1QQ3A

The solution structure of the heme binding variant arg98cys of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNAYHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title Structural consequences of b- to c-type heme conversion in oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qq3A00
4IB4A 1E85A 1CGNA 5JVEA 3ZTMA 1MQVA 4WGZA 2YLDA 2YL3A 5JRAA 4JEBA 4ER9A 5JLIA 4U9DA 1RCPA 2XL8A 3QVYA 2YLIA 5JS5A 2J9BA 4JE9A 2BC5A 4CDAA 1NBBA 1EKYA 2XLDA 1S05A 2XLWA 1YYJA 3L1MA 3QVZA 3QW0A 1A7VA 2YL7A 2XM4A 4CIPA 4CX9A 1E83A 3TOLA 3M79A 3DE9A 3FOPA 4N6HA 4IAQA 4L6RA 3ZWIA 4D4NA 3ZTZA 5B3IA 4CJGA 3M4BA 1GQAA 2YKZA 3IQ5A 1BBHA 4CDVA 4D4XA 3TOMA 2XL6A 4ULVA 4N4WA 1YYXA 3ZQYA 3HNKA 1QPUA 4IARA 2XLEA 2J8WA 3M4CA 3VRCA 4JKVA 1QQ3A 3C63A 2XLHA 256BA 1APCA 2YLGA 3ZQVA 2QLAA 3NMIA 3U8PA 2XLOA 3HNIA 4WGYA 3C62A 2CCYA 3M15A 3DE8A 2XLMA 3NMKA 3HNLA 2YL0A 1CPRA 4U9EA 5JSLA 3IQ6A 4JEAA 1YZAA 3HNJA 3FOOA 4NC3A 1CPQA 5JP7A 1LM3B 2XM0A 2YL1A 4CJOA 5JT4A 1YZCA 2XLVA 1E86A 1M6TA 1E84A 1CGOA 3NMJA 4CDYA 5AGFA 3QW1A 1JAFA 4EIYA 5JUAA
chains in the Genus database with same CATH superfamily
2CDQA 1CGNA 3NYJA 3LEOA 3MYIA 1VB5A 5JVEA 1OKKA 3EGDA 4JJFA 3ZTMA 4XQ1A 2WVOA 3W2VA 4DBQA 3UGOA 5DVWA 3T6JA 3AG1C 2YLDA 2OG2A 2Q4FA 4P9FA 3EG9A 1K04A 3GM1A 4ULWA 4AX2A 4CSAA 2G3KA 3HJCA 5JLIA 3BEHA 4U9DA 3EZIA 2XL8A 3HKKA 2J9BA 2KQ9A 1O87A 3NG1A 2BC5A 2D4UA 1SR2A 1SMYF 3DM9B 4XTKA 4MVRA 1Y4CA 2H8AA 2XLDA 4G78A 1OW6A 2EILC 3DMDA 3N2ZB 1S05A 2CNWA 1PCXA 2I8BA 2Y3BA 3ASNC 4LDKA 1YYJA 4U5DE 3JRMO 4G0HA 4KNWA 3QW0A 5K0IA 4FX5A 3K66A 4AL0A 2KW3C 2LIGA 1OW7A 2NSGA 2XM4A 3AJMA 3IQTA 5B1BC 1HE1A 1E83A 5KYUA 1ZW2A 4N06A 2EIMC 3EJNA 1TWCA 3DE9A 3FOPA 3CQZA 3X1OA 3TULA 1ORSC 3ABMC 3LLIA 4XPWA 1EQ1A 4JCHA 2IXMA 4CJGA 3M4BA 1LE4A 1IZMA 2LK4A 3O55A 4IRUA 1NU9C 3TD7A 1JR8A 2EIJC 1HMDA 1YARO 4HEAJ 3C18A 4CDVA 3MBGA 3S29A 4A2NB 2RSEB 1OR2A 3LNMB 1M2OA 3GEHA 4PR9A 3EHNA 3WAQA 4BJ5A 1ST6A 5T3WA 3RYLA 4LLEA 2R7QA 4EWCA 1KTMA 4IARA 3WHNA 3MLGA 4XPXA 3RQFA 1MNDA 1T9KA 2JX0A 3RVYA 5KYNA 3M1CB 4XPYA 3OA1A 3AOUA 3SXMA 3TK0A 5DQTA 1VLSA 2W4BA 5GPGB 2GAQA 2DI3A 2R7OA 3VRCA 4JTDB 4JKVA 1VTMP 2R7TA 1Z6AA 4FWVA 1LS1A 1OCCC 1BZ4A 2ZXPA 2VCBA 3RQEA 4PJLA 3ABKC 4XWJA 3S90A 2ASRA 1UG7A 2YLGA 1B68A 3ZQVA 1ZHYA 2A6HF 4EHPA 5IY5C 3POVA 2EPLX 1NFNA 5FZTA 1RMVA 3NKDA 2XS8A 3SP1A 1Z23A 3DM5A 3J06A 2BE5F 2CCYA 1G5ZA 1FMWA 1ORJA 2L6GA 4JC7A 2V3CC 4CIHA 3WODF 1C17M 4DVZA 2XLMA 2UUHA 3Q7GA 1L7CA 1K40A 3HNLA 4XEVA 2KYHA 1LVKA 2A6EF 2Y3GA 2O9XA 3EFOA 4DRIB 4MS2A 3IQ6A 4PJMA 3VM6A 5KYYA 2OU6A 1ZHZA 2A0BA 3FOOA 3PMRA 2DYRC 4JW1A 1Y6DA 2IXPA 5JP7A 4MW8A 2C04A 2XM0A 2PX3A 3T6GB 3T6BA 4I1MA 3UMKA 1W2WA 4CBEA 3EGXB 4JVSA 3GM2A 4OINF 2G62A 3JYHA 2GFHA 3AQBA 4PFOA 3ZIBA 4CS8C 5BUOA 1CGOA 2FFHA 3S9OA 1MNEA 2WZGA 1V54C 2NSFA 5HV9A 5KYWB 1NLXA 2P6VA 1OCOC 5AGFA 2XXAB 2OCCC 2J45A 1JAFA 1DOVA 2PP4A 2JPUA 5KYXA 5JUAA 5L3VA 3U5SA 3ASOC 3KYIA 3LUTB 2R7SA 3GEIA 2Y3DA 3U3BA 2QY9A 4H4KC 4EUKB 5EHHA 2WVNA 2OOCA 3C8ZA 3K33A 3A11A 2JD3A 3GEEA 2YQYA 1GGQA 1KNYA 3OWTA 4NQFA 4ER9A 3K1HA 1EI7A 3K1IA 2HJ3A 4MVMA 4J32B 1ZVZA 4JE9A 4YT2A 5B3SC 3SNHA 3U9JA 1KU2A 2D5RB 3SXZA 4BEMJ 4CDAA 2DB4A 1O3UA 2DGJA 2EPKX 4O7GA 4JRZA 4DRJB 3IQCA 1N1CA 1H9TA 1I4YA 2OEXA 3L1MA 4IGGA 1OQCA 5EK0A 2OJQA 2J7PD 3JTLO 2MWQA 2Q9AA 1RXQA 5COMA 2YL7A 5L0JA 2CYDA 3EH2A 1Q0MA 3S28A 2R7RA 1Z63A 4C7OB 3AQCA 4CX9A 4CIPA 4NTBA 3W2WA 3N24A 2R7UA 4PK4A 1AEPA 1FMVA 1NG1A 1V55C 1ZU5A 5CIVA 4J7YA 3JCUQ 2J0WA 3U8VA 1RKEB 1FAPB 1H6GA 3DWWA 3HLZA 5B1AC 2PF4E 4BEJA 4DXWA 4YT8A 2YKZA 2LQGA 3C7JA 3F47A 2R7WA 2P61A 2RD9A 1BBHA 2VH3A 3H2UA 3SYNA 3X2QC 4QI2A 3G4ZA 3TOMA 4JIOA 1MMGA 4N4WA 5FCLA 1LPEA 2Q3TA 1I5NA 3F46A 2L7AA 3V5XA 5A6BA 1C02A 1FFHA 3ITFA 3DKAA 3ZQYA 3UMIA 2J7PA 1QPUA 2A0UA 1Q0KA 2L6HA 5L0HA 2P0NA 1D0YA 5A69A 3B0VC 1AVOB 1WOLA 2XLEA 3KKBA 4U5BE 4AE4B 4ANJA 5KYUB 2PFDA 5COFA 3Q7LA 4MW3A 2J8WA 4PJNA 3M4CA 4EBKA 3NYMA 2LD6A 5E3AA 1RKCA 1R5ID 2A69F 2XL4A 4LDQA 3OEOA 5F28E 3B0PA 3KMIA 2XS1A 4HFKB 4E0HA 5EGYA 3C63A 4K7BA 5T1DB 1ZZPA 3DJUB 1TR2A 2WL8A 1GM5A 2H7OA 1LI7A 2YWAA 1RJ9A 2AP3A 4O6MA 4I1OB 1YLMA 2EPMX 1Q0GA 2QLAA 3A9CA 4JTAB 2Q7RA 3RW0A 3O10A 2XLOA 3LNRA 1SF8A 2IOQA 4AK9A 4ZLCA 2ICWG 1TFOB 5L3QA 1D0ZA 1NFOA 3C62A 1R4TA 5BQGA 3R7CA 2R05A 2YVKA 3I5PA 1OXKA 3M15A 3W4YA 4BG0A 2KK1A 2TMVP 1M2VB 4C3DA 4KI2A 2H7VC 4U5FE 3UNGC 3JSEO 3O39A 1HY5A 2WZFA 3DE8A 5E33A 3T4RA 4BJ6C 3EQLF 2J9UA 1VOMA 2P7VA 3VAYA 4E0IA 1A0BA 3VF0A 3JRTA 3ZG1A 3EGDB 5DQZA 2G3VA 3LJBA 3E70C 5JSLA 1AUEA 3W8IA 3U2LA 4PFPA 1MMDA 2HS5A 1YZAA 4JEAA 2LCHA 2ZPAA 1J8YF 1CPQA 3EG9B 5L0CA 1LM3B 4DOZA 1WATA 2YL1A 4YL1A 4CJOA 5JT4A 1SZIA 4B6IA 4JURI 4QI0A 2VB6A 2NUTA 3RQGA 2VASA 1ZHTA 4KBLA 5AC5A 1E84A 1CGME 2NG1A 4MQ9F 1G8XA 4G7OF 4OIRF 3V7OA 4F4BA 3DD7A 3U3FA 4HE8D 2VCAA 2WB7A 1Z7Qc 5L0IA 3SXYA 2QE9A 4O79A 2R7VA 1VMAA 2Q9BA 3FMSA 3KYJA 4IB4A 4WABA 5F5HA 1EA8A 3JZ0A 3ZC4A 3GWNA 1E85A 3NDBB 2CGEA 2F22A 3TJ5A 3FDQA 2R02A 3GANA 3L8IA 1MQVA 5TJ5E 2NPUA 3AGTA 3L34A 4Z9IA 3EZHA 3K6BA 1FFTC 4JEBA 3KL4A 4U5HA 4GEHA 4AL1A 1PV3A 2P1AA 1RCPA 1A41A 4CS8A 3S27A 2BL2A 2L81A 2WZLA 2LSEA 3IHUA 1NBBA 3PDMP 1T01A 3LS0A 4E17A 1OXBA 2W45A 2XLWA 2HFIA 3NRHA 3QVZA 3C8GB 1G4US 3DJNB 4MTOA 1A7VA 2WVQA 3FAPB 3B29A 3G4XA 3R2PA 4I44A 4JTCB 3RF3A 4UDVA 2R9RB 2KC3A 3GWLA 1T6IA 1ZHXA 3O6XA 1LI5A 1D1BA 4NCQA 4LDRA 3TOLA 1BR2A 2IXNA 2IYLD 4N6HA 4IAQA 1WTYA 1HW1A 2QUPA 4U5EE 4E7ZA 2HV6A 1A7EA 2OKUA 2XRHA 4L6RA 4MTFA 3ZTZA 4D4NA 5B3IA 1G4WR 2AWCA 4EBBA 3GM3A 3CSKA 2AVKA 1HE9A 2KSFA 2L6FA 2VC9A 2HMZA 3MFNA 2OEVA 4FAPB 4MVQA 2E87A 2J46A 2VCCA 3S0XA 4J7TA 3ZSUA 1ZYRF 4DVYP 4JCZA 4ULVA 1YVIA 3AG2C 2X0CA 1YJGA 3EPVA 1JMWA 1TFKB 3CEXA 3Q6MA 4IAOA 4U5GA 3E9VA 5CI8A 1S7ZA 2OQMA 1D0XA 3NKEA 5D91A 2EPOA 3JT1A 4BPMA 1M56C 4A4AA 4YWQA 3UMHA 1ORYA 1QSPA 1F1MA 4ONSA 2LP4A 4XLNF 2KNHA 3KPHA 5BQIA 3LS1A 2YHSA 1YA7O 2QTVA 2HKVA 2W4MA 2XLHA 3EH1A 1LE2A 1WN0A 3EHMA 3DAGA 4NTAA 1Z5ZA 2MHRA 3SEOA 3T9OA 3HNIA 2YZSA 1U89A 2Q00A 1SYQA 2NUPB 5COGA 2X51A 2ZXWC 3I4UA 2FGYA 1ZW3A 1LIHA 1FTSA 2A68F 3BRJA 3ABLC 4FESA 4E7SA 4PJJA 5DS6A 5L0FA 3AG4C 1NZEA 4RDAA 4NY3A 3DAFA 2DYSC 4JZAA 3SZRA 1T6UA 4Q7CA 2GWWA 3CAXA 2ZXRA 3H65A 2IM8A 4PACA 5KYXB 2YL0A 3LEVA 1CPRA 1TQGA 2CW0F 3ATPA 3GORA 4MTGA 2UUIA 4XEKA 4DJ9A 3Q6NA 2J0XA 2J9WA 3PCVA 4R32A 4U9EA 3U0CA 4YT4A 1PD1A 2KGOA 2R03A 4NC3A 3I5QA 3HTKC 1K05A 5L0GA 3U9MA 3LAYA 4IWBA 4H54A 1V4AA 1YZCA 3RFYA 1V74B 1BDJB 1TWHA 2Y3HA 4YT5A 1E86A 4KNVA 4CSAC 1M6TA 1BR1A 3LLKA 4BJ6A 4MVOA 3B71A 1OW8A 2C03A 1JRAA 5DLJA 4OIPF 4EBJA 1XZPA 3FAJA 5CI9A 4CDYA 4GQHA 1JPNA 3C8GD 3H2VA 1JPJA 2EINC 2MYSA 3QW1A 4GYTA 5A6AA 4N6CA 4OIOF 3GODA 4CS9A 1J8MF 2LFDA 1LKXA 1TWAA 4E18A 4O6NA 1TWGA 3LESA 1XZQA 2AWYA 2A1DD 4EKWA 1H7IA 4W8KA 4HFFB 4WGZA 1E2XA 3UGPA 4K1OA 5F5FA 2YL3A 3N0TA 4RD9A 4IJJA 5JRAA 1YAUO 5DS5A 3FXHA 1PD0A 4YL3A 3MYFA 3QVYA 4YN0B 2YLIA 3TJ6A 4C3BA 5JS5A 3B0UX 3QTHA 3EGXA 2FAPB 3S84A 1EKYA 4WJ0A 4G7HF 1HMOA 1VYIA 1I4ZA 4ZLDA 3C8GA 3QMKA 5KYWA 4OD4A 4X0RA 2HMQA 2XXAA 1YA9A 2J9VA 2PX0A 1H9GA 4BJ5C 2Q9CA 3V5YA 3US6A 4CS7A 2HSQA 3AGUA 1OR3A 1MMNA 2L9JA 3AG3C 4RBNA 5T3TA 1T5OA 3M79A 1XWJA 5A6JA 1NSGB 1O5HA 2M4EA 4OD5A 3PHF2 1D1AA 5BQHA 1HW2A 4LERA 4XLPF 4OIQF 3SXKA 3ZWIA 2W9YA 3CZ6A 4YJWA 2AU5A 1GQAA 1RJ9B 3IQ5A 5L0DA 5E3CA 1WGWA 5AC4A 4D4XA 1WASA 2XL6A 3NYLA 1QKRA 1WWPA 1LS4A 3FVYA 4NTFA 2B0JA 4G7ZF 1M57C 1YYXA 3RKOF 3HNKA 3KH2A 1BR4A 4M63A 1T6QA 4XEFA 2YEVA 5A6KA 2EPNA 4I3MA 4LLCA 2PBEA 2HSBA 3FHDA 4J30B 4Z9HA 1U6HA 1U0BB 4C7OA 1ZHWA 3DXJF 1TKNA 4BJTA 4MNDA 3RIPA 3IEEA 1QQ3A 3ECSA 3VYWA 2QNLA 1VK5A 2ETSA 4YK5A 4DRHB 1NU7D 2ZD9A 1RKEA 3DZAA 256BA 2HV7A 1APCA 2Z15A 4BJ1A 4Q5SF 2HUJA 3DI5A 3NMIA 3U8PA 1YDIA 1UFBA 4QDLA 1IW7F 2GDCA 1Q0DA 3L0IA 2NUPA 3ZVRA 4WGYA 2R7XA 4MVZA 2EIKC 4KC9A 2HZ8A 2NUTB 3MX3A 2PNOA 3ZDLA 2XSEA 2KJGA 2H7BA 1OCZC 2B0HA 3W8HA 4JJGA 2Y69C 4CS9C 1FR0A 1Q0FA 3RH3A 2YRFA 5D92A 4AE4A 1QZXA 2GA0A 3NMKA 3RVZA 4P9TA 3U2MA 4YL0A 1DOWA 1MMAA 4U5CE 1C03A 2OJED 3V5ZA 1JOGA 1FNTc 2R25A 2IBFA 1VYKA 3EFOB 1OCRC 4K0DA 1OKKD 5E2QA 2IXOA 2ZXOA 2LFFA 3HNJA 4MVUA 4O6YA 5KYYB 3K7DA 1GS9A 1Z3IX 2M64A 1ZU4A 3IPMO 3JYYA 3TQOA 2XLVA 2V26A 4DBRA 3QZCA 3WG7C 3K1IC 1VLTA 4P6IC 1QLEC 3UR3C 3JSZA 4Z9JA 2Y39A 1QVXA 3G50A 2HJMA 4LACB 1M2VA 5A6BD 4MVSA 1D1CA 1L3PA 2CNWD 3B9QA 3NMJA 2I15A 4C3EA 4W8PA 5HSWA 5DS4A 1A7DA 4EIYA 4Q4ZF 3L8JA
chains in the Genus database with same CATH topology
4IB4A 1E85A 1CGNA 5JVEA 3ZTMA 1MQVA 4WGZA 2YLDA 2YL3A 5JRAA 4JEBA 4ER9A 5JLIA 4U9DA 1RCPA 2XL8A 3QVYA 2YLIA 5JS5A 2J9BA 4JE9A 2BC5A 4CDAA 1NBBA 1EKYA 2XLDA 1S05A 2XLWA 1YYJA 3L1MA 3QVZA 3QW0A 1A7VA 2YL7A 2XM4A 4CIPA 4CX9A 1E83A 3TOLA 3M79A 3DE9A 3FOPA 4N6HA 4IAQA 4L6RA 3ZWIA 4D4NA 3ZTZA 5B3IA 4CJGA 3M4BA 1GQAA 2YKZA 3IQ5A 1BBHA 4CDVA 4D4XA 3TOMA 2XL6A 4ULVA 4N4WA 1YYXA 3ZQYA 3HNKA 1QPUA 4IARA 2XLEA 2J8WA 3M4CA 3VRCA 4JKVA 1QQ3A 3C63A 2XLHA 256BA 1APCA 2YLGA 3ZQVA 2QLAA 3NMIA 3U8PA 2XLOA 3HNIA 4WGYA 3C62A 2CCYA 3M15A 3DE8A 2XLMA 3NMKA 3HNLA 2YL0A 1CPRA 4U9EA 5JSLA 3IQ6A 4JEAA 1YZAA 3HNJA 3FOOA 4NC3A 1CPQA 5JP7A 1LM3B 2XM0A 2YL1A 4CJOA 5JT4A 1YZCA 2XLVA 1E86A 1M6TA 1E84A 1CGOA 3NMJA 4CDYA 5AGFA 3QW1A 1JAFA 4EIYA 5JUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IB4 A;  1E85 A;  1CGN A;  5JVE A;  3ZTM A;  1MQV A;  4WGZ A;  2YLD A;  2YL3 A;  5JRA A;  4JEB A;  4ER9 A;  5JLI A;  4U9D A;  1RCP A;  2XL8 A;  3QVY A;  2YLI A;  5JS5 A;  2J9B A;  4JE9 A;  2BC5 A;  4CDA A;  1NBB A;  1EKY A;  2XLD A;  1S05 A;  2XLW A;  1YYJ A;  3L1M A;  3QVZ A;  3QW0 A;  1A7V A;  2YL7 A;  2XM4 A;  4CIP A;  4CX9 A;  1E83 A;  3TOL A;  3M79 A;  3DE9 A;  3FOP A;  4N6H A;  4IAQ A;  4L6R A;  3ZWI A;  4D4N A;  3ZTZ A;  5B3I A;  4CJG A;  3M4B A;  1GQA A;  2YKZ A;  3IQ5 A;  1BBH A;  4CDV A;  4D4X A;  3TOM A;  2XL6 A;  4ULV A;  4N4W A;  1YYX A;  3ZQY A;  3HNK A;  1QPU A;  4IAR A;  2XLE A;  2J8W A;  3M4C A;  3VRC A;  4JKV A;  1QQ3 A;  3C63 A;  2XLH A;  256B A;  1APC A;  2YLG A;  3ZQV A;  2QLA A;  3NMI A;  3U8P A;  2XLO A;  3HNI A;  4WGY A;  3C62 A;  2CCY A;  3M15 A;  3DE8 A;  2XLM A;  3NMK A;  3HNL A;  2YL0 A;  1CPR A;  4U9E A;  5JSL A;  3IQ6 A;  4JEA A;  1YZA A;  3HNJ A;  3FOO A;  4NC3 A;  1CPQ A;  5JP7 A;  1LM3 B;  2XM0 A;  2YL1 A;  4CJO A;  5JT4 A;  1YZC A;  2XLV A;  1E86 A;  1M6T A;  1E84 A;  1CGO A;  3NMJ A;  4CDY A;  5AGF A;  3QW1 A;  1JAF A;  4EIY A;  5JUA A; 
#chains in the Genus database with same CATH topology
 2CDQ A;  1CGN A;  3NYJ A;  3LEO A;  3MYI A;  1VB5 A;  5JVE A;  1OKK A;  3EGD A;  4JJF A;  3ZTM A;  4XQ1 A;  2WVO A;  3W2V A;  4DBQ A;  3UGO A;  5DVW A;  3T6J A;  3AG1 C;  2YLD A;  2OG2 A;  2Q4F A;  4P9F A;  3EG9 A;  1K04 A;  3GM1 A;  4ULW A;  4AX2 A;  4CSA A;  2G3K A;  3HJC A;  5JLI A;  3BEH A;  4U9D A;  3EZI A;  2XL8 A;  3HKK A;  2J9B A;  2KQ9 A;  1O87 A;  3NG1 A;  2BC5 A;  2D4U A;  1SR2 A;  1SMY F;  3DM9 B;  4XTK A;  4MVR A;  1Y4C A;  2H8A A;  2XLD A;  4G78 A;  1OW6 A;  2EIL C;  3DMD A;  3N2Z B;  1S05 A;  2CNW A;  1PCX A;  2I8B A;  2Y3B A;  3ASN C;  4LDK A;  1YYJ A;  4U5D E;  3JRM O;  4G0H A;  4KNW A;  3QW0 A;  5K0I A;  4FX5 A;  3K66 A;  4AL0 A;  2KW3 C;  2LIG A;  1OW7 A;  2NSG A;  2XM4 A;  3AJM A;  3IQT A;  5B1B C;  1HE1 A;  1E83 A;  5KYU A;  1ZW2 A;  4N06 A;  2EIM C;  3EJN A;  1TWC A;  3DE9 A;  3FOP A;  3CQZ A;  3X1O A;  3TUL A;  1ORS C;  3ABM C;  3LLI A;  4XPW A;  1EQ1 A;  4JCH A;  2IXM A;  4CJG A;  3M4B A;  1LE4 A;  1IZM A;  2LK4 A;  3O55 A;  4IRU A;  1NU9 C;  3TD7 A;  1JR8 A;  2EIJ C;  1HMD A;  1YAR O;  4HEA J;  3C18 A;  4CDV A;  3MBG A;  3S29 A;  4A2N B;  2RSE B;  1OR2 A;  3LNM B;  1M2O A;  3GEH A;  4PR9 A;  3EHN A;  3WAQ A;  4BJ5 A;  1ST6 A;  5T3W A;  3RYL A;  4LLE A;  2R7Q A;  4EWC A;  1KTM A;  4IAR A;  3WHN A;  3MLG A;  4XPX A;  3RQF A;  1MND A;  1T9K A;  2JX0 A;  3RVY A;  5KYN A;  3M1C B;  4XPY A;  3OA1 A;  3AOU A;  3SXM A;  3TK0 A;  5DQT A;  1VLS A;  2W4B A;  5GPG B;  2GAQ A;  2DI3 A;  2R7O A;  3VRC A;  4JTD B;  4JKV A;  1VTM P;  2R7T A;  1Z6A A;  4FWV A;  1LS1 A;  1OCC C;  1BZ4 A;  2ZXP A;  2VCB A;  3RQE A;  4PJL A;  3ABK C;  4XWJ A;  3S90 A;  2ASR A;  1UG7 A;  2YLG A;  1B68 A;  3ZQV A;  1ZHY A;  2A6H F;  4EHP A;  5IY5 C;  3POV A;  2EPL X;  1NFN A;  5FZT A;  1RMV A;  3NKD A;  2XS8 A;  3SP1 A;  1Z23 A;  3DM5 A;  3J06 A;  2BE5 F;  2CCY A;  1G5Z A;  1FMW A;  1ORJ A;  2L6G A;  4JC7 A;  2V3C C;  4CIH A;  3WOD F;  1C17 M;  4DVZ A;  2XLM A;  2UUH A;  3Q7G A;  1L7C A;  1K40 A;  3HNL A;  4XEV A;  2KYH A;  1LVK A;  2A6E F;  2Y3G A;  2O9X A;  3EFO A;  4DRI B;  4MS2 A;  3IQ6 A;  4PJM A;  3VM6 A;  5KYY A;  2OU6 A;  1ZHZ A;  2A0B A;  3FOO A;  3PMR A;  2DYR C;  4JW1 A;  1Y6D A;  2IXP A;  5JP7 A;  4MW8 A;  2C04 A;  2XM0 A;  2PX3 A;  3T6G B;  3T6B A;  4I1M A;  3UMK A;  1W2W A;  4CBE A;  3EGX B;  4JVS A;  3GM2 A;  4OIN F;  2G62 A;  3JYH A;  2GFH A;  3AQB A;  4PFO A;  3ZIB A;  4CS8 C;  5BUO A;  1CGO A;  2FFH A;  3S9O A;  1MNE A;  2WZG A;  1V54 C;  2NSF A;  5HV9 A;  5KYW B;  1NLX A;  2P6V A;  1OCO C;  5AGF A;  2XXA B;  2OCC C;  2J45 A;  1JAF A;  1DOV A;  2PP4 A;  2JPU A;  5KYX A;  5JUA A;  5L3V A;  3U5S A;  3ASO C;  3KYI A;  3LUT B;  2R7S A;  3GEI A;  2Y3D A;  3U3B A;  2QY9 A;  4H4K C;  4EUK B;  5EHH A;  2WVN A;  2OOC A;  3C8Z A;  3K33 A;  3A11 A;  2JD3 A;  3GEE A;  2YQY A;  1GGQ A;  1KNY A;  3OWT A;  4NQF A;  4ER9 A;  3K1H A;  1EI7 A;  3K1I A;  2HJ3 A;  4MVM A;  4J32 B;  1ZVZ A;  4JE9 A;  4YT2 A;  5B3S C;  3SNH A;  3U9J A;  1KU2 A;  2D5R B;  3SXZ A;  4BEM J;  4CDA A;  2DB4 A;  1O3U A;  2DGJ A;  2EPK X;  4O7G A;  4JRZ A;  4DRJ B;  3IQC A;  1N1C A;  1H9T A;  1I4Y A;  2OEX A;  3L1M A;  4IGG A;  1OQC A;  5EK0 A;  2OJQ A;  2J7P D;  3JTL O;  2MWQ A;  2Q9A A;  1RXQ A;  5COM A;  2YL7 A;  5L0J A;  2CYD A;  3EH2 A;  1Q0M A;  3S28 A;  2R7R A;  1Z63 A;  4C7O B;  3AQC A;  4CX9 A;  4CIP A;  4NTB A;  3W2W A;  3N24 A;  2R7U A;  4PK4 A;  1AEP A;  1FMV A;  1NG1 A;  1V55 C;  1ZU5 A;  5CIV A;  4J7Y A;  3JCU Q;  2J0W A;  3U8V A;  1RKE B;  1FAP B;  1H6G A;  3DWW A;  3HLZ A;  5B1A C;  2PF4 E;  4BEJ A;  4DXW A;  4YT8 A;  2YKZ A;  2LQG A;  3C7J A;  3F47 A;  2R7W A;  2P61 A;  2RD9 A;  1BBH A;  2VH3 A;  3H2U A;  3SYN A;  3X2Q C;  4QI2 A;  3G4Z A;  3TOM A;  4JIO A;  1MMG A;  4N4W A;  5FCL A;  1LPE A;  2Q3T A;  1I5N A;  3F46 A;  2L7A A;  3V5X A;  5A6B A;  1C02 A;  1FFH A;  3ITF A;  3DKA A;  3ZQY A;  3UMI A;  2J7P A;  1QPU A;  2A0U A;  1Q0K A;  2L6H A;  5L0H A;  2P0N A;  1D0Y A;  5A69 A;  3B0V C;  1AVO B;  1WOL A;  2XLE A;  3KKB A;  4U5B E;  4AE4 B;  4ANJ A;  5KYU B;  2PFD A;  5COF A;  3Q7L A;  4MW3 A;  2J8W A;  4PJN A;  3M4C A;  4EBK A;  3NYM A;  2LD6 A;  5E3A A;  1RKC A;  1R5I D;  2A69 F;  2XL4 A;  4LDQ A;  3OEO A;  5F28 E;  3B0P A;  3KMI A;  2XS1 A;  4HFK B;  4E0H A;  5EGY A;  3C63 A;  4K7B A;  5T1D B;  1ZZP A;  3DJU B;  1TR2 A;  2WL8 A;  1GM5 A;  2H7O A;  1LI7 A;  2YWA A;  1RJ9 A;  2AP3 A;  4O6M A;  4I1O B;  1YLM A;  2EPM X;  1Q0G A;  2QLA A;  3A9C A;  4JTA B;  2Q7R A;  3RW0 A;  3O10 A;  2XLO A;  3LNR A;  1SF8 A;  2IOQ A;  4AK9 A;  4ZLC A;  2ICW G;  1TFO B;  5L3Q A;  1D0Z A;  1NFO A;  3C62 A;  1R4T A;  5BQG A;  3R7C A;  2R05 A;  2YVK A;  3I5P A;  1OXK A;  3M15 A;  3W4Y A;  4BG0 A;  2KK1 A;  2TMV P;  1M2V B;  4C3D A;  4KI2 A;  2H7V C;  4U5F E;  3UNG C;  3JSE O;  3O39 A;  1HY5 A;  2WZF A;  3DE8 A;  5E33 A;  3T4R A;  4BJ6 C;  3EQL F;  2J9U A;  1VOM A;  2P7V A;  3VAY A;  4E0I A;  1A0B A;  3VF0 A;  3JRT A;  3ZG1 A;  3EGD B;  5DQZ A;  2G3V A;  3LJB A;  3E70 C;  5JSL A;  1AUE A;  3W8I A;  3U2L A;  4PFP A;  1MMD A;  2HS5 A;  1YZA A;  4JEA A;  2LCH A;  2ZPA A;  1J8Y F;  1CPQ A;  3EG9 B;  5L0C A;  1LM3 B;  4DOZ A;  1WAT A;  2YL1 A;  4YL1 A;  4CJO A;  5JT4 A;  1SZI A;  4B6I A;  4JUR I;  4QI0 A;  2VB6 A;  2NUT A;  3RQG A;  2VAS A;  1ZHT A;  4KBL A;  5AC5 A;  1E84 A;  1CGM E;  2NG1 A;  4MQ9 F;  1G8X A;  4G7O F;  4OIR F;  3V7O A;  4F4B A;  3DD7 A;  3U3F A;  4HE8 D;  2VCA A;  2WB7 A;  1Z7Q c;  5L0I A;  3SXY A;  2QE9 A;  4O79 A;  2R7V A;  1VMA A;  2Q9B A;  3FMS A;  3KYJ A;  4IB4 A;  4WAB A;  5F5H A;  1EA8 A;  3JZ0 A;  3ZC4 A;  3GWN A;  1E85 A;  3NDB B;  2CGE A;  2F22 A;  3TJ5 A;  3FDQ A;  2R02 A;  3GAN A;  3L8I A;  1MQV A;  5TJ5 E;  2NPU A;  3AGT A;  3L34 A;  4Z9I A;  3EZH A;  3K6B A;  1FFT C;  4JEB A;  3KL4 A;  4U5H A;  4GEH A;  4AL1 A;  1PV3 A;  2P1A A;  1RCP A;  1A41 A;  4CS8 A;  3S27 A;  2BL2 A;  2L81 A;  2WZL A;  2LSE A;  3IHU A;  1NBB A;  3PDM P;  1T01 A;  3LS0 A;  4E17 A;  1OXB A;  2W45 A;  2XLW A;  2HFI A;  3NRH A;  3QVZ A;  3C8G B;  1G4U S;  3DJN B;  4MTO A;  1A7V A;  2WVQ A;  3FAP B;  3B29 A;  3G4X A;  3R2P A;  4I44 A;  4JTC B;  3RF3 A;  4UDV A;  2R9R B;  2KC3 A;  3GWL A;  1T6I A;  1ZHX A;  3O6X A;  1LI5 A;  1D1B A;  4NCQ A;  4LDR A;  3TOL A;  1BR2 A;  2IXN A;  2IYL D;  4N6H A;  4IAQ A;  1WTY A;  1HW1 A;  2QUP A;  4U5E E;  4E7Z A;  2HV6 A;  1A7E A;  2OKU A;  2XRH A;  4L6R A;  4MTF A;  3ZTZ A;  4D4N A;  5B3I A;  1G4W R;  2AWC A;  4EBB A;  3GM3 A;  3CSK A;  2AVK A;  1HE9 A;  2KSF A;  2L6F A;  2VC9 A;  2HMZ A;  3MFN A;  2OEV A;  4FAP B;  4MVQ A;  2E87 A;  2J46 A;  2VCC A;  3S0X A;  4J7T A;  3ZSU A;  1ZYR F;  4DVY P;  4JCZ A;  4ULV A;  1YVI A;  3AG2 C;  2X0C A;  1YJG A;  3EPV A;  1JMW A;  1TFK B;  3CEX A;  3Q6M A;  4IAO A;  4U5G A;  3E9V A;  5CI8 A;  1S7Z A;  2OQM A;  1D0X A;  3NKE A;  5D91 A;  2EPO A;  3JT1 A;  4BPM A;  1M56 C;  4A4A A;  4YWQ A;  3UMH A;  1ORY A;  1QSP A;  1F1M A;  4ONS A;  2LP4 A;  4XLN F;  2KNH A;  3KPH A;  5BQI A;  3LS1 A;  2YHS A;  1YA7 O;  2QTV A;  2HKV A;  2W4M A;  2XLH A;  3EH1 A;  1LE2 A;  1WN0 A;  3EHM A;  3DAG A;  4NTA A;  1Z5Z A;  2MHR A;  3SEO A;  3T9O A;  3HNI A;  2YZS A;  1U89 A;  2Q00 A;  1SYQ A;  2NUP B;  5COG A;  2X51 A;  2ZXW C;  3I4U A;  2FGY A;  1ZW3 A;  1LIH A;  1FTS A;  2A68 F;  3BRJ A;  3ABL C;  4FES A;  4E7S A;  4PJJ A;  5DS6 A;  5L0F A;  3AG4 C;  1NZE A;  4RDA A;  4NY3 A;  3DAF A;  2DYS C;  4JZA A;  3SZR A;  1T6U A;  4Q7C A;  2GWW A;  3CAX A;  2ZXR A;  3H65 A;  2IM8 A;  4PAC A;  5KYX B;  2YL0 A;  3LEV A;  1CPR A;  1TQG A;  2CW0 F;  3ATP A;  3GOR A;  4MTG A;  2UUI A;  4XEK A;  4DJ9 A;  3Q6N A;  2J0X A;  2J9W A;  3PCV A;  4R32 A;  4U9E A;  3U0C A;  4YT4 A;  1PD1 A;  2KGO A;  2R03 A;  4NC3 A;  3I5Q A;  3HTK C;  1K05 A;  5L0G A;  3U9M A;  3LAY A;  4IWB A;  4H54 A;  1V4A A;  1YZC A;  3RFY A;  1V74 B;  1BDJ B;  1TWH A;  2Y3H A;  4YT5 A;  1E86 A;  4KNV A;  4CSA C;  1M6T A;  1BR1 A;  3LLK A;  4BJ6 A;  4MVO A;  3B71 A;  1OW8 A;  2C03 A;  1JRA A;  5DLJ A;  4OIP F;  4EBJ A;  1XZP A;  3FAJ A;  5CI9 A;  4CDY A;  4GQH A;  1JPN A;  3C8G D;  3H2V A;  1JPJ A;  2EIN C;  2MYS A;  3QW1 A;  4GYT A;  5A6A A;  4N6C A;  4OIO F;  3GOD A;  4CS9 A;  1J8M F;  2LFD A;  1LKX A;  1TWA A;  4E18 A;  4O6N A;  1TWG A;  3LES A;  1XZQ A;  2AWY A;  2A1D D;  4EKW A;  1H7I A;  4W8K A;  4HFF B;  4WGZ A;  1E2X A;  3UGP A;  4K1O A;  5F5F A;  2YL3 A;  3N0T A;  4RD9 A;  4IJJ A;  5JRA A;  1YAU O;  5DS5 A;  3FXH A;  1PD0 A;  4YL3 A;  3MYF A;  3QVY A;  4YN0 B;  2YLI A;  3TJ6 A;  4C3B A;  5JS5 A;  3B0U X;  3QTH A;  3EGX A;  2FAP B;  3S84 A;  1EKY A;  4WJ0 A;  4G7H F;  1HMO A;  1VYI A;  1I4Z A;  4ZLD A;  3C8G A;  3QMK A;  5KYW A;  4OD4 A;  4X0R A;  2HMQ A;  2XXA A;  1YA9 A;  2J9V A;  2PX0 A;  1H9G A;  4BJ5 C;  2Q9C A;  3V5Y A;  3US6 A;  4CS7 A;  2HSQ A;  3AGU A;  1OR3 A;  1MMN A;  2L9J A;  3AG3 C;  4RBN A;  5T3T A;  1T5O A;  3M79 A;  1XWJ A;  5A6J A;  1NSG B;  1O5H A;  2M4E A;  4OD5 A;  3PHF 2;  1D1A A;  5BQH A;  1HW2 A;  4LER A;  4XLP F;  4OIQ F;  3SXK A;  3ZWI A;  2W9Y A;  3CZ6 A;  4YJW A;  2AU5 A;  1GQA A;  1RJ9 B;  3IQ5 A;  5L0D A;  5E3C A;  1WGW A;  5AC4 A;  4D4X A;  1WAS A;  2XL6 A;  3NYL A;  1QKR A;  1WWP A;  1LS4 A;  3FVY A;  4NTF A;  2B0J A;  4G7Z F;  1M57 C;  1YYX A;  3RKO F;  3HNK A;  3KH2 A;  1BR4 A;  4M63 A;  1T6Q A;  4XEF A;  2YEV A;  5A6K A;  2EPN A;  4I3M A;  4LLC A;  2PBE A;  2HSB A;  3FHD A;  4J30 B;  4Z9H A;  1U6H A;  1U0B B;  4C7O A;  1ZHW A;  3DXJ F;  1TKN A;  4BJT A;  4MND A;  3RIP A;  3IEE A;  1QQ3 A;  3ECS A;  3VYW A;  2QNL A;  1VK5 A;  2ETS A;  4YK5 A;  4DRH B;  1NU7 D;  2ZD9 A;  1RKE A;  3DZA A;  256B A;  2HV7 A;  1APC A;  2Z15 A;  4BJ1 A;  4Q5S F;  2HUJ A;  3DI5 A;  3NMI A;  3U8P A;  1YDI A;  1UFB A;  4QDL A;  1IW7 F;  2GDC A;  1Q0D A;  3L0I A;  2NUP A;  3ZVR A;  4WGY A;  2R7X A;  4MVZ A;  2EIK C;  4KC9 A;  2HZ8 A;  2NUT B;  3MX3 A;  2PNO A;  3ZDL A;  2XSE A;  2KJG A;  2H7B A;  1OCZ C;  2B0H A;  3W8H A;  4JJG A;  2Y69 C;  4CS9 C;  1FR0 A;  1Q0F A;  3RH3 A;  2YRF A;  5D92 A;  4AE4 A;  1QZX A;  2GA0 A;  3NMK A;  3RVZ A;  4P9T A;  3U2M A;  4YL0 A;  1DOW A;  1MMA A;  4U5C E;  1C03 A;  2OJE D;  3V5Z A;  1JOG A;  1FNT c;  2R25 A;  2IBF A;  1VYK A;  3EFO B;  1OCR C;  4K0D A;  1OKK D;  5E2Q A;  2IXO A;  2ZXO A;  2LFF A;  3HNJ A;  4MVU A;  4O6Y A;  5KYY B;  3K7D A;  1GS9 A;  1Z3I X;  2M64 A;  1ZU4 A;  3IPM O;  3JYY A;  3TQO A;  2XLV A;  2V26 A;  4DBR A;  3QZC A;  3WG7 C;  3K1I C;  1VLT A;  4P6I C;  1QLE C;  3UR3 C;  3JSZ A;  4Z9J A;  2Y39 A;  1QVX A;  3G50 A;  2HJM A;  4LAC B;  1M2V A;  5A6B D;  4MVS A;  1D1C A;  1L3P A;  2CNW D;  3B9Q A;  3NMJ A;  2I15 A;  4C3E A;  4W8P A;  5HSW A;  5DS4 A;  1A7D A;  4EIY A;  4Q4Z F;  3L8J A; 
#chains in the Genus database with same CATH homology
 4IB4 A;  1E85 A;  1CGN A;  5JVE A;  3ZTM A;  1MQV A;  4WGZ A;  2YLD A;  2YL3 A;  5JRA A;  4JEB A;  4ER9 A;  5JLI A;  4U9D A;  1RCP A;  2XL8 A;  3QVY A;  2YLI A;  5JS5 A;  2J9B A;  4JE9 A;  2BC5 A;  4CDA A;  1NBB A;  1EKY A;  2XLD A;  1S05 A;  2XLW A;  1YYJ A;  3L1M A;  3QVZ A;  3QW0 A;  1A7V A;  2YL7 A;  2XM4 A;  4CIP A;  4CX9 A;  1E83 A;  3TOL A;  3M79 A;  3DE9 A;  3FOP A;  4N6H A;  4IAQ A;  4L6R A;  3ZWI A;  4D4N A;  3ZTZ A;  5B3I A;  4CJG A;  3M4B A;  1GQA A;  2YKZ A;  3IQ5 A;  1BBH A;  4CDV A;  4D4X A;  3TOM A;  2XL6 A;  4ULV A;  4N4W A;  1YYX A;  3ZQY A;  3HNK A;  1QPU A;  4IAR A;  2XLE A;  2J8W A;  3M4C A;  3VRC A;  4JKV A;  1QQ3 A;  3C63 A;  2XLH A;  256B A;  1APC A;  2YLG A;  3ZQV A;  2QLA A;  3NMI A;  3U8P A;  2XLO A;  3HNI A;  4WGY A;  3C62 A;  2CCY A;  3M15 A;  3DE8 A;  2XLM A;  3NMK A;  3HNL A;  2YL0 A;  1CPR A;  4U9E A;  5JSL A;  3IQ6 A;  4JEA A;  1YZA A;  3HNJ A;  3FOO A;  4NC3 A;  1CPQ A;  5JP7 A;  1LM3 B;  2XM0 A;  2YL1 A;  4CJO A;  5JT4 A;  1YZC A;  2XLV A;  1E86 A;  1M6T A;  1E84 A;  1CGO A;  3NMJ A;  4CDY A;  5AGF A;  3QW1 A;  1JAF A;  4EIY A;  5JUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...