2G3VA

Crystal structure of cags (hp0534, cag13) from helicobacter pylori
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
161
Chain Sequence
KLIESLQENELLNTDEKKKIIDQIKTMHDFFKQMHTNKGALDKVLRNYMKDYRAVIKSIGVDKFKKVYRLLESETMELLHAIAENPNFLFSKFDRSILGIFLPFFSKPIMFKMSIREMDSQIELYGTKLPLLKLFVMTDEEMNFYANLKTIEQYNDYVRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAG pathogenicity island protein 13
publication title Crystal structure of CagS from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Unknown function
total genus 43
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16707 CagS Cag pathogenicity island protein S of Helicobacter pylori
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2g3vA00
2G3VA
chains in the Genus database with same CATH superfamily
3PMRA 1QQ3A 3KYJA 3TD7A 1E86A 1WN0A 4XEFA 4Q5SF 1SF8A 1LI7A 2J7PD 1OKKA 2P0NA 3GM2A 4U9DA 3ASOC 2GAQA 3EZIA 4MS2A 1GM5A 2GFHA 2WZGA 3MFNA 4IWBA 4G7OF 2G62A 1K05A 2EPOA 1ZHWA 1VYKA 2CDQA 5F5HA 1SZIA 3LEOA 3IHUA 3ZSUA 4E0HA 3CEXA 3IQ6A 3NMIA 1OCRC 3O10A 4DRIB 1APCA 3H2VA 1ST6A 3JCUQ 4RD9A 1Y6DA 2ZXOA 2JPUA 1NBBA 1N1CA 2KC3A 4OINF 4JTAB 2EINC 2R7RA 1OCOC 4EUKB 3QMKA 2OOCA 3KPHA 3AQBA 3EHNA 1RMVA 1K04A 5COMA 2BE5F 2CNWA 3K1IA 1D1AA 1M2VA 4PR9A 1C02A 4N6CA 4CX9A 4HEAJ 5L0DA 1A41A 1JPJA 1JPNA 1MMAA 3O6XA 1GS9A 1T6IA 3K33A 4IRUA 4JEAA 1U0BB 1RKEB 2EPNA 3SXMA 1PD0A 1EI7A 2R25A 2YEVA 3U2LA 1KTMA 1YA7O 2W9YA 4ULVA 3T4RA 3QZCA 1E83A 4U5FE 3W4YA 5B1AC 2VCCA 2D4UA 3HJCA 1YDIA 4PJJA 1MNEA 4BJ5C 4J30B 5K0IA 1S05A 3EQLF 5COGA 3ZG1A 4QDLA 3JTLO 5BQHA 3T9OA 1SMYF 2J0XA 4DJ9A 3CAXA 2YKZA 2J9BA 3I5PA 1NFOA 2A68F 3U5SA 3X2QC 5L0CA 4XPXA 2UUHA 5EGYA 2C04A 2QTVA 4P9TA 1V54C 4YJWA 1R4TA 4JKVA 2KYHA 2IXPA 3HNLA 1ZU5A 2L9JA 3WG7C 2JX0A 1T6QA 3EGXA 4R32A 4NTBA 3KMIA 3ZTMA 4J7TA 4MVZA 3QTHA 4PK4A 1WOLA 4YL1A 2Q7RA 2P7VA 3EG9B 2YL3A 4MVUA 4FAPB 2HMQA 3U3BA 4CSAA 2ZPAA 3C8GB 4QI0A 4LACB 5COFA 3DKAA 4FESA 2NUTB 1SYQA 1UG7A 1T01A 3B0VC 1Q0KA 3PDMP 3FDQA 2J0WA 2XLHA 3EHMA 5HV9A 3GEEA 3AGTA 3L8JA 4U5HA 1NLXA 1EKYA 1TWCA 2I15A 2A1DD 2QUPA 3NYJA 3RVYA 3VM6A 5BUOA 3KYIA 4IJJA 1OKKD 3DE8A 3N24A 3ZWIA 2XXAB 1T6UA 3TOMA 2KNHA 1ZW3A 1T5OA 3LJBA 4KNWA 1BR2A 2CW0F 5AC5A 1VK5A 2YZSA 2I8BA 2L7AA 3DAGA 3DJUB 4P9FA 1VMAA 1L7CA 3EH2A 3TJ6A 1CGME 2VC9A 3LNRA 4C3BA 4JURI 3MBGA 4NC3A 4JCZA 4UDVA 3MYFA 4LDRA 4RDAA 2XL6A 1DOWA 4BJ6A 4U5BE 3B0UX 5KYWA 3TQOA 3GWLA 1I4ZA 1QKRA 1RKCA 2YLGA 1LM3B 2UUIA 3ABKC 3AJMA 4K0DA 2J45A 3RIPA 3UGOA 4CDYA 3H65A 1OXKA 1NG1A 3O39A 2HZ8A 3FAJA 2MHRA 3FAPB 3G4ZA 4Q4ZF 4GYTA 2Q9AA 4F4BA 2HFIA 1ZW2A 4KBLA 2YQYA 3B71A 1YJGA 2XS1A 5JLIA 5CIVA 3EH1A 1K40A 3S28A 3U8PA 1JR8A 4PFOA 2KJGA 1OW8A 2PP4A 3GM3A 3T6BA 2IM8A 2YHSA 2EIKC 1MMNA 2DI3A 256BA 4MW3A 3UMHA 4BJ1A 3EFOA 2DYSC 4C7OB 3AG3C 2HSQA 2FGYA 2LCHA 3O55A 5A6AA 4O6MA 3JRMO 5DS5A 4E7SA 1FMWA 1WGWA 2VH3A 4ONSA 3ABMC 1JAFA 2DYRC 1LPEA 3NYLA 1O5HA 1QVXA 2RD9A 3NKDA 2W45A 1D1CA 3GEIA 4BG0A 3LUTB 3DE9A 4EBJA 3S0XA 2OEXA 4MQ9F 4W8KA 4AX2A 2CYDA 3U0CA 2HMZA 2WZLA 3GEHA 2W4BA 3AG4C 3SXYA 5A6KA 5F28E 1EQ1A 4PACA 5KYXB 4DRHB 1QZXA 2J9WA 2L6FA 4ER9A 1M2OA 1DOVA 3R2PA 4JJGA 1H6GA 5JSLA 4CS8A 5L0IA 2YL7A 3DD7A 3S84A 1C03A 4A2NB 3A11A 4I1MA 1FNTc 1HW2A 2DGJA 1FTSA 2A6EF 4I3MA 2OCCC 4G78A 2IXMA 3MYIA 5JRAA 4LLEA 1A7DA 3GORA 2NSFA 3QVZA 1L3PA 1BBHA 3CSKA 3T6GB 3HTKC 3JYYA 2W4MA 3W2WA 3NDBB 2LQGA 2HJMA 3ZTZA 4JVSA 1Z6AA 3JRTA 4ZLDA 3M4BA 1VLSA 2Z15A 4NCQA 4EWCA 4W8PA 3G4XA 1Z3IX 3RQFA 4OIRF 3E70C 1AVOB 4H54A 4U5CE 2LFFA 4D4XA 1V4AA 2Q4FA 2DB4A 4BJ5A 5KYYB 1FR0A 4DXWA 4GQHA 1QLEC 4YL3A 2L6GA 4OIQF 3L0IA 3CZ6A 2M64A 1OCZC 4XWJA 3S90A 4J7YA 1B68A 2GWWA 2BL2A 4PJNA 3L8IA 1YA9A 2HJ3A 2OJQA 4JJFA 4YT8A 2KW3C 2PBEA 2ZD9A 5AC4A 3ZC4A 2J46A 4JEBA 1NFNA 1IZMA 4XEKA 4ULWA 2KK1A 5KYUA 2X0CA 1ZVZA 4MW8A 2ZXRA 5EHHA 4HE8D 1OQCA 3JT1A 5JVEA 2HUJA 1OW6A 1TFKB 3R7CA 2Y39A 4N4WA 3PCVA 1OXBA 3W8HA 4U5GA 3JZ0A 5AGFA 3SXZA 4DBRA 2XM0A 4D4NA 2H8AA 2XLEA 1Z7Qc 3U9JA 1Q0FA 1CGNA 3FHDA 2R7OA 2MWQA 4AL1A 5DLJA 3AOUA 4C3DA 1M2VB 1VB5A 1MMGA 2KQ9A 3BEHA 1HY5A 3VYWA 5A6BA 3ZDLA 4G0HA 3UNGC 3JYHA 5DQTA 4NTAA 2XLWA 1OR2A 1PV3A 3I5QA 3DAFA 3AQCA 5JP7A 3SXKA 3FVYA 3ZQVA 4LDQA 4DBQA 1O3UA 4YT4A 4XTKA 2YWAA 3S27A 4O7GA 1GGQA 5KYNA 2WVQA 5TJ5E 1LS1A 3ASNC 4E7ZA 1FFTC 2LP4A 4XLPF 1PCXA 3UR3C 2J9UA 3FXHA 3M4CA 1JRAA 4PJMA 2D5RB 1Q0GA 5GPGB 4EBBA 2NUPA 4NTFA 4LDKA 4MVSA 2YL0A 3SNHA 3VF0A 4MTFA 1E2XA 2CCYA 2YL1A 3IPMO 1E85A 1ZZPA 3SYNA 3RF3A 1LS4A 3IEEA 1AUEA 4E18A 1ZHTA 3HNJA 4GEHA 3K6BA 4YT5A 1BR4A 2LK4A 4WJ0A 2Q9CA 5CI9A 3EGXB 1TR2A 3T6JA 1JOGA 1QSPA 4XPYA 2R02A 4B6IA 3WHNA 4U5DE 1G5ZA 2OG2A 4U5EE 3RYLA 1A7EA 1ZYRF 3Q7LA 3C8ZA 1HMOA 4CBEA 4E0IA 1TWHA 3G50A 4DVZA 5E2QA 1AEPA 2H7VC 3GWNA 2QY9A 3J06A 3FMSA 4DOZA 4QI2A 2NUPB 3C7JA 3TK0A 1OR3A 5FCLA 2IXNA 3V7OA 1BZ4A 2O9XA 3US6A 1RJ9A 2WL8A 1ORJA 2CNWD 1UFBA 2Y3HA 4JRZA 2XLOA 4IGGA 3F46A 4LLCA 4BJTA 3DWWA 2KSFA 3VRCA 3RW0A 4AK9A 4CDVA 5IY5C 1V55C 3NRHA 3OWTA 4MVMA 3SZRA 3RQGA 2WZFA 3FOOA 3I4UA 3V5XA 4YT2A 4KNVA 5DVWA 4CSAC 2IXOA 2XLMA 3CQZA 5BQGA 3W2VA 4AE4B 4NQFA 3FOPA 1MMDA 3RFYA 3WODF 1D1BA 5L0JA 4JCHA 2XLDA 5E3CA 3KL4A 2FFHA 3LNMB 4EKWA 2AU5A 1YYJA 3HKKA 3HNIA 4JC7A 3RKOF 3VAYA 1MQVA 4U9EA 3F47A 5KYWB 1FFHA 2F22A 2KGOA 2PFDA 4XLNF 4CS7A 2V26A 2NG1A 1RJ9B 3DI5A 3S29A 4JW1A 1JMWA 2B0JA 2EPMX 2Q00A 2XL8A 1TQGA 1CGOA 2Y69C 3TJ5A 5DS6A 5B1BC 1M6TA 4P6IC 5BQIA 5A6BD 2EIJC 2YRFA 2R7UA 3U3FA 1OCCC 3DZAA 5L3QA 2OJED 2CGEA 1G4WR 3UGPA 1I4YA 2YLDA 2Y3GA 3E9VA 4O79A 4BPMA 4ANJA 3X1OA 4DVYP 2HV7A 3M1CB 1A0BA 1IW7F 2OEVA 2Q9BA 3ITFA 4MVOA 1I5NA 3DM5A 2P6VA 1RXQA 3JSEO 4CIHA 3KH2A 4MTOA 3EFOB 4C3EA 3HNKA 1Z23A 2L81A 4JE9A 2PX0A 3IQCA 1M56C 2A0UA 4LERA 4Z9IA 5T3WA 2A6HF 3NYMA 4H4KC 4Z9JA 3ZVRA 1C17M 5JUAA 3SEOA 2R7WA 4RBNA 4Z9HA 3DJNB 3U2MA 5B3IA 4I1OB 1G8XA 1H9GA 1WATA 2P61A 4O6NA 2ZXPA 2R9RB 1ORSC 1TWGA 3ABLC 4J32B 1HE1A 3OA1A 2XS8A 5CI8A 2G3KA 1J8YF 3N2ZB 4IAQA 3WAQA 2WB7A 1E84A 1F1MA 2Q3TA 3QW1A 4ZLCA 1RKEA 4L6RA 3Q6NA 2J9VA 4WGYA 5E3AA 2IBFA 1HW1A 2TMVP 1VOMA 1NU9C 4JTCB 1KU2A 1R5ID 2G3VA 4CS9C 3DM9B 3L34A 2VCBA 2YVKA 4MNDA 4K7BA 4EHPA 2EPKX 2LFDA 2QE9A 4IARA 4N06A 3POVA 5HSWA 1Q0DA 3W8IA 2H7BA 3LAYA 4HFKB 4KI2A 4M63A 2Y3BA 2QLAA 1S7ZA 2AWCA 3B9QA 3SP1A 5DS4A 1ZHYA 3RH3A 5JT4A 2XM4A 1H9TA 5E33A 1D0YA 3MLGA 4AE4A 1WASA 1NZEA 4CS8C 3DMDA 3LEVA 3QW0A 4OIPF 3HLZA 3L1MA 1LI5A 4MVQA 1YVIA 3LESA 4CJOA 1PD1A 2HV6A 2QNLA 1TKNA 2EILC 2IOQA 3LLKA 2R7TA 3V5YA 3H2UA 5L3VA 4OIOF 1SR2A 5L0FA 2FAPB 4CJGA 3DXJF 3B29A 1T9KA 3IQ5A 5FZTA 1NSGB 3EGDA 5KYUB 2R7QA 1QPUA 4EBKA 4YL0A 4G7ZF 4Q7CA 5D91A 3EG9A 4AL0A 2R03A 3IQTA 4OD5A 1TWAA 3K1IC 1YZAA 3C8GA 1LVKA 2A0BA 2NUTA 1LIHA 3JSZA 3UMIA 4BEMJ 4KC9A 1CPRA 1GQAA 1YYXA 5T1DB 1KNYA 1RCPA 2HKVA 3C62A 4CDAA 4WABA 1ZU4A 1WTYA 3QVYA 1YLMA 1YZCA 4XQ1A 2RSEB 2WVOA 2XL4A 2XRHA 2ASRA 2BC5A 2EPLX 1YAUO 1D0ZA 3M79A 3NG1A 2XLVA 4FX5A 4YK5A 3ZQYA 2XXAA 4EIYA 3K1HA 1EA8A 4MVRA 2M4EA 2R05A 4WGZA 2JD3A 2OU6A 2J7PA 4O6YA 3TOLA 5B3SC 2AVKA 3EGDB 4PFPA 5A6JA 4IB4A 1HE9A 2VCAA 1VYIA 2Y3DA 1FMVA 3EZHA 3KKBA 5EK0A 3S9OA 1V74B 3EPVA 2B0HA 3GM1A 3ECSA 2HS5A 2VASA 2OQMA 3U8VA 4G7HF 3M15A 1OW7A 1LKXA 2PX3A 2ZXWC 5D92A 1M57C 1J8MF 5L0GA 3UMKA 2LSEA 2HSBA 2GDCA 2VB6A 3Q6MA 4XEVA 5L0HA 4A4AA 4HFFB 1HMDA 1LE4A 4PJLA 3B0PA 2AWYA 5T3TA 2R7SA 2ETSA 3ATPA 4NY3A 3C18A 3ZIBA 4E17A 3LS0A 1VTMP 3AGUA 1Q0MA 1U89A 2XSEA 5DQZA 3A9CA 1ORYA 2X51A 2LIGA 1BDJB 1VLTA 3GODA 3LS1A 2WVNA 1YARO 4MTGA 1BR1A 2GA0A 2J8WA 3LLIA 4FWVA 1A7VA 1CPQA 1XZPA 2NSGA 4JIOA 1G4US 1NU7D 4IAOA 4C7OA 5JS5A 3AG1C 2P1AA 2A69F 4I44A 1H7IA 2LD6A 3AG2C 2L6HA 1ZHZA 4JZAA 1WWPA 4K1OA 4CIPA 3NKEA 4OD4A 4N6HA 4YWQA 2NPUA 2AP3A 1Z63A 3NMKA 2MYSA 5A69A 1ZHXA 3K7DA 1XWJA 3NMJA 2ICWG 2EIMC 3OEOA 5KYXA 1W2WA 2OKUA 4BJ6C 3BRJA 1Y4CA 4JTDB 4BEJA 4YN0B 1D0XA 3TULA 3MX3A 1TFOB 2V3CC 1U6HA 1LE2A 1O87A 1FAPB 3C8GD 2YLIA 1Z5ZA 2PF4E 3RVZA 4DRJB 3C63A 3RQEA 4X0RA 5F5FA 3K66A 3U9MA 3GANA 2E87A 2R7VA 3PHF2 4XPWA 3N0TA 2R7XA 3EJNA 4CS9A 3Q7GA 1XZQA 2PNOA 2IYLD 1MNDA 3V5ZA 5KYYA 2C03A 2H7OA
chains in the Genus database with same CATH topology
3PMRA 3TD7A 4Q5SF 1SF8A 2J7PD 1OKKA 3ASOC 3EZIA 2GFHA 2WZGA 4IWBA 4G7OF 2G62A 1ZHWA 1VYKA 2CDQA 5F5HA 1SZIA 3ZSUA 1OCRC 1ST6A 3JCUQ 4RD9A 2ZXOA 1N1CA 4OINF 2EINC 2R7RA 1OCOC 3QMKA 3AQBA 3EHNA 2BE5F 2CNWA 1D1AA 1M2VA 4HEAJ 1JPJA 1JPNA 1MMAA 3O6XA 4IRUA 3K33A 1PD0A 2YEVA 3T4RA 2W9YA 3QZCA 4U5FE 5B1AC 3HJCA 4PJJA 1MNEA 4BJ5C 4J30B 3ZG1A 3EQLF 4QDLA 1SMYF 2J0XA 3I5PA 2A68F 3X2QC 5EGYA 2C04A 2QTVA 1V54C 4YJWA 2IXPA 3WG7C 1ZU5A 2L9JA 3EGXA 3KMIA 4PK4A 2P7VA 3EG9B 4CSAA 2ZPAA 4QI0A 4LACB 4FESA 2NUTB 3B0VC 3FDQA 2J0WA 3EHMA 4U5HA 1TWCA 2A1DD 5BUOA 3NYJA 4IJJA 1OKKD 3N24A 2XXAB 2KNHA 3LJBA 4KNWA 1BR2A 2CW0F 1VK5A 2YZSA 2I8BA 3DAGA 3DJUB 4AE4A 1VMAA 3EH2A 3LNRA 4C3BA 4JURI 4RDAA 4BJ6A 3B0UX 4U5BE 5KYWA 4K0DA 3ABKC 3RIPA 3UGOA 2J45A 3H65A 1NG1A 3O39A 3FAJA 4Q4ZF 4GYTA 2Q9AA 4F4BA 4KBLA 3EH1A 3S28A 4PFOA 2KJGA 2PP4A 3T6BA 2YHSA 2EIKC 1MMNA 3UMHA 4BJ1A 3EFOA 2DYSC 4C7OB 3AG3C 2FGYA 4O6MA 5DS5A 4E7SA 1FMWA 1WGWA 2VH3A 3ABMC 2DYRC 3NYLA 1O5HA 3NKDA 2W45A 1D1CA 4BG0A 3S0XA 4MQ9F 4W8KA 4AX2A 2WZLA 2W4BA 3AG4C 5KYXB 1QZXA 2J9WA 1M2OA 4CS8A 4JJGA 3DD7A 4A2NB 4I1MA 2DGJA 1FTSA 2A6EF 4I3MA 2OCCC 2IXMA 4LLEA 3CSKA 3HTKC 3NDBB 2W4MA 3W2WA 4JVSA 1Z6AA 3JRTA 4ZLDA 2Z15A 4EWCA 1Z3IX 4OIRF 3E70C 4U5CE 4BJ5A 5KYYB 1QLEC 4OIQF 3L0IA 3CZ6A 1OCZC 4XWJA 4PJNA 4JJFA 4YT8A 2KW3C 3ZC4A 2J46A 1IZMA 4ULWA 5KYUA 2ZXRA 5EHHA 4HE8D 3JT1A 2Y39A 3W8HA 4U5GA 4DBRA 3FHDA 2R7OA 2MWQA 5DLJA 4C3DA 1M2VB 1MMGA 2KQ9A 3VYWA 4G0HA 3UNGC 3JYHA 5DQTA 3I5QA 3DAFA 3AQCA 3FVYA 4YT4A 4DBQA 4XTKA 3S27A 4O7GA 5KYNA 2WVQA 1LS1A 3ASNC 4E7ZA 1FFTC 4XLPF 1PCXA 3UR3C 2J9UA 4PJMA 2D5RB 4EBBA 2NUPA 3SNHA 3SYNA 3IEEA 1ZHTA 4GEHA 3K6BA 4YT5A 1BR4A 4WJ0A 2Q9CA 5CI9A 3EGXB 1TR2A 3T6JA 4B6IA 4U5DE 2OG2A 4U5EE 3RYLA 1ZYRF 3Q7LA 4CBEA 1TWHA 4DVZA 5E2QA 2H7VC 2QY9A 4DOZA 4QI2A 2NUPB 5FCLA 2IXNA 3V7OA 2O9XA 1RJ9A 2WL8A 2CNWD 2Y3HA 3F46A 4LLCA 4BJTA 5IY5C 4AK9A 1V55C 3NRHA 3OWTA 3SZRA 2WZFA 3I4UA 4YT2A 4KNVA 5DVWA 4CSAC 2IXOA 3CQZA 3W2VA 4AE4B 1MMDA 3RFYA 3WODF 1D1BA 4JCHA 5E3CA 3KL4A 2FFHA 3RKOF 3VAYA 3F47A 5KYWB 1FFHA 2KGOA 2PFDA 4XLNF 4CS7A 2V26A 2NG1A 1RJ9B 3S29A 4JW1A 2B0JA 2Y69C 5DS6A 5B1BC 4P6IC 2EIJC 2R7UA 1OCCC 3DZAA 5L3QA 2CGEA 3UGPA 4O79A 4ANJA 2Y3GA 3E9VA 4DVYP 3X1OA 2HV7A 3M1CB 1IW7F 2Q9BA 3ITFA 3DM5A 2P6VA 4CIHA 3KH2A 3EFOB 4C3EA 1Z23A 2L81A 4LERA 2PX0A 1M56C 5T3WA 2A6HF 3NYMA 4H4KC 3ZVRA 2R7WA 3SEOA 4RBNA 3DJNB 4I1OB 1G8XA 4O6NA 2ZXPA 1TWGA 3ABLC 4J32B 3OA1A 5CI8A 2G3KA 1J8YF 3N2ZB 2WB7A 2Q3TA 4ZLCA 3Q6NA 2J9VA 5E3AA 1VOMA 1NU9C 1KU2A 2G3VA 4CS9C 3DM9B 3L34A 4MNDA 4K7BA 4N06A 3POVA 5HSWA 4KI2A 3W8IA 2H7BA 3LAYA 4HFKB 4M63A 2Y3BA 1S7ZA 5DS4A 3B9QA 3SP1A 1ZHYA 3RH3A 5E33A 1D0YA 3MLGA 4CS8C 1NZEA 3DMDA 3LEVA 4OIPF 3HLZA 3LESA 1PD1A 2HV6A 1TKNA 2EILC 2IOQA 3LLKA 2R7TA 5L3VA 4OIOF 3DXJF 3EGDA 5KYUB 2R7QA 4G7ZF 4Q7CA 5D91A 3EG9A 4OD5A 1TWAA 3K1IC 1LVKA 2NUTA 3JSZA 3UMIA 4KC9A 5T1DB 1ZU4A 2WVOA 2XL4A 2XRHA 4FX5A 1D0ZA 3NG1A 2XXAA 3K1HA 2M4EA 2JD3A 4O6YA 2J7PA 5B3SC 3EGDB 4PFPA 2Y3DA 1VYIA 3EZHA 1FMVA 3KKBA 3EPVA 3ECSA 2VASA 4G7HF 1LKXA 2PX3A 2ZXWC 5D92A 1M57C 1J8MF 3UMKA 2LSEA 2VB6A 3Q6MA 4HFFB 4PJLA 3B0PA 5T3TA 2R7SA 4NY3A 3ZIBA 3LS0A 2XSEA 5DQZA 2X51A 3GODA 3LS1A 2WVNA 1BR1A 3LLIA 4FWVA 1NU7D 4IAOA 4C7OA 3AG1C 2A69F 4I44A 3AG2C 1ZHZA 4JZAA 3NKEA 4OD4A 4YWQA 1Z63A 2MYSA 1ZHXA 3K7DA 2EIMC 3OEOA 5KYXA 1W2WA 4BJ6C 4BEJA 4YN0B 1D0XA 3MX3A 2V3CC 1O87A 1Z5ZA 2PF4E 5F5FA 4X0RA 3K66A 3GANA 2E87A 2R7VA 3PHF2 3N0TA 2R7XA 3EJNA 4CS9A 3Q7GA 2IYLD 1MNDA 5KYYA 2C03A 2H7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3V A; 
#chains in the Genus database with same CATH topology
 3PMR A;  1QQ3 A;  3KYJ A;  3TD7 A;  1E86 A;  1WN0 A;  4XEF A;  4Q5S F;  1SF8 A;  1LI7 A;  2J7P D;  1OKK A;  2P0N A;  3GM2 A;  4U9D A;  3ASO C;  2GAQ A;  3EZI A;  4MS2 A;  1GM5 A;  2GFH A;  2WZG A;  3MFN A;  4IWB A;  4G7O F;  2G62 A;  1K05 A;  2EPO A;  1ZHW A;  1VYK A;  2CDQ A;  5F5H A;  1SZI A;  3LEO A;  3IHU A;  3ZSU A;  4E0H A;  3CEX A;  3IQ6 A;  3NMI A;  1OCR C;  3O10 A;  4DRI B;  1APC A;  3H2V A;  1ST6 A;  3JCU Q;  4RD9 A;  1Y6D A;  2ZXO A;  2JPU A;  1NBB A;  1N1C A;  2KC3 A;  4OIN F;  4JTA B;  2EIN C;  2R7R A;  1OCO C;  4EUK B;  3QMK A;  2OOC A;  3KPH A;  3AQB A;  3EHN A;  1RMV A;  1K04 A;  5COM A;  2BE5 F;  2CNW A;  3K1I A;  1D1A A;  1M2V A;  4PR9 A;  1C02 A;  4N6C A;  4CX9 A;  4HEA J;  5L0D A;  1A41 A;  1JPJ A;  1JPN A;  1MMA A;  3O6X A;  1GS9 A;  1T6I A;  3K33 A;  4IRU A;  4JEA A;  1U0B B;  1RKE B;  2EPN A;  3SXM A;  1PD0 A;  1EI7 A;  2R25 A;  2YEV A;  3U2L A;  1KTM A;  1YA7 O;  2W9Y A;  4ULV A;  3T4R A;  3QZC A;  1E83 A;  4U5F E;  3W4Y A;  5B1A C;  2VCC A;  2D4U A;  3HJC A;  1YDI A;  4PJJ A;  1MNE A;  4BJ5 C;  4J30 B;  5K0I A;  1S05 A;  3EQL F;  5COG A;  3ZG1 A;  4QDL A;  3JTL O;  5BQH A;  3T9O A;  1SMY F;  2J0X A;  4DJ9 A;  3CAX A;  2YKZ A;  2J9B A;  3I5P A;  1NFO A;  2A68 F;  3U5S A;  3X2Q C;  5L0C A;  4XPX A;  2UUH A;  5EGY A;  2C04 A;  2QTV A;  4P9T A;  1V54 C;  4YJW A;  1R4T A;  4JKV A;  2KYH A;  2IXP A;  3HNL A;  1ZU5 A;  2L9J A;  3WG7 C;  2JX0 A;  1T6Q A;  3EGX A;  4R32 A;  4NTB A;  3KMI A;  3ZTM A;  4J7T A;  4MVZ A;  3QTH A;  4PK4 A;  1WOL A;  4YL1 A;  2Q7R A;  2P7V A;  3EG9 B;  2YL3 A;  4MVU A;  4FAP B;  2HMQ A;  3U3B A;  4CSA A;  2ZPA A;  3C8G B;  4QI0 A;  4LAC B;  5COF A;  3DKA A;  4FES A;  2NUT B;  1SYQ A;  1UG7 A;  1T01 A;  3B0V C;  1Q0K A;  3PDM P;  3FDQ A;  2J0W A;  2XLH A;  3EHM A;  5HV9 A;  3GEE A;  3AGT A;  3L8J A;  4U5H A;  1NLX A;  1EKY A;  1TWC A;  2I15 A;  2A1D D;  2QUP A;  3NYJ A;  3RVY A;  3VM6 A;  5BUO A;  3KYI A;  4IJJ A;  1OKK D;  3DE8 A;  3N24 A;  3ZWI A;  2XXA B;  1T6U A;  3TOM A;  2KNH A;  1ZW3 A;  1T5O A;  3LJB A;  4KNW A;  1BR2 A;  2CW0 F;  5AC5 A;  1VK5 A;  2YZS A;  2I8B A;  2L7A A;  3DAG A;  3DJU B;  4P9F A;  1VMA A;  1L7C A;  3EH2 A;  3TJ6 A;  1CGM E;  2VC9 A;  3LNR A;  4C3B A;  4JUR I;  3MBG A;  4NC3 A;  4JCZ A;  4UDV A;  3MYF A;  4LDR A;  4RDA A;  2XL6 A;  1DOW A;  4BJ6 A;  4U5B E;  3B0U X;  5KYW A;  3TQO A;  3GWL A;  1I4Z A;  1QKR A;  1RKC A;  2YLG A;  1LM3 B;  2UUI A;  3ABK C;  3AJM A;  4K0D A;  2J45 A;  3RIP A;  3UGO A;  4CDY A;  3H65 A;  1OXK A;  1NG1 A;  3O39 A;  2HZ8 A;  3FAJ A;  2MHR A;  3FAP B;  3G4Z A;  4Q4Z F;  4GYT A;  2Q9A A;  4F4B A;  2HFI A;  1ZW2 A;  4KBL A;  2YQY A;  3B71 A;  1YJG A;  2XS1 A;  5JLI A;  5CIV A;  3EH1 A;  1K40 A;  3S28 A;  3U8P A;  1JR8 A;  4PFO A;  2KJG A;  1OW8 A;  2PP4 A;  3GM3 A;  3T6B A;  2IM8 A;  2YHS A;  2EIK C;  1MMN A;  2DI3 A;  256B A;  4MW3 A;  3UMH A;  4BJ1 A;  3EFO A;  2DYS C;  4C7O B;  3AG3 C;  2HSQ A;  2FGY A;  2LCH A;  3O55 A;  5A6A A;  4O6M A;  3JRM O;  5DS5 A;  4E7S A;  1FMW A;  1WGW A;  2VH3 A;  4ONS A;  3ABM C;  1JAF A;  2DYR C;  1LPE A;  3NYL A;  1O5H A;  1QVX A;  2RD9 A;  3NKD A;  2W45 A;  1D1C A;  3GEI A;  4BG0 A;  3LUT B;  3DE9 A;  4EBJ A;  3S0X A;  2OEX A;  4MQ9 F;  4W8K A;  4AX2 A;  2CYD A;  3U0C A;  2HMZ A;  2WZL A;  3GEH A;  2W4B A;  3AG4 C;  3SXY A;  5A6K A;  5F28 E;  1EQ1 A;  4PAC A;  5KYX B;  4DRH B;  1QZX A;  2J9W A;  2L6F A;  4ER9 A;  1M2O A;  1DOV A;  3R2P A;  4JJG A;  1H6G A;  5JSL A;  4CS8 A;  5L0I A;  2YL7 A;  3DD7 A;  3S84 A;  1C03 A;  4A2N B;  3A11 A;  4I1M A;  1FNT c;  1HW2 A;  2DGJ A;  1FTS A;  2A6E F;  4I3M A;  2OCC C;  4G78 A;  2IXM A;  3MYI A;  5JRA A;  4LLE A;  1A7D A;  3GOR A;  2NSF A;  3QVZ A;  1L3P A;  1BBH A;  3CSK A;  3T6G B;  3HTK C;  3JYY A;  2W4M A;  3W2W A;  3NDB B;  2LQG A;  2HJM A;  3ZTZ A;  4JVS A;  1Z6A A;  3JRT A;  4ZLD A;  3M4B A;  1VLS A;  2Z15 A;  4NCQ A;  4EWC A;  4W8P A;  3G4X A;  1Z3I X;  3RQF A;  4OIR F;  3E70 C;  1AVO B;  4H54 A;  4U5C E;  2LFF A;  4D4X A;  1V4A A;  2Q4F A;  2DB4 A;  4BJ5 A;  5KYY B;  1FR0 A;  4DXW A;  4GQH A;  1QLE C;  4YL3 A;  2L6G A;  4OIQ F;  3L0I A;  3CZ6 A;  2M64 A;  1OCZ C;  4XWJ A;  3S90 A;  4J7Y A;  1B68 A;  2GWW A;  2BL2 A;  4PJN A;  3L8I A;  1YA9 A;  2HJ3 A;  2OJQ A;  4JJF A;  4YT8 A;  2KW3 C;  2PBE A;  2ZD9 A;  5AC4 A;  3ZC4 A;  2J46 A;  4JEB A;  1NFN A;  1IZM A;  4XEK A;  4ULW A;  2KK1 A;  5KYU A;  2X0C A;  1ZVZ A;  4MW8 A;  2ZXR A;  5EHH A;  4HE8 D;  1OQC A;  3JT1 A;  5JVE A;  2HUJ A;  1OW6 A;  1TFK B;  3R7C A;  2Y39 A;  4N4W A;  3PCV A;  1OXB A;  3W8H A;  4U5G A;  3JZ0 A;  5AGF A;  3SXZ A;  4DBR A;  2XM0 A;  4D4N A;  2H8A A;  2XLE A;  1Z7Q c;  3U9J A;  1Q0F A;  1CGN A;  3FHD A;  2R7O A;  2MWQ A;  4AL1 A;  5DLJ A;  3AOU A;  4C3D A;  1M2V B;  1VB5 A;  1MMG A;  2KQ9 A;  3BEH A;  1HY5 A;  3VYW A;  5A6B A;  3ZDL A;  4G0H A;  3UNG C;  3JYH A;  5DQT A;  4NTA A;  2XLW A;  1OR2 A;  1PV3 A;  3I5Q A;  3DAF A;  3AQC A;  5JP7 A;  3SXK A;  3FVY A;  3ZQV A;  4LDQ A;  4DBQ A;  1O3U A;  4YT4 A;  4XTK A;  2YWA A;  3S27 A;  4O7G A;  1GGQ A;  5KYN A;  2WVQ A;  5TJ5 E;  1LS1 A;  3ASN C;  4E7Z A;  1FFT C;  2LP4 A;  4XLP F;  1PCX A;  3UR3 C;  2J9U A;  3FXH A;  3M4C A;  1JRA A;  4PJM A;  2D5R B;  1Q0G A;  5GPG B;  4EBB A;  2NUP A;  4NTF A;  4LDK A;  4MVS A;  2YL0 A;  3SNH A;  3VF0 A;  4MTF A;  1E2X A;  2CCY A;  2YL1 A;  3IPM O;  1E85 A;  1ZZP A;  3SYN A;  3RF3 A;  1LS4 A;  3IEE A;  1AUE A;  4E18 A;  1ZHT A;  3HNJ A;  4GEH A;  3K6B A;  4YT5 A;  1BR4 A;  2LK4 A;  4WJ0 A;  2Q9C A;  5CI9 A;  3EGX B;  1TR2 A;  3T6J A;  1JOG A;  1QSP A;  4XPY A;  2R02 A;  4B6I A;  3WHN A;  4U5D E;  1G5Z A;  2OG2 A;  4U5E E;  3RYL A;  1A7E A;  1ZYR F;  3Q7L A;  3C8Z A;  1HMO A;  4CBE A;  4E0I A;  1TWH A;  3G50 A;  4DVZ A;  5E2Q A;  1AEP A;  2H7V C;  3GWN A;  2QY9 A;  3J06 A;  3FMS A;  4DOZ A;  4QI2 A;  2NUP B;  3C7J A;  3TK0 A;  1OR3 A;  5FCL A;  2IXN A;  3V7O A;  1BZ4 A;  2O9X A;  3US6 A;  1RJ9 A;  2WL8 A;  1ORJ A;  2CNW D;  1UFB A;  2Y3H A;  4JRZ A;  2XLO A;  4IGG A;  3F46 A;  4LLC A;  4BJT A;  3DWW A;  2KSF A;  3VRC A;  3RW0 A;  4AK9 A;  4CDV A;  5IY5 C;  1V55 C;  3NRH A;  3OWT A;  4MVM A;  3SZR A;  3RQG A;  2WZF A;  3FOO A;  3I4U A;  3V5X A;  4YT2 A;  4KNV A;  5DVW A;  4CSA C;  2IXO A;  2XLM A;  3CQZ A;  5BQG A;  3W2V A;  4AE4 B;  4NQF A;  3FOP A;  1MMD A;  3RFY A;  3WOD F;  1D1B A;  5L0J A;  4JCH A;  2XLD A;  5E3C A;  3KL4 A;  2FFH A;  3LNM B;  4EKW A;  2AU5 A;  1YYJ A;  3HKK A;  3HNI A;  4JC7 A;  3RKO F;  3VAY A;  1MQV A;  4U9E A;  3F47 A;  5KYW B;  1FFH A;  2F22 A;  2KGO A;  2PFD A;  4XLN F;  4CS7 A;  2V26 A;  2NG1 A;  1RJ9 B;  3DI5 A;  3S29 A;  4JW1 A;  1JMW A;  2B0J A;  2EPM X;  2Q00 A;  2XL8 A;  1TQG A;  1CGO A;  2Y69 C;  3TJ5 A;  5DS6 A;  5B1B C;  1M6T A;  4P6I C;  5BQI A;  5A6B D;  2EIJ C;  2YRF A;  2R7U A;  3U3F A;  1OCC C;  3DZA A;  5L3Q A;  2OJE D;  2CGE A;  1G4W R;  3UGP A;  1I4Y A;  2YLD A;  2Y3G A;  3E9V A;  4O79 A;  4BPM A;  4ANJ A;  3X1O A;  4DVY P;  2HV7 A;  3M1C B;  1A0B A;  1IW7 F;  2OEV A;  2Q9B A;  3ITF A;  4MVO A;  1I5N A;  3DM5 A;  2P6V A;  1RXQ A;  3JSE O;  4CIH A;  3KH2 A;  4MTO A;  3EFO B;  4C3E A;  3HNK A;  1Z23 A;  2L81 A;  4JE9 A;  2PX0 A;  3IQC A;  1M56 C;  2A0U A;  4LER A;  4Z9I A;  5T3W A;  2A6H F;  3NYM A;  4H4K C;  4Z9J A;  3ZVR A;  1C17 M;  5JUA A;  3SEO A;  2R7W A;  4RBN A;  4Z9H A;  3DJN B;  3U2M A;  5B3I A;  4I1O B;  1G8X A;  1H9G A;  1WAT A;  2P61 A;  4O6N A;  2ZXP A;  2R9R B;  1ORS C;  1TWG A;  3ABL C;  4J32 B;  1HE1 A;  3OA1 A;  2XS8 A;  5CI8 A;  2G3K A;  1J8Y F;  3N2Z B;  4IAQ A;  3WAQ A;  2WB7 A;  1E84 A;  1F1M A;  2Q3T A;  3QW1 A;  4ZLC A;  1RKE A;  4L6R A;  3Q6N A;  2J9V A;  4WGY A;  5E3A A;  2IBF A;  1HW1 A;  2TMV P;  1VOM A;  1NU9 C;  4JTC B;  1KU2 A;  1R5I D;  2G3V A;  4CS9 C;  3DM9 B;  3L34 A;  2VCB A;  2YVK A;  4MND A;  4K7B A;  4EHP A;  2EPK X;  2LFD A;  2QE9 A;  4IAR A;  4N06 A;  3POV A;  5HSW A;  1Q0D A;  3W8I A;  2H7B A;  3LAY A;  4HFK B;  4KI2 A;  4M63 A;  2Y3B A;  2QLA A;  1S7Z A;  2AWC A;  3B9Q A;  3SP1 A;  5DS4 A;  1ZHY A;  3RH3 A;  5JT4 A;  2XM4 A;  1H9T A;  5E33 A;  1D0Y A;  3MLG A;  4AE4 A;  1WAS A;  1NZE A;  4CS8 C;  3DMD A;  3LEV A;  3QW0 A;  4OIP F;  3HLZ A;  3L1M A;  1LI5 A;  4MVQ A;  1YVI A;  3LES A;  4CJO A;  1PD1 A;  2HV6 A;  2QNL A;  1TKN A;  2EIL C;  2IOQ A;  3LLK A;  2R7T A;  3V5Y A;  3H2U A;  5L3V A;  4OIO F;  1SR2 A;  5L0F A;  2FAP B;  4CJG A;  3DXJ F;  3B29 A;  1T9K A;  3IQ5 A;  5FZT A;  1NSG B;  3EGD A;  5KYU B;  2R7Q A;  1QPU A;  4EBK A;  4YL0 A;  4G7Z F;  4Q7C A;  5D91 A;  3EG9 A;  4AL0 A;  2R03 A;  3IQT A;  4OD5 A;  1TWA A;  3K1I C;  1YZA A;  3C8G A;  1LVK A;  2A0B A;  2NUT A;  1LIH A;  3JSZ A;  3UMI A;  4BEM J;  4KC9 A;  1CPR A;  1GQA A;  1YYX A;  5T1D B;  1KNY A;  1RCP A;  2HKV A;  3C62 A;  4CDA A;  4WAB A;  1ZU4 A;  1WTY A;  3QVY A;  1YLM A;  1YZC A;  4XQ1 A;  2RSE B;  2WVO A;  2XL4 A;  2XRH A;  2ASR A;  2BC5 A;  2EPL X;  1YAU O;  1D0Z A;  3M79 A;  3NG1 A;  2XLV A;  4FX5 A;  4YK5 A;  3ZQY A;  2XXA A;  4EIY A;  3K1H A;  1EA8 A;  4MVR A;  2M4E A;  2R05 A;  4WGZ A;  2JD3 A;  2OU6 A;  2J7P A;  4O6Y A;  3TOL A;  5B3S C;  2AVK A;  3EGD B;  4PFP A;  5A6J A;  4IB4 A;  1HE9 A;  2VCA A;  1VYI A;  2Y3D A;  1FMV A;  3EZH A;  3KKB A;  5EK0 A;  3S9O A;  1V74 B;  3EPV A;  2B0H A;  3GM1 A;  3ECS A;  2HS5 A;  2VAS A;  2OQM A;  3U8V A;  4G7H F;  3M15 A;  1OW7 A;  1LKX A;  2PX3 A;  2ZXW C;  5D92 A;  1M57 C;  1J8M F;  5L0G A;  3UMK A;  2LSE A;  2HSB A;  2GDC A;  2VB6 A;  3Q6M A;  4XEV A;  5L0H A;  4A4A A;  4HFF B;  1HMD A;  1LE4 A;  4PJL A;  3B0P A;  2AWY A;  5T3T A;  2R7S A;  2ETS A;  3ATP A;  4NY3 A;  3C18 A;  3ZIB A;  4E17 A;  3LS0 A;  1VTM P;  3AGU A;  1Q0M A;  1U89 A;  2XSE A;  5DQZ A;  3A9C A;  1ORY A;  2X51 A;  2LIG A;  1BDJ B;  1VLT A;  3GOD A;  3LS1 A;  2WVN A;  1YAR O;  4MTG A;  1BR1 A;  2GA0 A;  2J8W A;  3LLI A;  4FWV A;  1A7V A;  1CPQ A;  1XZP A;  2NSG A;  4JIO A;  1G4U S;  1NU7 D;  4IAO A;  4C7O A;  5JS5 A;  3AG1 C;  2P1A A;  2A69 F;  4I44 A;  1H7I A;  2LD6 A;  3AG2 C;  2L6H A;  1ZHZ A;  4JZA A;  1WWP A;  4K1O A;  4CIP A;  3NKE A;  4OD4 A;  4N6H A;  4YWQ A;  2NPU A;  2AP3 A;  1Z63 A;  3NMK A;  2MYS A;  5A69 A;  1ZHX A;  3K7D A;  1XWJ A;  3NMJ A;  2ICW G;  2EIM C;  3OEO A;  5KYX A;  1W2W A;  2OKU A;  4BJ6 C;  3BRJ A;  1Y4C A;  4JTD B;  4BEJ A;  4YN0 B;  1D0X A;  3TUL A;  3MX3 A;  1TFO B;  2V3C C;  1U6H A;  1LE2 A;  1O87 A;  1FAP B;  3C8G D;  2YLI A;  1Z5Z A;  2PF4 E;  3RVZ A;  4DRJ B;  3C63 A;  3RQE A;  4X0R A;  5F5F A;  3K66 A;  3U9M A;  3GAN A;  2E87 A;  2R7V A;  3PHF 2;  4XPW A;  3N0T A;  2R7X A;  3EJN A;  4CS9 A;  3Q7G A;  1XZQ A;  2PNO A;  2IYL D;  1MND A;  3V5Z A;  5KYY A;  2C03 A;  2H7O A; 
#chains in the Genus database with same CATH homology
 3PMR A;  3TD7 A;  4Q5S F;  1SF8 A;  2J7P D;  1OKK A;  3ASO C;  3EZI A;  2GFH A;  2WZG A;  4IWB A;  4G7O F;  2G62 A;  1ZHW A;  1VYK A;  2CDQ A;  5F5H A;  1SZI A;  3ZSU A;  1OCR C;  1ST6 A;  3JCU Q;  4RD9 A;  2ZXO A;  1N1C A;  4OIN F;  2EIN C;  2R7R A;  1OCO C;  3QMK A;  3AQB A;  3EHN A;  2BE5 F;  2CNW A;  1D1A A;  1M2V A;  4HEA J;  1JPJ A;  1JPN A;  1MMA A;  3O6X A;  4IRU A;  3K33 A;  1PD0 A;  2YEV A;  3T4R A;  2W9Y A;  3QZC A;  4U5F E;  5B1A C;  3HJC A;  4PJJ A;  1MNE A;  4BJ5 C;  4J30 B;  3ZG1 A;  3EQL F;  4QDL A;  1SMY F;  2J0X A;  3I5P A;  2A68 F;  3X2Q C;  5EGY A;  2C04 A;  2QTV A;  1V54 C;  4YJW A;  2IXP A;  3WG7 C;  1ZU5 A;  2L9J A;  3EGX A;  3KMI A;  4PK4 A;  2P7V A;  3EG9 B;  4CSA A;  2ZPA A;  4QI0 A;  4LAC B;  4FES A;  2NUT B;  3B0V C;  3FDQ A;  2J0W A;  3EHM A;  4U5H A;  1TWC A;  2A1D D;  5BUO A;  3NYJ A;  4IJJ A;  1OKK D;  3N24 A;  2XXA B;  2KNH A;  3LJB A;  4KNW A;  1BR2 A;  2CW0 F;  1VK5 A;  2YZS A;  2I8B A;  3DAG A;  3DJU B;  4AE4 A;  1VMA A;  3EH2 A;  3LNR A;  4C3B A;  4JUR I;  4RDA A;  4BJ6 A;  3B0U X;  4U5B E;  5KYW A;  4K0D A;  3ABK C;  3RIP A;  3UGO A;  2J45 A;  3H65 A;  1NG1 A;  3O39 A;  3FAJ A;  4Q4Z F;  4GYT A;  2Q9A A;  4F4B A;  4KBL A;  3EH1 A;  3S28 A;  4PFO A;  2KJG A;  2PP4 A;  3T6B A;  2YHS A;  2EIK C;  1MMN A;  3UMH A;  4BJ1 A;  3EFO A;  2DYS C;  4C7O B;  3AG3 C;  2FGY A;  4O6M A;  5DS5 A;  4E7S A;  1FMW A;  1WGW A;  2VH3 A;  3ABM C;  2DYR C;  3NYL A;  1O5H A;  3NKD A;  2W45 A;  1D1C A;  4BG0 A;  3S0X A;  4MQ9 F;  4W8K A;  4AX2 A;  2WZL A;  2W4B A;  3AG4 C;  5KYX B;  1QZX A;  2J9W A;  1M2O A;  4CS8 A;  4JJG A;  3DD7 A;  4A2N B;  4I1M A;  2DGJ A;  1FTS A;  2A6E F;  4I3M A;  2OCC C;  2IXM A;  4LLE A;  3CSK A;  3HTK C;  3NDB B;  2W4M A;  3W2W A;  4JVS A;  1Z6A A;  3JRT A;  4ZLD A;  2Z15 A;  4EWC A;  1Z3I X;  4OIR F;  3E70 C;  4U5C E;  4BJ5 A;  5KYY B;  1QLE C;  4OIQ F;  3L0I A;  3CZ6 A;  1OCZ C;  4XWJ A;  4PJN A;  4JJF A;  4YT8 A;  2KW3 C;  3ZC4 A;  2J46 A;  1IZM A;  4ULW A;  5KYU A;  2ZXR A;  5EHH A;  4HE8 D;  3JT1 A;  2Y39 A;  3W8H A;  4U5G A;  4DBR A;  3FHD A;  2R7O A;  2MWQ A;  5DLJ A;  4C3D A;  1M2V B;  1MMG A;  2KQ9 A;  3VYW A;  4G0H A;  3UNG C;  3JYH A;  5DQT A;  3I5Q A;  3DAF A;  3AQC A;  3FVY A;  4YT4 A;  4DBQ A;  4XTK A;  3S27 A;  4O7G A;  5KYN A;  2WVQ A;  1LS1 A;  3ASN C;  4E7Z A;  1FFT C;  4XLP F;  1PCX A;  3UR3 C;  2J9U A;  4PJM A;  2D5R B;  4EBB A;  2NUP A;  3SNH A;  3SYN A;  3IEE A;  1ZHT A;  4GEH A;  3K6B A;  4YT5 A;  1BR4 A;  4WJ0 A;  2Q9C A;  5CI9 A;  3EGX B;  1TR2 A;  3T6J A;  4B6I A;  4U5D E;  2OG2 A;  4U5E E;  3RYL A;  1ZYR F;  3Q7L A;  4CBE A;  1TWH A;  4DVZ A;  5E2Q A;  2H7V C;  2QY9 A;  4DOZ A;  4QI2 A;  2NUP B;  5FCL A;  2IXN A;  3V7O A;  2O9X A;  1RJ9 A;  2WL8 A;  2CNW D;  2Y3H A;  3F46 A;  4LLC A;  4BJT A;  5IY5 C;  4AK9 A;  1V55 C;  3NRH A;  3OWT A;  3SZR A;  2WZF A;  3I4U A;  4YT2 A;  4KNV A;  5DVW A;  4CSA C;  2IXO A;  3CQZ A;  3W2V A;  4AE4 B;  1MMD A;  3RFY A;  3WOD F;  1D1B A;  4JCH A;  5E3C A;  3KL4 A;  2FFH A;  3RKO F;  3VAY A;  3F47 A;  5KYW B;  1FFH A;  2KGO A;  2PFD A;  4XLN F;  4CS7 A;  2V26 A;  2NG1 A;  1RJ9 B;  3S29 A;  4JW1 A;  2B0J A;  2Y69 C;  5DS6 A;  5B1B C;  4P6I C;  2EIJ C;  2R7U A;  1OCC C;  3DZA A;  5L3Q A;  2CGE A;  3UGP A;  4O79 A;  4ANJ A;  2Y3G A;  3E9V A;  4DVY P;  3X1O A;  2HV7 A;  3M1C B;  1IW7 F;  2Q9B A;  3ITF A;  3DM5 A;  2P6V A;  4CIH A;  3KH2 A;  3EFO B;  4C3E A;  1Z23 A;  2L81 A;  4LER A;  2PX0 A;  1M56 C;  5T3W A;  2A6H F;  3NYM A;  4H4K C;  3ZVR A;  2R7W A;  3SEO A;  4RBN A;  3DJN B;  4I1O B;  1G8X A;  4O6N A;  2ZXP A;  1TWG A;  3ABL C;  4J32 B;  3OA1 A;  5CI8 A;  2G3K A;  1J8Y F;  3N2Z B;  2WB7 A;  2Q3T A;  4ZLC A;  3Q6N A;  2J9V A;  5E3A A;  1VOM A;  1NU9 C;  1KU2 A;  2G3V A;  4CS9 C;  3DM9 B;  3L34 A;  4MND A;  4K7B A;  4N06 A;  3POV A;  5HSW A;  4KI2 A;  3W8I A;  2H7B A;  3LAY A;  4HFK B;  4M63 A;  2Y3B A;  1S7Z A;  5DS4 A;  3B9Q A;  3SP1 A;  1ZHY A;  3RH3 A;  5E33 A;  1D0Y A;  3MLG A;  4CS8 C;  1NZE A;  3DMD A;  3LEV A;  4OIP F;  3HLZ A;  3LES A;  1PD1 A;  2HV6 A;  1TKN A;  2EIL C;  2IOQ A;  3LLK A;  2R7T A;  5L3V A;  4OIO F;  3DXJ F;  3EGD A;  5KYU B;  2R7Q A;  4G7Z F;  4Q7C A;  5D91 A;  3EG9 A;  4OD5 A;  1TWA A;  3K1I C;  1LVK A;  2NUT A;  3JSZ A;  3UMI A;  4KC9 A;  5T1D B;  1ZU4 A;  2WVO A;  2XL4 A;  2XRH A;  4FX5 A;  1D0Z A;  3NG1 A;  2XXA A;  3K1H A;  2M4E A;  2JD3 A;  4O6Y A;  2J7P A;  5B3S C;  3EGD B;  4PFP A;  2Y3D A;  1VYI A;  3EZH A;  1FMV A;  3KKB A;  3EPV A;  3ECS A;  2VAS A;  4G7H F;  1LKX A;  2PX3 A;  2ZXW C;  5D92 A;  1M57 C;  1J8M F;  3UMK A;  2LSE A;  2VB6 A;  3Q6M A;  4HFF B;  4PJL A;  3B0P A;  5T3T A;  2R7S A;  4NY3 A;  3ZIB A;  3LS0 A;  2XSE A;  5DQZ A;  2X51 A;  3GOD A;  3LS1 A;  2WVN A;  1BR1 A;  3LLI A;  4FWV A;  1NU7 D;  4IAO A;  4C7O A;  3AG1 C;  2A69 F;  4I44 A;  3AG2 C;  1ZHZ A;  4JZA A;  3NKE A;  4OD4 A;  4YWQ A;  1Z63 A;  2MYS A;  1ZHX A;  3K7D A;  2EIM C;  3OEO A;  5KYX A;  1W2W A;  4BJ6 C;  4BEJ A;  4YN0 B;  1D0X A;  3MX3 A;  2V3C C;  1O87 A;  1Z5Z A;  2PF4 E;  5F5F A;  4X0R A;  3K66 A;  3GAN A;  2E87 A;  2R7V A;  3PHF 2;  3N0T A;  2R7X A;  3EJN A;  4CS9 A;  3Q7G A;  2IYL D;  1MND A;  5KYY A;  2C03 A;  2H7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...