1QQ3A

The solution structure of the heme binding variant arg98cys of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title Structural consequences of b- to c-type heme conversion in oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qq3A00
4IARA 1RCPA 1CGNA 5JLIA 1CGOA 3C63A 2XLVA 3NMJA 1BBHA 3L1MA 2XL6A 1A7VA 3DE9A 4IB4A 1YYJA 1NBBA 1CPQA 3TOLA 4CX9A 4D4NA 4JKVA 4ER9A 2YL3A 3ZTZA 3U8PA 1E84A 3M79A 4CDAA 3NMIA 5JSLA 3IQ5A 2XM4A 3IQ6A 4WGYA 5JS5A 3ZWIA 4CJOA 3TOMA 4JE9A 3ZQYA 3ZTMA 5JRAA 4CJGA 1S05A 1QQ3A 4IAQA 3FOPA 1APCA 3QVYA 4CDVA 4CIPA 5AGFA 3NMKA 3M4BA 3HNKA 2QLAA 2YL0A 256BA 1YZAA 3DE8A 4U9EA 4CDYA 2J9BA 3C62A 1MQVA 4L6RA 4JEBA 1E86A 2YL7A 4ULVA 1YYXA 4JEAA 5JP7A 3VRCA 2XLDA 3M4CA 2YL1A 1E85A 3HNLA 1LM3B 4WGZA 1M6TA 4D4XA 1YZCA 2XL8A 3HNJA 3M15A 1QPUA 2BC5A 2XM0A 2YLDA 2XLOA 2XLMA 2J8WA 3QVZA 4N4WA 4U9DA 3ZQVA 1E83A 5JVEA 1JAFA 2YKZA 3QW1A 2XLWA 2YLIA 5JT4A 4EIYA 1GQAA 1EKYA 4N6HA 5B3IA 2CCYA 5JUAA 2XLHA 4NC3A 3HNIA 2XLEA 3FOOA 1CPRA 3QW0A 2YLGA
chains in the Genus database with same CATH superfamily
1M56C 1HE9A 1TWAA 3AGUA 1CGNA 5JLIA 5KYYA 1CGOA 4JVSA 1L7CA 4HFFB 2HUJA 5KYUA 3NMJA 1ZHZA 3UMKA 2IM8A 2PNOA 5COGA 2YHSA 3T6BA 3W4YA 5A6JA 2R7XA 4BJTA 3KYJA 2MYSA 2VB6A 3LUTB 1BR4A 3AGTA 2V3CC 1MMAA 3SZRA 3UGPA 1VLSA 1YYJA 2VCBA 1H9GA 3JRTA 3CAXA 4CX9A 4D4NA 4IWBA 2OEVA 1ZHYA 2R03A 4LLCA 1OR3A 4RDAA 2Y3GA 3C8GA 3K1HA 3RQFA 4BJ1A 3A9CA 4C3DA 4E7SA 4KBLA 2CW0F 1J8YF 3TD7A 3NRHA 3DD7A 3CQZA 2R7TA 2OJQA 1ORYA 4CJOA 4DRIB 1RKEA 2CNWA 4JE9A 3I4UA 3ATPA 4JTDB 5JRAA 4PFPA 1FMVA 3L0IA 2MHRA 4PJJA 3LNRA 4DOZA 3T6JA 4J32B 3B71A 3DI5A 3QVYA 2WL8A 3MLGA 1OXBA 4P9FA 3SXZA 2NUPB 1RJ9B 2HMZA 3NMKA 2QY9A 4I1OB 4MVSA 1OR2A 3M4BA 5A6BD 4KI2A 3AQCA 3PDMP 1HMOA 4MVUA 5AC5A 4U5EE 1N1CA 1LS1A 1ORJA 3GM3A 1O5HA 1JOGA 4CDYA 1M2VB 2DYSC 1ZHTA 2RD9A 3C62A 1NG1A 1PD0A 4PR9A 3RH3A 3U2MA 4J7TA 4YL0A 1MQVA 3SYNA 4X0RA 3N0TA 3QZCA 3DXJF 5L0CA 3FAPB 3DJUB 4BJ5A 3PHF2 3C8GD 3OEOA 2R25A 2OG2A 3C18A 3KMIA 1QLEC 3NKEA 4MVQA 3SP1A 3SXMA 1YYXA 5JP7A 2YL1A 1T6QA 5HSWA 1WWPA 3LJBA 5D91A 2CNWD 4O6MA 4U9DA 3LEVA 2GAQA 2H7OA 2HZ8A 3I5QA 4MQ9F 3S9OA 2ZXWC 3KH2A 3US6A 3JRMO 4D4XA 4DBQA 4W8PA 3LLIA 1O3UA 1ZVZA 2QNLA 3EGXA 3GM1A 1Y6DA 4MNDA 2F22A 4MW8A 1BR1A 1XZPA 1KU2A 2KSFA 3OA1A 3EZHA 3M15A 4N4WA 5KYWA 2BC5A 2GDCA 2W9YA 2EPLX 2HKVA 2XM0A 4MW3A 4GEHA 4YL1A 3V5XA 2H7BA 3H2UA 1TFOB 1Z6AA 4JTCB 1MMNA 2WVOA 3DZAA 4LDRA 3SNHA 3TQOA 3O39A 2GFHA 4MTGA 1ST6A 2AWCA 5T3TA 4ANJA 1NU7D 5CIVA 1VYIA 2J8WA 3ZVRA 2QE9A 3U3BA 2Q00A 3H2VA 4JTAB 2J9UA 3DJNB 1AUEA 2YKZA 4HEAJ 4MVMA 4P9TA 1QVXA 4AL0A 1K04A 2G62A 2HJMA 2PF4E 2XLWA 3QW1A 4LDKA 3LESA 5JT4A 1I4YA 3W8HA 1GQAA 5B1AC 4RBNA 3N2ZB 1EKYA 3MBGA 4PJMA 4N6HA 4CS7A 5KYNA 1Z23A 4XPYA 3DAFA 3EFOB 2H7VC 1FFHA 4UDVA 1YA9A 2KJGA 1DOWA 1AVOB 2PP4A 4O6YA 3RVZA 2R7RA 1I5NA 1U89A 5T1DB 1A0BA 2LQGA 4ONSA 2J7PA 2NSFA 2X51A 1VOMA 4H4KC 3LLKA 1YAUO 3KYIA 2HSQA 1ZYRF 5DLJA 1RCPA 3G4ZA 4MTOA 2L81A 4BJ6C 1T9KA 3LS0A 3L8JA 2XLVA 4I44A 3DKAA 2FFHA 1GS9A 2G3VA 1D0ZA 1EA8A 2KQ9A 2XL6A 2ZXRA 3MYIA 4QDLA 4PFOA 5D92A 5L0FA 1A41A 2L7AA 1EI7A 4I1MA 4MVRA 3Q6NA 4U5CE 3RW0A 1V55C 2EILC 3F46A 1ZHXA 5COMA 2VASA 4IAOA 1PV3A 1YLMA 3A11A 3ABLC 3POVA 2IYLD 2WVNA 3HLZA 4JJGA 1R5ID 3TJ6A 1M57C 2E87A 4KNVA 4LACB 3U5SA 3EG9B 3UNGC 2IXMA 3C8ZA 4OIPF 4JC7A 3ITFA 4O6NA 3ZIBA 3ABMC 2Q7RA 2YL3A 3U8PA 4AE4A 3M79A 3S27A 5BQHA 3NMIA 2XL4A 3GODA 3IQ5A 4PACA 1KTMA 1QZXA 3GANA 2JPUA 2M4EA 1HMDA 1H7IA 2KW3C 3ZWIA 4AX2A 2OU6A 3W8IA 5KYYB 4FESA 2X0CA 3RF3A 3GEEA 2Y3HA 3ZTMA 1E2XA 4GQHA 3ZDLA 2DGJA 3G4XA 5KYUB 3KL4A 3S0XA 2J7PD 2W45A 2LFFA 2ZD9A 3IHUA 1QQ3A 3U8VA 3W2VA 2J9WA 5B3SC 2C03A 5A6BA 4CDVA 3UGOA 1FTSA 1U6HA 3K6BA 1TWHA 4XPXA 2PX0A 5BUOA 3B0UX 2A0BA 2D5RB 3EHNA 3B0PA 1K05A 1VLTA 5EGYA 2YL0A 256BA 2LK4A 2P0NA 3DE8A 3DM9B 3O6XA 4U5DE 3M1CB 4U9EA 3EZIA 1R4TA 1JPNA 2OQMA 3L8IA 5FZTA 2R9RB 3V7OA 4BG0A 3MYFA 3QMKA 2HV6A 3IPMO 4L6RA 1W2WA 3JYYA 4A4AA 4JEBA 4E0HA 1H9TA 1MMGA 1HE1A 3PCVA 3SXYA 4U5GA 4EUKB 4M63A 3GEHA 1OKKA 2R7QA 2XLDA 3ABKC 3M4CA 1XZQA 3EGDA 1JMWA 4LDQA 2JX0A 3HNLA 1AEPA 1LI5A 5EK0A 1Y4CA 4WGZA 2LIGA 2AP3A 2YWAA 3S84A 2KNHA 2R05A 4QI2A 1Z5ZA 3JT1A 3U0CA 4Q5SF 1FNTc 3EH2A 1T6IA 2J9VA 4E18A 4DBRA 2NG1A 3LS1A 5FCLA 3AG3C 4CIHA 1YARO 2OKUA 4JURI 4BJ6A 1Q0KA 2HJ3A 4OIQF 1VB5A 2Y39A 5E3CA 2WZLA 3NKDA 5TJ5E 2V26A 4K7BA 3S28A 4F4BA 1A7DA 2XLOA 2IXPA 2R7WA 4CSAA 4PK4A 2EPOA 1BDJB 1HW1A 3ASOC 1LKXA 1ZW2A 4XEKA 2ZPAA 4R32A 4CS9C 3QVZA 1RMVA 1FFTC 2HSBA 1U0BB 3HJCA 3FAJA 4PJNA 3ZQVA 4YL3A 2P6VA 4OD4A 1JAFA 2W4MA 2A69F 3JZ0A 1RJ9A 3EJNA 3FMSA 4EIYA 1OKKD 2KYHA 5L3VA 2LCHA 1UG7A 2OEXA 1LE4A 3WG7C 3X2QC 2UUIA 3EGXB 2CDQA 4YWQA 2O9XA 5B3IA 4K1OA 2R02A 1LE2A 1VK5A 4C7OA 4JIOA 1M2VA 4IJJA 5KYWB 3C7JA 4BPMA 1G4US 3KPHA 4CS8C 1CPRA 2W4BA 3QW0A 1JPJA 3T9OA 4E17A 3TOMA 2M64A 4EHPA 2TMVP 4CSAC 2XSEA 2L9JA 4RD9A 4KNWA 3NYMA 4IARA 2A1DD 3C63A 2CGEA 4E7ZA 4DJ9A 5EHHA 1BBHA 4P6IC 3L1MA 3DM5A 3Q7GA 4MVOA 3W2WA 3OWTA 2Y3DA 4K0DA 1K40A 2Q3TA 4DRJB 1XWJA 1A7VA 2AVKA 2PFDA 3IEEA 5L0HA 2Q4FA 3Q7LA 4PJLA 3GORA 1NBBA 4JCHA 1OCOC 1OW6A 3EH1A 3TOLA 1WGWA 4C3BA 1TR2A 2Q9AA 4FX5A 1OXKA 1LI7A 1SR2A 1D1CA 1SZIA 4JKVA 3U9MA 3UMIA 1IW7F 2Y3BA 3JSEO 3SXKA 3ZTZA 1E84A 1ORSC 2EIKC 2B0HA 5JSLA 4NTFA 4BEMJ 3RQGA 3AG1C 4C3EA 1PCXA 5JS5A 3S29A 1L3PA 2EPKX 4IRUA 1Q0GA 3ZQYA 5K0IA 4FAPB 2Q9CA 1S05A 1OCCC 4YK5A 4YT4A 1IZMA 4IAQA 4EBBA 3FOPA 5L0DA 1KNYA 2VCAA 3VM6A 4XEFA 5BQIA 3UR3C 3DAGA 1TQGA 1YVIA 4BEJA 4EKWA 1H6GA 1DOVA 1T6UA 3HNKA 5A6AA 3LNMB 4N06A 3RVYA 4YJWA 3CSKA 2QLAA 2QTVA 3EFOA 4YN0B 1YZAA 4A2NB 4NY3A 2YVKA 4XLNF 1B68A 3B9QA 1OCZC 1NU9C 3O10A 1T5OA 4U5HA 2C04A 5GPGB 1PD1A 2XXAB 4I3MA 4CS9A 5L0JA 1VMAA 3ASNC 2ASRA 1E86A 3R2PA 2DYRC 3AG4C 3AOUA 2XXAA 1C17M 4NTBA 1V54C 1NFNA 2P61A 4JJFA 4ULVA 2NUTA 1RXQA 5DVWA 4JEAA 3VRCA 3TULA 2WZFA 3TJ5A 3V5YA 4WABA 3FDQA 2QUPA 1I4ZA 2LD6A 4WJ0A 1SYQA 3ZC4A 1Q0FA 4JCZA 1OQCA 1WOLA 3ECSA 1YDIA 4XWJA 2L6HA 2Q9BA 4XLPF 1YZCA 4CS8A 3T4RA 1Z7Qc 2GA0A 3WAQA 1CGME 1FR0A 2D4UA 3EG9A 3GEIA 1WTYA 3C8GB 3K1IC 3WODF 4AK9A 2XS1A 4XQ1A 2A68F 1ZW3A 5B1BC 2YLDA 3F47A 2MWQA 5BQGA 3RYLA 5F5HA 5KYXA 3EQLF 2H8AA 3MX3A 2XLMA 1RKEB 4KC9A 4Z9IA 4Q7CA 1OCRC 3VYWA 4AL1A 3FHDA 4YT2A 5HV9A 3RKOF 4IGGA 3RQEA 1GGQA 1LS4A 2I8BA 2A0UA 2KK1A 2OJED 3FXHA 2ETSA 3K66A 2BE5F 3EGDB 4NCQA 4OD5A 5AC4A 3B0VC 1MNEA 1YA7O 3DMDA 5CI9A 2ICWG 2YLIA 1O87A 2L6FA 2FGYA 1C03A 2ZXOA 2P1AA 5L3QA 1OW7A 2IOQA 4U5FE 4W8KA 2CCYA 3X1OA 2R7OA 3GWNA 1ZHWA 2XLHA 4ZLCA 2R7SA 4NTAA 2EINC 3IQCA 3QTHA 1SF8A 3LAYA 1SMYF 1M2OA 4G7ZF 4H54A 3O55A 1HW2A 3B29A 1QSPA 3GM2A 5IY5C 2RSEB 4MTFA 2L6GA 3AJMA 3CEXA 3KKBA 3RFYA 2GWWA 1S7ZA 1LIHA 3VAYA 2HV7A 4YT8A 2R7VA 1NSGB 1JRAA 1TWGA 3FVYA 3GWLA 2OOCA 3RIPA 3JYHA 3V5ZA 3DE9A 4IB4A 1Z63A 4EBJA 5DQTA 2NUPA 3U3FA 3J06A 3EHMA 4EBKA 2YRFA 3VF0A 2I15A 1D0YA 2JD3A 1CPQA 4C7OB 3L34A 2A6EF 4DXWA 4ULWA 2LP4A 4JW1A 2EPMX 4ER9A 5L0IA 2ZXPA 4CDAA 4O79A 4OIRF 2PX3A 2XM4A 1D1AA 3IQ6A 3Q6MA 1FMWA 2KGOA 1JR8A 2WB7A 4MVZA 2WVQA 3I5PA 4WGYA 1GM5A 5E3AA 3U9JA 2VCCA 4CJGA 2HFIA 1QKRA 3HKKA 2VC9A 4GYTA 1V74B 1APCA 4CIPA 5COFA 4OIOF 5AGFA 1WATA 3R7CA 3NYLA 4DVZA 2NPUA 2B0JA 5A6KA 2HS5A 3EPVA 2Z15A 4MS2A 1ZU4A 3K1IA 3G50A 1D1BA 3N24A 1LVKA 2IXOA 4FWVA 5DQZA 4Q4ZF 1V4AA 1A7EA 3K33A 3LEOA 5F28E 4XTKA 2YEVA 2LFDA 3JTLO 1C02A 3MFNA 1G5ZA 2J9BA 4LERA 2J45A 2P7VA 2UUHA 3NYJA 2KC3A 5F5FA 2Y69C 2IBFA 2EIJC 3E9VA 1TWCA 4HFKB 2YL7A 1TFKB 1D0XA 1VYKA 1BZ4A 1J8MF 2A6HF 1MMDA 4NQFA 3U2LA 2EIMC 1RKCA 2EPNA 1Q0MA 3BEHA 3CZ6A 3AQBA 4O7GA 4XEVA 4EWCA 3UMHA 4XPWA 1E85A 1F1MA 2WZGA 4JRZA 3DWWA 1LM3B 2YQYA 1OW8A 4LLEA 2LSEA 1M6TA 3TK0A 1BR2A 3K7DA 1NLXA 4G7HF 4Z9HA 4DVYP 2IXNA 5E2QA 1WN0A 4CBEA 2J0XA 2XL8A 3HNJA 4QI0A 1VTMP 5E33A 4G0HA 1UFBA 2PBEA 2XS8A 3AG2C 1NFOA 3ZSUA 1ZZPA 1QPUA 3E70C 5CI8A 4AE4B 4E0IA 3NDBB 1TKNA 5DS6A 5L0GA 4ZLDA 1LPEA 1T01A 2NSGA 3S90A 4DRHB 1FAPB 3JCUQ 4OINF 3BRJA 2NUTB 2YZSA 3H65A 1Q0DA 4YT5A 5A69A 2DI3A 1NZEA 4J7YA 4G78A 4J30B 2R7UA 2AWYA 5T3WA 1E83A 2XRHA 5JVEA 4BJ5C 2OCCC 3PMRA 4G7OF 1WASA 4U5BE 3SEOA 3T6GB 4HE8D 3ZG1A 2J46A 1G4WR 1YJGA 2DB4A 2J0WA 1MNDA 5DS4A 5JUAA 4NC3A 1HY5A 3WHNA 1G8XA 3HNIA 2XLEA 4N6CA 2G3KA 3JSZA 3NG1A 4JZAA 1Z3IX 3HTKC 2AU5A 2FAPB 3IQTA 4Z9JA 2CYDA 5DS5A 2HMQA 3FOOA 4B6IA 1ZU5A 1EQ1A 2BL2A 5KYXB 2YLGA 2VH3A
chains in the Genus database with same CATH topology
4IARA 1RCPA 1CGNA 5JLIA 1CGOA 3C63A 2XLVA 3NMJA 1BBHA 3L1MA 2XL6A 1A7VA 3DE9A 4IB4A 1YYJA 1NBBA 1CPQA 3TOLA 4CX9A 4D4NA 4JKVA 4ER9A 2YL3A 3ZTZA 3U8PA 1E84A 3M79A 4CDAA 3NMIA 5JSLA 3IQ5A 2XM4A 3IQ6A 4WGYA 5JS5A 3ZWIA 4CJOA 3TOMA 4JE9A 3ZQYA 3ZTMA 5JRAA 4CJGA 1S05A 1QQ3A 4IAQA 3FOPA 1APCA 3QVYA 4CDVA 4CIPA 5AGFA 3NMKA 3M4BA 3HNKA 2QLAA 2YL0A 256BA 1YZAA 3DE8A 4U9EA 4CDYA 2J9BA 3C62A 1MQVA 4L6RA 4JEBA 1E86A 2YL7A 4ULVA 1YYXA 4JEAA 5JP7A 3VRCA 2XLDA 3M4CA 2YL1A 1E85A 3HNLA 1LM3B 4WGZA 1M6TA 4D4XA 1YZCA 2XL8A 3HNJA 3M15A 1QPUA 2BC5A 2XM0A 2YLDA 2XLOA 2XLMA 2J8WA 3QVZA 4N4WA 4U9DA 3ZQVA 1E83A 5JVEA 1JAFA 2YKZA 3QW1A 2XLWA 2YLIA 5JT4A 4EIYA 1GQAA 1EKYA 4N6HA 5B3IA 2CCYA 5JUAA 2XLHA 4NC3A 3HNIA 2XLEA 3FOOA 1CPRA 3QW0A 2YLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAR A;  1RCP A;  1CGN A;  5JLI A;  1CGO A;  3C63 A;  2XLV A;  3NMJ A;  1BBH A;  3L1M A;  2XL6 A;  1A7V A;  3DE9 A;  4IB4 A;  1YYJ A;  1NBB A;  1CPQ A;  3TOL A;  4CX9 A;  4D4N A;  4JKV A;  4ER9 A;  2YL3 A;  3ZTZ A;  3U8P A;  1E84 A;  3M79 A;  4CDA A;  3NMI A;  5JSL A;  3IQ5 A;  2XM4 A;  3IQ6 A;  4WGY A;  5JS5 A;  3ZWI A;  4CJO A;  3TOM A;  4JE9 A;  3ZQY A;  3ZTM A;  5JRA A;  4CJG A;  1S05 A;  1QQ3 A;  4IAQ A;  3FOP A;  1APC A;  3QVY A;  4CDV A;  4CIP A;  5AGF A;  3NMK A;  3M4B A;  3HNK A;  2QLA A;  2YL0 A;  256B A;  1YZA A;  3DE8 A;  4U9E A;  4CDY A;  2J9B A;  3C62 A;  1MQV A;  4L6R A;  4JEB A;  1E86 A;  2YL7 A;  4ULV A;  1YYX A;  4JEA A;  5JP7 A;  3VRC A;  2XLD A;  3M4C A;  2YL1 A;  1E85 A;  3HNL A;  1LM3 B;  4WGZ A;  1M6T A;  4D4X A;  1YZC A;  2XL8 A;  3HNJ A;  3M15 A;  1QPU A;  2BC5 A;  2XM0 A;  2YLD A;  2XLO A;  2XLM A;  2J8W A;  3QVZ A;  4N4W A;  4U9D A;  3ZQV A;  1E83 A;  5JVE A;  1JAF A;  2YKZ A;  3QW1 A;  2XLW A;  2YLI A;  5JT4 A;  4EIY A;  1GQA A;  1EKY A;  4N6H A;  5B3I A;  2CCY A;  5JUA A;  2XLH A;  4NC3 A;  3HNI A;  2XLE A;  3FOO A;  1CPR A;  3QW0 A;  2YLG A; 
#chains in the Genus database with same CATH topology
 1M56 C;  1HE9 A;  1TWA A;  3AGU A;  1CGN A;  5JLI A;  5KYY A;  1CGO A;  4JVS A;  1L7C A;  4HFF B;  2HUJ A;  5KYU A;  3NMJ A;  1ZHZ A;  3UMK A;  2IM8 A;  2PNO A;  5COG A;  2YHS A;  3T6B A;  3W4Y A;  5A6J A;  2R7X A;  4BJT A;  3KYJ A;  2MYS A;  2VB6 A;  3LUT B;  1BR4 A;  3AGT A;  2V3C C;  1MMA A;  3SZR A;  3UGP A;  1VLS A;  1YYJ A;  2VCB A;  1H9G A;  3JRT A;  3CAX A;  4CX9 A;  4D4N A;  4IWB A;  2OEV A;  1ZHY A;  2R03 A;  4LLC A;  1OR3 A;  4RDA A;  2Y3G A;  3C8G A;  3K1H A;  3RQF A;  4BJ1 A;  3A9C A;  4C3D A;  4E7S A;  4KBL A;  2CW0 F;  1J8Y F;  3TD7 A;  3NRH A;  3DD7 A;  3CQZ A;  2R7T A;  2OJQ A;  1ORY A;  4CJO A;  4DRI B;  1RKE A;  2CNW A;  4JE9 A;  3I4U A;  3ATP A;  4JTD B;  5JRA A;  4PFP A;  1FMV A;  3L0I A;  2MHR A;  4PJJ A;  3LNR A;  4DOZ A;  3T6J A;  4J32 B;  3B71 A;  3DI5 A;  3QVY A;  2WL8 A;  3MLG A;  1OXB A;  4P9F A;  3SXZ A;  2NUP B;  1RJ9 B;  2HMZ A;  3NMK A;  2QY9 A;  4I1O B;  4MVS A;  1OR2 A;  3M4B A;  5A6B D;  4KI2 A;  3AQC A;  3PDM P;  1HMO A;  4MVU A;  5AC5 A;  4U5E E;  1N1C A;  1LS1 A;  1ORJ A;  3GM3 A;  1O5H A;  1JOG A;  4CDY A;  1M2V B;  2DYS C;  1ZHT A;  2RD9 A;  3C62 A;  1NG1 A;  1PD0 A;  4PR9 A;  3RH3 A;  3U2M A;  4J7T A;  4YL0 A;  1MQV A;  3SYN A;  4X0R A;  3N0T A;  3QZC A;  3DXJ F;  5L0C A;  3FAP B;  3DJU B;  4BJ5 A;  3PHF 2;  3C8G D;  3OEO A;  2R25 A;  2OG2 A;  3C18 A;  3KMI A;  1QLE C;  3NKE A;  4MVQ A;  3SP1 A;  3SXM A;  1YYX A;  5JP7 A;  2YL1 A;  1T6Q A;  5HSW A;  1WWP A;  3LJB A;  5D91 A;  2CNW D;  4O6M A;  4U9D A;  3LEV A;  2GAQ A;  2H7O A;  2HZ8 A;  3I5Q A;  4MQ9 F;  3S9O A;  2ZXW C;  3KH2 A;  3US6 A;  3JRM O;  4D4X A;  4DBQ A;  4W8P A;  3LLI A;  1O3U A;  1ZVZ A;  2QNL A;  3EGX A;  3GM1 A;  1Y6D A;  4MND A;  2F22 A;  4MW8 A;  1BR1 A;  1XZP A;  1KU2 A;  2KSF A;  3OA1 A;  3EZH A;  3M15 A;  4N4W A;  5KYW A;  2BC5 A;  2GDC A;  2W9Y A;  2EPL X;  2HKV A;  2XM0 A;  4MW3 A;  4GEH A;  4YL1 A;  3V5X A;  2H7B A;  3H2U A;  1TFO B;  1Z6A A;  4JTC B;  1MMN A;  2WVO A;  3DZA A;  4LDR A;  3SNH A;  3TQO A;  3O39 A;  2GFH A;  4MTG A;  1ST6 A;  2AWC A;  5T3T A;  4ANJ A;  1NU7 D;  5CIV A;  1VYI A;  2J8W A;  3ZVR A;  2QE9 A;  3U3B A;  2Q00 A;  3H2V A;  4JTA B;  2J9U A;  3DJN B;  1AUE A;  2YKZ A;  4HEA J;  4MVM A;  4P9T A;  1QVX A;  4AL0 A;  1K04 A;  2G62 A;  2HJM A;  2PF4 E;  2XLW A;  3QW1 A;  4LDK A;  3LES A;  5JT4 A;  1I4Y A;  3W8H A;  1GQA A;  5B1A C;  4RBN A;  3N2Z B;  1EKY A;  3MBG A;  4PJM A;  4N6H A;  4CS7 A;  5KYN A;  1Z23 A;  4XPY A;  3DAF A;  3EFO B;  2H7V C;  1FFH A;  4UDV A;  1YA9 A;  2KJG A;  1DOW A;  1AVO B;  2PP4 A;  4O6Y A;  3RVZ A;  2R7R A;  1I5N A;  1U89 A;  5T1D B;  1A0B A;  2LQG A;  4ONS A;  2J7P A;  2NSF A;  2X51 A;  1VOM A;  4H4K C;  3LLK A;  1YAU O;  3KYI A;  2HSQ A;  1ZYR F;  5DLJ A;  1RCP A;  3G4Z A;  4MTO A;  2L81 A;  4BJ6 C;  1T9K A;  3LS0 A;  3L8J A;  2XLV A;  4I44 A;  3DKA A;  2FFH A;  1GS9 A;  2G3V A;  1D0Z A;  1EA8 A;  2KQ9 A;  2XL6 A;  2ZXR A;  3MYI A;  4QDL A;  4PFO A;  5D92 A;  5L0F A;  1A41 A;  2L7A A;  1EI7 A;  4I1M A;  4MVR A;  3Q6N A;  4U5C E;  3RW0 A;  1V55 C;  2EIL C;  3F46 A;  1ZHX A;  5COM A;  2VAS A;  4IAO A;  1PV3 A;  1YLM A;  3A11 A;  3ABL C;  3POV A;  2IYL D;  2WVN A;  3HLZ A;  4JJG A;  1R5I D;  3TJ6 A;  1M57 C;  2E87 A;  4KNV A;  4LAC B;  3U5S A;  3EG9 B;  3UNG C;  2IXM A;  3C8Z A;  4OIP F;  4JC7 A;  3ITF A;  4O6N A;  3ZIB A;  3ABM C;  2Q7R A;  2YL3 A;  3U8P A;  4AE4 A;  3M79 A;  3S27 A;  5BQH A;  3NMI A;  2XL4 A;  3GOD A;  3IQ5 A;  4PAC A;  1KTM A;  1QZX A;  3GAN A;  2JPU A;  2M4E A;  1HMD A;  1H7I A;  2KW3 C;  3ZWI A;  4AX2 A;  2OU6 A;  3W8I A;  5KYY B;  4FES A;  2X0C A;  3RF3 A;  3GEE A;  2Y3H A;  3ZTM A;  1E2X A;  4GQH A;  3ZDL A;  2DGJ A;  3G4X A;  5KYU B;  3KL4 A;  3S0X A;  2J7P D;  2W45 A;  2LFF A;  2ZD9 A;  3IHU A;  1QQ3 A;  3U8V A;  3W2V A;  2J9W A;  5B3S C;  2C03 A;  5A6B A;  4CDV A;  3UGO A;  1FTS A;  1U6H A;  3K6B A;  1TWH A;  4XPX A;  2PX0 A;  5BUO A;  3B0U X;  2A0B A;  2D5R B;  3EHN A;  3B0P A;  1K05 A;  1VLT A;  5EGY A;  2YL0 A;  256B A;  2LK4 A;  2P0N A;  3DE8 A;  3DM9 B;  3O6X A;  4U5D E;  3M1C B;  4U9E A;  3EZI A;  1R4T A;  1JPN A;  2OQM A;  3L8I A;  5FZT A;  2R9R B;  3V7O A;  4BG0 A;  3MYF A;  3QMK A;  2HV6 A;  3IPM O;  4L6R A;  1W2W A;  3JYY A;  4A4A A;  4JEB A;  4E0H A;  1H9T A;  1MMG A;  1HE1 A;  3PCV A;  3SXY A;  4U5G A;  4EUK B;  4M63 A;  3GEH A;  1OKK A;  2R7Q A;  2XLD A;  3ABK C;  3M4C A;  1XZQ A;  3EGD A;  1JMW A;  4LDQ A;  2JX0 A;  3HNL A;  1AEP A;  1LI5 A;  5EK0 A;  1Y4C A;  4WGZ A;  2LIG A;  2AP3 A;  2YWA A;  3S84 A;  2KNH A;  2R05 A;  4QI2 A;  1Z5Z A;  3JT1 A;  3U0C A;  4Q5S F;  1FNT c;  3EH2 A;  1T6I A;  2J9V A;  4E18 A;  4DBR A;  2NG1 A;  3LS1 A;  5FCL A;  3AG3 C;  4CIH A;  1YAR O;  2OKU A;  4JUR I;  4BJ6 A;  1Q0K A;  2HJ3 A;  4OIQ F;  1VB5 A;  2Y39 A;  5E3C A;  2WZL A;  3NKD A;  5TJ5 E;  2V26 A;  4K7B A;  3S28 A;  4F4B A;  1A7D A;  2XLO A;  2IXP A;  2R7W A;  4CSA A;  4PK4 A;  2EPO A;  1BDJ B;  1HW1 A;  3ASO C;  1LKX A;  1ZW2 A;  4XEK A;  2ZPA A;  4R32 A;  4CS9 C;  3QVZ A;  1RMV A;  1FFT C;  2HSB A;  1U0B B;  3HJC A;  3FAJ A;  4PJN A;  3ZQV A;  4YL3 A;  2P6V A;  4OD4 A;  1JAF A;  2W4M A;  2A69 F;  3JZ0 A;  1RJ9 A;  3EJN A;  3FMS A;  4EIY A;  1OKK D;  2KYH A;  5L3V A;  2LCH A;  1UG7 A;  2OEX A;  1LE4 A;  3WG7 C;  3X2Q C;  2UUI A;  3EGX B;  2CDQ A;  4YWQ A;  2O9X A;  5B3I A;  4K1O A;  2R02 A;  1LE2 A;  1VK5 A;  4C7O A;  4JIO A;  1M2V A;  4IJJ A;  5KYW B;  3C7J A;  4BPM A;  1G4U S;  3KPH A;  4CS8 C;  1CPR A;  2W4B A;  3QW0 A;  1JPJ A;  3T9O A;  4E17 A;  3TOM A;  2M64 A;  4EHP A;  2TMV P;  4CSA C;  2XSE A;  2L9J A;  4RD9 A;  4KNW A;  3NYM A;  4IAR A;  2A1D D;  3C63 A;  2CGE A;  4E7Z A;  4DJ9 A;  5EHH A;  1BBH A;  4P6I C;  3L1M A;  3DM5 A;  3Q7G A;  4MVO A;  3W2W A;  3OWT A;  2Y3D A;  4K0D A;  1K40 A;  2Q3T A;  4DRJ B;  1XWJ A;  1A7V A;  2AVK A;  2PFD A;  3IEE A;  5L0H A;  2Q4F A;  3Q7L A;  4PJL A;  3GOR A;  1NBB A;  4JCH A;  1OCO C;  1OW6 A;  3EH1 A;  3TOL A;  1WGW A;  4C3B A;  1TR2 A;  2Q9A A;  4FX5 A;  1OXK A;  1LI7 A;  1SR2 A;  1D1C A;  1SZI A;  4JKV A;  3U9M A;  3UMI A;  1IW7 F;  2Y3B A;  3JSE O;  3SXK A;  3ZTZ A;  1E84 A;  1ORS C;  2EIK C;  2B0H A;  5JSL A;  4NTF A;  4BEM J;  3RQG A;  3AG1 C;  4C3E A;  1PCX A;  5JS5 A;  3S29 A;  1L3P A;  2EPK X;  4IRU A;  1Q0G A;  3ZQY A;  5K0I A;  4FAP B;  2Q9C A;  1S05 A;  1OCC C;  4YK5 A;  4YT4 A;  1IZM A;  4IAQ A;  4EBB A;  3FOP A;  5L0D A;  1KNY A;  2VCA A;  3VM6 A;  4XEF A;  5BQI A;  3UR3 C;  3DAG A;  1TQG A;  1YVI A;  4BEJ A;  4EKW A;  1H6G A;  1DOV A;  1T6U A;  3HNK A;  5A6A A;  3LNM B;  4N06 A;  3RVY A;  4YJW A;  3CSK A;  2QLA A;  2QTV A;  3EFO A;  4YN0 B;  1YZA A;  4A2N B;  4NY3 A;  2YVK A;  4XLN F;  1B68 A;  3B9Q A;  1OCZ C;  1NU9 C;  3O10 A;  1T5O A;  4U5H A;  2C04 A;  5GPG B;  1PD1 A;  2XXA B;  4I3M A;  4CS9 A;  5L0J A;  1VMA A;  3ASN C;  2ASR A;  1E86 A;  3R2P A;  2DYR C;  3AG4 C;  3AOU A;  2XXA A;  1C17 M;  4NTB A;  1V54 C;  1NFN A;  2P61 A;  4JJF A;  4ULV A;  2NUT A;  1RXQ A;  5DVW A;  4JEA A;  3VRC A;  3TUL A;  2WZF A;  3TJ5 A;  3V5Y A;  4WAB A;  3FDQ A;  2QUP A;  1I4Z A;  2LD6 A;  4WJ0 A;  1SYQ A;  3ZC4 A;  1Q0F A;  4JCZ A;  1OQC A;  1WOL A;  3ECS A;  1YDI A;  4XWJ A;  2L6H A;  2Q9B A;  4XLP F;  1YZC A;  4CS8 A;  3T4R A;  1Z7Q c;  2GA0 A;  3WAQ A;  1CGM E;  1FR0 A;  2D4U A;  3EG9 A;  3GEI A;  1WTY A;  3C8G B;  3K1I C;  3WOD F;  4AK9 A;  2XS1 A;  4XQ1 A;  2A68 F;  1ZW3 A;  5B1B C;  2YLD A;  3F47 A;  2MWQ A;  5BQG A;  3RYL A;  5F5H A;  5KYX A;  3EQL F;  2H8A A;  3MX3 A;  2XLM A;  1RKE B;  4KC9 A;  4Z9I A;  4Q7C A;  1OCR C;  3VYW A;  4AL1 A;  3FHD A;  4YT2 A;  5HV9 A;  3RKO F;  4IGG A;  3RQE A;  1GGQ A;  1LS4 A;  2I8B A;  2A0U A;  2KK1 A;  2OJE D;  3FXH A;  2ETS A;  3K66 A;  2BE5 F;  3EGD B;  4NCQ A;  4OD5 A;  5AC4 A;  3B0V C;  1MNE A;  1YA7 O;  3DMD A;  5CI9 A;  2ICW G;  2YLI A;  1O87 A;  2L6F A;  2FGY A;  1C03 A;  2ZXO A;  2P1A A;  5L3Q A;  1OW7 A;  2IOQ A;  4U5F E;  4W8K A;  2CCY A;  3X1O A;  2R7O A;  3GWN A;  1ZHW A;  2XLH A;  4ZLC A;  2R7S A;  4NTA A;  2EIN C;  3IQC A;  3QTH A;  1SF8 A;  3LAY A;  1SMY F;  1M2O A;  4G7Z F;  4H54 A;  3O55 A;  1HW2 A;  3B29 A;  1QSP A;  3GM2 A;  5IY5 C;  2RSE B;  4MTF A;  2L6G A;  3AJM A;  3CEX A;  3KKB A;  3RFY A;  2GWW A;  1S7Z A;  1LIH A;  3VAY A;  2HV7 A;  4YT8 A;  2R7V A;  1NSG B;  1JRA A;  1TWG A;  3FVY A;  3GWL A;  2OOC A;  3RIP A;  3JYH A;  3V5Z A;  3DE9 A;  4IB4 A;  1Z63 A;  4EBJ A;  5DQT A;  2NUP A;  3U3F A;  3J06 A;  3EHM A;  4EBK A;  2YRF A;  3VF0 A;  2I15 A;  1D0Y A;  2JD3 A;  1CPQ A;  4C7O B;  3L34 A;  2A6E F;  4DXW A;  4ULW A;  2LP4 A;  4JW1 A;  2EPM X;  4ER9 A;  5L0I A;  2ZXP A;  4CDA A;  4O79 A;  4OIR F;  2PX3 A;  2XM4 A;  1D1A A;  3IQ6 A;  3Q6M A;  1FMW A;  2KGO A;  1JR8 A;  2WB7 A;  4MVZ A;  2WVQ A;  3I5P A;  4WGY A;  1GM5 A;  5E3A A;  3U9J A;  2VCC A;  4CJG A;  2HFI A;  1QKR A;  3HKK A;  2VC9 A;  4GYT A;  1V74 B;  1APC A;  4CIP A;  5COF A;  4OIO F;  5AGF A;  1WAT A;  3R7C A;  3NYL A;  4DVZ A;  2NPU A;  2B0J A;  5A6K A;  2HS5 A;  3EPV A;  2Z15 A;  4MS2 A;  1ZU4 A;  3K1I A;  3G50 A;  1D1B A;  3N24 A;  1LVK A;  2IXO A;  4FWV A;  5DQZ A;  4Q4Z F;  1V4A A;  1A7E A;  3K33 A;  3LEO A;  5F28 E;  4XTK A;  2YEV A;  2LFD A;  3JTL O;  1C02 A;  3MFN A;  1G5Z A;  2J9B A;  4LER A;  2J45 A;  2P7V A;  2UUH A;  3NYJ A;  2KC3 A;  5F5F A;  2Y69 C;  2IBF A;  2EIJ C;  3E9V A;  1TWC A;  4HFK B;  2YL7 A;  1TFK B;  1D0X A;  1VYK A;  1BZ4 A;  1J8M F;  2A6H F;  1MMD A;  4NQF A;  3U2L A;  2EIM C;  1RKC A;  2EPN A;  1Q0M A;  3BEH A;  3CZ6 A;  3AQB A;  4O7G A;  4XEV A;  4EWC A;  3UMH A;  4XPW A;  1E85 A;  1F1M A;  2WZG A;  4JRZ A;  3DWW A;  1LM3 B;  2YQY A;  1OW8 A;  4LLE A;  2LSE A;  1M6T A;  3TK0 A;  1BR2 A;  3K7D A;  1NLX A;  4G7H F;  4Z9H A;  4DVY P;  2IXN A;  5E2Q A;  1WN0 A;  4CBE A;  2J0X A;  2XL8 A;  3HNJ A;  4QI0 A;  1VTM P;  5E33 A;  4G0H A;  1UFB A;  2PBE A;  2XS8 A;  3AG2 C;  1NFO A;  3ZSU A;  1ZZP A;  1QPU A;  3E70 C;  5CI8 A;  4AE4 B;  4E0I A;  3NDB B;  1TKN A;  5DS6 A;  5L0G A;  4ZLD A;  1LPE A;  1T01 A;  2NSG A;  3S90 A;  4DRH B;  1FAP B;  3JCU Q;  4OIN F;  3BRJ A;  2NUT B;  2YZS A;  3H65 A;  1Q0D A;  4YT5 A;  5A69 A;  2DI3 A;  1NZE A;  4J7Y A;  4G78 A;  4J30 B;  2R7U A;  2AWY A;  5T3W A;  1E83 A;  2XRH A;  5JVE A;  4BJ5 C;  2OCC C;  3PMR A;  4G7O F;  1WAS A;  4U5B E;  3SEO A;  3T6G B;  4HE8 D;  3ZG1 A;  2J46 A;  1G4W R;  1YJG A;  2DB4 A;  2J0W A;  1MND A;  5DS4 A;  5JUA A;  4NC3 A;  1HY5 A;  3WHN A;  1G8X A;  3HNI A;  2XLE A;  4N6C A;  2G3K A;  3JSZ A;  3NG1 A;  4JZA A;  1Z3I X;  3HTK C;  2AU5 A;  2FAP B;  3IQT A;  4Z9J A;  2CYD A;  5DS5 A;  2HMQ A;  3FOO A;  4B6I A;  1ZU5 A;  1EQ1 A;  2BL2 A;  5KYX B;  2YLG A;  2VH3 A; 
#chains in the Genus database with same CATH homology
 4IAR A;  1RCP A;  1CGN A;  5JLI A;  1CGO A;  3C63 A;  2XLV A;  3NMJ A;  1BBH A;  3L1M A;  2XL6 A;  1A7V A;  3DE9 A;  4IB4 A;  1YYJ A;  1NBB A;  1CPQ A;  3TOL A;  4CX9 A;  4D4N A;  4JKV A;  4ER9 A;  2YL3 A;  3ZTZ A;  3U8P A;  1E84 A;  3M79 A;  4CDA A;  3NMI A;  5JSL A;  3IQ5 A;  2XM4 A;  3IQ6 A;  4WGY A;  5JS5 A;  3ZWI A;  4CJO A;  3TOM A;  4JE9 A;  3ZQY A;  3ZTM A;  5JRA A;  4CJG A;  1S05 A;  1QQ3 A;  4IAQ A;  3FOP A;  1APC A;  3QVY A;  4CDV A;  4CIP A;  5AGF A;  3NMK A;  3M4B A;  3HNK A;  2QLA A;  2YL0 A;  256B A;  1YZA A;  3DE8 A;  4U9E A;  4CDY A;  2J9B A;  3C62 A;  1MQV A;  4L6R A;  4JEB A;  1E86 A;  2YL7 A;  4ULV A;  1YYX A;  4JEA A;  5JP7 A;  3VRC A;  2XLD A;  3M4C A;  2YL1 A;  1E85 A;  3HNL A;  1LM3 B;  4WGZ A;  1M6T A;  4D4X A;  1YZC A;  2XL8 A;  3HNJ A;  3M15 A;  1QPU A;  2BC5 A;  2XM0 A;  2YLD A;  2XLO A;  2XLM A;  2J8W A;  3QVZ A;  4N4W A;  4U9D A;  3ZQV A;  1E83 A;  5JVE A;  1JAF A;  2YKZ A;  3QW1 A;  2XLW A;  2YLI A;  5JT4 A;  4EIY A;  1GQA A;  1EKY A;  4N6H A;  5B3I A;  2CCY A;  5JUA A;  2XLH A;  4NC3 A;  3HNI A;  2XLE A;  3FOO A;  1CPR A;  3QW0 A;  2YLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...