1QQ3A

The solution structure of the heme binding variant arg98cys of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of b- to c-type heme conversion in oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords CYTOCHROME B562
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qq3A00
4CDYA 4ULVA 3HNIA 1S05A 3M79A 1RCPA 2XM0A 3HNLA 4CJGA 4EIYA 1EKYA 5JSLA 3NMIA 1E83A 3C63A 4N6HA 3TOLA 4CDAA 2YKZA 3NMJA 2XLDA 1JAFA 5JUAA 2XM4A 3M4CA 2XLHA 3QW1A 1YYXA 4CDVA 1E84A 3M4BA 1E86A 4JKVA 1APCA 2XLEA 3QVYA 4NC3A 4WGYA 1CGNA 2XL8A 1YZCA 2CCYA 3L1MA 3ZQVA 3QVZA 2YLIA 1LM3B 3ZTMA 2XLOA 3C62A 2XL6A 5JP7A 3HNKA 3ZWIA 4JEAA 1QQ3A 4JE9A 3ZTZA 4CIPA 2YL0A 2YLDA 3IQ6A 4CJOA 2YL7A 1A7VA 4D4XA 2J9BA 2BC5A 3FOOA 4CX9A 3FOPA 3M15A 1GQAA 2QLAA 1NBBA 1CPQA 5JVEA 1BBHA 4L6RA 1E85A 2YL3A 4IAQA 3DE8A 256BA 5JLIA 2YLGA 4U9DA 4WGZA 4N4WA 3NMKA 4IARA 3TOMA 4D4NA 1YZAA 1CGOA 2J8WA 4U9EA 3ZQYA 2XLMA 5JRAA 5AGFA 3HNJA 4ER9A 2XLWA 1M6TA 1MQVA 2XLVA 4JEBA 5JS5A 5B3IA 3IQ5A 3U8PA 1QPUA 1CPRA 3VRCA 1YYJA 5JT4A 4IB4A 2YL1A 3DE9A 3QW0A
chains in the Genus database with same CATH superfamily
5DS6A 2VB6A 2LCHA 2HUJA 1S05A 2H7VC 3K1HA 5L3VA 1RKEB 3RH3A 1OR2A 1Q0MA 3HNLA 3NYJA 3Q7GA 4EIYA 5JSLA 1ORYA 4Q4ZF 1R4TA 2WB7A 2I15A 4PJLA 3UR3C 3RF3A 3S90A 4RBNA 4YL1A 3LLIA 2AU5A 4OINF 5COFA 4PFPA 4ULWA 5AC4A 2A0BA 3POVA 3GODA 1SF8A 1FTSA 2V26A 2CNWA 2ZXRA 3PDMP 1I4ZA 4K1OA 4MS2A 1L3PA 3Q6NA 5GPGB 1QLEC 3SXKA 1XZQA 2KK1A 4YT2A 5JUAA 2HSQA 2HJMA 4RD9A 2D5RB 1VOMA 4C3BA 4C3DA 4IRUA 4CIHA 2B0HA 2L9JA 4XWJA 2WVNA 2PF4E 3AG4C 4K7BA 4IGGA 1ORSC 3MLGA 5KYWB 2LIGA 2QTVA 2R7WA 4HEAJ 3AGUA 4JTDB 3TJ5A 4NC3A 2AVKA 2P0NA 3ECSA 3S0XA 3ATPA 4JJFA 4BJ1A 3DD7A 1TWAA 2XL8A 3F46A 4JCZA 1RXQA 1VMAA 4ZLCA 1HW2A 3L1MA 4EBKA 1MNDA 1FFTC 1Y4CA 2L81A 1A0BA 3A11A 3QVZA 2KSFA 1OW6A 2YLIA 4LERA 4NTBA 3ZVRA 3OA1A 1HE1A 1LS1A 4DVZA 3DWWA 1LI7A 3ZTMA 4XPYA 4C7OB 5D91A 3C62A 3EG9B 1YARO 2LD6A 4MVQA 1Z5ZA 4DBQA 4EKWA 3MYIA 3S28A 3ZWIA 1M2VA 1H9GA 1R5ID 1ZYRF 4DRJB 1U0BB 1ORJA 4NQFA 1QQ3A 1K40A 2LFDA 1G4US 4FESA 5L0DA 2NSGA 4MQ9F 5F5HA 3U5SA 3PHF2 3SXMA 3R7CA 4BJ5A 2PX3A 3EGDB 4FWVA 5E3CA 3EFOB 1T6IA 3DKAA 4G78A 2WZGA 5CIVA 1Z3IX 2BL2A 3RVYA 4CIPA 5L0CA 5L0GA 3O55A 1FMWA 2CNWD 3GM1A 2YL7A 1TFKB 4NCQA 1FMVA 2YZSA 2WVQA 3CAXA 4I1MA 4ANJA 5D92A 2IXOA 4YL3A 3FOOA 4ONSA 4CX9A 3FOPA 2FAPB 3L8JA 4EHPA 2A69F 4DBRA 3VYWA 2DGJA 3I4UA 1FR0A 1WATA 3AOUA 2QLAA 2GA0A 4N06A 4CSAC 4PJNA 4YT4A 2JX0A 4JTAB 1ZU5A 1D1AA 5DS4A 1E85A 2YL3A 3EGXA 2R7VA 2A6EF 3HJCA 3T6JA 1ZHTA 4PJJA 4PFOA 3SYNA 4XQ1A 2J0WA 4XPWA 2XXAB 3JSZA 1Z6AA 2NSFA 4N4WA 1MMAA 4IARA 4LLCA 1JRAA 4D4NA 2V3CC 4K0DA 3ZC4A 4OIPF 3K33A 2GAQA 2J9VA 4IWBA 1CGOA 4I3MA 4JW1A 4LDKA 4XLNF 4CBEA 1D0XA 1C03A 1NZEA 4BJ6A 5KYYA 4AE4A 4KNVA 4Z9IA 2MHRA 3SP1A 5AGFA 2W9YA 1SMYF 4MTGA 4GYTA 2DB4A 3E9VA 5JS5A 2CYDA 3K6BA 3KYIA 1Q0FA 3GORA 3WAQA 2J9WA 5KYXA 5FCLA 2KC3A 2XS8A 2JPUA 4BG0A 1KU2A 1QVXA 4E18A 1QPUA 3OWTA 4YWQA 2YVKA 3H2UA 5T3WA 2P61A 2Q3TA 3CSKA 4FX5A 1AUEA 4E17A 3AQCA 5K0IA 1CPRA 4N6CA 3VRCA 1YYJA 1NU7D 3G50A 4IB4A 5JT4A 1E2XA 3EZIA 4AX2A 3QW0A 1RJ9B 2Y3DA 4CDYA 5DLJA 1H7IA 4ULVA 1DOVA 2IYLD 4Z9HA 3EGXB 2R25A 2CDQA 2X51A 3FAJA 1D1CA 1E83A 3KPHA 2NUPB 3C63A 4X0RA 3ZIBA 2P7VA 5L3QA 1KTMA 2HKVA 4YT8A 4ZLDA 2YKZA 5A69A 3UMHA 3K7DA 3JYYA 5DVWA 2GWWA 4PJMA 1EI7A 2XL4A 3B71A 3C8ZA 4W8KA 1LE2A 2R7TA 4IAOA 3IHUA 5BQGA 2XLHA 1FNTc 2EIJC 1YYXA 1RMVA 1LIHA 1MMGA 4WABA 4CDVA 3JSEO 4YN0B 3B29A 1E86A 4JKVA 3LS0A 3N0TA 3G4ZA 1NFNA 2EIMC 4AL0A 3SZRA 2MWQA 1VYIA 3QVYA 3S84A 3JT1A 3OEOA 5KYXB 1TQGA 2ZPAA 3LJBA 4MVUA 3N2ZB 5T1DB 3L34A 1T01A 4JTCB 1YZCA 2A68F 3IPMO 1U89A 3ZQVA 4LDQA 2Q7RA 5AC5A 3RQFA 2WVOA 2Q9BA 4MVMA 4JRZA 4E7ZA 2XL6A 4EBJA 3FDQA 1LVKA 3GEEA 5A6KA 4CS9A 1Z7Qc 2R7UA 1NU9C 3QMKA 3TULA 1YVIA 3C8GA 1NLXA 3DM5A 3FVYA 2H8AA 4JEAA 1VLSA 3LNRA 3RKOF 5EGYA 1ZHWA 5KYWA 4G0HA 3S9OA 4R32A 1SZIA 1VK5A 1HE9A 1OQCA 1NSGB 4AL1A 4G7HF 3WODF 2YLDA 2AWCA 3IQ6A 4J7YA 1ZZPA 4CJOA 1OW8A 4P9TA 3UMKA 5A6BA 2BC5A 3DMDA 2XRHA 4DJ9A 1BR2A 5IY5C 3C8GD 3EHNA 4MVSA 3Q6MA 3M15A 3JRTA 1GQAA 2OJQA 2LFFA 2IBFA 3NRHA 4KC9A 3V5ZA 2OJED 3LUTB 1T6UA 3GM2A 5KYUB 1HW1A 2EINC 2IXPA 2FFHA 3GM3A 3NG1A 4MNDA 4YL0A 4DOZA 2D4UA 1Z63A 1BBHA 2P1AA 3Q7LA 1OR3A 3VAYA 1OXBA 2G3VA 4IAQA 1RKEA 2PFDA 3ABLC 3DE8A 3ZDLA 256BA 4BJTA 3MX3A 3UGOA 3SEOA 1UFBA 1XWJA 1ZHYA 1ZVZA 2A0UA 2HV6A 2HFIA 2M4EA 5JLIA 2H7BA 2LSEA 4I44A 1YDIA 4WGZA 2PBEA 1M2VB 2IOQA 3NMKA 3TOMA 4OIOF 4QI2A 2KGOA 3RIPA 3ABKC 3TD7A 4M63A 1TWCA 3DAFA 2EPKX 2IXNA 4JVSA 1LS4A 3NDBB 4NTAA 2WZLA 4JJGA 3RFYA 1YAUO 3V5XA 1BR1A 1TWGA 3RQGA 5DS5A 1AVOB 3JCUQ 1D0YA 3HNJA 4P9FA 2LQGA 2XSEA 2XLVA 5F28E 2XS1A 1AEPA 2B0JA 4DVYP 3ITFA 3LNMB 1U6HA 1FAPB 2R7RA 1A7DA 2J7PA 4AK9A 3U8PA 3CEXA 2IXMA 4LACB 1RKCA 1MMDA 5L0HA 4E0IA 4KI2A 1OCRC 2X0CA 1O3UA 2O9XA 4WJ0A 3B0UX 2Y39A 2VCBA 4BEJA 1J8YF 2Z15A 3DE9A 4YT5A 3K1IC 1NG1A 2NPUA 1JR8A 3CQZA 3C18A 3HNIA 4MVOA 3NYMA 4F4BA 1JMWA 1YLMA 2EPMX 4XTKA 5COMA 3M79A 3S27A 2XM0A 2QUPA 3EQLF 3V5YA 4O6YA 3EPVA 3W4YA 1W2WA 2I8BA 3B0PA 2J45A 4HE8D 3DXJF 1OCZC 2QNLA 4N6HA 1OXKA 2UUHA 5KYUA 3TOLA 4CDAA 5KYNA 2EPOA 1WASA 2J0XA 4IJJA 1TKNA 3T6GB 3W2VA 3RQEA 4QDLA 1CGME 1N1CA 1JAFA 3JRMO 1I4YA 1FFHA 2Q00A 4H4KC 3WG7C 2NG1A 2GDCA 3UMIA 2XM4A 3G4XA 3U9JA 1SR2A 5BQHA 2FGYA 3GANA 1YA9A 3MYFA 4LDRA 4XEVA 3S29A 3U2LA 1BR4A 2HSBA 3M1CB 1LI5A 2YHSA 1T6QA 3R2PA 2KW3C 3C8GB 1F1MA 4O7GA 1OKKD 3LS1A 1K04A 4JC7A 3US6A 1APCA 1Z23A 4XPXA 1QKRA 2XLEA 3L8IA 3O39A 5FZTA 1MNEA 3EHMA 4PACA 1Y6DA 3KKBA 2G62A 1CGNA 2QY9A 2OEXA 2Q4FA 3AQBA 4P6IC 1IZMA 4YK5A 5L0JA 2CCYA 1NFOA 3RVZA 1VLTA 1ST6A 1ZU4A 5B1AC 1LM3B 2M64A 3O6XA 3W8IA 3B9QA 3UGPA 1QZXA 3BRJA 3L0IA 4HFFB 2XLOA 3N24A 4O6MA 2PP4A 1DOWA 3ASOC 5JP7A 3HNKA 4OD4A 2R05A 4YJWA 2KQ9A 3DJNB 2A6HF 3PCVA 3T9OA 4XEKA 4G7OF 4KBLA 5HV9A 2VASA 1JOGA 3K1IA 2XXAA 3VF0A 4BJ6C 3K66A 3MBGA 1HY5A 4BJ5C 3IEEA 1XZPA 5CI9A 1A7EA 2ZXWC 1A7VA 3GEIA 3LEVA 4D4XA 3JZ0A 4HFKB 3W8HA 1YA7O 3LEOA 1SYQA 4J7TA 2EIKC 4JIOA 4W8PA 2YQYA 2HV7A 2RD9A 1M57C 1H6GA 1S7ZA 2C03A 1WN0A 1KNYA 1ZHXA 2Y3HA 4QI0A 4UDVA 2R7XA 1OCCC 1NBBA 1HMOA 2EILC 2ZD9A 2NUPA 1OCOC 3GWLA 2DYRC 1OKKA 1PV3A 2OU6A 2VCAA 2A1DD 2CW0F 2R9RB 4U5BE 3U8VA 3X1OA 1V54C 3AG2C 5E33A 4JZAA 1VB5A 4H54A 3T6BA 4U5GA 2HMZA 2NUTB 2ASRA 2KNHA 3U9MA 3U2MA 5CI8A 3JTLO 2HJ3A 3EGDA 1EA8A 2W45A 5TJ5E 2DI3A 3TQOA 3U3BA 1VYKA 5DQZA 4DXWA 2Y69C 3W2WA 3MFNA 4EWCA 1ZW2A 2AWYA 5E2QA 5DQTA 5BQIA 1IW7F 2AP3A 2DYSC 1WOLA 2XLMA 2G3KA 4E0HA 5JRAA 4ER9A 4NY3A 4JEBA 3AG1C 4LLEA 4EUKB 2R7SA 4U5FE 2VCCA 2R7QA 4KNWA 4AE4B 5T3TA 5KYYB 5L0FA 2P6VA 3QTHA 1YJGA 4O6NA 3BEHA 2GFHA 2R02A 3E70C 3HTKC 2QE9A 5A6JA 3AG3C 4C3EA 5A6BD 1PD0A 2L7AA 3KMIA 3HKKA 2VC9A 1I5NA 1T9KA 5F5FA 3C7JA 2L6GA 2C04A 3ASNC 3V7OA 1GM5A 1MMNA 2R03A 2OEVA 3KH2A 2NUTA 5L0IA 4MW3A 4DRIB 3DAGA 3SXZA 3B0VC 1RCPA 4CJGA 2LK4A 2Y3GA 4O79A 4Q7CA 3A9CA 1EKYA 1K05A 2MYSA 3NMIA 1BDJB 4OIQF 1HMDA 3ZG1A 2PX0A 4CS7A 2ZXPA 1LE4A 2IM8A 2RSEB 3J06A 3NMJA 4GQHA 3IQCA 2Q9AA 2XLDA 3LAYA 4MVRA 1J8MF 1RJ9A 3UNGC 3RYLA 3EFOA 1A41A 3M4CA 2HZ8A 4I1OB 4OIRF 3RW0A 4FAPB 3QW1A 1E84A 5A6AA 4EBBA 4NTFA 3M4BA 4J30B 4BPMA 2KJGA 2W4MA 4JCHA 3PMRA 3F47A 4A4AA 2PNOA 1UG7A 3U3FA 1T5OA 1VTMP 2F22A 3CZ6A 2YRFA 4WGYA 4C7OA 3AGTA 1ZW3A 4Q5SF 1OW7A 2HMQA 3X2QC 1M2OA 2CGEA 1V4AA 3DI5A 4CSAA 2JD3A 5E3AA 3SNHA 4CS9C 1GS9A 2VH3A 1C02A 2YEVA 4B6IA 1QSPA 2HS5A 3FXHA 3DJUB 1WWPA 3H2VA 4J32B 4DRHB 2UUIA 4PK4A 2L6FA 3EH2A 3DM9B 3JYHA 4XEFA 2OG2A 4JE9A 3FHDA 1Q0KA 2ICWG 4BEMJ 1Q0DA 3H65A 1V74B 3ZTZA 2WL8A 2YL0A 3DZAA 4GEHA 4U5CE 3O10A 5EHHA 2R7OA 2Q9CA 2J9BA 4G7ZF 4RDAA 2LP4A 1V55C 2J7PD 1C17M 3NKDA 2W4BA 2L6HA 4MW8A 3FMSA 1D0ZA 3KL4A 1CPQA 3WHNA 3T4RA 1O5HA 5JVEA 3GEHA 4L6RA 2Y3BA 4MTFA 4JURI 2OCCC 3KYJA 1O87A 2OQMA 4U5EE 4CS8C 1WTYA 3TK0A 2OOCA 1M56C 1GGQA 3I5QA 3SXYA 4U5DE 1D1BA 5BUOA 2YLGA 3EZHA 4PR9A 4U9DA 1LPEA 3LESA 1G4WR 3QZCA 2TMVP 1JPJA 2EPLX 1EQ1A 3EH1A 4E7SA 1YZAA 3ABMC 4OD5A 3EG9A 4U5HA 1LKXA 2J8WA 4U9EA 5B3SC 3LLKA 3NKEA 1WGWA 4Z9JA 1TR2A 3ZSUA 2E87A 3GWNA 3ZQYA 3EJNA 1PD1A 3AJMA 5COGA 1Q0GA 2WZFA 3HLZA 3IQTA 4MTOA 3U0CA 1L7CA 1M6TA 1MQVA 1TWHA 2XLWA 2J46A 4XLPF 3VM6A 2YWAA 3NYLA 5B3IA 1ZHZA 3I5PA 3IQ5A 2OKUA 4A2NB 1JPNA 3TJ6A 5B1BC 1G8XA 2KYHA 3FAPB 2EPNA 4CS8A 2H7OA 1TFOB 2J9UA 1G5ZA 5HSWA 2ETSA 1BZ4A 2YL1A 4MVZA 5EK0A 1PCXA 2BE5F 1H9TA 2ZXOA 1B68A
chains in the Genus database with same CATH topology
4CDYA 4ULVA 3HNIA 1S05A 3M79A 1RCPA 2XM0A 3HNLA 4CJGA 4EIYA 1EKYA 5JSLA 3NMIA 1E83A 3C63A 4N6HA 3TOLA 4CDAA 2YKZA 3NMJA 2XLDA 1JAFA 5JUAA 2XM4A 3M4CA 2XLHA 3QW1A 1YYXA 4CDVA 1E84A 3M4BA 1E86A 4JKVA 1APCA 2XLEA 3QVYA 4NC3A 4WGYA 1CGNA 2XL8A 1YZCA 2CCYA 3L1MA 3ZQVA 3QVZA 2YLIA 1LM3B 3ZTMA 2XLOA 3C62A 2XL6A 5JP7A 3HNKA 3ZWIA 4JEAA 1QQ3A 4JE9A 3ZTZA 4CIPA 2YL0A 2YLDA 3IQ6A 4CJOA 2YL7A 1A7VA 4D4XA 2J9BA 2BC5A 3FOOA 4CX9A 3FOPA 3M15A 1GQAA 2QLAA 1NBBA 1CPQA 5JVEA 1BBHA 4L6RA 1E85A 2YL3A 4IAQA 3DE8A 256BA 5JLIA 2YLGA 4U9DA 4WGZA 4N4WA 3NMKA 4IARA 3TOMA 4D4NA 1YZAA 1CGOA 2J8WA 4U9EA 3ZQYA 2XLMA 5JRAA 5AGFA 3HNJA 4ER9A 2XLWA 1M6TA 1MQVA 2XLVA 4JEBA 5JS5A 5B3IA 3IQ5A 3U8PA 1QPUA 1CPRA 3VRCA 1YYJA 5JT4A 4IB4A 2YL1A 3DE9A 3QW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDY A;  4ULV A;  3HNI A;  1S05 A;  3M79 A;  1RCP A;  2XM0 A;  3HNL A;  4CJG A;  4EIY A;  1EKY A;  5JSL A;  3NMI A;  1E83 A;  3C63 A;  4N6H A;  3TOL A;  4CDA A;  2YKZ A;  3NMJ A;  2XLD A;  1JAF A;  5JUA A;  2XM4 A;  3M4C A;  2XLH A;  3QW1 A;  1YYX A;  4CDV A;  1E84 A;  3M4B A;  1E86 A;  4JKV A;  1APC A;  2XLE A;  3QVY A;  4NC3 A;  4WGY A;  1CGN A;  2XL8 A;  1YZC A;  2CCY A;  3L1M A;  3ZQV A;  3QVZ A;  2YLI A;  1LM3 B;  3ZTM A;  2XLO A;  3C62 A;  2XL6 A;  5JP7 A;  3HNK A;  3ZWI A;  4JEA A;  1QQ3 A;  4JE9 A;  3ZTZ A;  4CIP A;  2YL0 A;  2YLD A;  3IQ6 A;  4CJO A;  2YL7 A;  1A7V A;  4D4X A;  2J9B A;  2BC5 A;  3FOO A;  4CX9 A;  3FOP A;  3M15 A;  1GQA A;  2QLA A;  1NBB A;  1CPQ A;  5JVE A;  1BBH A;  4L6R A;  1E85 A;  2YL3 A;  4IAQ A;  3DE8 A;  256B A;  5JLI A;  2YLG A;  4U9D A;  4WGZ A;  4N4W A;  3NMK A;  4IAR A;  3TOM A;  4D4N A;  1YZA A;  1CGO A;  2J8W A;  4U9E A;  3ZQY A;  2XLM A;  5JRA A;  5AGF A;  3HNJ A;  4ER9 A;  2XLW A;  1M6T A;  1MQV A;  2XLV A;  4JEB A;  5JS5 A;  5B3I A;  3IQ5 A;  3U8P A;  1QPU A;  1CPR A;  3VRC A;  1YYJ A;  5JT4 A;  4IB4 A;  2YL1 A;  3DE9 A;  3QW0 A; 
#chains in the Genus database with same CATH topology
 5DS6 A;  2VB6 A;  2LCH A;  2HUJ A;  1S05 A;  2H7V C;  3K1H A;  5L3V A;  1RKE B;  3RH3 A;  1OR2 A;  1Q0M A;  3HNL A;  3NYJ A;  3Q7G A;  4EIY A;  5JSL A;  1ORY A;  4Q4Z F;  1R4T A;  2WB7 A;  2I15 A;  4PJL A;  3UR3 C;  3RF3 A;  3S90 A;  4RBN A;  4YL1 A;  3LLI A;  2AU5 A;  4OIN F;  5COF A;  4PFP A;  4ULW A;  5AC4 A;  2A0B A;  3POV A;  3GOD A;  1SF8 A;  1FTS A;  2V26 A;  2CNW A;  2ZXR A;  3PDM P;  1I4Z A;  4K1O A;  4MS2 A;  1L3P A;  3Q6N A;  5GPG B;  1QLE C;  3SXK A;  1XZQ A;  2KK1 A;  4YT2 A;  5JUA A;  2HSQ A;  2HJM A;  4RD9 A;  2D5R B;  1VOM A;  4C3B A;  4C3D A;  4IRU A;  4CIH A;  2B0H A;  2L9J A;  4XWJ A;  2WVN A;  2PF4 E;  3AG4 C;  4K7B A;  4IGG A;  1ORS C;  3MLG A;  5KYW B;  2LIG A;  2QTV A;  2R7W A;  4HEA J;  3AGU A;  4JTD B;  3TJ5 A;  4NC3 A;  2AVK A;  2P0N A;  3ECS A;  3S0X A;  3ATP A;  4JJF A;  4BJ1 A;  3DD7 A;  1TWA A;  2XL8 A;  3F46 A;  4JCZ A;  1RXQ A;  1VMA A;  4ZLC A;  1HW2 A;  3L1M A;  4EBK A;  1MND A;  1FFT C;  1Y4C A;  2L81 A;  1A0B A;  3A11 A;  3QVZ A;  2KSF A;  1OW6 A;  2YLI A;  4LER A;  4NTB A;  3ZVR A;  3OA1 A;  1HE1 A;  1LS1 A;  4DVZ A;  3DWW A;  1LI7 A;  3ZTM A;  4XPY A;  4C7O B;  5D91 A;  3C62 A;  3EG9 B;  1YAR O;  2LD6 A;  4MVQ A;  1Z5Z A;  4DBQ A;  4EKW A;  3MYI A;  3S28 A;  3ZWI A;  1M2V A;  1H9G A;  1R5I D;  1ZYR F;  4DRJ B;  1U0B B;  1ORJ A;  4NQF A;  1QQ3 A;  1K40 A;  2LFD A;  1G4U S;  4FES A;  5L0D A;  2NSG A;  4MQ9 F;  5F5H A;  3U5S A;  3PHF 2;  3SXM A;  3R7C A;  4BJ5 A;  2PX3 A;  3EGD B;  4FWV A;  5E3C A;  3EFO B;  1T6I A;  3DKA A;  4G78 A;  2WZG A;  5CIV A;  1Z3I X;  2BL2 A;  3RVY A;  4CIP A;  5L0C A;  5L0G A;  3O55 A;  1FMW A;  2CNW D;  3GM1 A;  2YL7 A;  1TFK B;  4NCQ A;  1FMV A;  2YZS A;  2WVQ A;  3CAX A;  4I1M A;  4ANJ A;  5D92 A;  2IXO A;  4YL3 A;  3FOO A;  4ONS A;  4CX9 A;  3FOP A;  2FAP B;  3L8J A;  4EHP A;  2A69 F;  4DBR A;  3VYW A;  2DGJ A;  3I4U A;  1FR0 A;  1WAT A;  3AOU A;  2QLA A;  2GA0 A;  4N06 A;  4CSA C;  4PJN A;  4YT4 A;  2JX0 A;  4JTA B;  1ZU5 A;  1D1A A;  5DS4 A;  1E85 A;  2YL3 A;  3EGX A;  2R7V A;  2A6E F;  3HJC A;  3T6J A;  1ZHT A;  4PJJ A;  4PFO A;  3SYN A;  4XQ1 A;  2J0W A;  4XPW A;  2XXA B;  3JSZ A;  1Z6A A;  2NSF A;  4N4W A;  1MMA A;  4IAR A;  4LLC A;  1JRA A;  4D4N A;  2V3C C;  4K0D A;  3ZC4 A;  4OIP F;  3K33 A;  2GAQ A;  2J9V A;  4IWB A;  1CGO A;  4I3M A;  4JW1 A;  4LDK A;  4XLN F;  4CBE A;  1D0X A;  1C03 A;  1NZE A;  4BJ6 A;  5KYY A;  4AE4 A;  4KNV A;  4Z9I A;  2MHR A;  3SP1 A;  5AGF A;  2W9Y A;  1SMY F;  4MTG A;  4GYT A;  2DB4 A;  3E9V A;  5JS5 A;  2CYD A;  3K6B A;  3KYI A;  1Q0F A;  3GOR A;  3WAQ A;  2J9W A;  5KYX A;  5FCL A;  2KC3 A;  2XS8 A;  2JPU A;  4BG0 A;  1KU2 A;  1QVX A;  4E18 A;  1QPU A;  3OWT A;  4YWQ A;  2YVK A;  3H2U A;  5T3W A;  2P61 A;  2Q3T A;  3CSK A;  4FX5 A;  1AUE A;  4E17 A;  3AQC A;  5K0I A;  1CPR A;  4N6C A;  3VRC A;  1YYJ A;  1NU7 D;  3G50 A;  4IB4 A;  5JT4 A;  1E2X A;  3EZI A;  4AX2 A;  3QW0 A;  1RJ9 B;  2Y3D A;  4CDY A;  5DLJ A;  1H7I A;  4ULV A;  1DOV A;  2IYL D;  4Z9H A;  3EGX B;  2R25 A;  2CDQ A;  2X51 A;  3FAJ A;  1D1C A;  1E83 A;  3KPH A;  2NUP B;  3C63 A;  4X0R A;  3ZIB A;  2P7V A;  5L3Q A;  1KTM A;  2HKV A;  4YT8 A;  4ZLD A;  2YKZ A;  5A69 A;  3UMH A;  3K7D A;  3JYY A;  5DVW A;  2GWW A;  4PJM A;  1EI7 A;  2XL4 A;  3B71 A;  3C8Z A;  4W8K A;  1LE2 A;  2R7T A;  4IAO A;  3IHU A;  5BQG A;  2XLH A;  1FNT c;  2EIJ C;  1YYX A;  1RMV A;  1LIH A;  1MMG A;  4WAB A;  4CDV A;  3JSE O;  4YN0 B;  3B29 A;  1E86 A;  4JKV A;  3LS0 A;  3N0T A;  3G4Z A;  1NFN A;  2EIM C;  4AL0 A;  3SZR A;  2MWQ A;  1VYI A;  3QVY A;  3S84 A;  3JT1 A;  3OEO A;  5KYX B;  1TQG A;  2ZPA A;  3LJB A;  4MVU A;  3N2Z B;  5T1D B;  3L34 A;  1T01 A;  4JTC B;  1YZC A;  2A68 F;  3IPM O;  1U89 A;  3ZQV A;  4LDQ A;  2Q7R A;  5AC5 A;  3RQF A;  2WVO A;  2Q9B A;  4MVM A;  4JRZ A;  4E7Z A;  2XL6 A;  4EBJ A;  3FDQ A;  1LVK A;  3GEE A;  5A6K A;  4CS9 A;  1Z7Q c;  2R7U A;  1NU9 C;  3QMK A;  3TUL A;  1YVI A;  3C8G A;  1NLX A;  3DM5 A;  3FVY A;  2H8A A;  4JEA A;  1VLS A;  3LNR A;  3RKO F;  5EGY A;  1ZHW A;  5KYW A;  4G0H A;  3S9O A;  4R32 A;  1SZI A;  1VK5 A;  1HE9 A;  1OQC A;  1NSG B;  4AL1 A;  4G7H F;  3WOD F;  2YLD A;  2AWC A;  3IQ6 A;  4J7Y A;  1ZZP A;  4CJO A;  1OW8 A;  4P9T A;  3UMK A;  5A6B A;  2BC5 A;  3DMD A;  2XRH A;  4DJ9 A;  1BR2 A;  5IY5 C;  3C8G D;  3EHN A;  4MVS A;  3Q6M A;  3M15 A;  3JRT A;  1GQA A;  2OJQ A;  2LFF A;  2IBF A;  3NRH A;  4KC9 A;  3V5Z A;  2OJE D;  3LUT B;  1T6U A;  3GM2 A;  5KYU B;  1HW1 A;  2EIN C;  2IXP A;  2FFH A;  3GM3 A;  3NG1 A;  4MND A;  4YL0 A;  4DOZ A;  2D4U A;  1Z63 A;  1BBH A;  2P1A A;  3Q7L A;  1OR3 A;  3VAY A;  1OXB A;  2G3V A;  4IAQ A;  1RKE A;  2PFD A;  3ABL C;  3DE8 A;  3ZDL A;  256B A;  4BJT A;  3MX3 A;  3UGO A;  3SEO A;  1UFB A;  1XWJ A;  1ZHY A;  1ZVZ A;  2A0U A;  2HV6 A;  2HFI A;  2M4E A;  5JLI A;  2H7B A;  2LSE A;  4I44 A;  1YDI A;  4WGZ A;  2PBE A;  1M2V B;  2IOQ A;  3NMK A;  3TOM A;  4OIO F;  4QI2 A;  2KGO A;  3RIP A;  3ABK C;  3TD7 A;  4M63 A;  1TWC A;  3DAF A;  2EPK X;  2IXN A;  4JVS A;  1LS4 A;  3NDB B;  4NTA A;  2WZL A;  4JJG A;  3RFY A;  1YAU O;  3V5X A;  1BR1 A;  1TWG A;  3RQG A;  5DS5 A;  1AVO B;  3JCU Q;  1D0Y A;  3HNJ A;  4P9F A;  2LQG A;  2XSE A;  2XLV A;  5F28 E;  2XS1 A;  1AEP A;  2B0J A;  4DVY P;  3ITF A;  3LNM B;  1U6H A;  1FAP B;  2R7R A;  1A7D A;  2J7P A;  4AK9 A;  3U8P A;  3CEX A;  2IXM A;  4LAC B;  1RKC A;  1MMD A;  5L0H A;  4E0I A;  4KI2 A;  1OCR C;  2X0C A;  1O3U A;  2O9X A;  4WJ0 A;  3B0U X;  2Y39 A;  2VCB A;  4BEJ A;  1J8Y F;  2Z15 A;  3DE9 A;  4YT5 A;  3K1I C;  1NG1 A;  2NPU A;  1JR8 A;  3CQZ A;  3C18 A;  3HNI A;  4MVO A;  3NYM A;  4F4B A;  1JMW A;  1YLM A;  2EPM X;  4XTK A;  5COM A;  3M79 A;  3S27 A;  2XM0 A;  2QUP A;  3EQL F;  3V5Y A;  4O6Y A;  3EPV A;  3W4Y A;  1W2W A;  2I8B A;  3B0P A;  2J45 A;  4HE8 D;  3DXJ F;  1OCZ C;  2QNL A;  4N6H A;  1OXK A;  2UUH A;  5KYU A;  3TOL A;  4CDA A;  5KYN A;  2EPO A;  1WAS A;  2J0X A;  4IJJ A;  1TKN A;  3T6G B;  3W2V A;  3RQE A;  4QDL A;  1CGM E;  1N1C A;  1JAF A;  3JRM O;  1I4Y A;  1FFH A;  2Q00 A;  4H4K C;  3WG7 C;  2NG1 A;  2GDC A;  3UMI A;  2XM4 A;  3G4X A;  3U9J A;  1SR2 A;  5BQH A;  2FGY A;  3GAN A;  1YA9 A;  3MYF A;  4LDR A;  4XEV A;  3S29 A;  3U2L A;  1BR4 A;  2HSB A;  3M1C B;  1LI5 A;  2YHS A;  1T6Q A;  3R2P A;  2KW3 C;  3C8G B;  1F1M A;  4O7G A;  1OKK D;  3LS1 A;  1K04 A;  4JC7 A;  3US6 A;  1APC A;  1Z23 A;  4XPX A;  1QKR A;  2XLE A;  3L8I A;  3O39 A;  5FZT A;  1MNE A;  3EHM A;  4PAC A;  1Y6D A;  3KKB A;  2G62 A;  1CGN A;  2QY9 A;  2OEX A;  2Q4F A;  3AQB A;  4P6I C;  1IZM A;  4YK5 A;  5L0J A;  2CCY A;  1NFO A;  3RVZ A;  1VLT A;  1ST6 A;  1ZU4 A;  5B1A C;  1LM3 B;  2M64 A;  3O6X A;  3W8I A;  3B9Q A;  3UGP A;  1QZX A;  3BRJ A;  3L0I A;  4HFF B;  2XLO A;  3N24 A;  4O6M A;  2PP4 A;  1DOW A;  3ASO C;  5JP7 A;  3HNK A;  4OD4 A;  2R05 A;  4YJW A;  2KQ9 A;  3DJN B;  2A6H F;  3PCV A;  3T9O A;  4XEK A;  4G7O F;  4KBL A;  5HV9 A;  2VAS A;  1JOG A;  3K1I A;  2XXA A;  3VF0 A;  4BJ6 C;  3K66 A;  3MBG A;  1HY5 A;  4BJ5 C;  3IEE A;  1XZP A;  5CI9 A;  1A7E A;  2ZXW C;  1A7V A;  3GEI A;  3LEV A;  4D4X A;  3JZ0 A;  4HFK B;  3W8H A;  1YA7 O;  3LEO A;  1SYQ A;  4J7T A;  2EIK C;  4JIO A;  4W8P A;  2YQY A;  2HV7 A;  2RD9 A;  1M57 C;  1H6G A;  1S7Z A;  2C03 A;  1WN0 A;  1KNY A;  1ZHX A;  2Y3H A;  4QI0 A;  4UDV A;  2R7X A;  1OCC C;  1NBB A;  1HMO A;  2EIL C;  2ZD9 A;  2NUP A;  1OCO C;  3GWL A;  2DYR C;  1OKK A;  1PV3 A;  2OU6 A;  2VCA A;  2A1D D;  2CW0 F;  2R9R B;  4U5B E;  3U8V A;  3X1O A;  1V54 C;  3AG2 C;  5E33 A;  4JZA A;  1VB5 A;  4H54 A;  3T6B A;  4U5G A;  2HMZ A;  2NUT B;  2ASR A;  2KNH A;  3U9M A;  3U2M A;  5CI8 A;  3JTL O;  2HJ3 A;  3EGD A;  1EA8 A;  2W45 A;  5TJ5 E;  2DI3 A;  3TQO A;  3U3B A;  1VYK A;  5DQZ A;  4DXW A;  2Y69 C;  3W2W A;  3MFN A;  4EWC A;  1ZW2 A;  2AWY A;  5E2Q A;  5DQT A;  5BQI A;  1IW7 F;  2AP3 A;  2DYS C;  1WOL A;  2XLM A;  2G3K A;  4E0H A;  5JRA A;  4ER9 A;  4NY3 A;  4JEB A;  3AG1 C;  4LLE A;  4EUK B;  2R7S A;  4U5F E;  2VCC A;  2R7Q A;  4KNW A;  4AE4 B;  5T3T A;  5KYY B;  5L0F A;  2P6V A;  3QTH A;  1YJG A;  4O6N A;  3BEH A;  2GFH A;  2R02 A;  3E70 C;  3HTK C;  2QE9 A;  5A6J A;  3AG3 C;  4C3E A;  5A6B D;  1PD0 A;  2L7A A;  3KMI A;  3HKK A;  2VC9 A;  1I5N A;  1T9K A;  5F5F A;  3C7J A;  2L6G A;  2C04 A;  3ASN C;  3V7O A;  1GM5 A;  1MMN A;  2R03 A;  2OEV A;  3KH2 A;  2NUT A;  5L0I A;  4MW3 A;  4DRI B;  3DAG A;  3SXZ A;  3B0V C;  1RCP A;  4CJG A;  2LK4 A;  2Y3G A;  4O79 A;  4Q7C A;  3A9C A;  1EKY A;  1K05 A;  2MYS A;  3NMI A;  1BDJ B;  4OIQ F;  1HMD A;  3ZG1 A;  2PX0 A;  4CS7 A;  2ZXP A;  1LE4 A;  2IM8 A;  2RSE B;  3J06 A;  3NMJ A;  4GQH A;  3IQC A;  2Q9A A;  2XLD A;  3LAY A;  4MVR A;  1J8M F;  1RJ9 A;  3UNG C;  3RYL A;  3EFO A;  1A41 A;  3M4C A;  2HZ8 A;  4I1O B;  4OIR F;  3RW0 A;  4FAP B;  3QW1 A;  1E84 A;  5A6A A;  4EBB A;  4NTF A;  3M4B A;  4J30 B;  4BPM A;  2KJG A;  2W4M A;  4JCH A;  3PMR A;  3F47 A;  4A4A A;  2PNO A;  1UG7 A;  3U3F A;  1T5O A;  1VTM P;  2F22 A;  3CZ6 A;  2YRF A;  4WGY A;  4C7O A;  3AGT A;  1ZW3 A;  4Q5S F;  1OW7 A;  2HMQ A;  3X2Q C;  1M2O A;  2CGE A;  1V4A A;  3DI5 A;  4CSA A;  2JD3 A;  5E3A A;  3SNH A;  4CS9 C;  1GS9 A;  2VH3 A;  1C02 A;  2YEV A;  4B6I A;  1QSP A;  2HS5 A;  3FXH A;  3DJU B;  1WWP A;  3H2V A;  4J32 B;  4DRH B;  2UUI A;  4PK4 A;  2L6F A;  3EH2 A;  3DM9 B;  3JYH A;  4XEF A;  2OG2 A;  4JE9 A;  3FHD A;  1Q0K A;  2ICW G;  4BEM J;  1Q0D A;  3H65 A;  1V74 B;  3ZTZ A;  2WL8 A;  2YL0 A;  3DZA A;  4GEH A;  4U5C E;  3O10 A;  5EHH A;  2R7O A;  2Q9C A;  2J9B A;  4G7Z F;  4RDA A;  2LP4 A;  1V55 C;  2J7P D;  1C17 M;  3NKD A;  2W4B A;  2L6H A;  4MW8 A;  3FMS A;  1D0Z A;  3KL4 A;  1CPQ A;  3WHN A;  3T4R A;  1O5H A;  5JVE A;  3GEH A;  4L6R A;  2Y3B A;  4MTF A;  4JUR I;  2OCC C;  3KYJ A;  1O87 A;  2OQM A;  4U5E E;  4CS8 C;  1WTY A;  3TK0 A;  2OOC A;  1M56 C;  1GGQ A;  3I5Q A;  3SXY A;  4U5D E;  1D1B A;  5BUO A;  2YLG A;  3EZH A;  4PR9 A;  4U9D A;  1LPE A;  3LES A;  1G4W R;  3QZC A;  2TMV P;  1JPJ A;  2EPL X;  1EQ1 A;  3EH1 A;  4E7S A;  1YZA A;  3ABM C;  4OD5 A;  3EG9 A;  4U5H A;  1LKX A;  2J8W A;  4U9E A;  5B3S C;  3LLK A;  3NKE A;  1WGW A;  4Z9J A;  1TR2 A;  3ZSU A;  2E87 A;  3GWN A;  3ZQY A;  3EJN A;  1PD1 A;  3AJM A;  5COG A;  1Q0G A;  2WZF A;  3HLZ A;  3IQT A;  4MTO A;  3U0C A;  1L7C A;  1M6T A;  1MQV A;  1TWH A;  2XLW A;  2J46 A;  4XLP F;  3VM6 A;  2YWA A;  3NYL A;  5B3I A;  1ZHZ A;  3I5P A;  3IQ5 A;  2OKU A;  4A2N B;  1JPN A;  3TJ6 A;  5B1B C;  1G8X A;  2KYH A;  3FAP B;  2EPN A;  4CS8 A;  2H7O A;  1TFO B;  2J9U A;  1G5Z A;  5HSW A;  2ETS A;  1BZ4 A;  2YL1 A;  4MVZ A;  5EK0 A;  1PCX A;  2BE5 F;  1H9T A;  2ZXO A;  1B68 A; 
#chains in the Genus database with same CATH homology
 4CDY A;  4ULV A;  3HNI A;  1S05 A;  3M79 A;  1RCP A;  2XM0 A;  3HNL A;  4CJG A;  4EIY A;  1EKY A;  5JSL A;  3NMI A;  1E83 A;  3C63 A;  4N6H A;  3TOL A;  4CDA A;  2YKZ A;  3NMJ A;  2XLD A;  1JAF A;  5JUA A;  2XM4 A;  3M4C A;  2XLH A;  3QW1 A;  1YYX A;  4CDV A;  1E84 A;  3M4B A;  1E86 A;  4JKV A;  1APC A;  2XLE A;  3QVY A;  4NC3 A;  4WGY A;  1CGN A;  2XL8 A;  1YZC A;  2CCY A;  3L1M A;  3ZQV A;  3QVZ A;  2YLI A;  1LM3 B;  3ZTM A;  2XLO A;  3C62 A;  2XL6 A;  5JP7 A;  3HNK A;  3ZWI A;  4JEA A;  1QQ3 A;  4JE9 A;  3ZTZ A;  4CIP A;  2YL0 A;  2YLD A;  3IQ6 A;  4CJO A;  2YL7 A;  1A7V A;  4D4X A;  2J9B A;  2BC5 A;  3FOO A;  4CX9 A;  3FOP A;  3M15 A;  1GQA A;  2QLA A;  1NBB A;  1CPQ A;  5JVE A;  1BBH A;  4L6R A;  1E85 A;  2YL3 A;  4IAQ A;  3DE8 A;  256B A;  5JLI A;  2YLG A;  4U9D A;  4WGZ A;  4N4W A;  3NMK A;  4IAR A;  3TOM A;  4D4N A;  1YZA A;  1CGO A;  2J8W A;  4U9E A;  3ZQY A;  2XLM A;  5JRA A;  5AGF A;  3HNJ A;  4ER9 A;  2XLW A;  1M6T A;  1MQV A;  2XLV A;  4JEB A;  5JS5 A;  5B3I A;  3IQ5 A;  3U8P A;  1QPU A;  1CPR A;  3VRC A;  1YYJ A;  5JT4 A;  4IB4 A;  2YL1 A;  3DE9 A;  3QW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...