1QQ3A

The solution structure of the heme binding variant arg98cys of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of b- to c-type heme conversion in oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords CYTOCHROME B562
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qq3A00
4U9DA 2CCYA 1EKYA 2YL1A 2YLIA 1CPQA 5JP7A 1YZAA 3NMKA 4JKVA 3M4CA 3FOOA 4IAQA 5JS5A 2XM0A 5JT4A 3DE8A 4N4WA 3C63A 5JVEA 5AGFA 1RCPA 2XM4A 4D4NA 256BA 3ZTZA 4CIPA 1A7VA 2XLMA 1E86A 4CJOA 2XL8A 3QW1A 3ZWIA 1YZCA 1APCA 2YKZA 4JEBA 3NMIA 1BBHA 3QW0A 3DE9A 3QVYA 4L6RA 2YL7A 1GQAA 2J9BA 5JUAA 3FOPA 2J8WA 2BC5A 3M15A 4JE9A 4NC3A 4CX9A 2XLDA 4IB4A 4N6HA 4CDAA 3HNIA 5JRAA 1YYJA 1YYXA 1MQVA 3VRCA 3NMJA 2XLHA 3TOLA 2XLEA 1CGOA 4CDVA 5B3IA 1E85A 4CDYA 2YLGA 3HNLA 5JLIA 3C62A 1CGNA 3QVZA 3ZQVA 3ZQYA 1E83A 2YL0A 1CPRA 3TOMA 3U8PA 4ER9A 4JEAA 4IARA 3HNKA 4ULVA 3IQ5A 1JAFA 2XLWA 2XL6A 4D4XA 4WGZA 1S05A 1M6TA 2QLAA 2XLVA 3L1MA 1QPUA 4EIYA 1NBBA 3HNJA 1E84A 3M4BA 5JSLA 4U9EA 2YL3A 1LM3B 4CJGA 3ZTMA 2XLOA 3IQ6A 2YLDA 1QQ3A 3M79A 4WGYA
chains in the Genus database with same CATH superfamily
2CCYA 1EKYA 2I8BA 4XPXA 3HLZA 4U5CE 5DVWA 1QSPA 2YQYA 2YLIA 1CPQA 3U5SA 1MMNA 1L3PA 3W8IA 4B6IA 5KYWA 5HV9A 4I3MA 1GGQA 2CW0F 2LK4A 2NUPB 3E70C 3B29A 4Q5SF 5E3AA 1LS4A 2Y3DA 3DJUB 3AQBA 4JKVA 3BEHA 4DVZA 1YA9A 1C03A 4NTAA 1NG1A 3NKDA 1OW6A 2Z15A 4JTAB 2Q3TA 4MVOA 3OEOA 1R4TA 2HMZA 3FOOA 3IPMO 4NQFA 3N24A 5F5HA 1JMWA 1U6HA 3K7DA 1LI5A 1LKXA 1O3UA 2LCHA 5D92A 4JJGA 3MFNA 3VYWA 4YL0A 4PK4A 3GEEA 2ZXWC 1NLXA 2HS5A 4MW3A 3UMIA 2G62A 3WAQA 3Q7GA 1RCPA 1BR4A 4YL3A 2OG2A 3GWLA 4MVSA 2E87A 2H7BA 1FNTc 1M2VB 2KGOA 4J30B 4LLCA 4CIPA 2AWYA 5KYXA 1BDJB 3G50A 1YAUO 2XLMA 4JC7A 1E86A 3POVA 3MX3A 3I5PA 5DLJA 5COFA 2W9YA 2ZXPA 2FGYA 2LSEA 4JEBA 4JW1A 2R7WA 4HFKB 1QVXA 4RDAA 4XQ1A 4C3EA 3O10A 3TK0A 3V5YA 1H6GA 2KYHA 3KMIA 3LEVA 3QZCA 5E2QA 4U5HA 2CGEA 3EFOA 3HKKA 4MVRA 4MW8A 2R7XA 4W8PA 1OW7A 1RJ9A 1JOGA 4QDLA 1EQ1A 3B71A 4JVSA 2Q4FA 4JIOA 3S90A 2XLDA 3KKBA 1C17M 4H4KC 4IB4A 4BJ6C 2AP3A 2OU6A 4YT5A 3RF3A 2EPOA 2ICWG 3HNIA 3RYLA 3LS1A 3LS0A 4XTKA 2C03A 1FFHA 4GEHA 4NTBA 2MWQA 1FMVA 3LUTB 2VASA 2I15A 2EPLX 1NZEA 2Q7RA 4MTGA 2J9UA 2R03A 3SXZA 4CDVA 4C3BA 2ASRA 3M1CB 3K1IA 3TJ6A 1OR2A 2R02A 3EFOB 1OCOC 3EJNA 5DQZA 4AX2A 2HSQA 2YLGA 2B0JA 4IJJA 5JLIA 4M63A 2QNLA 3UGOA 2Y69C 1M2VA 2R7QA 3LNMB 2YL0A 1CPRA 3BRJA 4FESA 1CGME 2CYDA 2KW3C 1JPJA 2XRHA 3EQLF 3FVYA 1G5ZA 4Z9HA 5GPGB 3L8JA 2KSFA 4ULVA 3SEOA 4ER9A 1I4YA 4PFPA 5DS4A 4CBEA 3VM6A 4CS7A 2A0UA 2KQ9A 1T6UA 3IQ5A 2FFHA 2GA0A 2PF4E 4YT4A 3PCVA 5HSWA 2P1AA 3NYMA 2PBEA 2XLWA 2OCCC 1NFNA 3RKOF 3W4YA 2IXMA 3GEIA 3GODA 1W2WA 4QI2A 1DOVA 1FFTC 1G4WR 4LDKA 4NY3A 2XLVA 5COGA 4U5FE 3US6A 4O79A 2AVKA 4EKWA 2B0HA 4BJ5C 3T4RA 2R7TA 1ORJA 4EIYA 1FAPB 3KYJA 3PDMP 3HNJA 3KYIA 2QTVA 4J7TA 3M4BA 4YWQA 1OCRC 3U2LA 3N0TA 3GM3A 1YARO 5CI8A 3AJMA 1AVOB 3MYIA 3AQCA 1Q0FA 4EBBA 1QLEC 3A9CA 1A7EA 2WB7A 4DOZA 4CS8C 2M4EA 4MVQA 3DJNB 1XWJA 3JYYA 2P61A 5EGYA 2A69F 3V5XA 3GWNA 2WZLA 3DZAA 3Q6NA 4IGGA 3KPHA 3ZIBA 4WGYA 3L34A 2XS1A 5CI9A 5A6KA 4U5GA 1Y6DA 5A6AA 4U9DA 5KYXB 4W8KA 1ZHWA 2A1DD 2YL1A 1PD0A 1ZHYA 3JRTA 3U2MA 2LQGA 2LFDA 2HKVA 2XSEA 2AU5A 4EHPA 1TWAA 3EGDB 3RIPA 5BQHA 2CDQA 1OKKA 1QZXA 2C04A 3SNHA 2YZSA 2LD6A 3LESA 5FCLA 4N6CA 1A0BA 1PCXA 1RMVA 5AC5A 5L0DA 4LDRA 3EGXA 1FTSA 3ASNC 2A68F 3Q6MA 1ZHXA 5JS5A 2XXAA 1WTYA 1EA8A 3WHNA 2QY9A 2KC3A 4CSAA 1OCZC 1KNYA 4U5DE 3U3FA 1RKEA 3L8IA 1OXBA 4P9TA 1MMGA 4UDVA 3CQZA 3S84A 3EH2A 4XPWA 4NTFA 3ZSUA 2Y3HA 4MTOA 1JR8A 2ETSA 4QI0A 3UMHA 2P0NA 4E7SA 1T5OA 3V5ZA 2V3CC 3H2VA 4PJLA 3LLIA 1LI7A 3SP1A 1H9TA 4Q4ZF 1MNEA 5A69A 5F5FA 1IW7F 4IAOA 4KBLA 2R25A 1C02A 1O5HA 2PX3A 2VCAA 4O6NA 4CJOA 3DM5A 1SMYF 1VB5A 4CS9A 1YZCA 3FHDA 5FZTA 1V55C 2EIMC 2IXNA 4OIQF 3ZVRA 2PP4A 2RD9A 2VC9A 1M57C 3QVYA 1TR2A 3NKEA 2DYRC 4L6RA 2DYSC 4PFOA 1M56C 1VOMA 2J8WA 2BC5A 2LFFA 1Z5ZA 2OEXA 3ABKC 3C8GA 3M15A 3MBGA 4KC9A 4CX9A 2EPMX 4EWCA 4N6HA 2HV7A 3EHMA 4HE8D 1WGWA 1YYJA 1YYXA 4FWVA 5COMA 2OQMA 1B68A 4OIRF 3AG4C 3L0IA 1L7CA 2X0CA 4CS9C 1J8YF 5D91A 5L0CA 5L0HA 4JJFA 2BL2A 3MLGA 1Q0KA 1VK5A 1T9KA 2R7OA 4YJWA 2ZXOA 3I4UA 3RW0A 2OJQA 1IZMA 1KU2A 3CEXA 3IEEA 3JSEO 5K0IA 1YVIA 3NYJA 3C62A 3ZQVA 2J9VA 1OW8A 4XWJA 1LPEA 1K05A 1G8XA 2YWAA 3TOMA 2W45A 3DMDA 2DI3A 2OEVA 3FAJA 2HV6A 2J45A 3UMKA 1FMWA 2WL8A 3JRMO 2UUIA 4IARA 4JEAA 3LJBA 4JCHA 4JURI 4MVMA 4Z9IA 4XPYA 3UNGC 2J0WA 5IY5C 1ORYA 3TJ5A 5KYYA 3ATPA 4IWBA 1VYKA 4DJ9A 3RQFA 2XL6A 1YLMA 2LP4A 5A6JA 4DRJB 4YT2A 4WGZA 4HFFB 2QLAA 4G78A 3L1MA 5A6BA 5E3CA 4Q7CA 3W2WA 2L81A 4OIOF 1MNDA 1KTMA 1NBBA 4C7OA 1WWPA 1G4US 2D5RB 1TFOB 2GFHA 2WZGA 4AE4A 2X51A 1E84A 2NSFA 3RFYA 1K04A 1HMDA 2W4BA 3LEOA 2D4UA 5JSLA 5KYWB 2EPKX 1LIHA 2J46A 1D1AA 3RVYA 1GM5A 4PACA 3SXYA 3AG1C 2HSBA 5B3SC 1H7IA 3EH1A 3FDQA 3NDBB 1OQCA 2IBFA 3ECSA 3DWWA 4YK5A 1PD1A 3CSKA 4OIPF 1QQ3A 1LE2A 4FX5A 4ZLCA 1WOLA 4BPMA 5L0IA 3E9VA 1D0XA 5DS5A 2NG1A 1T6IA 3RQEA 2XS8A 2CNWD 3AGTA 3U8VA 1YA7O 3UR3C 4CIHA 5JP7A 3EG9B 1UG7A 1A7DA 1YZAA 3ABLC 3NMKA 2L9JA 1BR1A 1V54C 4J32B 2KK1A 2EINC 4O6MA 3SYNA 3VAYA 4MS2A 5L0GA 4ZLDA 5T3TA 4LDQA 4PJJA 3K33A 1TWHA 1ZU4A 2L7AA 2NUTB 2UUHA 3GM2A 3ZC4A 4AL0A 4ANJA 4IAQA 2XM0A 4ULWA 3J06A 5JT4A 1NSGB 2PX0A 3Q7LA 1ZYRF 1K40A 2IM8A 4H54A 5CIVA 1RKEB 1R5ID 2PNOA 3IQCA 1HE9A 3C63A 4A4AA 3DD7A 5JVEA 3NYLA 3EZHA 1VLSA 1D1CA 3LNRA 3FAPB 1Z7Qc 2GWWA 3JZ0A 2XM4A 4D4NA 1NU7D 2J7PA 2EIJC 3HTKC 3ITFA 2NUTA 3ZTZA 1F1MA 2AWCA 4G7OF 3O55A 4WABA 4JZAA 3CZ6A 2ZXRA 3K1HA 4O6YA 3UGPA 1VTMP 2WVNA 4MNDA 4OD5A 2ZD9A 1LVKA 1TWGA 4U5EE 1ZU5A 4CS8A 2XL8A 4A2NB 4LACB 4YN0B 3JCUQ 1U0BB 3GM1A 2RSEB 1VYIA 3K1IC 3S29A 2LIGA 3EZIA 2WZFA 4P9FA 3SZRA 3CAXA 4GYTA 1GQAA 2J7PD 2IYLD 2ZPAA 1HW1A 3FOPA 3FXHA 4K0DA 4LLEA 4ONSA 4XEVA 3R7CA 4AE4B 2L6FA 4JE9A 1Z63A 4XLNF 2OOCA 2Q9CA 1AEPA 4OINF 2IXOA 3AOUA 1MMAA 2GAQA 4MVZA 3JT1A 5A6BD 3VRCA 4DBRA 1TKNA 3NMJA 2VB6A 3B0PA 2TMVP 2YEVA 2MHRA 1ORSC 4C7OB 2Q9BA 3O39A 4OD4A 3RVZA 5B3IA 4XEFA 2H8AA 1OXKA 1T6QA 1ST6A 3G4XA 4I1MA 5KYUB 2GDCA 1V74B 1SR2A 4EBJA 3DXJF 2H7OA 3HNLA 1E2XA 3TD7A 5L3QA 1CGNA 3QVZA 4PJNA 4EBKA 4LERA 4G7ZF 1E83A 1OR3A 2A0BA 4K1OA 3RQGA 2W4MA 4E18A 5KYYB 2KJGA 4F4BA 1T01A 1UFBA 3F47A 4E0HA 4N06A 3FMSA 3HNKA 2WVQA 2WVOA 4R32A 5JRAA 5KYUA 1TFKB 5L3VA 3S9OA 2HJ3A 1JAFA 4XLPF 4JRZA 3DAFA 1HW2A 2DB4A 3N2ZB 1SF8A 5TJ5E 3B0UX 3TULA 2M64A 3LAYA 4D4XA 1WATA 3U9JA 2G3VA 1LS1A 1M6TA 2R05A 3WG7C 4MTFA 1QPUA 4DBQA 1VLTA 1ZHTA 2VCCA 4XEKA 4Z9JA 2FAPB 2YRFA 5EK0A 4MVUA 1OCCC 3B0VC 1U89A 3OWTA 2KNHA 2YHSA 4NCQA 4O7GA 4U9EA 5T3WA 3SXMA 4BG0A 1DOWA 1I4ZA 4DXWA 2DGJA 2HUJA 2YL3A 5EHHA 3HJCA 2R7SA 5DS6A 1V4AA 3EGDA 4CJGA 1RKCA 2PFDA 3NRHA 3T6JA 4BJTA 1J8MF 2YLDA 3M79A 2CNWA 3S0XA 3AG2C 2EIKC 1EI7A 1Z3IX 2MYSA 1WASA 3W8HA 3C8ZA 2A6EF 3QTHA 3X2QC 3C18A 2R7VA 4BEJA 2EPNA 5AC4A 4BEMJ 2G3KA 2YVKA 3ZDLA 1Z23A 3KH2A 3GORA 4IRUA 2NSGA 1D0YA 1LE4A 2OJED 3DKAA 2Y3BA 4DVYP 3M4CA 1NU9C 3U3BA 3WODF 2A6HF 2QUPA 4C3DA 3LLKA 1I5NA 2P6VA 3OA1A 3IHUA 3DE8A 2P7VA 4E0IA 4BJ1A 4J7YA 4N4WA 5DQTA 2OKUA 4AK9A 4U5BE 1Q0DA 5AGFA 5L0JA 4RD9A 5L0FA 3C8GD 256BA 1Q0MA 4X0RA 3AGUA 2HFIA 3EPVA 2NPUA 1ZVZA 4PJMA 1GS9A 3AG3C 1A7VA 3X1OA 4I1OB 1M2OA 1PV3A 3QW1A 2HMQA 3ZWIA 2YKZA 1APCA 5BQIA 4KI2A 3NMIA 1HY5A 1HE1A 1BBHA 1O87A 2Q9AA 3DE9A 3QMKA 3QW0A 5BUOA 2XL4A 4FAPB 1ZW2A 3ABMC 2YL7A 2J9BA 4G7HF 4DRHB 2JD3A 3DI5A 5JUAA 3W2VA 2R7UA 1SZIA 1H9GA 4K7BA 4NC3A 5BQGA 2QE9A 1A41A 1XZQA 4YL1A 4YT8A 2HJMA 5KYNA 3O6XA 1Z6AA 3DM9B 2JPUA 4JTCB 3S28A 4CDAA 1MQVA 2VCBA 4E7ZA 2XLHA 3G4ZA 3TOLA 1OKKD 2HZ8A 1N1CA 1BR2A 1CGOA 2XLEA 4RBNA 3K6BA 3VF0A 4CSAC 2R9RB 3JTLO 3A11A 1RJ9B 3C8GB 1E85A 3S27A 4KNVA 3SXKA 4CDYA 2JX0A 3I5QA 4EUKB 3H2UA 3GANA 2F22A 1JRAA 2Q00A 3F46A 3ZG1A 3T6BA 3GEHA 4JTDB 3ZQYA 3RH3A 3PHF2 3T6GB 3ASOC 3U9MA 3TQOA 5E33A 5F28E 4HEAJ 2IXPA 3U0CA 3EHNA 4DRIB 2J9WA 1TQGA 1ZZPA 1Y4CA 4AL1A 1S7ZA 1Q0GA 1QKRA 1VMAA 2J0XA 2L6GA 3JYHA 3H65A 3EGXB 2EILC 4PR9A 1D1BA 2BE5F 5B1BC 1YDIA 4BJ5A 1AUEA 1S05A 2H7VC 3T9OA 3U8PA 4WJ0A 1D0ZA 2VH3A 1NFOA 2Y3GA 1XZPA 4MQ9F 4G0HA 3C7JA 1BZ4A 3K66A 5B1AC 2IOQA 2O9XA 2XXAB 1JPNA 4P6IC 2R7RA 3NG1A 4GQHA 3EG9A 1MMDA 4JCZA 1WN0A 1RXQA 2Y39A 3IQTA 4I44A 3PMRA 3KL4A 3R2PA 4BJ6A 1HMOA 1LM3B 3B9QA 1ZHZA 1SYQA 3MYFA 2L6HA 3ZTMA 1FR0A 1YJGA 2NUPA 2XLOA 4E17A 3IQ6A 3JSZA 3V7OA 3DAGA 1ZW3A 1TWCA 5T1DB 4KNWA 2V26A
chains in the Genus database with same CATH topology
4U9DA 2CCYA 1EKYA 2YL1A 2YLIA 1CPQA 5JP7A 1YZAA 3NMKA 4JKVA 3M4CA 3FOOA 4IAQA 5JS5A 2XM0A 5JT4A 3DE8A 4N4WA 3C63A 5JVEA 5AGFA 1RCPA 2XM4A 4D4NA 256BA 3ZTZA 4CIPA 1A7VA 2XLMA 1E86A 4CJOA 2XL8A 3QW1A 3ZWIA 1YZCA 1APCA 2YKZA 4JEBA 3NMIA 1BBHA 3QW0A 3DE9A 3QVYA 4L6RA 2YL7A 1GQAA 2J9BA 5JUAA 3FOPA 2J8WA 2BC5A 3M15A 4JE9A 4NC3A 4CX9A 2XLDA 4IB4A 4N6HA 4CDAA 3HNIA 5JRAA 1YYJA 1YYXA 1MQVA 3VRCA 3NMJA 2XLHA 3TOLA 2XLEA 1CGOA 4CDVA 5B3IA 1E85A 4CDYA 2YLGA 3HNLA 5JLIA 3C62A 1CGNA 3QVZA 3ZQVA 3ZQYA 1E83A 2YL0A 1CPRA 3TOMA 3U8PA 4ER9A 4JEAA 4IARA 3HNKA 4ULVA 3IQ5A 1JAFA 2XLWA 2XL6A 4D4XA 4WGZA 1S05A 1M6TA 2QLAA 2XLVA 3L1MA 1QPUA 4EIYA 1NBBA 3HNJA 1E84A 3M4BA 5JSLA 4U9EA 2YL3A 1LM3B 4CJGA 3ZTMA 2XLOA 3IQ6A 2YLDA 1QQ3A 3M79A 4WGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9D A;  2CCY A;  1EKY A;  2YL1 A;  2YLI A;  1CPQ A;  5JP7 A;  1YZA A;  3NMK A;  4JKV A;  3M4C A;  3FOO A;  4IAQ A;  5JS5 A;  2XM0 A;  5JT4 A;  3DE8 A;  4N4W A;  3C63 A;  5JVE A;  5AGF A;  1RCP A;  2XM4 A;  4D4N A;  256B A;  3ZTZ A;  4CIP A;  1A7V A;  2XLM A;  1E86 A;  4CJO A;  2XL8 A;  3QW1 A;  3ZWI A;  1YZC A;  1APC A;  2YKZ A;  4JEB A;  3NMI A;  1BBH A;  3QW0 A;  3DE9 A;  3QVY A;  4L6R A;  2YL7 A;  1GQA A;  2J9B A;  5JUA A;  3FOP A;  2J8W A;  2BC5 A;  3M15 A;  4JE9 A;  4NC3 A;  4CX9 A;  2XLD A;  4IB4 A;  4N6H A;  4CDA A;  3HNI A;  5JRA A;  1YYJ A;  1YYX A;  1MQV A;  3VRC A;  3NMJ A;  2XLH A;  3TOL A;  2XLE A;  1CGO A;  4CDV A;  5B3I A;  1E85 A;  4CDY A;  2YLG A;  3HNL A;  5JLI A;  3C62 A;  1CGN A;  3QVZ A;  3ZQV A;  3ZQY A;  1E83 A;  2YL0 A;  1CPR A;  3TOM A;  3U8P A;  4ER9 A;  4JEA A;  4IAR A;  3HNK A;  4ULV A;  3IQ5 A;  1JAF A;  2XLW A;  2XL6 A;  4D4X A;  4WGZ A;  1S05 A;  1M6T A;  2QLA A;  2XLV A;  3L1M A;  1QPU A;  4EIY A;  1NBB A;  3HNJ A;  1E84 A;  3M4B A;  5JSL A;  4U9E A;  2YL3 A;  1LM3 B;  4CJG A;  3ZTM A;  2XLO A;  3IQ6 A;  2YLD A;  1QQ3 A;  3M79 A;  4WGY A; 
#chains in the Genus database with same CATH topology
 2CCY A;  1EKY A;  2I8B A;  4XPX A;  3HLZ A;  4U5C E;  5DVW A;  1QSP A;  2YQY A;  2YLI A;  1CPQ A;  3U5S A;  1MMN A;  1L3P A;  3W8I A;  4B6I A;  5KYW A;  5HV9 A;  4I3M A;  1GGQ A;  2CW0 F;  2LK4 A;  2NUP B;  3E70 C;  3B29 A;  4Q5S F;  5E3A A;  1LS4 A;  2Y3D A;  3DJU B;  3AQB A;  4JKV A;  3BEH A;  4DVZ A;  1YA9 A;  1C03 A;  4NTA A;  1NG1 A;  3NKD A;  1OW6 A;  2Z15 A;  4JTA B;  2Q3T A;  4MVO A;  3OEO A;  1R4T A;  2HMZ A;  3FOO A;  3IPM O;  4NQF A;  3N24 A;  5F5H A;  1JMW A;  1U6H A;  3K7D A;  1LI5 A;  1LKX A;  1O3U A;  2LCH A;  5D92 A;  4JJG A;  3MFN A;  3VYW A;  4YL0 A;  4PK4 A;  3GEE A;  2ZXW C;  1NLX A;  2HS5 A;  4MW3 A;  3UMI A;  2G62 A;  3WAQ A;  3Q7G A;  1RCP A;  1BR4 A;  4YL3 A;  2OG2 A;  3GWL A;  4MVS A;  2E87 A;  2H7B A;  1FNT c;  1M2V B;  2KGO A;  4J30 B;  4LLC A;  4CIP A;  2AWY A;  5KYX A;  1BDJ B;  3G50 A;  1YAU O;  2XLM A;  4JC7 A;  1E86 A;  3POV A;  3MX3 A;  3I5P A;  5DLJ A;  5COF A;  2W9Y A;  2ZXP A;  2FGY A;  2LSE A;  4JEB A;  4JW1 A;  2R7W A;  4HFK B;  1QVX A;  4RDA A;  4XQ1 A;  4C3E A;  3O10 A;  3TK0 A;  3V5Y A;  1H6G A;  2KYH A;  3KMI A;  3LEV A;  3QZC A;  5E2Q A;  4U5H A;  2CGE A;  3EFO A;  3HKK A;  4MVR A;  4MW8 A;  2R7X A;  4W8P A;  1OW7 A;  1RJ9 A;  1JOG A;  4QDL A;  1EQ1 A;  3B71 A;  4JVS A;  2Q4F A;  4JIO A;  3S90 A;  2XLD A;  3KKB A;  1C17 M;  4H4K C;  4IB4 A;  4BJ6 C;  2AP3 A;  2OU6 A;  4YT5 A;  3RF3 A;  2EPO A;  2ICW G;  3HNI A;  3RYL A;  3LS1 A;  3LS0 A;  4XTK A;  2C03 A;  1FFH A;  4GEH A;  4NTB A;  2MWQ A;  1FMV A;  3LUT B;  2VAS A;  2I15 A;  2EPL X;  1NZE A;  2Q7R A;  4MTG A;  2J9U A;  2R03 A;  3SXZ A;  4CDV A;  4C3B A;  2ASR A;  3M1C B;  3K1I A;  3TJ6 A;  1OR2 A;  2R02 A;  3EFO B;  1OCO C;  3EJN A;  5DQZ A;  4AX2 A;  2HSQ A;  2YLG A;  2B0J A;  4IJJ A;  5JLI A;  4M63 A;  2QNL A;  3UGO A;  2Y69 C;  1M2V A;  2R7Q A;  3LNM B;  2YL0 A;  1CPR A;  3BRJ A;  4FES A;  1CGM E;  2CYD A;  2KW3 C;  1JPJ A;  2XRH A;  3EQL F;  3FVY A;  1G5Z A;  4Z9H A;  5GPG B;  3L8J A;  2KSF A;  4ULV A;  3SEO A;  4ER9 A;  1I4Y A;  4PFP A;  5DS4 A;  4CBE A;  3VM6 A;  4CS7 A;  2A0U A;  2KQ9 A;  1T6U A;  3IQ5 A;  2FFH A;  2GA0 A;  2PF4 E;  4YT4 A;  3PCV A;  5HSW A;  2P1A A;  3NYM A;  2PBE A;  2XLW A;  2OCC C;  1NFN A;  3RKO F;  3W4Y A;  2IXM A;  3GEI A;  3GOD A;  1W2W A;  4QI2 A;  1DOV A;  1FFT C;  1G4W R;  4LDK A;  4NY3 A;  2XLV A;  5COG A;  4U5F E;  3US6 A;  4O79 A;  2AVK A;  4EKW A;  2B0H A;  4BJ5 C;  3T4R A;  2R7T A;  1ORJ A;  4EIY A;  1FAP B;  3KYJ A;  3PDM P;  3HNJ A;  3KYI A;  2QTV A;  4J7T A;  3M4B A;  4YWQ A;  1OCR C;  3U2L A;  3N0T A;  3GM3 A;  1YAR O;  5CI8 A;  3AJM A;  1AVO B;  3MYI A;  3AQC A;  1Q0F A;  4EBB A;  1QLE C;  3A9C A;  1A7E A;  2WB7 A;  4DOZ A;  4CS8 C;  2M4E A;  4MVQ A;  3DJN B;  1XWJ A;  3JYY A;  2P61 A;  5EGY A;  2A69 F;  3V5X A;  3GWN A;  2WZL A;  3DZA A;  3Q6N A;  4IGG A;  3KPH A;  3ZIB A;  4WGY A;  3L34 A;  2XS1 A;  5CI9 A;  5A6K A;  4U5G A;  1Y6D A;  5A6A A;  4U9D A;  5KYX B;  4W8K A;  1ZHW A;  2A1D D;  2YL1 A;  1PD0 A;  1ZHY A;  3JRT A;  3U2M A;  2LQG A;  2LFD A;  2HKV A;  2XSE A;  2AU5 A;  4EHP A;  1TWA A;  3EGD B;  3RIP A;  5BQH A;  2CDQ A;  1OKK A;  1QZX A;  2C04 A;  3SNH A;  2YZS A;  2LD6 A;  3LES A;  5FCL A;  4N6C A;  1A0B A;  1PCX A;  1RMV A;  5AC5 A;  5L0D A;  4LDR A;  3EGX A;  1FTS A;  3ASN C;  2A68 F;  3Q6M A;  1ZHX A;  5JS5 A;  2XXA A;  1WTY A;  1EA8 A;  3WHN A;  2QY9 A;  2KC3 A;  4CSA A;  1OCZ C;  1KNY A;  4U5D E;  3U3F A;  1RKE A;  3L8I A;  1OXB A;  4P9T A;  1MMG A;  4UDV A;  3CQZ A;  3S84 A;  3EH2 A;  4XPW A;  4NTF A;  3ZSU A;  2Y3H A;  4MTO A;  1JR8 A;  2ETS A;  4QI0 A;  3UMH A;  2P0N A;  4E7S A;  1T5O A;  3V5Z A;  2V3C C;  3H2V A;  4PJL A;  3LLI A;  1LI7 A;  3SP1 A;  1H9T A;  4Q4Z F;  1MNE A;  5A69 A;  5F5F A;  1IW7 F;  4IAO A;  4KBL A;  2R25 A;  1C02 A;  1O5H A;  2PX3 A;  2VCA A;  4O6N A;  4CJO A;  3DM5 A;  1SMY F;  1VB5 A;  4CS9 A;  1YZC A;  3FHD A;  5FZT A;  1V55 C;  2EIM C;  2IXN A;  4OIQ F;  3ZVR A;  2PP4 A;  2RD9 A;  2VC9 A;  1M57 C;  3QVY A;  1TR2 A;  3NKE A;  2DYR C;  4L6R A;  2DYS C;  4PFO A;  1M56 C;  1VOM A;  2J8W A;  2BC5 A;  2LFF A;  1Z5Z A;  2OEX A;  3ABK C;  3C8G A;  3M15 A;  3MBG A;  4KC9 A;  4CX9 A;  2EPM X;  4EWC A;  4N6H A;  2HV7 A;  3EHM A;  4HE8 D;  1WGW A;  1YYJ A;  1YYX A;  4FWV A;  5COM A;  2OQM A;  1B68 A;  4OIR F;  3AG4 C;  3L0I A;  1L7C A;  2X0C A;  4CS9 C;  1J8Y F;  5D91 A;  5L0C A;  5L0H A;  4JJF A;  2BL2 A;  3MLG A;  1Q0K A;  1VK5 A;  1T9K A;  2R7O A;  4YJW A;  2ZXO A;  3I4U A;  3RW0 A;  2OJQ A;  1IZM A;  1KU2 A;  3CEX A;  3IEE A;  3JSE O;  5K0I A;  1YVI A;  3NYJ A;  3C62 A;  3ZQV A;  2J9V A;  1OW8 A;  4XWJ A;  1LPE A;  1K05 A;  1G8X A;  2YWA A;  3TOM A;  2W45 A;  3DMD A;  2DI3 A;  2OEV A;  3FAJ A;  2HV6 A;  2J45 A;  3UMK A;  1FMW A;  2WL8 A;  3JRM O;  2UUI A;  4IAR A;  4JEA A;  3LJB A;  4JCH A;  4JUR I;  4MVM A;  4Z9I A;  4XPY A;  3UNG C;  2J0W A;  5IY5 C;  1ORY A;  3TJ5 A;  5KYY A;  3ATP A;  4IWB A;  1VYK A;  4DJ9 A;  3RQF A;  2XL6 A;  1YLM A;  2LP4 A;  5A6J A;  4DRJ B;  4YT2 A;  4WGZ A;  4HFF B;  2QLA A;  4G78 A;  3L1M A;  5A6B A;  5E3C A;  4Q7C A;  3W2W A;  2L81 A;  4OIO F;  1MND A;  1KTM A;  1NBB A;  4C7O A;  1WWP A;  1G4U S;  2D5R B;  1TFO B;  2GFH A;  2WZG A;  4AE4 A;  2X51 A;  1E84 A;  2NSF A;  3RFY A;  1K04 A;  1HMD A;  2W4B A;  3LEO A;  2D4U A;  5JSL A;  5KYW B;  2EPK X;  1LIH A;  2J46 A;  1D1A A;  3RVY A;  1GM5 A;  4PAC A;  3SXY A;  3AG1 C;  2HSB A;  5B3S C;  1H7I A;  3EH1 A;  3FDQ A;  3NDB B;  1OQC A;  2IBF A;  3ECS A;  3DWW A;  4YK5 A;  1PD1 A;  3CSK A;  4OIP F;  1QQ3 A;  1LE2 A;  4FX5 A;  4ZLC A;  1WOL A;  4BPM A;  5L0I A;  3E9V A;  1D0X A;  5DS5 A;  2NG1 A;  1T6I A;  3RQE A;  2XS8 A;  2CNW D;  3AGT A;  3U8V A;  1YA7 O;  3UR3 C;  4CIH A;  5JP7 A;  3EG9 B;  1UG7 A;  1A7D A;  1YZA A;  3ABL C;  3NMK A;  2L9J A;  1BR1 A;  1V54 C;  4J32 B;  2KK1 A;  2EIN C;  4O6M A;  3SYN A;  3VAY A;  4MS2 A;  5L0G A;  4ZLD A;  5T3T A;  4LDQ A;  4PJJ A;  3K33 A;  1TWH A;  1ZU4 A;  2L7A A;  2NUT B;  2UUH A;  3GM2 A;  3ZC4 A;  4AL0 A;  4ANJ A;  4IAQ A;  2XM0 A;  4ULW A;  3J06 A;  5JT4 A;  1NSG B;  2PX0 A;  3Q7L A;  1ZYR F;  1K40 A;  2IM8 A;  4H54 A;  5CIV A;  1RKE B;  1R5I D;  2PNO A;  3IQC A;  1HE9 A;  3C63 A;  4A4A A;  3DD7 A;  5JVE A;  3NYL A;  3EZH A;  1VLS A;  1D1C A;  3LNR A;  3FAP B;  1Z7Q c;  2GWW A;  3JZ0 A;  2XM4 A;  4D4N A;  1NU7 D;  2J7P A;  2EIJ C;  3HTK C;  3ITF A;  2NUT A;  3ZTZ A;  1F1M A;  2AWC A;  4G7O F;  3O55 A;  4WAB A;  4JZA A;  3CZ6 A;  2ZXR A;  3K1H A;  4O6Y A;  3UGP A;  1VTM P;  2WVN A;  4MND A;  4OD5 A;  2ZD9 A;  1LVK A;  1TWG A;  4U5E E;  1ZU5 A;  4CS8 A;  2XL8 A;  4A2N B;  4LAC B;  4YN0 B;  3JCU Q;  1U0B B;  3GM1 A;  2RSE B;  1VYI A;  3K1I C;  3S29 A;  2LIG A;  3EZI A;  2WZF A;  4P9F A;  3SZR A;  3CAX A;  4GYT A;  1GQA A;  2J7P D;  2IYL D;  2ZPA A;  1HW1 A;  3FOP A;  3FXH A;  4K0D A;  4LLE A;  4ONS A;  4XEV A;  3R7C A;  4AE4 B;  2L6F A;  4JE9 A;  1Z63 A;  4XLN F;  2OOC A;  2Q9C A;  1AEP A;  4OIN F;  2IXO A;  3AOU A;  1MMA A;  2GAQ A;  4MVZ A;  3JT1 A;  5A6B D;  3VRC A;  4DBR A;  1TKN A;  3NMJ A;  2VB6 A;  3B0P A;  2TMV P;  2YEV A;  2MHR A;  1ORS C;  4C7O B;  2Q9B A;  3O39 A;  4OD4 A;  3RVZ A;  5B3I A;  4XEF A;  2H8A A;  1OXK A;  1T6Q A;  1ST6 A;  3G4X A;  4I1M A;  5KYU B;  2GDC A;  1V74 B;  1SR2 A;  4EBJ A;  3DXJ F;  2H7O A;  3HNL A;  1E2X A;  3TD7 A;  5L3Q A;  1CGN A;  3QVZ A;  4PJN A;  4EBK A;  4LER A;  4G7Z F;  1E83 A;  1OR3 A;  2A0B A;  4K1O A;  3RQG A;  2W4M A;  4E18 A;  5KYY B;  2KJG A;  4F4B A;  1T01 A;  1UFB A;  3F47 A;  4E0H A;  4N06 A;  3FMS A;  3HNK A;  2WVQ A;  2WVO A;  4R32 A;  5JRA A;  5KYU A;  1TFK B;  5L3V A;  3S9O A;  2HJ3 A;  1JAF A;  4XLP F;  4JRZ A;  3DAF A;  1HW2 A;  2DB4 A;  3N2Z B;  1SF8 A;  5TJ5 E;  3B0U X;  3TUL A;  2M64 A;  3LAY A;  4D4X A;  1WAT A;  3U9J A;  2G3V A;  1LS1 A;  1M6T A;  2R05 A;  3WG7 C;  4MTF A;  1QPU A;  4DBQ A;  1VLT A;  1ZHT A;  2VCC A;  4XEK A;  4Z9J A;  2FAP B;  2YRF A;  5EK0 A;  4MVU A;  1OCC C;  3B0V C;  1U89 A;  3OWT A;  2KNH A;  2YHS A;  4NCQ A;  4O7G A;  4U9E A;  5T3W A;  3SXM A;  4BG0 A;  1DOW A;  1I4Z A;  4DXW A;  2DGJ A;  2HUJ A;  2YL3 A;  5EHH A;  3HJC A;  2R7S A;  5DS6 A;  1V4A A;  3EGD A;  4CJG A;  1RKC A;  2PFD A;  3NRH A;  3T6J A;  4BJT A;  1J8M F;  2YLD A;  3M79 A;  2CNW A;  3S0X A;  3AG2 C;  2EIK C;  1EI7 A;  1Z3I X;  2MYS A;  1WAS A;  3W8H A;  3C8Z A;  2A6E F;  3QTH A;  3X2Q C;  3C18 A;  2R7V A;  4BEJ A;  2EPN A;  5AC4 A;  4BEM J;  2G3K A;  2YVK A;  3ZDL A;  1Z23 A;  3KH2 A;  3GOR A;  4IRU A;  2NSG A;  1D0Y A;  1LE4 A;  2OJE D;  3DKA A;  2Y3B A;  4DVY P;  3M4C A;  1NU9 C;  3U3B A;  3WOD F;  2A6H F;  2QUP A;  4C3D A;  3LLK A;  1I5N A;  2P6V A;  3OA1 A;  3IHU A;  3DE8 A;  2P7V A;  4E0I A;  4BJ1 A;  4J7Y A;  4N4W A;  5DQT A;  2OKU A;  4AK9 A;  4U5B E;  1Q0D A;  5AGF A;  5L0J A;  4RD9 A;  5L0F A;  3C8G D;  256B A;  1Q0M A;  4X0R A;  3AGU A;  2HFI A;  3EPV A;  2NPU A;  1ZVZ A;  4PJM A;  1GS9 A;  3AG3 C;  1A7V A;  3X1O A;  4I1O B;  1M2O A;  1PV3 A;  3QW1 A;  2HMQ A;  3ZWI A;  2YKZ A;  1APC A;  5BQI A;  4KI2 A;  3NMI A;  1HY5 A;  1HE1 A;  1BBH A;  1O87 A;  2Q9A A;  3DE9 A;  3QMK A;  3QW0 A;  5BUO A;  2XL4 A;  4FAP B;  1ZW2 A;  3ABM C;  2YL7 A;  2J9B A;  4G7H F;  4DRH B;  2JD3 A;  3DI5 A;  5JUA A;  3W2V A;  2R7U A;  1SZI A;  1H9G A;  4K7B A;  4NC3 A;  5BQG A;  2QE9 A;  1A41 A;  1XZQ A;  4YL1 A;  4YT8 A;  2HJM A;  5KYN A;  3O6X A;  1Z6A A;  3DM9 B;  2JPU A;  4JTC B;  3S28 A;  4CDA A;  1MQV A;  2VCB A;  4E7Z A;  2XLH A;  3G4Z A;  3TOL A;  1OKK D;  2HZ8 A;  1N1C A;  1BR2 A;  1CGO A;  2XLE A;  4RBN A;  3K6B A;  3VF0 A;  4CSA C;  2R9R B;  3JTL O;  3A11 A;  1RJ9 B;  3C8G B;  1E85 A;  3S27 A;  4KNV A;  3SXK A;  4CDY A;  2JX0 A;  3I5Q A;  4EUK B;  3H2U A;  3GAN A;  2F22 A;  1JRA A;  2Q00 A;  3F46 A;  3ZG1 A;  3T6B A;  3GEH A;  4JTD B;  3ZQY A;  3RH3 A;  3PHF 2;  3T6G B;  3ASO C;  3U9M A;  3TQO A;  5E33 A;  5F28 E;  4HEA J;  2IXP A;  3U0C A;  3EHN A;  4DRI B;  2J9W A;  1TQG A;  1ZZP A;  1Y4C A;  4AL1 A;  1S7Z A;  1Q0G A;  1QKR A;  1VMA A;  2J0X A;  2L6G A;  3JYH A;  3H65 A;  3EGX B;  2EIL C;  4PR9 A;  1D1B A;  2BE5 F;  5B1B C;  1YDI A;  4BJ5 A;  1AUE A;  1S05 A;  2H7V C;  3T9O A;  3U8P A;  4WJ0 A;  1D0Z A;  2VH3 A;  1NFO A;  2Y3G A;  1XZP A;  4MQ9 F;  4G0H A;  3C7J A;  1BZ4 A;  3K66 A;  5B1A C;  2IOQ A;  2O9X A;  2XXA B;  1JPN A;  4P6I C;  2R7R A;  3NG1 A;  4GQH A;  3EG9 A;  1MMD A;  4JCZ A;  1WN0 A;  1RXQ A;  2Y39 A;  3IQT A;  4I44 A;  3PMR A;  3KL4 A;  3R2P A;  4BJ6 A;  1HMO A;  1LM3 B;  3B9Q A;  1ZHZ A;  1SYQ A;  3MYF A;  2L6H A;  3ZTM A;  1FR0 A;  1YJG A;  2NUP A;  2XLO A;  4E17 A;  3IQ6 A;  3JSZ A;  3V7O A;  3DAG A;  1ZW3 A;  1TWC A;  5T1D B;  4KNW A;  2V26 A; 
#chains in the Genus database with same CATH homology
 4U9D A;  2CCY A;  1EKY A;  2YL1 A;  2YLI A;  1CPQ A;  5JP7 A;  1YZA A;  3NMK A;  4JKV A;  3M4C A;  3FOO A;  4IAQ A;  5JS5 A;  2XM0 A;  5JT4 A;  3DE8 A;  4N4W A;  3C63 A;  5JVE A;  5AGF A;  1RCP A;  2XM4 A;  4D4N A;  256B A;  3ZTZ A;  4CIP A;  1A7V A;  2XLM A;  1E86 A;  4CJO A;  2XL8 A;  3QW1 A;  3ZWI A;  1YZC A;  1APC A;  2YKZ A;  4JEB A;  3NMI A;  1BBH A;  3QW0 A;  3DE9 A;  3QVY A;  4L6R A;  2YL7 A;  1GQA A;  2J9B A;  5JUA A;  3FOP A;  2J8W A;  2BC5 A;  3M15 A;  4JE9 A;  4NC3 A;  4CX9 A;  2XLD A;  4IB4 A;  4N6H A;  4CDA A;  3HNI A;  5JRA A;  1YYJ A;  1YYX A;  1MQV A;  3VRC A;  3NMJ A;  2XLH A;  3TOL A;  2XLE A;  1CGO A;  4CDV A;  5B3I A;  1E85 A;  4CDY A;  2YLG A;  3HNL A;  5JLI A;  3C62 A;  1CGN A;  3QVZ A;  3ZQV A;  3ZQY A;  1E83 A;  2YL0 A;  1CPR A;  3TOM A;  3U8P A;  4ER9 A;  4JEA A;  4IAR A;  3HNK A;  4ULV A;  3IQ5 A;  1JAF A;  2XLW A;  2XL6 A;  4D4X A;  4WGZ A;  1S05 A;  1M6T A;  2QLA A;  2XLV A;  3L1M A;  1QPU A;  4EIY A;  1NBB A;  3HNJ A;  1E84 A;  3M4B A;  5JSL A;  4U9E A;  2YL3 A;  1LM3 B;  4CJG A;  3ZTM A;  2XLO A;  3IQ6 A;  2YLD A;  1QQ3 A;  3M79 A;  4WGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...