3UMKA

X-ray structure of the e2 domain of the human amyloid precursor protein (app) in complex with copper
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
184
structure length
184
Chain Sequence
DENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Metal Binding Dictates Conformation and Function of the Amyloid Precursor Protein (APP) E2 Domain.
pubmed doi rcsb
molecule keywords Amyloid beta A4 protein
molecule tags Metal binding protein
source organism Homo sapiens
total genus 83
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2011-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3umkA00
4YN0B 5BUOA 3UMHA 3NYLA 3Q7GA 3PMRA 4RD9A 3UMKA 1TKNA 4RDAA 3UMIA 3Q7LA 3NYJA 3K6BA 3QMKA 3K66A
chains in the Genus database with same CATH superfamily
4JIOA 5F5FA 1I4YA 2QE9A 2CYDA 3EQLF 4XEFA 2ZD9A 3KL4A 3TOMA 2AWCA 3SYNA 3PHF2 5HSWA 3EHMA 1V55C 1M6TA 2KSFA 1YA7O 2ASRA 1AVOB 2ZPAA 1LE2A 4NCQA 4XEKA 3O55A 1Z5ZA 4N6CA 4JURI 2VB6A 5JRAA 4PACA 1GQAA 2GWWA 1LE4A 1D0YA 2H7OA 3QMKA 3SP1A 4JEAA 2I8BA 2AP3A 4U5GA 3T6JA 4C7OB 3VM6A 2KJGA 5L0FA 2J8WA 3EJNA 3HNKA 4NC3A 3RH3A 4ULVA 2QUPA 4ULWA 5DVWA 2P61A 4Q7CA 4IWBA 1YVIA 2GA0A 2HZ8A 2LIGA 1AUEA 4BJ6C 4ONSA 4JCZA 1Q0DA 1W2WA 2IXMA 2NUPA 2NG1A 2VH3A 3AG4C 3US6A 2E87A 2NSFA 2OKUA 2G3VA 5HV9A 3FDQA 1OR3A 1TWAA 1E83A 3JYYA 2G3KA 3W8IA 1Q0FA 2J0XA 2BE5F 2FAPB 3KPHA 5F5HA 3W2VA 2TMVP 3DXJF 3T6GB 4JRZA 2WL8A 4CBEA 4E18A 2XXAA 1VLTA 3U2LA 4GYTA 2YL3A 1TWGA 2V3CC 1U0BB 1DOWA 1V74B 1NFOA 3C62A 4K7BA 3ZQVA 2NSGA 2R02A 4AK9A 4BEMJ 2RD9A 3B0UX 1RKEB 4HFKB 3Q7LA 2Y69C 2KNHA 1WASA 3NDBB 2HJ3A 1BR4A 1Z7Qc 4AL1A 2VCAA 3JCUQ 4J7YA 4LLEA 1PD1A 1SYQA 1YDIA 2IXNA 2QLAA 2RSEB 2C04A 4N6HA 2OJED 2PX0A 4XEVA 3G50A 3WG7C 4CS8C 5L0JA 5TJ5E 1Y4CA 1TWCA 1J8MF 4N4WA 5A6JA 1YZAA 4NTFA 3CSKA 3F47A 4JVSA 4NQFA 2YRFA 2EIMC 3C8GA 1ZU4A 1OW8A 1UFBA 3ITFA 1OCRC 2QTVA 2LCHA 5DS4A 3SXKA 1YZCA 3RQGA 3U3FA 4CIHA 3ZTMA 5DLJA 1M2VB 3FVYA 4JJGA 3DJNB 3QTHA 2EPMX 1YYXA 4CS7A 3LJBA 1LKXA 3I5QA 2MWQA 1G4WR 2J7PA 5L3QA 3IQCA 3IQ5A 4IAOA 1T6UA 3AGUA 4L6RA 3B9QA 4YN0B 2L6GA 4O6YA 2XL8A 1LS1A 1VLSA 3EG9B 1CPRA 4HFFB 2L81A 4JE9A 3ZWIA 3DJUB 4RD9A 4PJJA 2B0HA 4IAQA 2X0CA 3S9OA 1A41A 1HMDA 1OXKA 1T5OA 2HKVA 4BJ5A 4AX2A 2CNWD 3AG3C 2C03A 4YWQA 4J30B 1OKKD 1VMAA 2AVKA 2VCBA 3ABLC 3PCVA 3N0TA 3LS0A 3FAPB 3K33A 3UGPA 3NKEA 3U9MA 3LEOA 2EPKX 3B0PA 4PFOA 4YJWA 1WWPA 3LNMB 1RCPA 3N24A 5CI9A 3IQ6A 2R7UA 1L7CA 2YHSA 1VYKA 1ZHWA 4AE4B 4JKVA 3HNLA 3H65A 4ER9A 2IXOA 4DOZA 4MNDA 4N06A 2KQ9A 2KYHA 4JJFA 3GODA 2CGEA 5L0HA 2A0BA 1Q0MA 2R05A 3QVYA 4K1OA 3UMIA 2UUHA 3OEOA 1XZPA 1A0BA 3AJMA 3LUTB 5BQGA 4NTBA 3LNRA 1JOGA 1NU9C 5KYUA 1MMAA 1Q0GA 4DRIB 5JVEA 1QSPA 3TJ6A 2XS8A 4XPYA 1TFOB 3SNHA 1BZ4A 3S0XA 1ORJA 1EQ1A 4J7TA 2W4MA 4CIPA 3RQEA 2ZXRA 3NKDA 4O7GA 4E0HA 2O9XA 1E86A 3EH1A 1MMDA 4C3DA 2B0JA 3DM5A 4FWVA 3RFYA 3OA1A 5KYNA 1JMWA 4U9DA 5DS6A 2MHRA 2LK4A 4CS9C 4I1MA 3PDMP 4A4AA 2DGJA 1VYIA 2AU5A 1GGQA 1OQCA 2HMZA 3Q6NA 2R7VA 1C03A 3X2QC 3CEXA 1WTYA 1O3UA 3GEIA 1D0ZA 4RDAA 1QKRA 4PJLA 1A7DA 5DQTA 5EHHA 3NYJA 2PNOA 1JPJA 2V26A 1ZHZA 4YT5A 1XWJA 2L6FA 2YWAA 3C8ZA 3Q7GA 2YZSA 1MQVA 3GM3A 3MFNA 4CDYA 4CJGA 3V7OA 4KI2A 4LDRA 3FAJA 3U2MA 3OWTA 4YT8A 3A9CA 1CGNA 3X1OA 3G4XA 4MVRA 1ZZPA 2LP4A 3K1IC 3U0CA 1HE9A 4XPXA 2PBEA 4KBLA 1YYJA 1BR1A 5CIVA 1YLMA 2JD3A 1NLXA 2W45A 2XM4A 2YLIA 2Q7RA 4AL0A 3SEOA 3JSEO 1I4ZA 4FX5A 4I44A 4WGYA 3H2UA 5B1BC 3WODF 1HY5A 3AQCA 3AQBA 3K1HA 3LESA 1M57C 1MMGA 4IARA 3E70C 3W4YA 2GFHA 1ORYA 3VAYA 2Q4FA 2XLEA 3AG1C 3M79A 1CPQA 2R7RA 1EKYA 4OD5A 3QZCA 2PP4A 1Z23A 2Q9BA 3KYIA 3QVZA 4WJ0A 4EIYA 3NRHA 4CDVA 3IHUA 3NMKA 1YA9A 3M1CB 4P9TA 3JYHA 4MW8A 3WAQA 4Z9IA 2XSEA 1OCCC 2J46A 1T01A 2XLVA 1LIHA 2R25A 3EGXA 2WVNA 4XPWA 2P1AA 1RKCA 1GM5A 3M15A 2EILC 4I1OB 1U6HA 1H9TA 4P9FA 3ZQYA 3KKBA 2I15A 1IW7F 2Y3BA 5K0IA 4WABA 2W4BA 2IXPA 3GWNA 3J06A 1WN0A 1U89A 1FFHA 2YL7A 3GEHA 4GQHA 3MBGA 2YQYA 3NYMA 4G0HA 3NMJA 1OR2A 4D4XA 1FAPB 3B0VC 4YK5A 3QW1A 1LM3B 3LS1A 1WATA 2BC5A 1UG7A 4KNVA 3G4ZA 3VRCA 4OINF 4MVZA 3EZIA 4X0RA 1MNDA 1NBBA 2A0UA 3TD7A 3SZRA 5F28E 1D1BA 1EI7A 4DVZA 2WVOA 4J32B 1E84A 1F1MA 2YLDA 4D4NA 2HFIA 2J9VA 4BEJA 3N2ZB 3PMRA 4MS2A 3ZC4A 4JTCB 2AWYA 1QQ3A 2HV6A 4DBRA 4NTAA 3EPVA 5A6BA 2XXAB 2P0NA 1VK5A 5JSLA 5KYUB 2KW3C 3MX3A 3W8HA 5GPGB 4U5DE 2KK1A 5L0CA 5BQIA 5KYYA 1TR2A 2J45A 1FFTC 4BJTA 5JUAA 1D1CA 4FAPB 3RF3A 4QDLA 3EHNA 3HJCA 2XLOA 4JZAA 3U5SA 4DBQA 2L9JA 3V5XA 1PV3A 2IM8A 1VOMA 1HW1A 5CI8A 4UDVA 5AGFA 2M4EA 2IBFA 2Q9AA 1NG1A 1OXBA 2HS5A 4C3BA 3SXZA 1OCZC 1CGME 4BJ5C 1LS4A 1T6IA 2A6HF 2CDQA 5E3CA 3RVZA 4XWJA 3LLIA 3L8IA 3NMIA 3M4CA 2D4UA 2GDCA 2JX0A 2QY9A 4E0IA 1VB5A 2PFDA 4K0DA 2HUJA 3TJ5A 2WVQA 2YL0A 4IRUA 1T9KA 1JR8A 4LLCA 2WZLA 2ZXOA 4JEBA 1HW2A 1C17M 256BA 1K40A 2LFFA 3JRTA 1OCOC 1E2XA 1RJ9A 2EPNA 1YARO 2DB4A 4JCHA 1FTSA 3L34A 1NZEA 2R9RB 3LAYA 3HKKA 3UR3C 3C8GD 2EIJC 3KMIA 3DWWA 2XS1A 1ZW3A 3GANA 3FHDA 2EPOA 2ETSA 3H2VA 2KGOA 3W2WA 4P6IC 4PJMA 2J0WA 1B68A 2KC3A 2OU6A 3TQOA 3UNGC 1G5ZA 1Z6AA 3EGDA 4YT4A 3B29A 3L8JA 3V5ZA 3M4BA 2J7PD 3TK0A 2DYSC 4M63A 2LQGA 2DYRC 2GAQA 1WGWA 4PFPA 3O10A 4R32A 2JPUA 3DI5A 4DVYP 2NUPB 5A69A 1QPUA 4NY3A 5L0IA 3VYWA 2R03A 1K05A 5T1DB 4JTAB 4QI0A 5L3VA 5KYWA 1SMYF 1T6QA 3DD7A 3T6BA 2NUTA 4LACB 3RKOF 2YVKA 5B3SC 2R7OA 4JC7A 4U5CE 4U5FE 2HMQA 2PX3A 3MYFA 2IOQA 1MMNA 2OJQA 3F46A 3K7DA 3U8VA 3S90A 4CJOA 3ZTZA 3EGXB 4BJ1A 3ATPA 2OQMA 3WHNA 2YKZA 1R5ID 2YL1A 2YEVA 3HNJA 4MVUA 4MVOA 2LD6A 1LI5A 2YLGA 3UMHA 4XLPF 1GS9A 3EZHA 1L3PA 4I3MA 3T9OA 2WZGA 5JP7A 1AEPA 2Y3DA 2FGYA 4MTFA 4FESA 1LVKA 3AOUA 2BL2A 4OIPF 3U9JA 1WOLA 4F4BA 5BUOA 4GEHA 1RMVA 5L0DA 3MLGA 1JAFA 1OW7A 2D5RB 3S27A 2EIKC 4AE4A 5IY5C 3ZIBA 4ZLDA 4XLNF 4HE8D 4PR9A 4EHPA 3ZG1A 2IYLD 3C8GB 3E9VA 3JT1A 5EGYA 2UUIA 3O6XA 4YL1A 1ST6A 2P7VA 4U5EE 1BBHA 3R7CA 3DAFA 5COGA 4EKWA 4MQ9F 4BJ6A 4DXWA 4KC9A 3VF0A 5B1AC 1FMWA 4RBNA 5DQZA 1D0XA 3EFOA 2H8AA 3JZ0A 4G78A 4Z9JA 4G7OF 1VTMP 4ZLCA 1I5NA 2XL4A 4B6IA 4JTDB 3DZAA 5E33A 1ZU5A 2M64A 2Q3TA 1BR2A 4MTGA 4YL0A 2FFHA 5E2QA 2R7TA 2R7QA 3V5YA 5KYYB 4W8KA 5KYXA 3C7JA 4E7ZA 2R7XA 1ZYRF 2XM0A 3AG2C 5D91A 5FZTA 3UMKA 5L0GA 2PF4E 3EH2A 2OOCA 4BG0A 2LSEA 4U5BE 5BQHA 3ECSA 2A6EF 2HJMA 2CNWA 1FMVA 4MVQA 3ZSUA 4BPMA 2OCCC 3GM2A 2A1DD 4LERA 3B71A 2HSBA 1OKKA 2OEXA 3DM9B 3IPMO 3DE9A 2Y39A 3RVYA 3ZVRA 4CS8A 4IB4A 3NYLA 1R4TA 4MTOA 4PJNA 1Y6DA 2H7BA 2LFDA 3AGTA 3JRMO 2ZXWC 1NU7D 1TFKB 3IEEA 4IJJA 4IGGA 4E7SA 3C18A 1K04A 2HV7A 4DRJB 1O87A 3BRJA 1Z3IX 3C63A 2L7AA 2XRHA 1Q0KA 4A2NB 2ICWG 1SF8A 1RJ9B 4Z9HA 4G7ZF 4E17A 1C02A 2Y3GA 3A11A 1JPNA 3QW0A 3DE8A 2ZXPA 4EUKB 4CSAA 4C7OA 4U9EA 4H4KC 1FR0A 1OW6A 3ABMC 3NG1A 1LPEA 4W8PA 4O6NA 3O39A 3GEEA 2OG2A 5A6KA 1JRAA 3ASNC 3DKAA 1XZQA 2VC9A 1TWHA 1TKNA 2Q00A 3EGDB 3L1MA 1A7EA 1LI7A 1NFNA 2XLMA 3DMDA 1V4AA 4HEAJ 3HLZA 4CSAC 4ANJA 5D92A 3R2PA 1IZMA 4H54A 1ZVZA 3KYJA 4Q4ZF 2XL6A 3ZDLA 4CDAA 1EA8A 1S05A 1H6GA 3JSZA 3Q6MA 5KYWB 1G4US 1H7IA 3ABKC 3CQZA 1KU2A 2NUTB 4MVMA 3RW0A 1E85A 2A68F 4G7HF 3K6BA 5DS5A 4EWCA 4JW1A 1SZIA 3IQTA 3KH2A 4YT2A 5B3IA 2VCCA 1HMOA 4MW3A 4WGZA 4OIOF 3GWLA 1RKEA 1QVXA 3I4UA 4LDKA 2XLWA 4O6MA 4CX9A 4XQ1A 4XTKA 2L6HA 3FMSA 1ORSC 2VASA 4PK4A 4EBBA 4OIRF 4U5HA 1SR2A 1V54C 2MYSA 2EINC 1ZHYA 5T3WA 3RYLA 2WZFA 1DOVA 1J8YF 1RXQA 4QI2A 1M56C 1KTMA 3RQFA 1PCXA 2F22A 5T3TA 2P6VA 4MVSA 4DRHB 5JS5A 2R7WA 4DJ9A 1YAUO 5AC5A 3FOOA 3TOLA 3GM1A 2Q9CA 3LEVA 3LLKA 5A6AA 1CGOA 2A69F 3U8PA 2CCYA 4OIQF 3L0IA 3CAXA 1G8XA 4OD4A 5COFA 5JLIA 3T4RA 2H7VC 5A6BD 1A7VA 1M2VA 2CW0F 1YJGA 2J9WA 2XLHA 3MYIA 2WB7A 3BEHA 4LDQA 5EK0A 3U3BA 4EBJA 5COMA 3K66A 1M2OA 3POVA 4Q5SF 1H9GA 2J9BA 2Z15A 2DI3A 3S84A 3CZ6A 3TULA 2J9UA 5FCLA 3RIPA 3JTLO 3DAGA 3EFOB 1ZHTA 1HE1A 3EG9A 3HTKC 3S28A 5JT4A 3FOPA 4CS9A 1O5HA 4KNWA 2EPLX 2OEVA 1FNTc 3ASOC 1APCA 1PD0A 1BDJB 3GORA 1N1CA 1QLEC 3SXMA 1Z63A 1MNEA 2W9YA 1QZXA 2R7SA 4EBKA 4C3EA 5KYXB 3UGOA 2XLDA 2QNLA 5AC4A 2G62A 2Y3HA 1D1AA 3I5PA 4YL3A 1KNYA 1ZHXA 2NPUA 4O79A 5E3AA 2X51A 3K1IA 1TQGA 3HNIA 1ZW2A 2HSQA 3FXHA 3S29A 3SXYA 1S7ZA 1NSGB
chains in the Genus database with same CATH topology
5F5FA 3EQLF 3KL4A 3PHF2 3SYNA 5HSWA 3EHMA 1V55C 2ZPAA 1Z5ZA 4JURI 2VB6A 1D0YA 2H7OA 3QMKA 3SP1A 2I8BA 4U5GA 3T6JA 4C7OB 2KJGA 3EJNA 3RH3A 4BJ6C 4ULWA 5DVWA 4Q7CA 4IWBA 1W2WA 2IXMA 2NUPA 2NG1A 2VH3A 3AG4C 2E87A 3FDQA 2G3VA 1TWAA 3W8IA 2G3KA 2J0XA 2BE5F 5F5HA 3W2VA 3DXJF 2WL8A 4CBEA 2XXAA 4GYTA 1TWGA 2V3CC 4K7BA 4AK9A 3B0UX 4HFKB 3Q7LA 2Y69C 2KNHA 3NDBB 1BR4A 3JCUQ 4LLEA 1PD1A 2IXNA 2C04A 4CS8C 2PX0A 3WG7C 1TWCA 1J8MF 3CSKA 3F47A 4JVSA 2EIMC 1ZU4A 3ITFA 1OCRC 2QTVA 5DS4A 4CIHA 5DLJA 1M2VB 3FVYA 4JJGA 3DJNB 4CS7A 3LJBA 1LKXA 3I5QA 2MWQA 2J7PA 5L3QA 4IAOA 3B9QA 4YN0B 4O6YA 1LS1A 3EG9B 4HFFB 2L81A 3DJUB 4RD9A 4PJJA 4BJ5A 4AX2A 2CNWD 3AG3C 2C03A 4YWQA 4J30B 1OKKD 1VMAA 3ABLC 3N0TA 3LS0A 3K33A 3UGPA 3NKEA 4PFOA 3B0PA 4YJWA 5CI9A 3N24A 2R7UA 2YHSA 1VYKA 1ZHWA 4AE4B 3H65A 2IXOA 4DOZA 4MNDA 2KQ9A 4JJFA 3GODA 2CGEA 3UMIA 3OEOA 3LNRA 1NU9C 5KYUA 1MMAA 3SNHA 3S0XA 2W4MA 2ZXRA 3NKDA 4O7GA 2O9XA 3EH1A 1MMDA 4C3DA 2B0JA 3DM5A 4FWVA 3RFYA 3OA1A 5KYNA 5DS6A 4CS9C 4I1MA 2DGJA 1VYIA 3Q6NA 2R7VA 3X2QC 1D0ZA 4RDAA 4PJLA 5EHHA 5DQTA 3NYJA 1JPJA 2V26A 1ZHZA 4YT5A 3Q7GA 2YZSA 3V7OA 4KI2A 3FAJA 3OWTA 4YT8A 3X1OA 3K1IC 4KBLA 1BR1A 2JD3A 2W45A 3SEOA 4FX5A 4I44A 5B1BC 3WODF 3AQCA 3AQBA 3K1HA 3LESA 1M57C 1MMGA 3E70C 2GFHA 3VAYA 3AG1C 2R7RA 4OD5A 3QZCA 2PP4A 1Z23A 2Q9BA 4WJ0A 3NRHA 3M1CB 3JYHA 2XSEA 1OCCC 2J46A 3EGXA 2WVNA 2EILC 4I1OB 3KKBA 1IW7F 2Y3BA 2W4BA 2IXPA 1FFHA 3NYMA 4G0HA 3B0VC 3LS1A 4KNVA 4OINF 3EZIA 4X0RA 1MNDA 3TD7A 3SZRA 1D1BA 4DVZA 2WVOA 4J32B 2J9VA 4BEJA 3N2ZB 3PMRA 3ZC4A 2HV6A 4DBRA 3EPVA 1VK5A 5KYUB 2KW3C 3MX3A 3W8HA 4U5DE 5KYYA 1TR2A 2J45A 1FFTC 4BJTA 1D1CA 4QDLA 3EHNA 3HJCA 4JZAA 4DBQA 2L9JA 1VOMA 5CI8A 2M4EA 2Q9AA 1NG1A 4C3BA 1OCZC 4BJ5C 2A6HF 2CDQA 5E3CA 4XWJA 3LLIA 2QY9A 2PFDA 4K0DA 2WVQA 4IRUA 4LLCA 2WZLA 2ZXOA 3JRTA 4ZLCA 1OCOC 1RJ9A 4JCHA 1FTSA 3L34A 1NZEA 3UR3C 3LAYA 2EIJC 3KMIA 3GANA 3FHDA 2KGOA 3W2WA 4P6IC 4PJMA 2J0WA 3UNGC 1Z6AA 3EGDA 4YT4A 2J7PD 2DYSC 4M63A 2DYRC 1WGWA 4PFPA 4DVYP 2NUPB 4NY3A 3VYWA 5L3VA 5T1DB 4QI0A 5KYWA 1SMYF 3DD7A 3T6BA 2NUTA 4LACB 3RKOF 5B3SC 2R7OA 4U5CE 4U5FE 2PX3A 2XXAB 2IOQA 1MMNA 3F46A 3K7DA 3EGXB 4BJ1A 4N06A 2YEVA 3UMHA 4XLPF 3EZHA 4I3MA 2WZGA 2Y3DA 2FGYA 4FESA 1LVKA 4OIPF 4F4BA 5BUOA 4GEHA 3MLGA 3S27A 2D5RB 2EIKC 4AE4A 5IY5C 3ZIBA 4ZLDA 4XLNF 3ZG1A 2IYLD 3E9VA 3JT1A 5EGYA 3O6XA 1ST6A 2P7VA 4U5EE 3DAFA 4MQ9F 4BJ6A 4KC9A 5B1AC 1FMWA 4RBNA 5DQZA 1D0XA 3EFOA 4G7OF 2XL4A 4B6IA 3DZAA 5E33A 1ZU5A 2Q3TA 1BR2A 5E2QA 2R7TA 2FFHA 2R7QA 5KYYB 4W8KA 5KYXA 4E7ZA 2R7XA 1ZYRF 3AG2C 5D91A 3UMKA 2PF4E 3EH2A 4BG0A 2LSEA 4U5BE 3ECSA 2A6EF 2CNWA 1FMVA 3ZSUA 2OCCC 2A1DD 4LERA 3DM9B 1OKKA 2Y39A 3ZVRA 4CS8A 3NYLA 4PJNA 2H7BA 2ZXWC 1NU7D 3IEEA 4IJJA 4E7SA 2HV7A 1O87A 1Z3IX 2XRHA 4A2NB 1SF8A 1RJ9B 4G7ZF 2Y3GA 1JPNA 4CSAA 2ZXPA 4C7OA 4H4KC 3ABMC 3NG1A 4O6NA 3O39A 2OG2A 3ASNC 1TWHA 1TKNA 3EGDB 3DMDA 4HEAJ 3HLZA 4CSAC 4ANJA 5D92A 1IZMA 4Q4ZF 3JSZA 3Q6MA 5KYWB 3ABKC 3CQZA 1KU2A 2NUTB 2A68F 4G7HF 3K6BA 4EWCA 4JW1A 1SZIA 3KH2A 4YT2A 4OIOF 3I4UA 4O6MA 4XTKA 4PK4A 2VASA 4EBBA 4OIRF 4U5HA 1V54C 2MYSA 2EINC 1ZHYA 5T3WA 3RYLA 2WZFA 4QI2A 1J8YF 1M56C 5DS5A 1PCXA 5T3TA 2R7WA 2P6VA 2Q9CA 3LEVA 3LLKA 2A69F 4OIQF 3L0IA 4OD4A 1G8XA 3T4RA 2H7VC 1M2VA 2CW0F 2J9WA 2WB7A 3POVA 3K66A 1M2OA 4Q5SF 2Z15A 3CZ6A 2J9UA 5FCLA 3RIPA 3S28A 3DAGA 3EFOB 1ZHTA 3EG9A 3HTKC 4CS9A 1O5HA 4KNWA 3ASOC 1PD0A 1N1CA 1QLEC 1Z63A 1MNEA 2W9YA 1QZXA 2R7SA 4C3EA 5KYXB 3UGOA 2G62A 2Y3HA 1D1AA 3I5PA 1ZHXA 4O79A 5E3AA 2X51A 3S29A 1S7ZA 4HE8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YN0 B;  5BUO A;  3UMH A;  3NYL A;  3Q7G A;  3PMR A;  4RD9 A;  3UMK A;  1TKN A;  4RDA A;  3UMI A;  3Q7L A;  3NYJ A;  3K6B A;  3QMK A;  3K66 A; 
#chains in the Genus database with same CATH topology
 4JIO A;  5F5F A;  1I4Y A;  2QE9 A;  2CYD A;  3EQL F;  4XEF A;  2ZD9 A;  3KL4 A;  3TOM A;  2AWC A;  3SYN A;  3PHF 2;  5HSW A;  3EHM A;  1V55 C;  1M6T A;  2KSF A;  1YA7 O;  2ASR A;  1AVO B;  2ZPA A;  1LE2 A;  4NCQ A;  4XEK A;  3O55 A;  1Z5Z A;  4N6C A;  4JUR I;  2VB6 A;  5JRA A;  4PAC A;  1GQA A;  2GWW A;  1LE4 A;  1D0Y A;  2H7O A;  3QMK A;  3SP1 A;  4JEA A;  2I8B A;  2AP3 A;  4U5G A;  3T6J A;  4C7O B;  3VM6 A;  2KJG A;  5L0F A;  2J8W A;  3EJN A;  3HNK A;  4NC3 A;  3RH3 A;  4ULV A;  2QUP A;  4ULW A;  5DVW A;  2P61 A;  4Q7C A;  4IWB A;  1YVI A;  2GA0 A;  2HZ8 A;  2LIG A;  1AUE A;  4BJ6 C;  4ONS A;  4JCZ A;  1Q0D A;  1W2W A;  2IXM A;  2NUP A;  2NG1 A;  2VH3 A;  3AG4 C;  3US6 A;  2E87 A;  2NSF A;  2OKU A;  2G3V A;  5HV9 A;  3FDQ A;  1OR3 A;  1TWA A;  1E83 A;  3JYY A;  2G3K A;  3W8I A;  1Q0F A;  2J0X A;  2BE5 F;  2FAP B;  3KPH A;  5F5H A;  3W2V A;  2TMV P;  3DXJ F;  3T6G B;  4JRZ A;  2WL8 A;  4CBE A;  4E18 A;  2XXA A;  1VLT A;  3U2L A;  4GYT A;  2YL3 A;  1TWG A;  2V3C C;  1U0B B;  1DOW A;  1V74 B;  1NFO A;  3C62 A;  4K7B A;  3ZQV A;  2NSG A;  2R02 A;  4AK9 A;  4BEM J;  2RD9 A;  3B0U X;  1RKE B;  4HFK B;  3Q7L A;  2Y69 C;  2KNH A;  1WAS A;  3NDB B;  2HJ3 A;  1BR4 A;  1Z7Q c;  4AL1 A;  2VCA A;  3JCU Q;  4J7Y A;  4LLE A;  1PD1 A;  1SYQ A;  1YDI A;  2IXN A;  2QLA A;  2RSE B;  2C04 A;  4N6H A;  2OJE D;  2PX0 A;  4XEV A;  3G50 A;  3WG7 C;  4CS8 C;  5L0J A;  5TJ5 E;  1Y4C A;  1TWC A;  1J8M F;  4N4W A;  5A6J A;  1YZA A;  4NTF A;  3CSK A;  3F47 A;  4JVS A;  4NQF A;  2YRF A;  2EIM C;  3C8G A;  1ZU4 A;  1OW8 A;  1UFB A;  3ITF A;  1OCR C;  2QTV A;  2LCH A;  5DS4 A;  3SXK A;  1YZC A;  3RQG A;  3U3F A;  4CIH A;  3ZTM A;  5DLJ A;  1M2V B;  3FVY A;  4JJG A;  3DJN B;  3QTH A;  2EPM X;  1YYX A;  4CS7 A;  3LJB A;  1LKX A;  3I5Q A;  2MWQ A;  1G4W R;  2J7P A;  5L3Q A;  3IQC A;  3IQ5 A;  4IAO A;  1T6U A;  3AGU A;  4L6R A;  3B9Q A;  4YN0 B;  2L6G A;  4O6Y A;  2XL8 A;  1LS1 A;  1VLS A;  3EG9 B;  1CPR A;  4HFF B;  2L81 A;  4JE9 A;  3ZWI A;  3DJU B;  4RD9 A;  4PJJ A;  2B0H A;  4IAQ A;  2X0C A;  3S9O A;  1A41 A;  1HMD A;  1OXK A;  1T5O A;  2HKV A;  4BJ5 A;  4AX2 A;  2CNW D;  3AG3 C;  2C03 A;  4YWQ A;  4J30 B;  1OKK D;  1VMA A;  2AVK A;  2VCB A;  3ABL C;  3PCV A;  3N0T A;  3LS0 A;  3FAP B;  3K33 A;  3UGP A;  3NKE A;  3U9M A;  3LEO A;  2EPK X;  3B0P A;  4PFO A;  4YJW A;  1WWP A;  3LNM B;  1RCP A;  3N24 A;  5CI9 A;  3IQ6 A;  2R7U A;  1L7C A;  2YHS A;  1VYK A;  1ZHW A;  4AE4 B;  4JKV A;  3HNL A;  3H65 A;  4ER9 A;  2IXO A;  4DOZ A;  4MND A;  4N06 A;  2KQ9 A;  2KYH A;  4JJF A;  3GOD A;  2CGE A;  5L0H A;  2A0B A;  1Q0M A;  2R05 A;  3QVY A;  4K1O A;  3UMI A;  2UUH A;  3OEO A;  1XZP A;  1A0B A;  3AJM A;  3LUT B;  5BQG A;  4NTB A;  3LNR A;  1JOG A;  1NU9 C;  5KYU A;  1MMA A;  1Q0G A;  4DRI B;  5JVE A;  1QSP A;  3TJ6 A;  2XS8 A;  4XPY A;  1TFO B;  3SNH A;  1BZ4 A;  3S0X A;  1ORJ A;  1EQ1 A;  4J7T A;  2W4M A;  4CIP A;  3RQE A;  2ZXR A;  3NKD A;  4O7G A;  4E0H A;  2O9X A;  1E86 A;  3EH1 A;  1MMD A;  4C3D A;  2B0J A;  3DM5 A;  4FWV A;  3RFY A;  3OA1 A;  5KYN A;  1JMW A;  4U9D A;  5DS6 A;  2MHR A;  2LK4 A;  4CS9 C;  4I1M A;  3PDM P;  4A4A A;  2DGJ A;  1VYI A;  2AU5 A;  1GGQ A;  1OQC A;  2HMZ A;  3Q6N A;  2R7V A;  1C03 A;  3X2Q C;  3CEX A;  1WTY A;  1O3U A;  3GEI A;  1D0Z A;  4RDA A;  1QKR A;  4PJL A;  1A7D A;  5DQT A;  5EHH A;  3NYJ A;  2PNO A;  1JPJ A;  2V26 A;  1ZHZ A;  4YT5 A;  1XWJ A;  2L6F A;  2YWA A;  3C8Z A;  3Q7G A;  2YZS A;  1MQV A;  3GM3 A;  3MFN A;  4CDY A;  4CJG A;  3V7O A;  4KI2 A;  4LDR A;  3FAJ A;  3U2M A;  3OWT A;  4YT8 A;  3A9C A;  1CGN A;  3X1O A;  3G4X A;  4MVR A;  1ZZP A;  2LP4 A;  3K1I C;  3U0C A;  1HE9 A;  4XPX A;  2PBE A;  4KBL A;  1YYJ A;  1BR1 A;  5CIV A;  1YLM A;  2JD3 A;  1NLX A;  2W45 A;  2XM4 A;  2YLI A;  2Q7R A;  4AL0 A;  3SEO A;  3JSE O;  1I4Z A;  4FX5 A;  4I44 A;  4WGY A;  3H2U A;  5B1B C;  3WOD F;  1HY5 A;  3AQC A;  3AQB A;  3K1H A;  3LES A;  1M57 C;  1MMG A;  4IAR A;  3E70 C;  3W4Y A;  2GFH A;  1ORY A;  3VAY A;  2Q4F A;  2XLE A;  3AG1 C;  3M79 A;  1CPQ A;  2R7R A;  1EKY A;  4OD5 A;  3QZC A;  2PP4 A;  1Z23 A;  2Q9B A;  3KYI A;  3QVZ A;  4WJ0 A;  4EIY A;  3NRH A;  4CDV A;  3IHU A;  3NMK A;  1YA9 A;  3M1C B;  4P9T A;  3JYH A;  4MW8 A;  3WAQ A;  4Z9I A;  2XSE A;  1OCC C;  2J46 A;  1T01 A;  2XLV A;  1LIH A;  2R25 A;  3EGX A;  2WVN A;  4XPW A;  2P1A A;  1RKC A;  1GM5 A;  3M15 A;  2EIL C;  4I1O B;  1U6H A;  1H9T A;  4P9F A;  3ZQY A;  3KKB A;  2I15 A;  1IW7 F;  2Y3B A;  5K0I A;  4WAB A;  2W4B A;  2IXP A;  3GWN A;  3J06 A;  1WN0 A;  1U89 A;  1FFH A;  2YL7 A;  3GEH A;  4GQH A;  3MBG A;  2YQY A;  3NYM A;  4G0H A;  3NMJ A;  1OR2 A;  4D4X A;  1FAP B;  3B0V C;  4YK5 A;  3QW1 A;  1LM3 B;  3LS1 A;  1WAT A;  2BC5 A;  1UG7 A;  4KNV A;  3G4Z A;  3VRC A;  4OIN F;  4MVZ A;  3EZI A;  4X0R A;  1MND A;  1NBB A;  2A0U A;  3TD7 A;  3SZR A;  5F28 E;  1D1B A;  1EI7 A;  4DVZ A;  2WVO A;  4J32 B;  1E84 A;  1F1M A;  2YLD A;  4D4N A;  2HFI A;  2J9V A;  4BEJ A;  3N2Z B;  3PMR A;  4MS2 A;  3ZC4 A;  4JTC B;  2AWY A;  1QQ3 A;  2HV6 A;  4DBR A;  4NTA A;  3EPV A;  5A6B A;  2XXA B;  2P0N A;  1VK5 A;  5JSL A;  5KYU B;  2KW3 C;  3MX3 A;  3W8H A;  5GPG B;  4U5D E;  2KK1 A;  5L0C A;  5BQI A;  5KYY A;  1TR2 A;  2J45 A;  1FFT C;  4BJT A;  5JUA A;  1D1C A;  4FAP B;  3RF3 A;  4QDL A;  3EHN A;  3HJC A;  2XLO A;  4JZA A;  3U5S A;  4DBQ A;  2L9J A;  3V5X A;  1PV3 A;  2IM8 A;  1VOM A;  1HW1 A;  5CI8 A;  4UDV A;  5AGF A;  2M4E A;  2IBF A;  2Q9A A;  1NG1 A;  1OXB A;  2HS5 A;  4C3B A;  3SXZ A;  1OCZ C;  1CGM E;  4BJ5 C;  1LS4 A;  1T6I A;  2A6H F;  2CDQ A;  5E3C A;  3RVZ A;  4XWJ A;  3LLI A;  3L8I A;  3NMI A;  3M4C A;  2D4U A;  2GDC A;  2JX0 A;  2QY9 A;  4E0I A;  1VB5 A;  2PFD A;  4K0D A;  2HUJ A;  3TJ5 A;  2WVQ A;  2YL0 A;  4IRU A;  1T9K A;  1JR8 A;  4LLC A;  2WZL A;  2ZXO A;  4JEB A;  1HW2 A;  1C17 M;  256B A;  1K40 A;  2LFF A;  3JRT A;  1OCO C;  1E2X A;  1RJ9 A;  2EPN A;  1YAR O;  2DB4 A;  4JCH A;  1FTS A;  3L34 A;  1NZE A;  2R9R B;  3LAY A;  3HKK A;  3UR3 C;  3C8G D;  2EIJ C;  3KMI A;  3DWW A;  2XS1 A;  1ZW3 A;  3GAN A;  3FHD A;  2EPO A;  2ETS A;  3H2V A;  2KGO A;  3W2W A;  4P6I C;  4PJM A;  2J0W A;  1B68 A;  2KC3 A;  2OU6 A;  3TQO A;  3UNG C;  1G5Z A;  1Z6A A;  3EGD A;  4YT4 A;  3B29 A;  3L8J A;  3V5Z A;  3M4B A;  2J7P D;  3TK0 A;  2DYS C;  4M63 A;  2LQG A;  2DYR C;  2GAQ A;  1WGW A;  4PFP A;  3O10 A;  4R32 A;  2JPU A;  3DI5 A;  4DVY P;  2NUP B;  5A69 A;  1QPU A;  4NY3 A;  5L0I A;  3VYW A;  2R03 A;  1K05 A;  5T1D B;  4JTA B;  4QI0 A;  5L3V A;  5KYW A;  1SMY F;  1T6Q A;  3DD7 A;  3T6B A;  2NUT A;  4LAC B;  3RKO F;  2YVK A;  5B3S C;  2R7O A;  4JC7 A;  4U5C E;  4U5F E;  2HMQ A;  2PX3 A;  3MYF A;  2IOQ A;  1MMN A;  2OJQ A;  3F46 A;  3K7D A;  3U8V A;  3S90 A;  4CJO A;  3ZTZ A;  3EGX B;  4BJ1 A;  3ATP A;  2OQM A;  3WHN A;  2YKZ A;  1R5I D;  2YL1 A;  2YEV A;  3HNJ A;  4MVU A;  4MVO A;  2LD6 A;  1LI5 A;  2YLG A;  3UMH A;  4XLP F;  1GS9 A;  3EZH A;  1L3P A;  4I3M A;  3T9O A;  2WZG A;  5JP7 A;  1AEP A;  2Y3D A;  2FGY A;  4MTF A;  4FES A;  1LVK A;  3AOU A;  2BL2 A;  4OIP F;  3U9J A;  1WOL A;  4F4B A;  5BUO A;  4GEH A;  1RMV A;  5L0D A;  3MLG A;  1JAF A;  1OW7 A;  2D5R B;  3S27 A;  2EIK C;  4AE4 A;  5IY5 C;  3ZIB A;  4ZLD A;  4XLN F;  4HE8 D;  4PR9 A;  4EHP A;  3ZG1 A;  2IYL D;  3C8G B;  3E9V A;  3JT1 A;  5EGY A;  2UUI A;  3O6X A;  4YL1 A;  1ST6 A;  2P7V A;  4U5E E;  1BBH A;  3R7C A;  3DAF A;  5COG A;  4EKW A;  4MQ9 F;  4BJ6 A;  4DXW A;  4KC9 A;  3VF0 A;  5B1A C;  1FMW A;  4RBN A;  5DQZ A;  1D0X A;  3EFO A;  2H8A A;  3JZ0 A;  4G78 A;  4Z9J A;  4G7O F;  1VTM P;  4ZLC A;  1I5N A;  2XL4 A;  4B6I A;  4JTD B;  3DZA A;  5E33 A;  1ZU5 A;  2M64 A;  2Q3T A;  1BR2 A;  4MTG A;  4YL0 A;  2FFH A;  5E2Q A;  2R7T A;  2R7Q A;  3V5Y A;  5KYY B;  4W8K A;  5KYX A;  3C7J A;  4E7Z A;  2R7X A;  1ZYR F;  2XM0 A;  3AG2 C;  5D91 A;  5FZT A;  3UMK A;  5L0G A;  2PF4 E;  3EH2 A;  2OOC A;  4BG0 A;  2LSE A;  4U5B E;  5BQH A;  3ECS A;  2A6E F;  2HJM A;  2CNW A;  1FMV A;  4MVQ A;  3ZSU A;  4BPM A;  2OCC C;  3GM2 A;  2A1D D;  4LER A;  3B71 A;  2HSB A;  1OKK A;  2OEX A;  3DM9 B;  3IPM O;  3DE9 A;  2Y39 A;  3RVY A;  3ZVR A;  4CS8 A;  4IB4 A;  3NYL A;  1R4T A;  4MTO A;  4PJN A;  1Y6D A;  2H7B A;  2LFD A;  3AGT A;  3JRM O;  2ZXW C;  1NU7 D;  1TFK B;  3IEE A;  4IJJ A;  4IGG A;  4E7S A;  3C18 A;  1K04 A;  2HV7 A;  4DRJ B;  1O87 A;  3BRJ A;  1Z3I X;  3C63 A;  2L7A A;  2XRH A;  1Q0K A;  4A2N B;  2ICW G;  1SF8 A;  1RJ9 B;  4Z9H A;  4G7Z F;  4E17 A;  1C02 A;  2Y3G A;  3A11 A;  1JPN A;  3QW0 A;  3DE8 A;  2ZXP A;  4EUK B;  4CSA A;  4C7O A;  4U9E A;  4H4K C;  1FR0 A;  1OW6 A;  3ABM C;  3NG1 A;  1LPE A;  4W8P A;  4O6N A;  3O39 A;  3GEE A;  2OG2 A;  5A6K A;  1JRA A;  3ASN C;  3DKA A;  1XZQ A;  2VC9 A;  1TWH A;  1TKN A;  2Q00 A;  3EGD B;  3L1M A;  1A7E A;  1LI7 A;  1NFN A;  2XLM A;  3DMD A;  1V4A A;  4HEA J;  3HLZ A;  4CSA C;  4ANJ A;  5D92 A;  3R2P A;  1IZM A;  4H54 A;  1ZVZ A;  3KYJ A;  4Q4Z F;  2XL6 A;  3ZDL A;  4CDA A;  1EA8 A;  1S05 A;  1H6G A;  3JSZ A;  3Q6M A;  5KYW B;  1G4U S;  1H7I A;  3ABK C;  3CQZ A;  1KU2 A;  2NUT B;  4MVM A;  3RW0 A;  1E85 A;  2A68 F;  4G7H F;  3K6B A;  5DS5 A;  4EWC A;  4JW1 A;  1SZI A;  3IQT A;  3KH2 A;  4YT2 A;  5B3I A;  2VCC A;  1HMO A;  4MW3 A;  4WGZ A;  4OIO F;  3GWL A;  1RKE A;  1QVX A;  3I4U A;  4LDK A;  2XLW A;  4O6M A;  4CX9 A;  4XQ1 A;  4XTK A;  2L6H A;  3FMS A;  1ORS C;  2VAS A;  4PK4 A;  4EBB A;  4OIR F;  4U5H A;  1SR2 A;  1V54 C;  2MYS A;  2EIN C;  1ZHY A;  5T3W A;  3RYL A;  2WZF A;  1DOV A;  1J8Y F;  1RXQ A;  4QI2 A;  1M56 C;  1KTM A;  3RQF A;  1PCX A;  2F22 A;  5T3T A;  2P6V A;  4MVS A;  4DRH B;  5JS5 A;  2R7W A;  4DJ9 A;  1YAU O;  5AC5 A;  3FOO A;  3TOL A;  3GM1 A;  2Q9C A;  3LEV A;  3LLK A;  5A6A A;  1CGO A;  2A69 F;  3U8P A;  2CCY A;  4OIQ F;  3L0I A;  3CAX A;  1G8X A;  4OD4 A;  5COF A;  5JLI A;  3T4R A;  2H7V C;  5A6B D;  1A7V A;  1M2V A;  2CW0 F;  1YJG A;  2J9W A;  2XLH A;  3MYI A;  2WB7 A;  3BEH A;  4LDQ A;  5EK0 A;  3U3B A;  4EBJ A;  5COM A;  3K66 A;  1M2O A;  3POV A;  4Q5S F;  1H9G A;  2J9B A;  2Z15 A;  2DI3 A;  3S84 A;  3CZ6 A;  3TUL A;  2J9U A;  5FCL A;  3RIP A;  3JTL O;  3DAG A;  3EFO B;  1ZHT A;  1HE1 A;  3EG9 A;  3HTK C;  3S28 A;  5JT4 A;  3FOP A;  4CS9 A;  1O5H A;  4KNW A;  2EPL X;  2OEV A;  1FNT c;  3ASO C;  1APC A;  1PD0 A;  1BDJ B;  3GOR A;  1N1C A;  1QLE C;  3SXM A;  1Z63 A;  1MNE A;  2W9Y A;  1QZX A;  2R7S A;  4EBK A;  4C3E A;  5KYX B;  3UGO A;  2XLD A;  2QNL A;  5AC4 A;  2G62 A;  2Y3H A;  1D1A A;  3I5P A;  4YL3 A;  1KNY A;  1ZHX A;  2NPU A;  4O79 A;  5E3A A;  2X51 A;  3K1I A;  1TQG A;  3HNI A;  1ZW2 A;  2HSQ A;  3FXH A;  3S29 A;  3SXY A;  1S7Z A;  1NSG B; 
#chains in the Genus database with same CATH homology
 5F5F A;  3EQL F;  3KL4 A;  3PHF 2;  3SYN A;  5HSW A;  3EHM A;  1V55 C;  2ZPA A;  1Z5Z A;  4JUR I;  2VB6 A;  1D0Y A;  2H7O A;  3QMK A;  3SP1 A;  2I8B A;  4U5G A;  3T6J A;  4C7O B;  2KJG A;  3EJN A;  3RH3 A;  4BJ6 C;  4ULW A;  5DVW A;  4Q7C A;  4IWB A;  1W2W A;  2IXM A;  2NUP A;  2NG1 A;  2VH3 A;  3AG4 C;  2E87 A;  3FDQ A;  2G3V A;  1TWA A;  3W8I A;  2G3K A;  2J0X A;  2BE5 F;  5F5H A;  3W2V A;  3DXJ F;  2WL8 A;  4CBE A;  2XXA A;  4GYT A;  1TWG A;  2V3C C;  4K7B A;  4AK9 A;  3B0U X;  4HFK B;  3Q7L A;  2Y69 C;  2KNH A;  3NDB B;  1BR4 A;  3JCU Q;  4LLE A;  1PD1 A;  2IXN A;  2C04 A;  4CS8 C;  2PX0 A;  3WG7 C;  1TWC A;  1J8M F;  3CSK A;  3F47 A;  4JVS A;  2EIM C;  1ZU4 A;  3ITF A;  1OCR C;  2QTV A;  5DS4 A;  4CIH A;  5DLJ A;  1M2V B;  3FVY A;  4JJG A;  3DJN B;  4CS7 A;  3LJB A;  1LKX A;  3I5Q A;  2MWQ A;  2J7P A;  5L3Q A;  4IAO A;  3B9Q A;  4YN0 B;  4O6Y A;  1LS1 A;  3EG9 B;  4HFF B;  2L81 A;  3DJU B;  4RD9 A;  4PJJ A;  4BJ5 A;  4AX2 A;  2CNW D;  3AG3 C;  2C03 A;  4YWQ A;  4J30 B;  1OKK D;  1VMA A;  3ABL C;  3N0T A;  3LS0 A;  3K33 A;  3UGP A;  3NKE A;  4PFO A;  3B0P A;  4YJW A;  5CI9 A;  3N24 A;  2R7U A;  2YHS A;  1VYK A;  1ZHW A;  4AE4 B;  3H65 A;  2IXO A;  4DOZ A;  4MND A;  2KQ9 A;  4JJF A;  3GOD A;  2CGE A;  3UMI A;  3OEO A;  3LNR A;  1NU9 C;  5KYU A;  1MMA A;  3SNH A;  3S0X A;  2W4M A;  2ZXR A;  3NKD A;  4O7G A;  2O9X A;  3EH1 A;  1MMD A;  4C3D A;  2B0J A;  3DM5 A;  4FWV A;  3RFY A;  3OA1 A;  5KYN A;  5DS6 A;  4CS9 C;  4I1M A;  2DGJ A;  1VYI A;  3Q6N A;  2R7V A;  3X2Q C;  1D0Z A;  4RDA A;  4PJL A;  5EHH A;  5DQT A;  3NYJ A;  1JPJ A;  2V26 A;  1ZHZ A;  4YT5 A;  3Q7G A;  2YZS A;  3V7O A;  4KI2 A;  3FAJ A;  3OWT A;  4YT8 A;  3X1O A;  3K1I C;  4KBL A;  1BR1 A;  2JD3 A;  2W45 A;  3SEO A;  4FX5 A;  4I44 A;  5B1B C;  3WOD F;  3AQC A;  3AQB A;  3K1H A;  3LES A;  1M57 C;  1MMG A;  3E70 C;  2GFH A;  3VAY A;  3AG1 C;  2R7R A;  4OD5 A;  3QZC A;  2PP4 A;  1Z23 A;  2Q9B A;  4WJ0 A;  3NRH A;  3M1C B;  3JYH A;  2XSE A;  1OCC C;  2J46 A;  3EGX A;  2WVN A;  2EIL C;  4I1O B;  3KKB A;  1IW7 F;  2Y3B A;  2W4B A;  2IXP A;  1FFH A;  3NYM A;  4G0H A;  3B0V C;  3LS1 A;  4KNV A;  4OIN F;  3EZI A;  4X0R A;  1MND A;  3TD7 A;  3SZR A;  1D1B A;  4DVZ A;  2WVO A;  4J32 B;  2J9V A;  4BEJ A;  3N2Z B;  3PMR A;  3ZC4 A;  2HV6 A;  4DBR A;  3EPV A;  1VK5 A;  5KYU B;  2KW3 C;  3MX3 A;  3W8H A;  4U5D E;  5KYY A;  1TR2 A;  2J45 A;  1FFT C;  4BJT A;  1D1C A;  4QDL A;  3EHN A;  3HJC A;  4JZA A;  4DBQ A;  2L9J A;  1VOM A;  5CI8 A;  2M4E A;  2Q9A A;  1NG1 A;  4C3B A;  1OCZ C;  4BJ5 C;  2A6H F;  2CDQ A;  5E3C A;  4XWJ A;  3LLI A;  2QY9 A;  2PFD A;  4K0D A;  2WVQ A;  4IRU A;  4LLC A;  2WZL A;  2ZXO A;  3JRT A;  4ZLC A;  1OCO C;  1RJ9 A;  4JCH A;  1FTS A;  3L34 A;  1NZE A;  3UR3 C;  3LAY A;  2EIJ C;  3KMI A;  3GAN A;  3FHD A;  2KGO A;  3W2W A;  4P6I C;  4PJM A;  2J0W A;  3UNG C;  1Z6A A;  3EGD A;  4YT4 A;  2J7P D;  2DYS C;  4M63 A;  2DYR C;  1WGW A;  4PFP A;  4DVY P;  2NUP B;  4NY3 A;  3VYW A;  5L3V A;  5T1D B;  4QI0 A;  5KYW A;  1SMY F;  3DD7 A;  3T6B A;  2NUT A;  4LAC B;  3RKO F;  5B3S C;  2R7O A;  4U5C E;  4U5F E;  2PX3 A;  2XXA B;  2IOQ A;  1MMN A;  3F46 A;  3K7D A;  3EGX B;  4BJ1 A;  4N06 A;  2YEV A;  3UMH A;  4XLP F;  3EZH A;  4I3M A;  2WZG A;  2Y3D A;  2FGY A;  4FES A;  1LVK A;  4OIP F;  4F4B A;  5BUO A;  4GEH A;  3MLG A;  3S27 A;  2D5R B;  2EIK C;  4AE4 A;  5IY5 C;  3ZIB A;  4ZLD A;  4XLN F;  3ZG1 A;  2IYL D;  3E9V A;  3JT1 A;  5EGY A;  3O6X A;  1ST6 A;  2P7V A;  4U5E E;  3DAF A;  4MQ9 F;  4BJ6 A;  4KC9 A;  5B1A C;  1FMW A;  4RBN A;  5DQZ A;  1D0X A;  3EFO A;  4G7O F;  2XL4 A;  4B6I A;  3DZA A;  5E33 A;  1ZU5 A;  2Q3T A;  1BR2 A;  5E2Q A;  2R7T A;  2FFH A;  2R7Q A;  5KYY B;  4W8K A;  5KYX A;  4E7Z A;  2R7X A;  1ZYR F;  3AG2 C;  5D91 A;  3UMK A;  2PF4 E;  3EH2 A;  4BG0 A;  2LSE A;  4U5B E;  3ECS A;  2A6E F;  2CNW A;  1FMV A;  3ZSU A;  2OCC C;  2A1D D;  4LER A;  3DM9 B;  1OKK A;  2Y39 A;  3ZVR A;  4CS8 A;  3NYL A;  4PJN A;  2H7B A;  2ZXW C;  1NU7 D;  3IEE A;  4IJJ A;  4E7S A;  2HV7 A;  1O87 A;  1Z3I X;  2XRH A;  4A2N B;  1SF8 A;  1RJ9 B;  4G7Z F;  2Y3G A;  1JPN A;  4CSA A;  2ZXP A;  4C7O A;  4H4K C;  3ABM C;  3NG1 A;  4O6N A;  3O39 A;  2OG2 A;  3ASN C;  1TWH A;  1TKN A;  3EGD B;  3DMD A;  4HEA J;  3HLZ A;  4CSA C;  4ANJ A;  5D92 A;  1IZM A;  4Q4Z F;  3JSZ A;  3Q6M A;  5KYW B;  3ABK C;  3CQZ A;  1KU2 A;  2NUT B;  2A68 F;  4G7H F;  3K6B A;  4EWC A;  4JW1 A;  1SZI A;  3KH2 A;  4YT2 A;  4OIO F;  3I4U A;  4O6M A;  4XTK A;  4PK4 A;  2VAS A;  4EBB A;  4OIR F;  4U5H A;  1V54 C;  2MYS A;  2EIN C;  1ZHY A;  5T3W A;  3RYL A;  2WZF A;  4QI2 A;  1J8Y F;  1M56 C;  5DS5 A;  1PCX A;  5T3T A;  2R7W A;  2P6V A;  2Q9C A;  3LEV A;  3LLK A;  2A69 F;  4OIQ F;  3L0I A;  4OD4 A;  1G8X A;  3T4R A;  2H7V C;  1M2V A;  2CW0 F;  2J9W A;  2WB7 A;  3POV A;  3K66 A;  1M2O A;  4Q5S F;  2Z15 A;  3CZ6 A;  2J9U A;  5FCL A;  3RIP A;  3S28 A;  3DAG A;  3EFO B;  1ZHT A;  3EG9 A;  3HTK C;  4CS9 A;  1O5H A;  4KNW A;  3ASO C;  1PD0 A;  1N1C A;  1QLE C;  1Z63 A;  1MNE A;  2W9Y A;  1QZX A;  2R7S A;  4C3E A;  5KYX B;  3UGO A;  2G62 A;  2Y3H A;  1D1A A;  3I5P A;  1ZHX A;  4O79 A;  5E3A A;  2X51 A;  3S29 A;  1S7Z A;  4HE8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...