
chains in the Genus database with same CATH topology
2EINC 3AQCA 4KNWA 1MNDA 3LS1A 5FCLA 3S28A 1PD1A 5B3SC 3GANA 3X1OA 3AG4C 4PFPA 2Y3BA 2PX3A 3LEVA 4FWVA 3LJBA 1MMGA 3JRTA 3K6BA 4IWBA 4BEJA 4PJNA 3FHDA 3PMRA 5DS6A 3FVYA 1NU7D 2W4MA 2QY9A 2IXPA 3ABKC 3L34A 1TWGA 2WVNA 1BR2A 3UR3C 4DOZA 4MQ9F 3IEEA 2LSEA 3LNRA 2NUPA 4ZLCA 1ZHZA 3ASNC 3EZIA 4N06A 3K1HA 4AK9A 4CSAC 4J32B 2MYSA 3EFOA 2EIJC 3LESA 1SMYF 3JYHA 2W4BA 4H4KC 2IXOA 4NY3A 3UMIA 3ZIBA 4XWJA 1KU2A 3UGOA 1WGWA 3DM5A 2Y3DA 3V7OA 2ZXWC 2B0JA 4PJJA 4DBQA 5E3CA 2G3VA 5KYWA 1FTSA 4AX2A 3EQLF 5KYUB 3M1CB 3Q7GA 4B6IA 5T1DB 2WZGA 3S27A 2KJGA 2KNHA 2Q3TA 2R7SA 1Z3IX 2DGJA 3F47A 4RD9A 3B0UX 4F4BA 4CS8A 1IZMA 1Z5ZA 1D1BA 1D1CA 4I1MA 5L3QA 4OINF 4PK4A 2Q9AA 4CS9C 2XRHA 3E9VA 3JSZA 2M4EA 2J7PA 3EG9A 1M57C 2ZXRA 4C3BA 3DJUB 1VYIA 3NKEA 4EWCA 3F46A 2G3KA 4YT8A 1ST6A 4U5GA 4XLNF 2Q9BA 1QLEC 2H7VC 3EPVA 3KKBA 4Q4ZF 2H7OA 3MX3A 2IXMA 1SZIA 1D0ZA 1MNEA 2Y69C 3AG3C 1OKKD 2R7OA 1TKNA 3NYMA 2O9XA 4HE8D 3I5PA 3I4UA 2CNWA 1Z6AA 2I8BA 1LKXA 3X2QC 1RJ9A 3ABMC 4LERA 1N1CA 1BR4A 3T6BA 2PX0A 4YWQA 1MMDA 4QI0A 3HTKC 2IOQA 4BJ6A 4JJGA 4I44A 2E87A 3AG2C 2GFHA 1MMNA 4ANJA 3WG7C 4E7SA 2Y3HA 4E7ZA 2G62A 2J46A 2J0XA 4YT2A 3QZCA 3DJNB 1BR1A 4U5CE 1SF8A 3FDQA 3E70C 1VMAA 4U5BE 3EG9B 4G7HF 4JCHA 4LLCA 3Q7LA 4KBLA 3L0IA 2L81A 1NU9C 3EGDA 5F5HA 5E33A 1W2WA 1M56C 3DMDA 4CS8C 5D91A 5DS4A 5EHHA 2J9VA 3UNGC 3ASOC 2PP4A 4BJ5A 1LS1A 2KGOA 3RYLA 5KYYA 3SYNA 3RIPA 1PD0A 3EZHA 2NUTA 3UMHA 2XSEA 3EGXA 3ZC4A 2W45A 5DLJA 2Z15A 4MNDA 2OCCC 4M63A 3T4RA 3DZAA 1RJ9B 2R7XA 3UMKA 1FMWA 2FGYA 3RH3A 3SP1A 1O5HA 2YEVA 3Q6MA 5CI8A 4HFFB 1J8MF 3ZSUA 3EH2A 4A2NB 4AE4B 4PJLA 3UGPA 3GODA 5KYXB 1D1AA 2WZFA 4XLPF 2DYRC 2DYSC 3NG1A 4XTKA 3CQZA 2IXNA 2Y39A 1V55C 1ZU4A 3OWTA 2YHSA 1VK5A 4BJ6C 3CSKA 2A6EF 4CS7A 3H65A 1MMAA 5B1AC 3K1IC 2H7BA 2HV6A 1TWHA 1VOMA 2YZSA 4JVSA 4C3DA 4C7OA 5EGYA 1FFHA 4YT4A 1ZHWA 3QMKA 4G7ZF 5DS5A 1VYKA 4HEAJ 4OIQF 4BJTA 4RBNA 2V3CC 1O87A 2A68F 2NUPB 4OIPF 2R7TA 2V26A 3AQBA 2EIKC 1JPNA 3LLKA 1D0XA 4GYTA 4WJ0A 3DXJF 1S7ZA 2NUTB 3CZ6A 3DAFA 3EFOB 4CIHA 4DVZA 3ABLC 2P7VA 3HLZA 2X51A 4K0DA 3JCUQ 4U5EE 5T3WA 4CSAA 4LLEA 3T6JA 4BJ5C 1NZEA 4JURI 2KQ9A 3NRHA 4GEHA 4JW1A 1NG1A 2IYLD 5KYWB 1JPJA 2WZLA 4RDAA 2VB6A 4KC9A 2ZXPA 2CDQA 4ULWA 3S29A 3ZVRA 1M2VA 3HJCA 5E3AA 2C04A 5E2QA 4QI2A 3W8HA 2EIMC 3AG1C 1OCRC 2MWQA 2D5RB 3MLGA 5DQTA 1TR2A 2A69F 4ZLDA 1OKKA 3NYJA 3S0XA 3VAYA 3B9QA 3EHNA 3RFYA 1ZHYA 4O7GA 1ZHTA 1TWCA 3K33A 1TWAA 4DVYP 4OIRF 5KYUA 3FAJA 4CS9A 1Z23A 5BUOA 4O6MA 2HV7A 4K7BA 1ZU5A 3B0PA 4P6IC 3W8IA 4FESA 2ZPAA 2P6VA 5F5FA 3SZRA 3EJNA 5L3VA 3ITFA 3POVA 2ZXOA 3N24A 4U5DE 5D92A 1FFTC 4JZAA 3NKDA 4U5HA 2J45A 2XL4A 3LS0A 3I5QA 1OCZC 2WL8A 4BJ1A 2VH3A 2PFDA 1V54C 3Q6NA 3TD7A 4OIOF 3SNHA 4IJJA 3K7DA 5CI9A 2J9UA 5DVWA 1LVKA 1PCXA 3W2WA 4EBBA 4IRUA 2PF4E 4BG0A 4X0RA 2XXAA 2CGEA 4PJMA 3RKOF 4YJWA 3ZG1A 1M2VB 4O6NA 4O79A 2CW0F 4YT5A 4O6YA 4W8KA 3N0TA 2J9WA 3W2VA 5IY5C 3EHMA 2J7PD 4FX5A 2J0WA 1FMVA 3N2ZB 3SEOA 1Z63A 4C3EA 3KL4A 2VASA 3NDBB 3DM9B 2R7VA 4CBEA 3EGDB 4I3MA 3PHF2 2EILC 2R7RA 3B0VC 1QZXA 3OA1A 5T3TA 3KMIA 4G7OF 4LACB 3VYWA 4OD5A 4JJFA 1D0YA 5HSWA 5KYYB 2WB7A 3NYLA 2CNWD 1ZHXA 3K66A 3EGXB 4HFKB 2R7WA 5DQZA 3WODF 1ZYRF 5B1BC 2Y3GA 4KI2A 2WVOA 4U5FE 2JD3A 1OCCC 4I1OB 1OCOC 3JT1A 4DBRA 4PFOA 3OEOA 2XXAB 5KYNA 2W9YA 2R7QA 4Q7CA 3KH2A 3DD7A 2QTVA 2A1DD 2L9JA 2WVQA 1IW7F 2NG1A 1G8XA 4Q5SF 3LLIA 2A6HF 4IAOA 2OG2A 3ECSA 2KW3C 2R7UA 3DAGA 4YN0B 2C03A 2BE5F 3O6XA 3O39A 1M2OA 3LAYA 3EH1A 4OD4A 4G0HA 4C7OB 4KNVA 4QDLA 2Q9CA 1J8YF 4AE4A 2FFHA 4J30B 5KYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3V A; 
#chains in the Genus database with same CATH topology
 4N6H A;  3K1I A;  3NMJ A;  2EIN C;  4XQ1 A;  4H54 A;  1YZC A;  5F28 E;  1I4Y A;  1A7V A;  3AQC A;  4KNW A;  1MND A;  3VF0 A;  2OQM A;  1T9K A;  2P0N A;  3LS1 A;  5FCL A;  3S28 A;  1PD1 A;  1EA8 A;  3GAN A;  3X1O A;  5B3S C;  3AG4 C;  1CGO A;  4PFP A;  2Y3B A;  2PX3 A;  3LEV A;  1Q0F A;  4Z9I A;  2HFI A;  4FWV A;  3LJB A;  1MMG A;  3JRT A;  1ZW2 A;  3K6B A;  4EKW A;  4IWB A;  4BEJ A;  4PJN A;  2IM8 A;  1GM5 A;  3FHD A;  3PMR A;  4MTF A;  4EUK B;  2HJM A;  2M64 A;  3AGT A;  5DS6 A;  1XZP A;  1CGN A;  2BC5 A;  3FVY A;  3V5Z A;  3R2P A;  1NU7 D;  2W4M A;  1T6U A;  2QY9 A;  1T5O A;  2IXP A;  3M79 A;  3RQG A;  5A6B A;  5A6A A;  3ABK C;  3L34 A;  1TWG A;  2WVN A;  3JTL O;  1O3U A;  1BR2 A;  2X0C A;  3UR3 C;  1QVX A;  3HKK A;  4MQ9 F;  4DOZ A;  3A11 A;  3H2V A;  3IEE A;  1WAT A;  3V5X A;  1BBH A;  2LSE A;  3LNR A;  5A6K A;  2NUP A;  5A6J A;  4ZLC A;  2XM0 A;  1DOV A;  2NPU A;  3M4B A;  4DXW A;  1ZHZ A;  3ASN C;  2GDC A;  3EZI A;  3K1H A;  4N06 A;  3U5S A;  2PBE A;  4AK9 A;  4CSA C;  4E0I A;  4J32 B;  3L1M A;  2MYS A;  2YKZ A;  2EIJ C;  1M6T A;  3EFO A;  2KSF A;  3LES A;  4IAR A;  4NTB A;  4ER9 A;  1SMY F;  1LI7 A;  3JYH A;  2YL0 A;  256B A;  1Q0G A;  3FOP A;  2W4B A;  3RVY A;  3AJM A;  2OEV A;  4H4K C;  2IXO A;  4LDQ A;  3HNK A;  4NY3 A;  3UMI A;  3DKA A;  4XWJ A;  3ZIB A;  1KU2 A;  1FAP B;  3UGO A;  4WAB A;  4MVZ A;  2HMQ A;  2LFF A;  1T6Q A;  4NQF A;  1WGW A;  3DM5 A;  2HJ3 A;  3QVZ A;  2Y3D A;  3V7O A;  1EI7 A;  2R05 A;  2ZXW C;  2OJQ A;  2B0J A;  2FAP B;  2KK1 A;  4PJJ A;  4AE4 A;  4CDY A;  4DBQ A;  1Q0M A;  2G3V A;  5E3C A;  5KYW A;  1CPQ A;  1FTS A;  2HSQ A;  1K04 A;  3EQL F;  3GOR A;  3NMK A;  2EPL X;  4AX2 A;  5KYU B;  3M1C B;  3Q7G A;  4B6I A;  2YL3 A;  3JSE O;  2XLE A;  5T1D B;  2LK4 A;  3L8J A;  3LEO A;  4JEB A;  2WZG A;  3US6 A;  3S27 A;  2KJG A;  2KNH A;  4EBJ A;  2Q3T A;  4DRH B;  1YAU O;  3WAQ A;  2R7S A;  1Z3I X;  2DGJ A;  3F47 A;  4RD9 A;  1I5N A;  3HNI A;  4WGY A;  1ORS C;  2XLW A;  1G5Z A;  2Q7R A;  4F4B A;  1A7E A;  2XLM A;  3CAX A;  1LE4 A;  4CS8 A;  1IZM A;  1Z5Z A;  1D1B A;  1D1C A;  4I1M A;  3L8I A;  5L3Q A;  1U6H A;  4OIN F;  1QKR A;  4NCQ A;  4PK4 A;  2Q9A A;  3M15 A;  4CS9 C;  2XRH A;  3E9V A;  1YDI A;  3CEX A;  1S05 A;  3JSZ A;  2M4E A;  2L6F A;  4JC7 A;  2J7P A;  5L0I A;  3EG9 A;  1M57 C;  2ZXR A;  5FZT A;  2YLI A;  3DJU B;  4C3B A;  5COM A;  1VYI A;  3NKE A;  4EWC A;  1TFK B;  3F46 A;  2JX0 A;  2R25 A;  2G3K A;  3J06 A;  4MTO A;  4YT8 A;  1ST6 A;  3C18 A;  4U5G A;  1GS9 A;  4XLN F;  1L3P A;  2Q9B A;  1QLE C;  2H7V C;  3EPV A;  3KKB A;  4Q4Z F;  1NBB A;  2OJE D;  2H7O A;  3H2U A;  2MHR A;  1V4A A;  1XWJ A;  3MX3 A;  2HS5 A;  4YL3 A;  2IXM A;  1SZI A;  1D0Z A;  1MNE A;  2XS1 A;  2Y69 C;  1E83 A;  1VTM P;  2R02 A;  2EPK X;  2VCA A;  1KNY A;  1OKK D;  2R7O A;  3AG3 C;  1ZVZ A;  3JRM O;  2XM4 A;  3MYI A;  2QNL A;  1TKN A;  3NYM A;  4BPM A;  2O9X A;  1BZ4 A;  4HE8 D;  1OXB A;  1WAS A;  3B71 A;  3I5P A;  3IPM O;  5JS5 A;  2AWY A;  3G4X A;  3I4U A;  2CNW A;  4JTD B;  1Z6A A;  2I8B A;  4JEA A;  1LKX A;  3X2Q C;  1RJ9 A;  3ABM C;  4LER A;  1N1C A;  1BR4 A;  3M4C A;  3O55 A;  3BRJ A;  3T6B A;  3ZWI A;  2PX0 A;  4YWQ A;  1MMD A;  4QI0 A;  3V5Y A;  1C17 M;  2FFH A;  1SYQ A;  2J8W A;  3HTK C;  3GWN A;  2IOQ A;  1L7C A;  2YQY A;  3C8G B;  4E18 A;  4BJ6 A;  2NSF A;  4JJG A;  4I44 A;  3PCV A;  1H7I A;  2E87 A;  3AG2 C;  2TMV P;  2GFH A;  2CYD A;  3C8Z A;  2J9B A;  1MMN A;  4ANJ A;  3WG7 C;  4E7S A;  1JRA A;  2Y3H A;  4E7Z A;  2G62 A;  2J46 A;  1VLS A;  2QUP A;  2J0X A;  4PAC A;  3U3B A;  4YT2 A;  1HY5 A;  2EPO A;  3QZC A;  1TQG A;  5EK0 A;  3RW0 A;  5CIV A;  3DJN B;  4XPX A;  1BDJ B;  1LE2 A;  1BR1 A;  5L0D A;  4U5C E;  1SF8 A;  3FDQ A;  4EBK A;  1K40 A;  3E70 C;  1VMA A;  2LFD A;  4U5B E;  1OR2 A;  1U0B B;  4UDV A;  3EG9 B;  4G7H F;  4JCH A;  4LLC A;  3Q7L A;  4GQH A;  2UUI A;  4KBL A;  3L0I A;  2L81 A;  5L0J A;  3GEE A;  1NU9 C;  3EGD A;  2AVK A;  5F5H A;  4JCZ A;  1R4T A;  4R32 A;  5E33 A;  3HNJ A;  1W2W A;  1M56 C;  1RMV A;  3U8P A;  2HKV A;  1H9G A;  3DMD A;  3GM2 A;  5D91 A;  4CS8 C;  5DS4 A;  5EHH A;  4BEM J;  2NSG A;  3IQ5 A;  2J9V A;  3PDM P;  4YL1 A;  1ORY A;  3UNG C;  3ASO C;  2PP4 A;  2RSE B;  2YLG A;  3C63 A;  3VM6 A;  3U0C A;  2OEX A;  4JIO A;  1OW8 A;  1Y6D A;  2GAQ A;  4BJ5 A;  1LS1 A;  1MQV A;  2KGO A;  2Q4F A;  4MVQ A;  1JAF A;  2KC3 A;  3RYL A;  2EPM X;  4K1O A;  4MW3 A;  3SYN A;  1LS4 A;  3RF3 A;  5KYY A;  1EQ1 A;  2LQG A;  3RIP A;  1RKE A;  1PD0 A;  1T01 A;  1LI5 A;  3EZH A;  4MVR A;  3AOU A;  2NUT A;  2XSE A;  3EGX A;  3UMH A;  3ZC4 A;  1FNT c;  3ZDL A;  2W45 A;  5DLJ A;  2LD6 A;  3S84 A;  2Z15 A;  2XLV A;  1DOW A;  4MND A;  2OCC C;  1WTY A;  3GEI A;  3GEH A;  4M63 A;  3T4R A;  3DZA A;  1RJ9 B;  3TQO A;  2R7X A;  3UMK A;  4MVM A;  1FMW A;  2FGY A;  1I4Z A;  3C8G D;  3RH3 A;  3SP1 A;  3ZTM A;  5BQH A;  1O5H A;  2YEV A;  3Q6M A;  2Q00 A;  1JR8 A;  1VB5 A;  3IQ6 A;  4HFF B;  2AWC A;  5CI8 A;  3HNL A;  5JUA A;  1J8M F;  3ZSU A;  3EH2 A;  4MS2 A;  4A2N B;  2XLO A;  3BEH A;  4PJL A;  4AE4 B;  3UGP A;  3ATP A;  3GOD A;  2XLH A;  5KYX B;  1D1A A;  2WZF A;  4CDV A;  5L0H A;  4XLP F;  1OXK A;  2DYR C;  2DYS C;  3NG1 A;  3WOD F;  1K05 A;  4XTK A;  3CQZ A;  4CJG A;  2IXN A;  2Y39 A;  1V55 C;  2L6H A;  3C62 A;  1ZU4 A;  3OWT A;  1A41 A;  2R9R B;  3U2M A;  3TK0 A;  5HV9 A;  2YHS A;  1Q0K A;  1VK5 A;  1OQC A;  1Z7Q c;  4BJ6 C;  5L0G A;  3CSK A;  1TFO B;  3JYY A;  3VRC A;  1LM3 B;  2A6E F;  4CS7 A;  3H65 A;  1MMA A;  5B1A C;  3K1I C;  1HW1 A;  1XZQ A;  1F1M A;  2H7B A;  2HV6 A;  1CPR A;  1HMO A;  1VOM A;  1H6G A;  2YZS A;  4JVS A;  4C3D A;  4C7O A;  5EGY A;  1FFH A;  4YT4 A;  1E84 A;  5JSL A;  2L7A A;  1ZHW A;  3QMK A;  4G7Z F;  4XPY A;  3S90 A;  1VYK A;  4HEA J;  5DS5 A;  4OIQ F;  4JKV A;  2HSB A;  2XL6 A;  3IQC A;  4RBN A;  4BJT A;  1OR3 A;  2V3C C;  1O87 A;  2A68 F;  2I15 A;  1A7D A;  2NUP B;  4OIP F;  2R7T A;  2V26 A;  3AQB A;  3U9J A;  2EIK C;  1JPN A;  3LLK A;  4LDK A;  1D0X A;  4GYT A;  4WJ0 A;  3DXJ F;  4JTC B;  1YAR O;  1S7Z A;  4CJO A;  2NUT B;  4ULV A;  3U9M A;  3CZ6 A;  3DAF A;  3EFO B;  1G4U S;  4DVZ A;  2B0H A;  4CIH A;  1G4W R;  3ABL C;  3SXZ A;  2RD9 A;  3TUL A;  1VLT A;  2P7V A;  3HLZ A;  3C7J A;  3RQF A;  2X51 A;  1ORJ A;  1H9T A;  4K0D A;  3JCU Q;  4U5E E;  5T3W A;  1APC A;  4LLE A;  4CSA A;  3QTH A;  3T6J A;  3TOL A;  3G4Z A;  4BJ5 C;  4MTG A;  2L6G A;  1NZE A;  4JUR I;  1WOL A;  2KQ9 A;  3NRH A;  1C02 A;  4GEH A;  4DRJ B;  4JW1 A;  1NG1 A;  3T6G B;  2IYL D;  5KYW B;  1C03 A;  1JPJ A;  1AVO B;  1V74 B;  3RVZ A;  2YVK A;  3RQE A;  1AEP A;  2WZL A;  3AGU A;  2VB6 A;  3G50 A;  4KC9 A;  2GWW A;  4RDA A;  2AP3 A;  2HZ8 A;  2ZXP A;  2CDQ A;  3KYI A;  1JMW A;  2P61 A;  3NMI A;  1A0B A;  4ULW A;  1YYJ A;  3S29 A;  3ZVR A;  1M2V A;  3HJC A;  2YL7 A;  3MFN A;  2C04 A;  4PR9 A;  5E2Q A;  5E3A A;  3U3F A;  3W8H A;  4QI2 A;  2VCB A;  2XLD A;  4Z9J A;  2PNO A;  2EIM C;  3AG1 C;  1OCR C;  2MWQ A;  2D5R B;  3MLG A;  1HMD A;  4XEK A;  1TR2 A;  5DQT A;  1UG7 A;  2A69 F;  4ZLD A;  1OKK A;  4E0H A;  3NYJ A;  5L0C A;  5COG A;  3S0X A;  5COF A;  1AUE A;  2VCC A;  5A6B D;  4ONS A;  3VAY A;  4L6R A;  3B9Q A;  4FAP B;  3U8V A;  3EHN A;  3DE8 A;  3RFY A;  3SXM A;  3WHN A;  1ZHY A;  4O7G A;  1ZHT A;  1RXQ A;  1TWC A;  3K33 A;  1OW6 A;  1TWA A;  4DVY P;  4OIR F;  5KYU A;  3FAJ A;  1R5I D;  4W8P A;  4CS9 A;  1Z23 A;  2HMZ A;  5BUO A;  3GWL A;  1GQA A;  1NFO A;  4O6M A;  2HV7 A;  2P1A A;  3ZTZ A;  2YL1 A;  4J7Y A;  4K7B A;  1NLX A;  3B0U X;  1ZU5 A;  2LP4 A;  3B0P A;  4P6I C;  3W8I A;  4FES A;  2ZPA A;  2P6V A;  5F5F A;  3SZR A;  1YJG A;  3EJN A;  3ITF A;  5L3V A;  3POV A;  2ZXO A;  3A9C A;  4DJ9 A;  2ETS A;  2EPN A;  3GM1 A;  3N24 A;  2YWA A;  3W4Y A;  4U5D E;  2LIG A;  4IGG A;  3FXH A;  4Z9H A;  5D92 A;  1RCP A;  2H8A A;  1PV3 A;  2LCH A;  4IAQ A;  1FFT C;  4J7T A;  3S9O A;  4JZA A;  3LUT B;  3NKD A;  4G78 A;  4U5H A;  4EHP A;  2J45 A;  2XL4 A;  3LS0 A;  1NSG B;  3I5Q A;  4AL1 A;  5A69 A;  3B29 A;  4XPW A;  1OCZ C;  2WL8 A;  3O10 A;  4WGZ A;  1YA7 O;  4U9D A;  4CIP A;  2ZD9 A;  2JPU A;  4NC3 A;  5AGF A;  2VH3 A;  4BJ1 A;  1FR0 A;  1V54 C;  2PFD A;  3Q6N A;  3TD7 A;  3DI5 A;  5JVE A;  3MBG A;  3SNH A;  2BL2 A;  4XEF A;  4OIO F;  1YLM A;  3K7D A;  1OW7 A;  4IJJ A;  5CI9 A;  2J9U A;  5DVW A;  1E85 A;  1LVK A;  2GA0 A;  1PCX A;  1B68 A;  3W2W A;  4EBB A;  4IRU A;  2PF4 E;  3T9O A;  4BG0 A;  4JE9 A;  4X0R A;  2XXA A;  2OKU A;  3JZ0 A;  3SXY A;  5BQG A;  2CGE A;  3LNM B;  4PJM A;  4YJW A;  3RKO F;  4EIY A;  3ZG1 A;  5BQI A;  1QQ3 A;  1M2V B;  1WWP A;  4YK5 A;  3SXK A;  1WN0 A;  4O6N A;  2CW0 F;  4O79 A;  4YT5 A;  4O6Y A;  1HW2 A;  1GGQ A;  4W8K A;  5K0I A;  3N0T A;  2J9W A;  3W2V A;  1YYX A;  3EHM A;  5IY5 C;  3TOM A;  1CGM E;  2J7P D;  3IHU A;  4FX5 A;  1HE9 A;  1Q0D A;  2J0W A;  4JTA B;  2XS8 A;  1FMV A;  3N2Z B;  3SEO A;  5GPG B;  1Z63 A;  1NFN A;  2QE9 A;  3FMS A;  4P9T A;  4C3E A;  3QVY A;  3KL4 A;  2VAS A;  3NDB B;  3DM9 B;  2R7V A;  4JRZ A;  4CBE A;  3EGD B;  2YRF A;  4I3M A;  3PHF 2;  3IQT A;  4D4N A;  4XEV A;  2EIL C;  2R7R A;  3C8G A;  3U2L A;  4MVS A;  1YA9 A;  1YZA A;  1E2X A;  1QZX A;  3B0V C;  1EKY A;  3OA1 A;  5T3T A;  3KMI A;  4G7O F;  4D4X A;  4LAC B;  2YLD A;  1LIH A;  3QW0 A;  4N4W A;  4MVU A;  3VYW A;  4OD5 A;  2OU6 A;  5JLI A;  1HE1 A;  4JJF A;  3DE9 A;  4N6C A;  4CDA A;  1Y4C A;  4DRI B;  2DB4 A;  3R7C A;  3MYF A;  2VC9 A;  1D0Y A;  1E86 A;  1ZZP A;  3GM3 A;  5HSW A;  5KYY B;  2WB7 A;  3NYL A;  5KYX A;  2CNW D;  3KYJ A;  2UUH A;  5AC5 A;  1RKE B;  1ZHX A;  3K66 A;  3EGX B;  2ICW G;  2OOC A;  5TJ5 E;  2DI3 A;  4HFK B;  3ZQV A;  5B3I A;  2R7W A;  4YL0 A;  4U9E A;  5DQZ A;  3FOO A;  1ZYR F;  2QLA A;  1UFB A;  3FAP B;  4MW8 A;  1QPU A;  2Y3G A;  4P9F A;  2WVO A;  5B1B C;  4AL0 A;  4KI2 A;  2CCY A;  4U5F E;  2IBF A;  1U89 A;  2JD3 A;  1OCC C;  5JT4 A;  1YVI A;  4I1O B;  1OCO C;  3JT1 A;  4DBR A;  1ZW3 A;  5JP7 A;  1QSP A;  4E17 A;  4PFO A;  3OEO A;  2AU5 A;  2XXA B;  5KYN A;  2W9Y A;  2R7Q A;  4Q7C A;  1KTM A;  2HUJ A;  3KH2 A;  1SR2 A;  3TJ5 A;  4MVO A;  3DD7 A;  2QTV A;  2A1D D;  2L9J A;  4A4A A;  3DWW A;  2WVQ A;  1IW7 F;  4NTF A;  5AC4 A;  2NG1 A;  1G8X A;  4NTA A;  2KYH A;  4Q5S F;  1T6I A;  3KPH A;  3LLI A;  2A6H F;  4IAO A;  4CX9 A;  2F22 A;  2OG2 A;  3ECS A;  2KW3 C;  3QW1 A;  3TJ6 A;  2R7U A;  2A0B A;  3DAG A;  4YN0 B;  2C03 A;  1RKC A;  2BE5 F;  5L0F A;  1JOG A;  3O6X A;  3O39 A;  1M2O A;  3LAY A;  3EH1 A;  4OD4 A;  3ZQY A;  4LDR A;  4G0H A;  4C7O B;  1LPE A;  4IB4 A;  2ASR A;  4KNV A;  4QDL A;  2A0U A;  2Q9C A;  1J8Y F;  2D4U A;  5JRA A;  2XL8 A;  1TWH A;  4J30 B;  2R03 A; 
#chains in the Genus database with same CATH homology
 2EIN C;  3AQC A;  4KNW A;  1MND A;  3LS1 A;  5FCL A;  3S28 A;  1PD1 A;  5B3S C;  3GAN A;  3X1O A;  3AG4 C;  4PFP A;  2Y3B A;  2PX3 A;  3LEV A;  4FWV A;  3LJB A;  1MMG A;  3JRT A;  3K6B A;  4IWB A;  4BEJ A;  4PJN A;  3FHD A;  3PMR A;  5DS6 A;  3FVY A;  1NU7 D;  2W4M A;  2QY9 A;  2IXP A;  3ABK C;  3L34 A;  1TWG A;  2WVN A;  1BR2 A;  3UR3 C;  4DOZ A;  4MQ9 F;  3IEE A;  2LSE A;  3LNR A;  2NUP A;  4ZLC A;  1ZHZ A;  3ASN C;  3EZI A;  4N06 A;  3K1H A;  4AK9 A;  4CSA C;  4J32 B;  2MYS A;  3EFO A;  2EIJ C;  3LES A;  1SMY F;  3JYH A;  2W4B A;  4H4K C;  2IXO A;  4NY3 A;  3UMI A;  3ZIB A;  4XWJ A;  1KU2 A;  3UGO A;  1WGW A;  3DM5 A;  2Y3D A;  3V7O A;  2ZXW C;  2B0J A;  4PJJ A;  4DBQ A;  5E3C A;  2G3V A;  5KYW A;  1FTS A;  4AX2 A;  3EQL F;  5KYU B;  3M1C B;  3Q7G A;  4B6I A;  5T1D B;  2WZG A;  3S27 A;  2KJG A;  2KNH A;  2Q3T A;  2R7S A;  1Z3I X;  2DGJ A;  3F47 A;  4RD9 A;  3B0U X;  4F4B A;  4CS8 A;  1IZM A;  1Z5Z A;  1D1B A;  1D1C A;  4I1M A;  5L3Q A;  4OIN F;  4PK4 A;  2Q9A A;  4CS9 C;  2XRH A;  3E9V A;  3JSZ A;  2M4E A;  2J7P A;  3EG9 A;  1M57 C;  2ZXR A;  4C3B A;  3DJU B;  1VYI A;  3NKE A;  4EWC A;  3F46 A;  2G3K A;  4YT8 A;  1ST6 A;  4U5G A;  4XLN F;  2Q9B A;  1QLE C;  2H7V C;  3EPV A;  3KKB A;  4Q4Z F;  2H7O A;  3MX3 A;  2IXM A;  1SZI A;  1D0Z A;  1MNE A;  2Y69 C;  3AG3 C;  1OKK D;  2R7O A;  1TKN A;  3NYM A;  2O9X A;  4HE8 D;  3I5P A;  3I4U A;  2CNW A;  1Z6A A;  2I8B A;  1LKX A;  3X2Q C;  1RJ9 A;  3ABM C;  4LER A;  1N1C A;  1BR4 A;  3T6B A;  2PX0 A;  4YWQ A;  1MMD A;  4QI0 A;  3HTK C;  2IOQ A;  4BJ6 A;  4JJG A;  4I44 A;  2E87 A;  3AG2 C;  2GFH A;  1MMN A;  4ANJ A;  3WG7 C;  4E7S A;  2Y3H A;  4E7Z A;  2G62 A;  2J46 A;  2J0X A;  4YT2 A;  3QZC A;  3DJN B;  1BR1 A;  4U5C E;  1SF8 A;  3FDQ A;  3E70 C;  1VMA A;  4U5B E;  3EG9 B;  4G7H F;  4JCH A;  4LLC A;  3Q7L A;  4KBL A;  3L0I A;  2L81 A;  1NU9 C;  3EGD A;  5F5H A;  5E33 A;  1W2W A;  1M56 C;  3DMD A;  4CS8 C;  5D91 A;  5DS4 A;  5EHH A;  2J9V A;  3UNG C;  3ASO C;  2PP4 A;  4BJ5 A;  1LS1 A;  2KGO A;  3RYL A;  5KYY A;  3SYN A;  3RIP A;  1PD0 A;  3EZH A;  2NUT A;  3UMH A;  2XSE A;  3EGX A;  3ZC4 A;  2W45 A;  5DLJ A;  2Z15 A;  4MND A;  2OCC C;  4M63 A;  3T4R A;  3DZA A;  1RJ9 B;  2R7X A;  3UMK A;  1FMW A;  2FGY A;  3RH3 A;  3SP1 A;  1O5H A;  2YEV A;  3Q6M A;  5CI8 A;  4HFF B;  1J8M F;  3ZSU A;  3EH2 A;  4A2N B;  4AE4 B;  4PJL A;  3UGP A;  3GOD A;  5KYX B;  1D1A A;  2WZF A;  4XLP F;  2DYR C;  2DYS C;  3NG1 A;  4XTK A;  3CQZ A;  2IXN A;  2Y39 A;  1V55 C;  1ZU4 A;  3OWT A;  2YHS A;  1VK5 A;  4BJ6 C;  3CSK A;  2A6E F;  4CS7 A;  3H65 A;  1MMA A;  5B1A C;  3K1I C;  2H7B A;  2HV6 A;  1TWH A;  1VOM A;  2YZS A;  4JVS A;  4C3D A;  4C7O A;  5EGY A;  1FFH A;  4YT4 A;  1ZHW A;  3QMK A;  4G7Z F;  5DS5 A;  1VYK A;  4HEA J;  4OIQ F;  4BJT A;  4RBN A;  2V3C C;  1O87 A;  2A68 F;  2NUP B;  4OIP F;  2R7T A;  2V26 A;  3AQB A;  2EIK C;  1JPN A;  3LLK A;  1D0X A;  4GYT A;  4WJ0 A;  3DXJ F;  1S7Z A;  2NUT B;  3CZ6 A;  3DAF A;  3EFO B;  4CIH A;  4DVZ A;  3ABL C;  2P7V A;  3HLZ A;  2X51 A;  4K0D A;  3JCU Q;  4U5E E;  5T3W A;  4CSA A;  4LLE A;  3T6J A;  4BJ5 C;  1NZE A;  4JUR I;  2KQ9 A;  3NRH A;  4GEH A;  4JW1 A;  1NG1 A;  2IYL D;  5KYW B;  1JPJ A;  2WZL A;  4RDA A;  2VB6 A;  4KC9 A;  2ZXP A;  2CDQ A;  4ULW A;  3S29 A;  3ZVR A;  1M2V A;  3HJC A;  5E3A A;  2C04 A;  5E2Q A;  4QI2 A;  3W8H A;  2EIM C;  3AG1 C;  1OCR C;  2MWQ A;  2D5R B;  3MLG A;  5DQT A;  1TR2 A;  2A69 F;  4ZLD A;  1OKK A;  3NYJ A;  3S0X A;  3VAY A;  3B9Q A;  3EHN A;  3RFY A;  1ZHY A;  4O7G A;  1ZHT A;  1TWC A;  3K33 A;  1TWA A;  4DVY P;  4OIR F;  5KYU A;  3FAJ A;  4CS9 A;  1Z23 A;  5BUO A;  4O6M A;  2HV7 A;  4K7B A;  1ZU5 A;  3B0P A;  4P6I C;  3W8I A;  4FES A;  2ZPA A;  2P6V A;  5F5F A;  3SZR A;  3EJN A;  5L3V A;  3ITF A;  3POV A;  2ZXO A;  3N24 A;  4U5D E;  5D92 A;  1FFT C;  4JZA A;  3NKD A;  4U5H A;  2J45 A;  2XL4 A;  3LS0 A;  3I5Q A;  1OCZ C;  2WL8 A;  4BJ1 A;  2VH3 A;  2PFD A;  1V54 C;  3Q6N A;  3TD7 A;  4OIO F;  3SNH A;  4IJJ A;  3K7D A;  5CI9 A;  2J9U A;  5DVW A;  1LVK A;  1PCX A;  3W2W A;  4EBB A;  4IRU A;  2PF4 E;  4BG0 A;  4X0R A;  2XXA A;  2CGE A;  4PJM A;  3RKO F;  4YJW A;  3ZG1 A;  1M2V B;  4O6N A;  4O79 A;  2CW0 F;  4YT5 A;  4O6Y A;  4W8K A;  3N0T A;  2J9W A;  3W2V A;  5IY5 C;  3EHM A;  2J7P D;  4FX5 A;  2J0W A;  1FMV A;  3N2Z B;  3SEO A;  1Z63 A;  4C3E A;  3KL4 A;  2VAS A;  3NDB B;  3DM9 B;  2R7V A;  4CBE A;  3EGD B;  4I3M A;  3PHF 2;  2EIL C;  2R7R A;  3B0V C;  1QZX A;  3OA1 A;  5T3T A;  3KMI A;  4G7O F;  4LAC B;  3VYW A;  4OD5 A;  4JJF A;  1D0Y A;  5HSW A;  5KYY B;  2WB7 A;  3NYL A;  2CNW D;  1ZHX A;  3K66 A;  3EGX B;  4HFK B;  2R7W A;  5DQZ A;  3WOD F;  1ZYR F;  5B1B C;  2Y3G A;  4KI2 A;  2WVO A;  4U5F E;  2JD3 A;  1OCC C;  4I1O B;  1OCO C;  3JT1 A;  4DBR A;  4PFO A;  3OEO A;  2XXA B;  5KYN A;  2W9Y A;  2R7Q A;  4Q7C A;  3KH2 A;  3DD7 A;  2QTV A;  2A1D D;  2L9J A;  2WVQ A;  1IW7 F;  2NG1 A;  1G8X A;  4Q5S F;  3LLI A;  2A6H F;  4IAO A;  2OG2 A;  3ECS A;  2KW3 C;  2R7U A;  3DAG A;  4YN0 B;  2C03 A;  2BE5 F;  3O6X A;  3O39 A;  1M2O A;  3LAY A;  3EH1 A;  4OD4 A;  4G0H A;  4C7O B;  4KNV A;  4QDL A;  2Q9C A;  1J8Y F;  4AE4 A;  2FFH A;  4J30 B;  5KYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...