1QQ3A

The solution structure of the heme binding variant arg98cys of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title Structural consequences of b- to c-type heme conversion in oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qq3A00
2XL8A 1M6TA 4D4NA 2XLMA 1S05A 4ER9A 4EIYA 1CPRA 1BBHA 5JRAA 3NMIA 1CGNA 4CIPA 3FOPA 2XM0A 3C62A 3QVZA 3ZTZA 2YLGA 2J9BA 1CGOA 1A7VA 2YL1A 2YL3A 5JLIA 1GQAA 2XLOA 3NMJA 2XL6A 5JP7A 4D4XA 1CPQA 2J8WA 1YYXA 4WGZA 4IB4A 3FOOA 4U9DA 2XLDA 2QLAA 3TOMA 2BC5A 4IARA 3NMKA 4JEBA 3DE8A 3M4CA 4CDVA 1JAFA 4ULVA 4L6RA 3QW1A 5JVEA 3C63A 2YLIA 2XLHA 3M4BA 4CJOA 3HNIA 3HNJA 1EKYA 4N4WA 2YL7A 3VRCA 1YZAA 1APCA 4JKVA 4NC3A 5JUAA 2YKZA 3L1MA 3QW0A 1YYJA 1RCPA 5JSLA 2XLWA 2CCYA 1QPUA 2YLDA 4CJGA 1E85A 3IQ5A 3M15A 3TOLA 1YZCA 1NBBA 3M79A 1E83A 3QVYA 3ZWIA 3ZTMA 3ZQYA 5JT4A 1LM3B 5B3IA 2XM4A 3U8PA 5AGFA 4JE9A 3DE9A 4CDAA 4U9EA 3HNLA 3ZQVA 1E84A 4JEAA 4IAQA 2XLEA 1E86A 3HNKA 3IQ6A 4WGYA 256BA 4CX9A 4CDYA 4N6HA 5JS5A 2YL0A 1QQ3A 2XLVA 1MQVA
chains in the Genus database with same CATH superfamily
3NG1A 2LCHA 1F1MA 2EPMX 2G3KA 3DI5A 3DJNB 2W4BA 4D4NA 2NSFA 2GA0A 4AE4A 1S05A 3SXKA 5A69A 4BJ6A 1ZHZA 3SXYA 2Q00A 4EIYA 4U5HA 1ORYA 4RD9A 1E2XA 2LSEA 3QTHA 3RYLA 1RJ9B 3PHF2 1CGNA 4DOZA 4LDRA 3K1IA 2L6FA 2XM0A 1H7IA 1V54C 1ZHTA 2PX3A 3N0TA 1AEPA 1Y4CA 3C62A 3L0IA 3Q6NA 4MTOA 3UMKA 2R7SA 3EHMA 3ITFA 3GM1A 4LLCA 4JTCB 4JVSA 2DI3A 4LACB 4DRJB 4BPMA 3MBGA 2YL3A 2VCBA 2HV6A 3JRTA 3EHNA 3Q6MA 2XL6A 3K1HA 3EJNA 1JMWA 1ZU4A 4I44A 4EBKA 5COGA 3AGUA 1HE1A 2Q3TA 3FOOA 4UDVA 1NZEA 3PCVA 1LE4A 4OINF 2DYSC 3T6JA 4DVZA 2BC5A 2P0NA 2PF4E 4XPWA 3W8IA 3RQGA 1TR2A 4C3BA 2R7VA 2B0JA 1M2VA 1Y6DA 3R2PA 2YZSA 1S7ZA 4YT2A 1Q0GA 5DQZA 1GGQA 3EGXB 3GANA 1Z3IX 5A6AA 5L3QA 1FMVA 1BDJB 2L6HA 1TFKB 3M4CA 3I5QA 1ZHXA 4MW3A 1HE9A 1KNYA 1JAFA 3VYWA 3S27A 3VAYA 1FNTc 3LEOA 2VB6A 3EPVA 3W4YA 3RKOF 1L3PA 4P9FA 1DOWA 2LQGA 4X0RA 3AGTA 5D92A 4YT5A 3X2QC 4BJ1A 4E7ZA 3C63A 4CSAC 1OKKA 2EPNA 1O87A 3CEXA 4O6MA 3HNIA 3HNJA 2P6VA 1WN0A 1U0BB 2C03A 1R5ID 4GEHA 1Z63A 1EQ1A 2AWCA 3SYNA 4O6NA 2CGEA 2W4MA 3B29A 3GEHA 4C7OB 1FTSA 2CW0F 3MYIA 1QVXA 3OEOA 4BEJA 2W9YA 3H2UA 1SZIA 1RKEA 3RW0A 4FAPB 2R7RA 1H9GA 2O9XA 3B0VC 1YYJA 4R32A 1M2OA 3CZ6A 2XLWA 1CGME 2M64A 3CQZA 1LS4A 1TWHA 2MYSA 1QPUA 2FFHA 3LUTB 5A6KA 5FCLA 5DS5A 4CJGA 1Q0FA 1E85A 4OIPF 2AWYA 4U5CE 3TOLA 2H7BA 4G7HF 2IBFA 2R02A 3KPHA 3RQEA 5B3SC 5CI9A 5L0FA 2FGYA 5T3WA 4NQFA 2VCAA 2ICWG 4WABA 4OD4A 1MNEA 3RFYA 4Z9IA 3S28A 2XS8A 1EA8A 2J0XA 1PD0A 2P1AA 1MMDA 2XM4A 3DMDA 3KYIA 4FWVA 5L0JA 3U2LA 3V7OA 2YWAA 3I5PA 3NKDA 4JTAB 2KGOA 3ASNC 2B0HA 2OU6A 4CS9A 3MX3A 3S29A 2L7AA 2W45A 2BE5F 3JT1A 4K0DA 4LDQA 4PJJA 4CDAA 4U9EA 4IGGA 5AC5A 1YARO 1LE2A 1V55C 1JPJA 3K6BA 2NG1A 2WVNA 1NLXA 1G5ZA 1YAUO 2DYRC 3EH1A 2KC3A 3E70C 3K7DA 4WGYA 256BA 3WG7C 1LPEA 2A6EF 3UMIA 4CX9A 5F5FA 2HMZA 4W8PA 5KYYA 4E7SA 5L0GA 1ZHWA 3B9QA 3JYHA 3HTKC 1XZQA 4G7ZF 2LP4A 1WOLA 2XL8A 3FAJA 2XL4A 3H2VA 1JPNA 1XZPA 1GS9A 3E9VA 2EIKC 1OR3A 2KQ9A 4JZAA 1Z5ZA 4BJ5A 1Z23A 4KNVA 2V26A 1BBHA 3OA1A 2WVOA 1R4TA 3FXHA 3NMIA 1RKCA 3FVYA 3TULA 3V5ZA 3JTLO 3F46A 4IWBA 3FOPA 5BQHA 3A11A 4CS8C 2AVKA 4LERA 3T4RA 2Q7RA 3C8GD 2Y3GA 4XWJA 1C02A 3EG9B 1A7VA 3EGDB 2YL1A 3ZDLA 4I3MA 2IOQA 5KYWB 5DQTA 5L0CA 3GEIA 3K33A 2JD3A 3NMJA 4AK9A 5HSWA 1T6IA 3EQLF 1MMGA 3FAPB 2J9VA 3IQCA 5JP7A 3SXZA 1CPQA 3TD7A 4BG0A 2WZGA 3JYYA 2HUJA 1JR8A 1YYXA 3GWLA 2VC9A 2J0WA 4WGZA 3UMHA 1K40A 4FX5A 1ZU5A 5GPGB 3K66A 2XLDA 4EBBA 4PFPA 2QLAA 1WWPA 2I15A 4PFOA 4G78A 1OKKD 2OKUA 3O10A 4GYTA 4Q5SF 2J7PA 3MFNA 1K04A 3AJMA 3C8ZA 3GODA 1ZW2A 2IYLD 3WODF 4CDVA 1MMAA 2PX0A 3ZIBA 4L6RA 3UNGC 3QW1A 1HW2A 5COMA 4DBRA 3EH2A 4U5FE 4B6IA 2KYHA 3JZ0A 1W2WA 2CYDA 2Q9AA 2PNOA 1SMYF 3AG3C 3LLKA 3NYLA 2YLIA 2RSEB 3DAGA 5BQGA 1A7DA 3POVA 4N4WA 3EZIA 4CIHA 1SR2A 2L81A 4M63A 3VRCA 4XEVA 4NTFA 3C8GA 4P6IC 3T6GB 4Z9JA 3CAXA 3JSZA 3X1OA 1TWCA 2TMVP 4MQ9F 2QNLA 4AE4B 3EGXA 2A69F 2MHRA 4E17A 4MVUA 2YKZA 3L1MA 1NFOA 1HY5A 1A7EA 1RCPA 5HV9A 3ABMC 4J7TA 4IAOA 4JC7A 1B68A 2CCYA 2EPKX 3C18A 1IW7F 4YJWA 3T9OA 4YT4A 1TQGA 3HJCA 3Q7LA 3AG4C 3IQ5A 5KYUB 2DB4A 5E3AA 2XRHA 3NKEA 4Q4ZF 1YZCA 1NBBA 1A0BA 3GWNA 3BRJA 3QVYA 3QZCA 1QLEC 5B1BC 3UGOA 3GM2A 1OW8A 3JSEO 3ZQYA 4EKWA 5JT4A 2ZD9A 2EINC 2X0CA 2Y3BA 2HKVA 3MLGA 3U8PA 5AGFA 2HFIA 3KKBA 2QUPA 2G62A 2WVQA 4ZLDA 3IEEA 1QSPA 3DE9A 4JJFA 4JIOA 4G7OF 3HNLA 1Q0KA 2KJGA 2NSGA 5D91A 1FMWA 4G0HA 4JEAA 2NUPB 1E84A 2R7OA 3NYJA 2ZXPA 2Y39A 2R7QA 1QZXA 2ETSA 1FFTC 1PD1A 1MMNA 3IQ6A 3L34A 4YN0B 5COFA 2HZ8A 4A2NB 2EILC 5BQIA 5L3VA 2UUHA 2YL0A 3QMKA 3DWWA 4MVMA 5TJ5E 4OIQF 2XS1A 3RH3A 4I1OB 3KH2A 3T6BA 3F47A 1ORJA 3DAFA 3MYFA 2YRFA 2P61A 4YL0A 4RDAA 1TWGA 3FDQA 2XLMA 4W8KA 5B1AC 1LI7A 3ZVRA 1NG1A 5F5HA 1C03A 3TK0A 1CPRA 1QKRA 1T9KA 4GQHA 1PCXA 5JRAA 2XXAA 3ASOC 3ABKC 3BEHA 1TFOB 2Y3DA 4MTGA 1V4AA 3RQFA 2R7XA 2ZXOA 3DM5A 3G4XA 4PJLA 2H7OA 3JCUQ 3ZTZA 5T3TA 3RF3A 2YLGA 3KL4A 1VTMP 2J9BA 1OW6A 1G4US 5A6BA 1CGOA 4LDKA 5CI8A 3ZSUA 3N2ZB 3RVZA 5JLIA 3S84A 1GQAA 1VK5A 1ZHYA 2Y69C 2XLOA 2GWWA 4WJ0A 4ONSA 4MTFA 4DRIB 3L8IA 3U3FA 1M56C 2A6HF 3WAQA 4ANJA 1OCOC 2J7PD 5E33A 4N6CA 3M1CB 3W2WA 5EHHA 1EI7A 2NUTB 1BR1A 1WGWA 3AQBA 3O55A 4U9DA 1OQCA 4CS9C 3DJUB 1XWJA 3B71A 3TOMA 2ZXWC 3AOUA 4IARA 1ZW3A 3V5XA 1G8XA 1LKXA 5A6JA 1I5NA 4JEBA 1U89A 2HV7A 2F22A 1LI5A 2ZPAA 3EGDA 3SEOA 1H9TA 4CS7A 2OEXA 4KNWA 1V74B 4DBQA 3V5YA 5KYWA 3SNHA 1C17M 2L9JA 5KYXB 4ULVA 3JRMO 5E3CA 1VB5A 5JVEA 3G50A 4F4BA 4I1MA 4XEFA 1FAPB 3EFOB 1IZMA 1YA7O 1A41A 1T6UA 2IXNA 1O3UA 4ZLCA 4N06A 2KSFA 4KC9A 4XPYA 4NTBA 3U0CA 1OCCC 3AG2C 5IY5C 1VYIA 2DGJA 2LIGA 2HMQA 1YZAA 1RJ9A 4C3EA 3O39A 1APCA 1VYKA 4BJ5C 2EIJC 1NFNA 2WL8A 5AC4A 4MS2A 1WASA 3U5SA 2VH3A 3U3BA 1OR2A 4DVYP 4QI2A 3QW0A 2VASA 3O6XA 4MW8A 3U9JA 4KI2A 4NCQA 5JSLA 1UG7A 2YVKA 2R9RB 1HMOA 4EHPA 2YLDA 1ZZPA 2QE9A 2VCCA 4BEMJ 1FR0A 4E0HA 5DLJA 1ZYRF 3M15A 1YA9A 2R03A 1LS1A 4FESA 4MVZA 5L0HA 3KMIA 2WZLA 3ZWIA 1L7CA 1UFBA 2A0UA 1OCRC 1Z6AA 2UUIA 2OQMA 1I4YA 2AU5A 1TWAA 1LM3B 2Q9CA 5B3IA 2V3CC 2OCCC 4YL1A 2R7UA 2C04A 3UR3C 3WHNA 3ZG1A 3PDMP 4MVRA 4JCZA 1DOVA 1K05A 2J9UA 4IRUA 4QDLA 3G4ZA 4XQ1A 2A0BA 4XLPF 3GEEA 1T6QA 1T01A 2P7VA 4BJ6C 3LLIA 2LFDA 1YJGA 3ZC4A 4EWCA 1O5HA 4NY3A 4JRZA 2EPOA 3J06A 2PP4A 2OG2A 1OXKA 4U5BE 1ORSC 2RD9A 3NYMA 5KYUA 2LFFA 2A1DD 2JX0A 2OJQA 1FFHA 1VOMA 2XLEA 3K1IC 3L8JA 3LNMB 4HE8D 2IM8A 2IXMA 5L0IA 1E86A 3I4UA 4O6YA 2EPLX 3U9MA 2QTVA 1LVKA 5EK0A 2HJMA 4N6HA 5JS5A 2R7WA 1YVIA 1D1BA 2H7VC 2XLVA 3TJ5A 1MQVA 3ATPA 4CSAA 3PMRA 1WATA 4MVSA 2CNWA 4OIOF 4HFKB 2PFDA 2ZXRA 1M6TA 2A68F 3TJ6A 5FZTA 4C7OA 1Q0DA 4EUKB 1WTYA 5L0DA 3W8HA 2AP3A 4ER9A 5A6BD 2NUPA 3LS1A 1SF8A 2MWQA 3ECSA 4HEAJ 3C8GB 2NPUA 4J32B 4U5GA 4CBEA 1JRAA 1SYQA 1RMVA 2EIMC 1Q0MA 4Z9HA 4IJJA 3R7CA 4NTAA 4CIPA 5KYNA 3LS0A 4JTDB 5EGYA 2JPUA 2ASRA 1J8MF 3QVZA 2J45A 2GAQA 3DD7A 1BR2A 3US6A 3DKAA 5DS4A 2Y3HA 4XLNF 2HSQA 4H4KC 1M2VB 2KNHA 3S90A 1T5OA 4J30B 3IHUA 2Q4FA 1HMDA 2OOCA 2M4EA 3LEVA 2WB7A 3LAYA 2I8BA 4H54A 4YK5A 5E2QA 4D4XA 1JOGA 2J8WA 3RIPA 2GFHA 3B0PA 1OXBA 2QY9A 2CDQA 4U5EE 3LJBA 4IB4A 5DS6A 3GM3A 4OIRF 4YL3A 2R7TA 4MNDA 5T1DB 3VF0A 1H6GA 1N1CA 2Q9BA 3LESA 1U6HA 4JCHA 3SP1A 2YQYA 1BZ4A 3NMKA 4BJTA 2HS5A 1M57C 3DM9B 1VMAA 3C7JA 1KU2A 2OJED 3DZAA 3FMSA 3H65A 2OEVA 1YDIA 3DE8A 1RKEB 4JURI 3UGPA 3NDBB 4RBNA 3IQTA 4DXWA 4Q7CA 2D5RB 2X51A 4A4AA 3KYJA 3OWTA 3U8VA 3TQOA 5DVWA 1BR4A 4MVQA 1J8YF 3GORA 4C3DA 4XEKA 1LIHA 2XLHA 3M4BA 1AUEA 4CJOA 2NUTA 4ULWA 4E18A 2IXOA 1EKYA 1KTMA 1MNDA 2E87A 1OCZC 4O7GA 2YL7A 3A9CA 2J46A 3LNRA 4MVOA 4J7YA 2KK1A 3RVYA 4YT8A 2G3VA 4JW1A 3W2VA 1D0ZA 1PV3A 4JKVA 1G4WR 1OW7A 4PK4A 3U2MA 1NU9C 4NC3A 4PR9A 1Z7Qc 4E0IA 5JUAA 1ZVZA 1VLTA 2FAPB 5K0IA 2HSBA 2YHSA 3SZRA 2KW3C 5KYXA 2L6GA 3HKKA 2XXAB 4CS8A 4PJMA 3EG9A 3EZHA 4K1OA 4AL0A 3DXJF 3EFOA 3Q7GA 4P9TA 3NRHA 1HW1A 1D1AA 1VLSA 3S0XA 1I4ZA 1NU7D 1AVOB 3M79A 4QI0A 1E83A 2HJ3A 4OD5A 2XSEA 3SXMA 3ABLC 3ZTMA 5BUOA 3CSKA 4KBLA 2YEVA 3S9OA 3AQCA 4AL1A 5KYYB 4YWQA 4EBJA 2PBEA 3IPMO 4LLEA 2H8AA 4JE9A 1D0YA 4PACA 2D4UA 3AG1C 4DJ9A 3HLZA 4DRHB 2LK4A 5CIVA 1GM5A 1RXQA 3ZQVA 3B0UX 4U5DE 4XTKA 1D1CA 1TKNA 2CNWD 4IAQA 2WZFA 1NSGB 2IXPA 3FHDA 3HNKA 1D0XA 4JJGA 4PJNA 4K7BA 2R05A 2R25A 1YLMA 3VM6A 2LD6A 4O79A 2J9WA 2Z15A 4CDYA 4XPXA 4HFFB 1QQ3A 3N24A 2BL2A 4AX2A 2GDCA 5F28E 1ST6A
chains in the Genus database with same CATH topology
2XL8A 1M6TA 4D4NA 2XLMA 1S05A 4ER9A 4EIYA 1CPRA 1BBHA 5JRAA 3NMIA 1CGNA 4CIPA 3FOPA 2XM0A 3C62A 3QVZA 3ZTZA 2YLGA 2J9BA 1CGOA 1A7VA 2YL1A 2YL3A 5JLIA 1GQAA 2XLOA 3NMJA 2XL6A 5JP7A 4D4XA 1CPQA 2J8WA 1YYXA 4WGZA 4IB4A 3FOOA 4U9DA 2XLDA 2QLAA 3TOMA 2BC5A 4IARA 3NMKA 4JEBA 3DE8A 3M4CA 4CDVA 1JAFA 4ULVA 4L6RA 3QW1A 5JVEA 3C63A 2YLIA 2XLHA 3M4BA 4CJOA 3HNIA 3HNJA 1EKYA 4N4WA 2YL7A 3VRCA 1YZAA 1APCA 4JKVA 4NC3A 5JUAA 2YKZA 3L1MA 3QW0A 1YYJA 1RCPA 5JSLA 2XLWA 2CCYA 1QPUA 2YLDA 4CJGA 1E85A 3IQ5A 3M15A 3TOLA 1YZCA 1NBBA 3M79A 1E83A 3QVYA 3ZWIA 3ZTMA 3ZQYA 5JT4A 1LM3B 5B3IA 2XM4A 3U8PA 5AGFA 4JE9A 3DE9A 4CDAA 4U9EA 3HNLA 3ZQVA 1E84A 4JEAA 4IAQA 2XLEA 1E86A 3HNKA 3IQ6A 4WGYA 256BA 4CX9A 4CDYA 4N6HA 5JS5A 2YL0A 1QQ3A 2XLVA 1MQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL8 A;  1M6T A;  4D4N A;  2XLM A;  1S05 A;  4ER9 A;  4EIY A;  1CPR A;  1BBH A;  5JRA A;  3NMI A;  1CGN A;  4CIP A;  3FOP A;  2XM0 A;  3C62 A;  3QVZ A;  3ZTZ A;  2YLG A;  2J9B A;  1CGO A;  1A7V A;  2YL1 A;  2YL3 A;  5JLI A;  1GQA A;  2XLO A;  3NMJ A;  2XL6 A;  5JP7 A;  4D4X A;  1CPQ A;  2J8W A;  1YYX A;  4WGZ A;  4IB4 A;  3FOO A;  4U9D A;  2XLD A;  2QLA A;  3TOM A;  2BC5 A;  4IAR A;  3NMK A;  4JEB A;  3DE8 A;  3M4C A;  4CDV A;  1JAF A;  4ULV A;  4L6R A;  3QW1 A;  5JVE A;  3C63 A;  2YLI A;  2XLH A;  3M4B A;  4CJO A;  3HNI A;  3HNJ A;  1EKY A;  4N4W A;  2YL7 A;  3VRC A;  1YZA A;  1APC A;  4JKV A;  4NC3 A;  5JUA A;  2YKZ A;  3L1M A;  3QW0 A;  1YYJ A;  1RCP A;  5JSL A;  2XLW A;  2CCY A;  1QPU A;  2YLD A;  4CJG A;  1E85 A;  3IQ5 A;  3M15 A;  3TOL A;  1YZC A;  1NBB A;  3M79 A;  1E83 A;  3QVY A;  3ZWI A;  3ZTM A;  3ZQY A;  5JT4 A;  1LM3 B;  5B3I A;  2XM4 A;  3U8P A;  5AGF A;  4JE9 A;  3DE9 A;  4CDA A;  4U9E A;  3HNL A;  3ZQV A;  1E84 A;  4JEA A;  4IAQ A;  2XLE A;  1E86 A;  3HNK A;  3IQ6 A;  4WGY A;  256B A;  4CX9 A;  4CDY A;  4N6H A;  5JS5 A;  2YL0 A;  1QQ3 A;  2XLV A;  1MQV A; 
#chains in the Genus database with same CATH topology
 3NG1 A;  2LCH A;  1F1M A;  2EPM X;  2G3K A;  3DI5 A;  3DJN B;  2W4B A;  4D4N A;  2NSF A;  2GA0 A;  4AE4 A;  1S05 A;  3SXK A;  5A69 A;  4BJ6 A;  1ZHZ A;  3SXY A;  2Q00 A;  4EIY A;  4U5H A;  1ORY A;  4RD9 A;  1E2X A;  2LSE A;  3QTH A;  3RYL A;  1RJ9 B;  3PHF 2;  1CGN A;  4DOZ A;  4LDR A;  3K1I A;  2L6F A;  2XM0 A;  1H7I A;  1V54 C;  1ZHT A;  2PX3 A;  3N0T A;  1AEP A;  1Y4C A;  3C62 A;  3L0I A;  3Q6N A;  4MTO A;  3UMK A;  2R7S A;  3EHM A;  3ITF A;  3GM1 A;  4LLC A;  4JTC B;  4JVS A;  2DI3 A;  4LAC B;  4DRJ B;  4BPM A;  3MBG A;  2YL3 A;  2VCB A;  2HV6 A;  3JRT A;  3EHN A;  3Q6M A;  2XL6 A;  3K1H A;  3EJN A;  1JMW A;  1ZU4 A;  4I44 A;  4EBK A;  5COG A;  3AGU A;  1HE1 A;  2Q3T A;  3FOO A;  4UDV A;  1NZE A;  3PCV A;  1LE4 A;  4OIN F;  2DYS C;  3T6J A;  4DVZ A;  2BC5 A;  2P0N A;  2PF4 E;  4XPW A;  3W8I A;  3RQG A;  1TR2 A;  4C3B A;  2R7V A;  2B0J A;  1M2V A;  1Y6D A;  3R2P A;  2YZS A;  1S7Z A;  4YT2 A;  1Q0G A;  5DQZ A;  1GGQ A;  3EGX B;  3GAN A;  1Z3I X;  5A6A A;  5L3Q A;  1FMV A;  1BDJ B;  2L6H A;  1TFK B;  3M4C A;  3I5Q A;  1ZHX A;  4MW3 A;  1HE9 A;  1KNY A;  1JAF A;  3VYW A;  3S27 A;  3VAY A;  1FNT c;  3LEO A;  2VB6 A;  3EPV A;  3W4Y A;  3RKO F;  1L3P A;  4P9F A;  1DOW A;  2LQG A;  4X0R A;  3AGT A;  5D92 A;  4YT5 A;  3X2Q C;  4BJ1 A;  4E7Z A;  3C63 A;  4CSA C;  1OKK A;  2EPN A;  1O87 A;  3CEX A;  4O6M A;  3HNI A;  3HNJ A;  2P6V A;  1WN0 A;  1U0B B;  2C03 A;  1R5I D;  4GEH A;  1Z63 A;  1EQ1 A;  2AWC A;  3SYN A;  4O6N A;  2CGE A;  2W4M A;  3B29 A;  3GEH A;  4C7O B;  1FTS A;  2CW0 F;  3MYI A;  1QVX A;  3OEO A;  4BEJ A;  2W9Y A;  3H2U A;  1SZI A;  1RKE A;  3RW0 A;  4FAP B;  2R7R A;  1H9G A;  2O9X A;  3B0V C;  1YYJ A;  4R32 A;  1M2O A;  3CZ6 A;  2XLW A;  1CGM E;  2M64 A;  3CQZ A;  1LS4 A;  1TWH A;  2MYS A;  1QPU A;  2FFH A;  3LUT B;  5A6K A;  5FCL A;  5DS5 A;  4CJG A;  1Q0F A;  1E85 A;  4OIP F;  2AWY A;  4U5C E;  3TOL A;  2H7B A;  4G7H F;  2IBF A;  2R02 A;  3KPH A;  3RQE A;  5B3S C;  5CI9 A;  5L0F A;  2FGY A;  5T3W A;  4NQF A;  2VCA A;  2ICW G;  4WAB A;  4OD4 A;  1MNE A;  3RFY A;  4Z9I A;  3S28 A;  2XS8 A;  1EA8 A;  2J0X A;  1PD0 A;  2P1A A;  1MMD A;  2XM4 A;  3DMD A;  3KYI A;  4FWV A;  5L0J A;  3U2L A;  3V7O A;  2YWA A;  3I5P A;  3NKD A;  4JTA B;  2KGO A;  3ASN C;  2B0H A;  2OU6 A;  4CS9 A;  3MX3 A;  3S29 A;  2L7A A;  2W45 A;  2BE5 F;  3JT1 A;  4K0D A;  4LDQ A;  4PJJ A;  4CDA A;  4U9E A;  4IGG A;  5AC5 A;  1YAR O;  1LE2 A;  1V55 C;  1JPJ A;  3K6B A;  2NG1 A;  2WVN A;  1NLX A;  1G5Z A;  1YAU O;  2DYR C;  3EH1 A;  2KC3 A;  3E70 C;  3K7D A;  4WGY A;  256B A;  3WG7 C;  1LPE A;  2A6E F;  3UMI A;  4CX9 A;  5F5F A;  2HMZ A;  4W8P A;  5KYY A;  4E7S A;  5L0G A;  1ZHW A;  3B9Q A;  3JYH A;  3HTK C;  1XZQ A;  4G7Z F;  2LP4 A;  1WOL A;  2XL8 A;  3FAJ A;  2XL4 A;  3H2V A;  1JPN A;  1XZP A;  1GS9 A;  3E9V A;  2EIK C;  1OR3 A;  2KQ9 A;  4JZA A;  1Z5Z A;  4BJ5 A;  1Z23 A;  4KNV A;  2V26 A;  1BBH A;  3OA1 A;  2WVO A;  1R4T A;  3FXH A;  3NMI A;  1RKC A;  3FVY A;  3TUL A;  3V5Z A;  3JTL O;  3F46 A;  4IWB A;  3FOP A;  5BQH A;  3A11 A;  4CS8 C;  2AVK A;  4LER A;  3T4R A;  2Q7R A;  3C8G D;  2Y3G A;  4XWJ A;  1C02 A;  3EG9 B;  1A7V A;  3EGD B;  2YL1 A;  3ZDL A;  4I3M A;  2IOQ A;  5KYW B;  5DQT A;  5L0C A;  3GEI A;  3K33 A;  2JD3 A;  3NMJ A;  4AK9 A;  5HSW A;  1T6I A;  3EQL F;  1MMG A;  3FAP B;  2J9V A;  3IQC A;  5JP7 A;  3SXZ A;  1CPQ A;  3TD7 A;  4BG0 A;  2WZG A;  3JYY A;  2HUJ A;  1JR8 A;  1YYX A;  3GWL A;  2VC9 A;  2J0W A;  4WGZ A;  3UMH A;  1K40 A;  4FX5 A;  1ZU5 A;  5GPG B;  3K66 A;  2XLD A;  4EBB A;  4PFP A;  2QLA A;  1WWP A;  2I15 A;  4PFO A;  4G78 A;  1OKK D;  2OKU A;  3O10 A;  4GYT A;  4Q5S F;  2J7P A;  3MFN A;  1K04 A;  3AJM A;  3C8Z A;  3GOD A;  1ZW2 A;  2IYL D;  3WOD F;  4CDV A;  1MMA A;  2PX0 A;  3ZIB A;  4L6R A;  3UNG C;  3QW1 A;  1HW2 A;  5COM A;  4DBR A;  3EH2 A;  4U5F E;  4B6I A;  2KYH A;  3JZ0 A;  1W2W A;  2CYD A;  2Q9A A;  2PNO A;  1SMY F;  3AG3 C;  3LLK A;  3NYL A;  2YLI A;  2RSE B;  3DAG A;  5BQG A;  1A7D A;  3POV A;  4N4W A;  3EZI A;  4CIH A;  1SR2 A;  2L81 A;  4M63 A;  3VRC A;  4XEV A;  4NTF A;  3C8G A;  4P6I C;  3T6G B;  4Z9J A;  3CAX A;  3JSZ A;  3X1O A;  1TWC A;  2TMV P;  4MQ9 F;  2QNL A;  4AE4 B;  3EGX A;  2A69 F;  2MHR A;  4E17 A;  4MVU A;  2YKZ A;  3L1M A;  1NFO A;  1HY5 A;  1A7E A;  1RCP A;  5HV9 A;  3ABM C;  4J7T A;  4IAO A;  4JC7 A;  1B68 A;  2CCY A;  2EPK X;  3C18 A;  1IW7 F;  4YJW A;  3T9O A;  4YT4 A;  1TQG A;  3HJC A;  3Q7L A;  3AG4 C;  3IQ5 A;  5KYU B;  2DB4 A;  5E3A A;  2XRH A;  3NKE A;  4Q4Z F;  1YZC A;  1NBB A;  1A0B A;  3GWN A;  3BRJ A;  3QVY A;  3QZC A;  1QLE C;  5B1B C;  3UGO A;  3GM2 A;  1OW8 A;  3JSE O;  3ZQY A;  4EKW A;  5JT4 A;  2ZD9 A;  2EIN C;  2X0C A;  2Y3B A;  2HKV A;  3MLG A;  3U8P A;  5AGF A;  2HFI A;  3KKB A;  2QUP A;  2G62 A;  2WVQ A;  4ZLD A;  3IEE A;  1QSP A;  3DE9 A;  4JJF A;  4JIO A;  4G7O F;  3HNL A;  1Q0K A;  2KJG A;  2NSG A;  5D91 A;  1FMW A;  4G0H A;  4JEA A;  2NUP B;  1E84 A;  2R7O A;  3NYJ A;  2ZXP A;  2Y39 A;  2R7Q A;  1QZX A;  2ETS A;  1FFT C;  1PD1 A;  1MMN A;  3IQ6 A;  3L34 A;  4YN0 B;  5COF A;  2HZ8 A;  4A2N B;  2EIL C;  5BQI A;  5L3V A;  2UUH A;  2YL0 A;  3QMK A;  3DWW A;  4MVM A;  5TJ5 E;  4OIQ F;  2XS1 A;  3RH3 A;  4I1O B;  3KH2 A;  3T6B A;  3F47 A;  1ORJ A;  3DAF A;  3MYF A;  2YRF A;  2P61 A;  4YL0 A;  4RDA A;  1TWG A;  3FDQ A;  2XLM A;  4W8K A;  5B1A C;  1LI7 A;  3ZVR A;  1NG1 A;  5F5H A;  1C03 A;  3TK0 A;  1CPR A;  1QKR A;  1T9K A;  4GQH A;  1PCX A;  5JRA A;  2XXA A;  3ASO C;  3ABK C;  3BEH A;  1TFO B;  2Y3D A;  4MTG A;  1V4A A;  3RQF A;  2R7X A;  2ZXO A;  3DM5 A;  3G4X A;  4PJL A;  2H7O A;  3JCU Q;  3ZTZ A;  5T3T A;  3RF3 A;  2YLG A;  3KL4 A;  1VTM P;  2J9B A;  1OW6 A;  1G4U S;  5A6B A;  1CGO A;  4LDK A;  5CI8 A;  3ZSU A;  3N2Z B;  3RVZ A;  5JLI A;  3S84 A;  1GQA A;  1VK5 A;  1ZHY A;  2Y69 C;  2XLO A;  2GWW A;  4WJ0 A;  4ONS A;  4MTF A;  4DRI B;  3L8I A;  3U3F A;  1M56 C;  2A6H F;  3WAQ A;  4ANJ A;  1OCO C;  2J7P D;  5E33 A;  4N6C A;  3M1C B;  3W2W A;  5EHH A;  1EI7 A;  2NUT B;  1BR1 A;  1WGW A;  3AQB A;  3O55 A;  4U9D A;  1OQC A;  4CS9 C;  3DJU B;  1XWJ A;  3B71 A;  3TOM A;  2ZXW C;  3AOU A;  4IAR A;  1ZW3 A;  3V5X A;  1G8X A;  1LKX A;  5A6J A;  1I5N A;  4JEB A;  1U89 A;  2HV7 A;  2F22 A;  1LI5 A;  2ZPA A;  3EGD A;  3SEO A;  1H9T A;  4CS7 A;  2OEX A;  4KNW A;  1V74 B;  4DBQ A;  3V5Y A;  5KYW A;  3SNH A;  1C17 M;  2L9J A;  5KYX B;  4ULV A;  3JRM O;  5E3C A;  1VB5 A;  5JVE A;  3G50 A;  4F4B A;  4I1M A;  4XEF A;  1FAP B;  3EFO B;  1IZM A;  1YA7 O;  1A41 A;  1T6U A;  2IXN A;  1O3U A;  4ZLC A;  4N06 A;  2KSF A;  4KC9 A;  4XPY A;  4NTB A;  3U0C A;  1OCC C;  3AG2 C;  5IY5 C;  1VYI A;  2DGJ A;  2LIG A;  2HMQ A;  1YZA A;  1RJ9 A;  4C3E A;  3O39 A;  1APC A;  1VYK A;  4BJ5 C;  2EIJ C;  1NFN A;  2WL8 A;  5AC4 A;  4MS2 A;  1WAS A;  3U5S A;  2VH3 A;  3U3B A;  1OR2 A;  4DVY P;  4QI2 A;  3QW0 A;  2VAS A;  3O6X A;  4MW8 A;  3U9J A;  4KI2 A;  4NCQ A;  5JSL A;  1UG7 A;  2YVK A;  2R9R B;  1HMO A;  4EHP A;  2YLD A;  1ZZP A;  2QE9 A;  2VCC A;  4BEM J;  1FR0 A;  4E0H A;  5DLJ A;  1ZYR F;  3M15 A;  1YA9 A;  2R03 A;  1LS1 A;  4FES A;  4MVZ A;  5L0H A;  3KMI A;  2WZL A;  3ZWI A;  1L7C A;  1UFB A;  2A0U A;  1OCR C;  1Z6A A;  2UUI A;  2OQM A;  1I4Y A;  2AU5 A;  1TWA A;  1LM3 B;  2Q9C A;  5B3I A;  2V3C C;  2OCC C;  4YL1 A;  2R7U A;  2C04 A;  3UR3 C;  3WHN A;  3ZG1 A;  3PDM P;  4MVR A;  4JCZ A;  1DOV A;  1K05 A;  2J9U A;  4IRU A;  4QDL A;  3G4Z A;  4XQ1 A;  2A0B A;  4XLP F;  3GEE A;  1T6Q A;  1T01 A;  2P7V A;  4BJ6 C;  3LLI A;  2LFD A;  1YJG A;  3ZC4 A;  4EWC A;  1O5H A;  4NY3 A;  4JRZ A;  2EPO A;  3J06 A;  2PP4 A;  2OG2 A;  1OXK A;  4U5B E;  1ORS C;  2RD9 A;  3NYM A;  5KYU A;  2LFF A;  2A1D D;  2JX0 A;  2OJQ A;  1FFH A;  1VOM A;  2XLE A;  3K1I C;  3L8J A;  3LNM B;  4HE8 D;  2IM8 A;  2IXM A;  5L0I A;  1E86 A;  3I4U A;  4O6Y A;  2EPL X;  3U9M A;  2QTV A;  1LVK A;  5EK0 A;  2HJM A;  4N6H A;  5JS5 A;  2R7W A;  1YVI A;  1D1B A;  2H7V C;  2XLV A;  3TJ5 A;  1MQV A;  3ATP A;  4CSA A;  3PMR A;  1WAT A;  4MVS A;  2CNW A;  4OIO F;  4HFK B;  2PFD A;  2ZXR A;  1M6T A;  2A68 F;  3TJ6 A;  5FZT A;  4C7O A;  1Q0D A;  4EUK B;  1WTY A;  5L0D A;  3W8H A;  2AP3 A;  4ER9 A;  5A6B D;  2NUP A;  3LS1 A;  1SF8 A;  2MWQ A;  3ECS A;  4HEA J;  3C8G B;  2NPU A;  4J32 B;  4U5G A;  4CBE A;  1JRA A;  1SYQ A;  1RMV A;  2EIM C;  1Q0M A;  4Z9H A;  4IJJ A;  3R7C A;  4NTA A;  4CIP A;  5KYN A;  3LS0 A;  4JTD B;  5EGY A;  2JPU A;  2ASR A;  1J8M F;  3QVZ A;  2J45 A;  2GAQ A;  3DD7 A;  1BR2 A;  3US6 A;  3DKA A;  5DS4 A;  2Y3H A;  4XLN F;  2HSQ A;  4H4K C;  1M2V B;  2KNH A;  3S90 A;  1T5O A;  4J30 B;  3IHU A;  2Q4F A;  1HMD A;  2OOC A;  2M4E A;  3LEV A;  2WB7 A;  3LAY A;  2I8B A;  4H54 A;  4YK5 A;  5E2Q A;  4D4X A;  1JOG A;  2J8W A;  3RIP A;  2GFH A;  3B0P A;  1OXB A;  2QY9 A;  2CDQ A;  4U5E E;  3LJB A;  4IB4 A;  5DS6 A;  3GM3 A;  4OIR F;  4YL3 A;  2R7T A;  4MND A;  5T1D B;  3VF0 A;  1H6G A;  1N1C A;  2Q9B A;  3LES A;  1U6H A;  4JCH A;  3SP1 A;  2YQY A;  1BZ4 A;  3NMK A;  4BJT A;  2HS5 A;  1M57 C;  3DM9 B;  1VMA A;  3C7J A;  1KU2 A;  2OJE D;  3DZA A;  3FMS A;  3H65 A;  2OEV A;  1YDI A;  3DE8 A;  1RKE B;  4JUR I;  3UGP A;  3NDB B;  4RBN A;  3IQT A;  4DXW A;  4Q7C A;  2D5R B;  2X51 A;  4A4A A;  3KYJ A;  3OWT A;  3U8V A;  3TQO A;  5DVW A;  1BR4 A;  4MVQ A;  1J8Y F;  3GOR A;  4C3D A;  4XEK A;  1LIH A;  2XLH A;  3M4B A;  1AUE A;  4CJO A;  2NUT A;  4ULW A;  4E18 A;  2IXO A;  1EKY A;  1KTM A;  1MND A;  2E87 A;  1OCZ C;  4O7G A;  2YL7 A;  3A9C A;  2J46 A;  3LNR A;  4MVO A;  4J7Y A;  2KK1 A;  3RVY A;  4YT8 A;  2G3V A;  4JW1 A;  3W2V A;  1D0Z A;  1PV3 A;  4JKV A;  1G4W R;  1OW7 A;  4PK4 A;  3U2M A;  1NU9 C;  4NC3 A;  4PR9 A;  1Z7Q c;  4E0I A;  5JUA A;  1ZVZ A;  1VLT A;  2FAP B;  5K0I A;  2HSB A;  2YHS A;  3SZR A;  2KW3 C;  5KYX A;  2L6G A;  3HKK A;  2XXA B;  4CS8 A;  4PJM A;  3EG9 A;  3EZH A;  4K1O A;  4AL0 A;  3DXJ F;  3EFO A;  3Q7G A;  4P9T A;  3NRH A;  1HW1 A;  1D1A A;  1VLS A;  3S0X A;  1I4Z A;  1NU7 D;  1AVO B;  3M79 A;  4QI0 A;  1E83 A;  2HJ3 A;  4OD5 A;  2XSE A;  3SXM A;  3ABL C;  3ZTM A;  5BUO A;  3CSK A;  4KBL A;  2YEV A;  3S9O A;  3AQC A;  4AL1 A;  5KYY B;  4YWQ A;  4EBJ A;  2PBE A;  3IPM O;  4LLE A;  2H8A A;  4JE9 A;  1D0Y A;  4PAC A;  2D4U A;  3AG1 C;  4DJ9 A;  3HLZ A;  4DRH B;  2LK4 A;  5CIV A;  1GM5 A;  1RXQ A;  3ZQV A;  3B0U X;  4U5D E;  4XTK A;  1D1C A;  1TKN A;  2CNW D;  4IAQ A;  2WZF A;  1NSG B;  2IXP A;  3FHD A;  3HNK A;  1D0X A;  4JJG A;  4PJN A;  4K7B A;  2R05 A;  2R25 A;  1YLM A;  3VM6 A;  2LD6 A;  4O79 A;  2J9W A;  2Z15 A;  4CDY A;  4XPX A;  4HFF B;  1QQ3 A;  3N24 A;  2BL2 A;  4AX2 A;  2GDC A;  5F28 E;  1ST6 A; 
#chains in the Genus database with same CATH homology
 2XL8 A;  1M6T A;  4D4N A;  2XLM A;  1S05 A;  4ER9 A;  4EIY A;  1CPR A;  1BBH A;  5JRA A;  3NMI A;  1CGN A;  4CIP A;  3FOP A;  2XM0 A;  3C62 A;  3QVZ A;  3ZTZ A;  2YLG A;  2J9B A;  1CGO A;  1A7V A;  2YL1 A;  2YL3 A;  5JLI A;  1GQA A;  2XLO A;  3NMJ A;  2XL6 A;  5JP7 A;  4D4X A;  1CPQ A;  2J8W A;  1YYX A;  4WGZ A;  4IB4 A;  3FOO A;  4U9D A;  2XLD A;  2QLA A;  3TOM A;  2BC5 A;  4IAR A;  3NMK A;  4JEB A;  3DE8 A;  3M4C A;  4CDV A;  1JAF A;  4ULV A;  4L6R A;  3QW1 A;  5JVE A;  3C63 A;  2YLI A;  2XLH A;  3M4B A;  4CJO A;  3HNI A;  3HNJ A;  1EKY A;  4N4W A;  2YL7 A;  3VRC A;  1YZA A;  1APC A;  4JKV A;  4NC3 A;  5JUA A;  2YKZ A;  3L1M A;  3QW0 A;  1YYJ A;  1RCP A;  5JSL A;  2XLW A;  2CCY A;  1QPU A;  2YLD A;  4CJG A;  1E85 A;  3IQ5 A;  3M15 A;  3TOL A;  1YZC A;  1NBB A;  3M79 A;  1E83 A;  3QVY A;  3ZWI A;  3ZTM A;  3ZQY A;  5JT4 A;  1LM3 B;  5B3I A;  2XM4 A;  3U8P A;  5AGF A;  4JE9 A;  3DE9 A;  4CDA A;  4U9E A;  3HNL A;  3ZQV A;  1E84 A;  4JEA A;  4IAQ A;  2XLE A;  1E86 A;  3HNK A;  3IQ6 A;  4WGY A;  256B A;  4CX9 A;  4CDY A;  4N6H A;  5JS5 A;  2YL0 A;  1QQ3 A;  2XLV A;  1MQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...