1WGWA

Solution structure of the n-terminal domain of mouse putative signal recognition particle 54 (srp54)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
GSSGSSGADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKVKVYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Domain of Mouse Putative Signal Recognition Particle 54 (SRP54)
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords 'Signal Recognition Particle 54
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1wgwA00
1ZU5A 1ZU4A 2NG1A 5L3QA 1RJ9B 2V3CC 4C7OB 4C7OA 3NG1A 3DM9B 2YHSA 1NG1A 1FFHA 2Q9AA 3DM5A 2XXAB 1O87A 1LS1A 2J7PD 4AK9A 1JPJA 2CNWA 1JPNA 2J45A 2QY9A 2Q9BA 3KL4A 2OG2A 1OKKA 1RJ9A 1J8MF 3NDBB 1FTSA 2IYLD 5L3VA 1OKKD 1VMAA 1J8YF 2C03A 2Q9CA 2XXAA 2CNWD 3DMDA 3E70C 2FFHA 2J46A 1QZXA 2J7PA 2C04A 3B9QA 1WGWA
chains in the Genus database with same CATH superfamily
3RQGA 4U5DE 3EH2A 2HV7A 3LEOA 4E0IA 2YRFA 4OINF 3T6GB 4IAQA 1VLSA 3AG3C 3AG4C 1U0BB 4E0HA 2Q9AA 4KC9A 4DVYP 4IB4A 4PFOA 4OIRF 2Y3DA 3E9VA 2FAPB 4J7YA 2WZLA 4IAOA 4CS8C 4RBNA 1ORSC 1I4ZA 1QQ3A 1ZHXA 4BJTA 3NDBB 3RH3A 3AOUA 2PNOA 2W4MA 5KYXA 2OOCA 1G4US 3DD7A 4KBLA 2ZXOA 3M1CB 4LLEA 2HJMA 2XLOA 3JRTA 3EFOB 4MVMA 2A0UA 4FWVA 4K0DA 4BJ5C 3E70C 3HJCA 4Q7CA 4EUKB 2FFHA 3T9OA 3V5XA 2HMZA 3EZIA 2MYSA 1ZU5A 1MMNA 2GDCA 1HW1A 2A6HF 3QW1A 1V55C 3L0IA 3RVYA 4CDYA 4U5GA 2ZD9A 3DJUB 3JSZA 1NG1A 2HV6A 1NLXA 3GWNA 3HTKC 3MX3A 2WVNA 3U2LA 3RQEA 1ST6A 3WHNA 2XLHA 3ZIBA 3W8HA 1QPUA 3LS0A 2LQGA 2OJED 4J32B 1J8MF 2XSEA 2Y3GA 4MNDA 1VMAA 2P7VA 1M2OA 1Z3IX 3GEEA 3W2VA 2XLEA 1E86A 1VYIA 4HE8D 2M4EA 2CCYA 3JYYA 5A6JA 2VB6A 3RQFA 1RKEA 1NFOA 2HS5A 2VCBA 2X0CA 3K7DA 2JPUA 4U5BE 2W4BA 4XPWA 1T5OA 3MYIA 1JR8A 2L9JA 3DM9B 4C3EA 5BQHA 1GS9A 4BG0A 4O6NA 2HMQA 2P6VA 1B68A 3KPHA 2OCCC 3OA1A 2PX0A 1NU9C 4JCHA 4PK4A 3TOMA 1VYKA 2R7VA 2R7QA 3ATPA 2DYSC 2QY9A 4CX9A 2OG2A 2CGEA 3ZC4A 3AJMA 3K33A 4LDRA 1RKCA 3SXYA 3X2QC 3C8ZA 3ABMC 4GYTA 2LFFA 4N06A 4A4AA 3G4ZA 3JSEO 3TD7A 1AVOB 4YL0A 2C03A 2IM8A 3LS1A 4JIOA 4BJ1A 5L0IA 3S0XA 2P61A 1E83A 3ABKC 1QKRA 1JAFA 2RSEB 1NFNA 2ZPAA 3O6XA 1OCOC 4HEAJ 1ZZPA 2IXPA 2DB4A 1OW6A 1T6IA 3A9CA 5T1DB 3EGDA 3S28A 4DJ9A 2AWCA 4C3DA 4ONSA 3F46A 2ETSA 1V54C 1D0ZA 2R7OA 4YT5A 5E2QA 3N0TA 4YJWA 1WOLA 2J7PD 2GAQA 1DOWA 4MW8A 4PACA 4DXWA 3TOLA 4AE4B 4PFPA 5F5HA 2KGOA 3DJNB 4GEHA 1RKEB 4P9TA 4H4KC 1SR2A 2DYRC 4U9DA 5CI8A 3PCVA 2CW0F 5KYUB 4JEBA 5AC5A 1WWPA 3NYJA 4P6IC 1IW7F 2LSEA 2ZXPA 5EHHA 2YKZA 3US6A 3A11A 4JURI 3KYJA 3L8IA 1QZXA 4M63A 4O79A 5DS6A 1ZHZA 1OW7A 1GQAA 5EK0A 1N1CA 4K7BA 4CBEA 1OW8A 4EWCA 2XM4A 1CGME 4N4WA 3MYFA 4C3BA 3Q7LA 5HV9A 3CQZA 4EBBA 2XXAB 2HJ3A 3DAFA 3GWLA 3U3BA 3VAYA 4EHPA 4G7OF 4GQHA 3CEXA 1UFBA 3TULA 1OKKA 2CDQA 2XLWA 5E3CA 2WVOA 4BJ6A 1VK5A 1YARO 4HFKB 1YYJA 4JJFA 4CS8A 5KYXB 2Q9CA 2J9VA 2XL8A 3NYLA 3RKOF 4YT2A 1H6GA 4JTDB 3SXKA 1MQVA 3AQCA 3T4RA 4CSAC 1QVXA 4MVRA 5JS5A 2W9YA 4NC3A 4AE4A 2IYLD 4XTKA 1LS4A 1HMDA 3AG1C 2EPLX 3C8GB 2CYDA 2IBFA 1M57C 3ASOC 2J9WA 1TR2A 2YWAA 3M4BA 3KKBA 4ZLCA 3ECSA 3GM1A 1O87A 1Q0KA 4Z9IA 4AK9A 1JPJA 2X51A 4KI2A 4B6IA 2AVKA 1KTMA 3VF0A 1Q0GA 4FESA 2QLAA 3R2PA 3G4XA 3K1IA 2EIJC 4O7GA 2LIGA 2J0WA 1NSGB 1YZCA 2XL4A 4J7TA 1HY5A 4IJJA 3ZDLA 4F4BA 5B3SC 1CGOA 1M56C 3K1HA 2P0NA 3C8GD 2EPMX 2YL3A 4KNVA 1Q0FA 2Z15A 4CS7A 4CS9A 1T6UA 4YT8A 4DVZA 3LEVA 2J9BA 2ZXWC 4E18A 4ANJA 2R7SA 4ER9A 3UGOA 5F5FA 1ZW3A 1HE9A 4NY3A 4YL3A 3M4CA 2XLVA 3NG1A 4QDLA 3RW0A 4CIPA 2YLGA 1M2VA 5DS5A 3C63A 1SMYF 3TQOA 4JKVA 4G7ZF 2OEXA 4CDAA 2VC9A 4EIYA 5EGYA 1R5ID 3QVZA 1QLEC 4ULWA 2NUPB 3U9MA 1GGQA 3GEIA 1TWAA 2QUPA 3R7CA 4Z9JA 4JVSA 4KNWA 2KW3C 3HLZA 3GEHA 4IRUA 4DRHB 3MLGA 3U2MA 1FNTc 3WODF 2HSQA 5B3IA 3I4UA 3PMRA 4MTGA 4DBRA 4NQFA 4XPYA 3V7OA 4AL0A 4XWJA 4YWQA 3IQ5A 1OKKD 4Q4ZF 4OIPF 1FAPB 4RDAA 2XLMA 2XXAA 3OWTA 3C7JA 3UMKA 3AGTA 4YT4A 2L6GA 2E87A 4JTAB 4HFFB 4LDQA 1LPEA 1Z5ZA 3ZTZA 4R32A 4NTFA 3NMIA 3DE9A 1WASA 3B9QA 4IGGA 1AUEA 3H65A 1RXQA 3EHNA 3HNJA 2VASA 4X0RA 5T3WA 3WAQA 1OCCC 1YZAA 2DI3A 1CPQA 4JJGA 1BDJB 2H7BA 5K0IA 1BR1A 4MVUA 1OR2A 1TFOB 4YN0B 4NTAA 1FFHA 3Q6NA 3DM5A 1D1CA 5F28E 1APCA 3VM6A 4E7ZA 2A68F 3S84A 1MMDA 2Q00A 4OD4A 3CAXA 2IOQA 5AGFA 4JEAA 2JX0A 4DBQA 2XL6A 3DKAA 5E3AA 1LKXA 2TMVP 3NYMA 2R02A 2R7RA 2ICWG 5L0FA 3Q7GA 2EPOA 1YVIA 4N6CA 5B1AC 2KNHA 3LJBA 256BA 2H8AA 4ULVA 5KYWB 4OIOF 4D4NA 3ZWIA 5JP7A 4I3MA 2R7XA 1FMVA 1S05A 2R9RB 3DZAA 3S90A 4CSAA 1YYXA 2G3KA 2OEVA 3FVYA 1W2WA 3NMKA 3K6BA 4XEVA 3IQTA 4OD5A 4JCZA 1NZEA 3W4YA 2YVKA 5L0JA 3W8IA 1LI7A 2XM0A 2MWQA 5JRAA 5A6BA 1CGNA 1A7VA 3LUTB 2YLIA 3LLIA 4L6RA 4IARA 3VYWA 3KL4A 2QTVA 3WG7C 3ZQYA 2D4UA 1MMGA 3PDMP 3EZHA 3KYIA 2L81A 2KQ9A 3H2UA 3EH1A 4BPMA 1TWCA 1G4WR 3LAYA 5L3VA 2RD9A 2WZFA 3U0CA 2KSFA 2KC3A 1LI5A 1K40A 1MNEA 1ZW2A 2EIKC 3LNRA 2KYHA 2G62A 4K1OA 1Q0MA 3FOPA 3M15A 1FFTC 3EJNA 3HKKA 1OXBA 4QI0A 4BJ6C 1HW2A 4G0HA 1WGWA 1ZHWA 4W8PA 5CIVA 5KYYB 2NG1A 5CI9A 4PJJA 4NCQA 3O10A 1O5HA 4C7OA 5KYUA 5BQIA 2VCAA 4FAPB 2ZXRA 1YA7O 2NUTB 4U5EE 1VOMA 2WB7A 4D4XA 1D0YA 3FAJA 1LM3B 2PF4E 2L7AA 1A41A 3QZCA 3QW0A 1TWGA 1T9KA 2NSFA 1RMVA 2Y3BA 3O39A 3SNHA 3CZ6A 2Q7RA 3JT1A 2QE9A 3UMIA 3DAGA 5AC4A 3FOOA 4CIHA 1TFKB 3RFYA 1PCXA 2A1DD 2Y39A 3DXJF 3H2VA 1OR3A 3JTLO 2G3VA 2R05A 2GWWA 2HUJA 1TKNA 2XLDA 3JCUQ 5JLIA 5L0CA 1IZMA 1C02A 3BEHA 2QNLA 2J46A 2PP4A 5DLJA 5JUAA 1HMOA 2J7PA 1A7EA 2C04A 3AQBA 3HNKA 5COMA 5JT4A 2OKUA 1SZIA 2NPUA 2V3CC 3ABLC 2GFHA 2BC5A 3NRHA 3JYHA 4YK5A 1D0XA 1OCRC 1LE4A 1GM5A 3ITFA 2PX3A 3EQLF 1R4TA 1AEPA 1M2VB 1BR2A 2HZ8A 3EG9A 1BR4A 4MQ9F 4OIQF 3F47A 1KU2A 2OU6A 5KYWA 1XZPA 4MVZA 3KH2A 2CNWA 1NBBA 2R25A 3B0PA 1ZYRF 3O55A 3IQCA 4LDKA 3ZSUA 2BL2A 4U9EA 4BJ5A 3MBGA 4MTOA 1FTSA 2R7TA 1WATA 3IPMO 5A69A 5IY5C 4EBJA 3GORA 1C03A 2F22A 2AWYA 2A69F 2PFDA 3GM3A 4I1OB 3QVYA 1RCPA 3SYNA 5B1BC 3RF3A 1LIHA 4DRIB 2LFDA 1ZHYA 5COGA 4UDVA 3DI5A 1YA9A 2P1AA 1F1MA 3DE8A 2BE5F 2WZGA 1MMAA 3EGDB 3LLKA 2UUIA 3N2ZB 4LLCA 4MS2A 3SZRA 4BEMJ 3HNIA 2YEVA 1T01A 2R7UA 4AX2A 4AL1A 2JD3A 2OJQA 3U8VA 3L34A 5A6AA 1Z23A 4N6HA 5L0GA 1H9GA 4U5CE 1G8XA 3V5ZA 3POVA 3J06A 2O9XA 1SF8A 5D92A 5TJ5E 3FAPB 5HSWA 4PJMA 1JMWA 2V26A 2D5RB 3TJ6A 3C8GA 3ASNC 3L8JA 4PJNA 3VRCA 1OXKA 2YL7A 3T6BA 2A0BA 1BZ4A 1Z6AA 1YLMA 1VTMP 3N24A 3UNGC 3EG9B 1U6HA 2Y69C 1A0BA 2CNWD 5DS4A 3TJ5A 2FGYA 2I15A 4U5HA 4MW3A 4Q5SF 3FDQA 1QSPA 2W45A 4I44A 1A7DA 3GANA 4WABA 2EINC 2IXMA 1UG7A 1RJ9B 1MNDA 3ZG1A 2XS1A 1WN0A 2GA0A 4CDVA 1I5NA 1JOGA 3U5SA 2IXOA 1M6TA 1E84A 4FX5A 2EIMC 2YLDA 3I5PA 4O6YA 1YDIA 4IWBA 2HFIA 2L6HA 1G5ZA 2XS8A 4JTCB 1D1AA 1V4AA 1JPNA 4Z9HA 4I1MA 4XLPF 2R03A 1YAUO 2WL8A 3QTHA 3U9JA 2LP4A 2J8WA 5L0DA 5D91A 2Q4FA 3ZVRA 3L1MA 3AG2C 3FMSA 2M64A 4G7HF 3DWWA 1U89A 2J0XA 3K1IC 2IXNA 3DMDA 2ASRA 5FZTA 4CJOA 2I8BA 1LE2A 2B0HA 1YJGA 3G50A 1ZVZA 2LK4A 4LACB 1PV3A 3B0VC 3S27A 4CJGA 5KYYA 1FMWA 3SEOA 5L3QA 5KYNA 1Z63A 4BEJA 4C7OB 3EGXB 3C18A 2H7VC 4YL1A 2A6EF 4PJLA 1XZQA 3UMHA 1VB5A 5FCLA 5JVEA 4WGYA 1PD0A 2EILC 2R7WA 1K04A 3RIPA 4JW1A 2Q9BA 4H54A 4E17A 2KJGA 3EHMA 1ORJA 1RJ9A 1PD1A 1HE1A 5BQGA 4MVSA 1D1BA 3EPVA 4MVOA 3SXMA 1V74B 4E7SA 1C17M 3SXZA 1CPRA 4P9FA 4U5FE 4JC7A 2NSGA 2LCHA 2WVQA 1Q0DA 3LESA 5JSLA 4W8KA 1OCZC 2AP3A 3NMJA 3FXHA 2AU5A 3NKDA 5A6BD 3B0UX 3RYLA 5DVWA 3S9OA 1L3PA 4XEKA 5A6KA 3IEEA 2VH3A 2HKVA 3U3FA 1SYQA 2PBEA 1KNYA 2EPNA 3I5QA 5T3TA 2NUPA 4MTFA 3GM2A 4JRZA 3KMIA 1EA8A 3B71A 3TK0A 2LD6A 3BRJA 1NU7D 2L6FA 5DQTA 1O3UA 1EQ1A 4NTBA 1Z7Qc 1EKYA 2KK1A 1BBHA 2OQMA 3EGXA 3LNMB 4LERA 4PR9A 1J8YF 1E2XA 3U8PA 5COFA 4DOZA 4ZLDA 1TWHA 2J9UA 2MHRA 2DGJA 3CSKA 4J30B 3JRMO 4MVQA 4XLNF 1L7CA 2Q3TA 1ORYA 2B0JA 3GODA 1K05A 2H7OA 3HNLA 1JRAA 1ZU4A 2YQYA 5GPGB 3UR3C 2UUHA 1H7IA 2Y3HA 4CS9C 2EPKX 3RVZA 3ZTMA 1EI7A 3W2WA 4JZAA 1H9TA 2YHSA 3EFOA 1Y6DA 5BUOA 1WTYA 4G78A 1FR0A 4WGZA 3IQ6A 2YL1A 3FHDA 1LS1A 2XRHA 3AGUA 3MFNA 1S7ZA 3SP1A 4A2NB 1OQCA 3JZ0A 2J45A 1DOVA 3UGPA 2YL0A 4QI2A 2YZSA 1VLTA 3NKEA 4XQ1A 2VCCA 3X1OA 4JE9A 5DQZA 3M79A 4O6MA 1ZHTA 1TQGA 3B29A 4RD9A 3C62A 3ZQVA 1Y4CA 3IHUA 4XEFA 3OEOA 5E33A 2NUTA 2HSBA 3Q6MA 3T6JA 3V5YA 4DRJB 1T6QA 4EBKA 4EKWA 3PHF2 4XPXA 5L0HA 3S29A 1LVKA 3K66A 1I4YA 3QMKA 4WJ0A 1XWJA 1E85A
chains in the Genus database with same CATH topology
4U5DE 3EH2A 2HV7A 4OINF 3AG3C 3AG4C 2Q9AA 4KC9A 4DVYP 4PFOA 4OIRF 2Y3DA 3E9VA 2WZLA 4IAOA 4CS8C 4RBNA 3NDBB 1ZHXA 4BJTA 3RH3A 2W4MA 5KYXA 4KBLA 3DD7A 4LLEA 2ZXOA 3M1CB 3JRTA 3EFOB 4K0DA 4FWVA 4BJ5C 3E70C 3HJCA 4Q7CA 2FFHA 3EZIA 2MYSA 1ZU5A 1MMNA 2A6HF 1V55C 3L0IA 4U5GA 3DJUB 3JSZA 1NG1A 2HV6A 3HTKC 3MX3A 2WVNA 1ST6A 3ZIBA 3W8HA 3LS0A 4J32B 1J8MF 2XSEA 2Y3GA 4MNDA 1VMAA 2P7VA 1M2OA 1Z3IX 3W2VA 1VYIA 4HE8D 2M4EA 2VB6A 3K7DA 4U5BE 2W4BA 2L9JA 3DM9B 4C3EA 4BG0A 4O6NA 2P6VA 3OA1A 2OCCC 2PX0A 1NU9C 4JCHA 4PK4A 2R7VA 1VYKA 2R7QA 2DYSC 2QY9A 2OG2A 2CGEA 3ZC4A 3K33A 3X2QC 3ABMC 4GYTA 4N06A 3TD7A 2C03A 3LS1A 4BJ1A 3S0XA 3ABKC 2ZPAA 3O6XA 1OCOC 4HEAJ 2IXPA 5T1DB 3EGDA 3S28A 4C3DA 3F46A 1V54C 1D0ZA 2R7OA 4YT5A 5E2QA 3N0TA 4YJWA 2J7PD 4AE4B 4PFPA 5F5HA 2KGOA 3DJNB 4GEHA 4H4KC 2DYRC 5CI8A 2CW0F 5KYUB 3NYJA 4P6IC 1IW7F 2LSEA 2ZXPA 5EHHA 4JURI 4M63A 5DS6A 1QZXA 4O79A 1ZHZA 1N1CA 4K7BA 4CBEA 4EWCA 4C3BA 3Q7LA 3CQZA 4EBBA 2XXAB 3DAFA 3VAYA 4G7OF 1OKKA 2CDQA 5E3CA 2WVOA 4BJ6A 1VK5A 4HFKB 4JJFA 4CS8A 5KYXB 2Q9CA 2J9VA 3RKOF 3NYLA 4YT2A 3AQCA 3T4RA 4CSAC 2W9YA 4AE4A 2IYLD 4XTKA 3AG1C 1M57C 3ASOC 2J9WA 1TR2A 3KKBA 4ZLCA 3ECSA 1O87A 4AK9A 1JPJA 2X51A 4KI2A 4B6IA 4FESA 2EIJC 4O7GA 2J0WA 2XL4A 4IJJA 5B3SC 4F4BA 1M56C 3K1HA 4KNVA 2Z15A 4CS9A 4CS7A 4YT8A 4DVZA 3LEVA 2ZXWC 4ANJA 2R7SA 3UGOA 5F5FA 4NY3A 3NG1A 4QDLA 1M2VA 5DS5A 1SMYF 4G7ZF 4ULWA 1QLEC 2NUPB 1TWAA 4JVSA 4KNWA 2KW3C 3HLZA 4IRUA 3MLGA 3WODF 3I4UA 3PMRA 4DBRA 4YWQA 3V7OA 4XWJA 4Q4ZF 1OKKD 4OIPF 4RDAA 2XXAA 3OWTA 3UMKA 4YT4A 2E87A 4HFFB 1Z5ZA 3B9QA 3H65A 3EHNA 4X0RA 2VASA 5T3WA 1OCCC 4JJGA 2H7BA 1BR1A 4YN0B 1FFHA 3Q6NA 3DM5A 1D1CA 4E7ZA 2A68F 1MMDA 4OD4A 2IOQA 4DBQA 5E3AA 1LKXA 3NYMA 2R7RA 3Q7GA 5B1AC 2KNHA 3LJBA 4OIOF 5KYWB 4I3MA 2R7XA 1FMVA 3DZAA 4CSAA 2G3KA 3FVYA 1W2WA 3K6BA 4OD5A 1NZEA 3W8IA 2MWQA 5EGYA 3LLIA 3VYWA 3KL4A 2QTVA 3WG7C 1MMGA 3EZHA 2L81A 2KQ9A 3EH1A 1TWCA 3LAYA 5L3VA 2WZFA 1MNEA 3LNRA 2EIKC 2G62A 1FFTC 3EJNA 4QI0A 4BJ6C 4G0HA 1WGWA 1ZHWA 5KYYB 2NG1A 5CI9A 4PJJA 1O5HA 4C7OA 5KYUA 2ZXRA 2NUTB 4U5EE 1VOMA 2WB7A 1D0YA 3FAJA 3QZCA 2PF4E 1TWGA 2Y3BA 3O39A 3SNHA 3CZ6A 3UMIA 3JT1A 3DAGA 4CIHA 3RFYA 1PCXA 2A1DD 2Y39A 3DXJF 2G3VA 1TKNA 3JCUQ 1IZMA 2J46A 2PP4A 5DLJA 2J7PA 2C04A 3AQBA 1SZIA 2V3CC 3ABLC 2GFHA 3NRHA 3JYHA 1D0XA 1OCRC 3ITFA 2PX3A 3EQLF 4MQ9F 1M2VB 3EG9A 1BR2A 1BR4A 4OIQF 3F47A 1KU2A 5KYWA 3KH2A 2CNWA 3B0PA 1ZYRF 3ZSUA 4BJ5A 1FTSA 2R7TA 5IY5C 2A69F 2PFDA 4I1OB 3SYNA 5B1BC 1ZHYA 3LLKA 2BE5F 2WZGA 1MMAA 3EGDB 3N2ZB 4LLCA 3SZRA 2YEVA 2R7UA 4AX2A 2JD3A 3L34A 3POVA 1Z23A 4U5CE 1G8XA 2O9XA 1SF8A 5D92A 5HSWA 4PJMA 2V26A 2D5RB 4PJNA 3ASNC 3T6BA 1Z6AA 3N24A 3UNGC 3EG9B 2Y69C 2CNWD 5DS4A 2FGYA 4U5HA 4Q5SF 3FDQA 2W45A 4I44A 3GANA 2EINC 2IXMA 1RJ9B 1MNDA 3ZG1A 2IXOA 4FX5A 2EIMC 3I5PA 4O6YA 4IWBA 1D1AA 1JPNA 4I1MA 4XLPF 2WL8A 5D91A 3ZVRA 3AG2C 4G7HF 2J0XA 3K1IC 2IXNA 3DMDA 2I8BA 4LACB 3B0VC 3S27A 5KYYA 1FMWA 3SEOA 5L3QA 5KYNA 1Z63A 4BEJA 4C7OB 3EGXB 2H7VC 2A6EF 4PJLA 3UMHA 5FCLA 1PD0A 2EILC 2R7WA 3RIPA 4JW1A 2Q9BA 2KJGA 3EHMA 1RJ9A 1PD1A 4E7SA 1D1BA 3EPVA 4U5FE 2WVQA 3LESA 4W8KA 1OCZC 3NKDA 3B0UX 3RYLA 5DVWA 3IEEA 2VH3A 3I5QA 5T3TA 2NUPA 3KMIA 1NU7D 5DQTA 4LERA 3EGXA 1J8YF 4DOZA 4ZLDA 1TWHA 2J9UA 4J30B 2DGJA 3CSKA 4XLNF 2Q3TA 2B0JA 3GODA 2H7OA 1ZU4A 3UR3C 4CS9C 2Y3HA 3W2WA 4JZAA 2YHSA 3EFOA 5BUOA 3FHDA 3SP1A 1LS1A 2XRHA 4A2NB 1S7ZA 3UGPA 2J45A 4QI2A 2YZSA 3NKEA 3X1OA 5DQZA 4O6MA 1ZHTA 4RD9A 3OEOA 5E33A 2NUTA 3T6JA 3Q6MA 3PHF2 3S29A 1LVKA 3K66A 3QMKA 4WJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU5 A;  1ZU4 A;  2NG1 A;  5L3Q A;  1RJ9 B;  2V3C C;  4C7O B;  4C7O A;  3NG1 A;  3DM9 B;  2YHS A;  1NG1 A;  1FFH A;  2Q9A A;  3DM5 A;  2XXA B;  1O87 A;  1LS1 A;  2J7P D;  4AK9 A;  1JPJ A;  2CNW A;  1JPN A;  2J45 A;  2QY9 A;  2Q9B A;  3KL4 A;  2OG2 A;  1OKK A;  1RJ9 A;  1J8M F;  3NDB B;  1FTS A;  2IYL D;  5L3V A;  1OKK D;  1VMA A;  1J8Y F;  2C03 A;  2Q9C A;  2XXA A;  2CNW D;  3DMD A;  3E70 C;  2FFH A;  2J46 A;  1QZX A;  2J7P A;  2C04 A;  3B9Q A;  1WGW A; 
#chains in the Genus database with same CATH topology
 3RQG A;  4U5D E;  3EH2 A;  2HV7 A;  3LEO A;  4E0I A;  2YRF A;  4OIN F;  3T6G B;  4IAQ A;  1VLS A;  3AG3 C;  3AG4 C;  1U0B B;  4E0H A;  2Q9A A;  4KC9 A;  4DVY P;  4IB4 A;  4PFO A;  4OIR F;  2Y3D A;  3E9V A;  2FAP B;  4J7Y A;  2WZL A;  4IAO A;  4CS8 C;  4RBN A;  1ORS C;  1I4Z A;  1QQ3 A;  1ZHX A;  4BJT A;  3NDB B;  3RH3 A;  3AOU A;  2PNO A;  2W4M A;  5KYX A;  2OOC A;  1G4U S;  3DD7 A;  4KBL A;  2ZXO A;  3M1C B;  4LLE A;  2HJM A;  2XLO A;  3JRT A;  3EFO B;  4MVM A;  2A0U A;  4FWV A;  4K0D A;  4BJ5 C;  3E70 C;  3HJC A;  4Q7C A;  4EUK B;  2FFH A;  3T9O A;  3V5X A;  2HMZ A;  3EZI A;  2MYS A;  1ZU5 A;  1MMN A;  2GDC A;  1HW1 A;  2A6H F;  3QW1 A;  1V55 C;  3L0I A;  3RVY A;  4CDY A;  4U5G A;  2ZD9 A;  3DJU B;  3JSZ A;  1NG1 A;  2HV6 A;  1NLX A;  3GWN A;  3HTK C;  3MX3 A;  2WVN A;  3U2L A;  3RQE A;  1ST6 A;  3WHN A;  2XLH A;  3ZIB A;  3W8H A;  1QPU A;  3LS0 A;  2LQG A;  2OJE D;  4J32 B;  1J8M F;  2XSE A;  2Y3G A;  4MND A;  1VMA A;  2P7V A;  1M2O A;  1Z3I X;  3GEE A;  3W2V A;  2XLE A;  1E86 A;  1VYI A;  4HE8 D;  2M4E A;  2CCY A;  3JYY A;  5A6J A;  2VB6 A;  3RQF A;  1RKE A;  1NFO A;  2HS5 A;  2VCB A;  2X0C A;  3K7D A;  2JPU A;  4U5B E;  2W4B A;  4XPW A;  1T5O A;  3MYI A;  1JR8 A;  2L9J A;  3DM9 B;  4C3E A;  5BQH A;  1GS9 A;  4BG0 A;  4O6N A;  2HMQ A;  2P6V A;  1B68 A;  3KPH A;  2OCC C;  3OA1 A;  2PX0 A;  1NU9 C;  4JCH A;  4PK4 A;  3TOM A;  1VYK A;  2R7V A;  2R7Q A;  3ATP A;  2DYS C;  2QY9 A;  4CX9 A;  2OG2 A;  2CGE A;  3ZC4 A;  3AJM A;  3K33 A;  4LDR A;  1RKC A;  3SXY A;  3X2Q C;  3C8Z A;  3ABM C;  4GYT A;  2LFF A;  4N06 A;  4A4A A;  3G4Z A;  3JSE O;  3TD7 A;  1AVO B;  4YL0 A;  2C03 A;  2IM8 A;  3LS1 A;  4JIO A;  4BJ1 A;  5L0I A;  3S0X A;  2P61 A;  1E83 A;  3ABK C;  1QKR A;  1JAF A;  2RSE B;  1NFN A;  2ZPA A;  3O6X A;  1OCO C;  4HEA J;  1ZZP A;  2IXP A;  2DB4 A;  1OW6 A;  1T6I A;  3A9C A;  5T1D B;  3EGD A;  3S28 A;  4DJ9 A;  2AWC A;  4C3D A;  4ONS A;  3F46 A;  2ETS A;  1V54 C;  1D0Z A;  2R7O A;  4YT5 A;  5E2Q A;  3N0T A;  4YJW A;  1WOL A;  2J7P D;  2GAQ A;  1DOW A;  4MW8 A;  4PAC A;  4DXW A;  3TOL A;  4AE4 B;  4PFP A;  5F5H A;  2KGO A;  3DJN B;  4GEH A;  1RKE B;  4P9T A;  4H4K C;  1SR2 A;  2DYR C;  4U9D A;  5CI8 A;  3PCV A;  2CW0 F;  5KYU B;  4JEB A;  5AC5 A;  1WWP A;  3NYJ A;  4P6I C;  1IW7 F;  2LSE A;  2ZXP A;  5EHH A;  2YKZ A;  3US6 A;  3A11 A;  4JUR I;  3KYJ A;  3L8I A;  1QZX A;  4M63 A;  4O79 A;  5DS6 A;  1ZHZ A;  1OW7 A;  1GQA A;  5EK0 A;  1N1C A;  4K7B A;  4CBE A;  1OW8 A;  4EWC A;  2XM4 A;  1CGM E;  4N4W A;  3MYF A;  4C3B A;  3Q7L A;  5HV9 A;  3CQZ A;  4EBB A;  2XXA B;  2HJ3 A;  3DAF A;  3GWL A;  3U3B A;  3VAY A;  4EHP A;  4G7O F;  4GQH A;  3CEX A;  1UFB A;  3TUL A;  1OKK A;  2CDQ A;  2XLW A;  5E3C A;  2WVO A;  4BJ6 A;  1VK5 A;  1YAR O;  4HFK B;  1YYJ A;  4JJF A;  4CS8 A;  5KYX B;  2Q9C A;  2J9V A;  2XL8 A;  3NYL A;  3RKO F;  4YT2 A;  1H6G A;  4JTD B;  3SXK A;  1MQV A;  3AQC A;  3T4R A;  4CSA C;  1QVX A;  4MVR A;  5JS5 A;  2W9Y A;  4NC3 A;  4AE4 A;  2IYL D;  4XTK A;  1LS4 A;  1HMD A;  3AG1 C;  2EPL X;  3C8G B;  2CYD A;  2IBF A;  1M57 C;  3ASO C;  2J9W A;  1TR2 A;  2YWA A;  3M4B A;  3KKB A;  4ZLC A;  3ECS A;  3GM1 A;  1O87 A;  1Q0K A;  4Z9I A;  4AK9 A;  1JPJ A;  2X51 A;  4KI2 A;  4B6I A;  2AVK A;  1KTM A;  3VF0 A;  1Q0G A;  4FES A;  2QLA A;  3R2P A;  3G4X A;  3K1I A;  2EIJ C;  4O7G A;  2LIG A;  2J0W A;  1NSG B;  1YZC A;  2XL4 A;  4J7T A;  1HY5 A;  4IJJ A;  3ZDL A;  4F4B A;  5B3S C;  1CGO A;  1M56 C;  3K1H A;  2P0N A;  3C8G D;  2EPM X;  2YL3 A;  4KNV A;  1Q0F A;  2Z15 A;  4CS7 A;  4CS9 A;  1T6U A;  4YT8 A;  4DVZ A;  3LEV A;  2J9B A;  2ZXW C;  4E18 A;  4ANJ A;  2R7S A;  4ER9 A;  3UGO A;  5F5F A;  1ZW3 A;  1HE9 A;  4NY3 A;  4YL3 A;  3M4C A;  2XLV A;  3NG1 A;  4QDL A;  3RW0 A;  4CIP A;  2YLG A;  1M2V A;  5DS5 A;  3C63 A;  1SMY F;  3TQO A;  4JKV A;  4G7Z F;  2OEX A;  4CDA A;  2VC9 A;  4EIY A;  5EGY A;  1R5I D;  3QVZ A;  1QLE C;  4ULW A;  2NUP B;  3U9M A;  1GGQ A;  3GEI A;  1TWA A;  2QUP A;  3R7C A;  4Z9J A;  4JVS A;  4KNW A;  2KW3 C;  3HLZ A;  3GEH A;  4IRU A;  4DRH B;  3MLG A;  3U2M A;  1FNT c;  3WOD F;  2HSQ A;  5B3I A;  3I4U A;  3PMR A;  4MTG A;  4DBR A;  4NQF A;  4XPY A;  3V7O A;  4AL0 A;  4XWJ A;  4YWQ A;  3IQ5 A;  1OKK D;  4Q4Z F;  4OIP F;  1FAP B;  4RDA A;  2XLM A;  2XXA A;  3OWT A;  3C7J A;  3UMK A;  3AGT A;  4YT4 A;  2L6G A;  2E87 A;  4JTA B;  4HFF B;  4LDQ A;  1LPE A;  1Z5Z A;  3ZTZ A;  4R32 A;  4NTF A;  3NMI A;  3DE9 A;  1WAS A;  3B9Q A;  4IGG A;  1AUE A;  3H65 A;  1RXQ A;  3EHN A;  3HNJ A;  2VAS A;  4X0R A;  5T3W A;  3WAQ A;  1OCC C;  1YZA A;  2DI3 A;  1CPQ A;  4JJG A;  1BDJ B;  2H7B A;  5K0I A;  1BR1 A;  4MVU A;  1OR2 A;  1TFO B;  4YN0 B;  4NTA A;  1FFH A;  3Q6N A;  3DM5 A;  1D1C A;  5F28 E;  1APC A;  3VM6 A;  4E7Z A;  2A68 F;  3S84 A;  1MMD A;  2Q00 A;  4OD4 A;  3CAX A;  2IOQ A;  5AGF A;  4JEA A;  2JX0 A;  4DBQ A;  2XL6 A;  3DKA A;  5E3A A;  1LKX A;  2TMV P;  3NYM A;  2R02 A;  2R7R A;  2ICW G;  5L0F A;  3Q7G A;  2EPO A;  1YVI A;  4N6C A;  5B1A C;  2KNH A;  3LJB A;  256B A;  2H8A A;  4ULV A;  5KYW B;  4OIO F;  4D4N A;  3ZWI A;  5JP7 A;  4I3M A;  2R7X A;  1FMV A;  1S05 A;  2R9R B;  3DZA A;  3S90 A;  4CSA A;  1YYX A;  2G3K A;  2OEV A;  3FVY A;  1W2W A;  3NMK A;  3K6B A;  4XEV A;  3IQT A;  4OD5 A;  4JCZ A;  1NZE A;  3W4Y A;  2YVK A;  5L0J A;  3W8I A;  1LI7 A;  2XM0 A;  2MWQ A;  5JRA A;  5A6B A;  1CGN A;  1A7V A;  3LUT B;  2YLI A;  3LLI A;  4L6R A;  4IAR A;  3VYW A;  3KL4 A;  2QTV A;  3WG7 C;  3ZQY A;  2D4U A;  1MMG A;  3PDM P;  3EZH A;  3KYI A;  2L81 A;  2KQ9 A;  3H2U A;  3EH1 A;  4BPM A;  1TWC A;  1G4W R;  3LAY A;  5L3V A;  2RD9 A;  2WZF A;  3U0C A;  2KSF A;  2KC3 A;  1LI5 A;  1K40 A;  1MNE A;  1ZW2 A;  2EIK C;  3LNR A;  2KYH A;  2G62 A;  4K1O A;  1Q0M A;  3FOP A;  3M15 A;  1FFT C;  3EJN A;  3HKK A;  1OXB A;  4QI0 A;  4BJ6 C;  1HW2 A;  4G0H A;  1WGW A;  1ZHW A;  4W8P A;  5CIV A;  5KYY B;  2NG1 A;  5CI9 A;  4PJJ A;  4NCQ A;  3O10 A;  1O5H A;  4C7O A;  5KYU A;  5BQI A;  2VCA A;  4FAP B;  2ZXR A;  1YA7 O;  2NUT B;  4U5E E;  1VOM A;  2WB7 A;  4D4X A;  1D0Y A;  3FAJ A;  1LM3 B;  2PF4 E;  2L7A A;  1A41 A;  3QZC A;  3QW0 A;  1TWG A;  1T9K A;  2NSF A;  1RMV A;  2Y3B A;  3O39 A;  3SNH A;  3CZ6 A;  2Q7R A;  3JT1 A;  2QE9 A;  3UMI A;  3DAG A;  5AC4 A;  3FOO A;  4CIH A;  1TFK B;  3RFY A;  1PCX A;  2A1D D;  2Y39 A;  3DXJ F;  3H2V A;  1OR3 A;  3JTL O;  2G3V A;  2R05 A;  2GWW A;  2HUJ A;  1TKN A;  2XLD A;  3JCU Q;  5JLI A;  5L0C A;  1IZM A;  1C02 A;  3BEH A;  2QNL A;  2J46 A;  2PP4 A;  5DLJ A;  5JUA A;  1HMO A;  2J7P A;  1A7E A;  2C04 A;  3AQB A;  3HNK A;  5COM A;  5JT4 A;  2OKU A;  1SZI A;  2NPU A;  2V3C C;  3ABL C;  2GFH A;  2BC5 A;  3NRH A;  3JYH A;  4YK5 A;  1D0X A;  1OCR C;  1LE4 A;  1GM5 A;  3ITF A;  2PX3 A;  3EQL F;  1R4T A;  1AEP A;  1M2V B;  1BR2 A;  2HZ8 A;  3EG9 A;  1BR4 A;  4MQ9 F;  4OIQ F;  3F47 A;  1KU2 A;  2OU6 A;  5KYW A;  1XZP A;  4MVZ A;  3KH2 A;  2CNW A;  1NBB A;  2R25 A;  3B0P A;  1ZYR F;  3O55 A;  3IQC A;  4LDK A;  3ZSU A;  2BL2 A;  4U9E A;  4BJ5 A;  3MBG A;  4MTO A;  1FTS A;  2R7T A;  1WAT A;  3IPM O;  5A69 A;  5IY5 C;  4EBJ A;  3GOR A;  1C03 A;  2F22 A;  2AWY A;  2A69 F;  2PFD A;  3GM3 A;  4I1O B;  3QVY A;  1RCP A;  3SYN A;  5B1B C;  3RF3 A;  1LIH A;  4DRI B;  2LFD A;  1ZHY A;  5COG A;  4UDV A;  3DI5 A;  1YA9 A;  2P1A A;  1F1M A;  3DE8 A;  2BE5 F;  2WZG A;  1MMA A;  3EGD B;  3LLK A;  2UUI A;  3N2Z B;  4LLC A;  4MS2 A;  3SZR A;  4BEM J;  3HNI A;  2YEV A;  1T01 A;  2R7U A;  4AX2 A;  4AL1 A;  2JD3 A;  2OJQ A;  3U8V A;  3L34 A;  5A6A A;  1Z23 A;  4N6H A;  5L0G A;  1H9G A;  4U5C E;  1G8X A;  3V5Z A;  3POV A;  3J06 A;  2O9X A;  1SF8 A;  5D92 A;  5TJ5 E;  3FAP B;  5HSW A;  4PJM A;  1JMW A;  2V26 A;  2D5R B;  3TJ6 A;  3C8G A;  3ASN C;  3L8J A;  4PJN A;  3VRC A;  1OXK A;  2YL7 A;  3T6B A;  2A0B A;  1BZ4 A;  1Z6A A;  1YLM A;  1VTM P;  3N24 A;  3UNG C;  3EG9 B;  1U6H A;  2Y69 C;  1A0B A;  2CNW D;  5DS4 A;  3TJ5 A;  2FGY A;  2I15 A;  4U5H A;  4MW3 A;  4Q5S F;  3FDQ A;  1QSP A;  2W45 A;  4I44 A;  1A7D A;  3GAN A;  4WAB A;  2EIN C;  2IXM A;  1UG7 A;  1RJ9 B;  1MND A;  3ZG1 A;  2XS1 A;  1WN0 A;  2GA0 A;  4CDV A;  1I5N A;  1JOG A;  3U5S A;  2IXO A;  1M6T A;  1E84 A;  4FX5 A;  2EIM C;  2YLD A;  3I5P A;  4O6Y A;  1YDI A;  4IWB A;  2HFI A;  2L6H A;  1G5Z A;  2XS8 A;  4JTC B;  1D1A A;  1V4A A;  1JPN A;  4Z9H A;  4I1M A;  4XLP F;  2R03 A;  1YAU O;  2WL8 A;  3QTH A;  3U9J A;  2LP4 A;  2J8W A;  5L0D A;  5D91 A;  2Q4F A;  3ZVR A;  3L1M A;  3AG2 C;  3FMS A;  2M64 A;  4G7H F;  3DWW A;  1U89 A;  2J0X A;  3K1I C;  2IXN A;  3DMD A;  2ASR A;  5FZT A;  4CJO A;  2I8B A;  1LE2 A;  2B0H A;  1YJG A;  3G50 A;  1ZVZ A;  2LK4 A;  4LAC B;  1PV3 A;  3B0V C;  3S27 A;  4CJG A;  5KYY A;  1FMW A;  3SEO A;  5L3Q A;  5KYN A;  1Z63 A;  4BEJ A;  4C7O B;  3EGX B;  3C18 A;  2H7V C;  4YL1 A;  2A6E F;  4PJL A;  1XZQ A;  3UMH A;  1VB5 A;  5FCL A;  5JVE A;  4WGY A;  1PD0 A;  2EIL C;  2R7W A;  1K04 A;  3RIP A;  4JW1 A;  2Q9B A;  4H54 A;  4E17 A;  2KJG A;  3EHM A;  1ORJ A;  1RJ9 A;  1PD1 A;  1HE1 A;  5BQG A;  4MVS A;  1D1B A;  3EPV A;  4MVO A;  3SXM A;  1V74 B;  4E7S A;  1C17 M;  3SXZ A;  1CPR A;  4P9F A;  4U5F E;  4JC7 A;  2NSG A;  2LCH A;  2WVQ A;  1Q0D A;  3LES A;  5JSL A;  4W8K A;  1OCZ C;  2AP3 A;  3NMJ A;  3FXH A;  2AU5 A;  3NKD A;  5A6B D;  3B0U X;  3RYL A;  5DVW A;  3S9O A;  1L3P A;  4XEK A;  5A6K A;  3IEE A;  2VH3 A;  2HKV A;  3U3F A;  1SYQ A;  2PBE A;  1KNY A;  2EPN A;  3I5Q A;  5T3T A;  2NUP A;  4MTF A;  3GM2 A;  4JRZ A;  3KMI A;  1EA8 A;  3B71 A;  3TK0 A;  2LD6 A;  3BRJ A;  1NU7 D;  2L6F A;  5DQT A;  1O3U A;  1EQ1 A;  4NTB A;  1Z7Q c;  1EKY A;  2KK1 A;  1BBH A;  2OQM A;  3EGX A;  3LNM B;  4LER A;  4PR9 A;  1J8Y F;  1E2X A;  3U8P A;  5COF A;  4DOZ A;  4ZLD A;  1TWH A;  2J9U A;  2MHR A;  2DGJ A;  3CSK A;  4J30 B;  3JRM O;  4MVQ A;  4XLN F;  1L7C A;  2Q3T A;  1ORY A;  2B0J A;  3GOD A;  1K05 A;  2H7O A;  3HNL A;  1JRA A;  1ZU4 A;  2YQY A;  5GPG B;  3UR3 C;  2UUH A;  1H7I A;  2Y3H A;  4CS9 C;  2EPK X;  3RVZ A;  3ZTM A;  1EI7 A;  3W2W A;  4JZA A;  1H9T A;  2YHS A;  3EFO A;  1Y6D A;  5BUO A;  1WTY A;  4G78 A;  1FR0 A;  4WGZ A;  3IQ6 A;  2YL1 A;  3FHD A;  1LS1 A;  2XRH A;  3AGU A;  3MFN A;  1S7Z A;  3SP1 A;  4A2N B;  1OQC A;  3JZ0 A;  2J45 A;  1DOV A;  3UGP A;  2YL0 A;  4QI2 A;  2YZS A;  1VLT A;  3NKE A;  4XQ1 A;  2VCC A;  3X1O A;  4JE9 A;  5DQZ A;  3M79 A;  4O6M A;  1ZHT A;  1TQG A;  3B29 A;  4RD9 A;  3C62 A;  3ZQV A;  1Y4C A;  3IHU A;  4XEF A;  3OEO A;  5E33 A;  2NUT A;  2HSB A;  3Q6M A;  3T6J A;  3V5Y A;  4DRJ B;  1T6Q A;  4EBK A;  4EKW A;  3PHF 2;  4XPX A;  5L0H A;  3S29 A;  1LVK A;  3K66 A;  1I4Y A;  3QMK A;  4WJ0 A;  1XWJ A;  1E85 A; 
#chains in the Genus database with same CATH homology
 4U5D E;  3EH2 A;  2HV7 A;  4OIN F;  3AG3 C;  3AG4 C;  2Q9A A;  4KC9 A;  4DVY P;  4PFO A;  4OIR F;  2Y3D A;  3E9V A;  2WZL A;  4IAO A;  4CS8 C;  4RBN A;  3NDB B;  1ZHX A;  4BJT A;  3RH3 A;  2W4M A;  5KYX A;  4KBL A;  3DD7 A;  4LLE A;  2ZXO A;  3M1C B;  3JRT A;  3EFO B;  4K0D A;  4FWV A;  4BJ5 C;  3E70 C;  3HJC A;  4Q7C A;  2FFH A;  3EZI A;  2MYS A;  1ZU5 A;  1MMN A;  2A6H F;  1V55 C;  3L0I A;  4U5G A;  3DJU B;  3JSZ A;  1NG1 A;  2HV6 A;  3HTK C;  3MX3 A;  2WVN A;  1ST6 A;  3ZIB A;  3W8H A;  3LS0 A;  4J32 B;  1J8M F;  2XSE A;  2Y3G A;  4MND A;  1VMA A;  2P7V A;  1M2O A;  1Z3I X;  3W2V A;  1VYI A;  4HE8 D;  2M4E A;  2VB6 A;  3K7D A;  4U5B E;  2W4B A;  2L9J A;  3DM9 B;  4C3E A;  4BG0 A;  4O6N A;  2P6V A;  3OA1 A;  2OCC C;  2PX0 A;  1NU9 C;  4JCH A;  4PK4 A;  2R7V A;  1VYK A;  2R7Q A;  2DYS C;  2QY9 A;  2OG2 A;  2CGE A;  3ZC4 A;  3K33 A;  3X2Q C;  3ABM C;  4GYT A;  4N06 A;  3TD7 A;  2C03 A;  3LS1 A;  4BJ1 A;  3S0X A;  3ABK C;  2ZPA A;  3O6X A;  1OCO C;  4HEA J;  2IXP A;  5T1D B;  3EGD A;  3S28 A;  4C3D A;  3F46 A;  1V54 C;  1D0Z A;  2R7O A;  4YT5 A;  5E2Q A;  3N0T A;  4YJW A;  2J7P D;  4AE4 B;  4PFP A;  5F5H A;  2KGO A;  3DJN B;  4GEH A;  4H4K C;  2DYR C;  5CI8 A;  2CW0 F;  5KYU B;  3NYJ A;  4P6I C;  1IW7 F;  2LSE A;  2ZXP A;  5EHH A;  4JUR I;  4M63 A;  5DS6 A;  1QZX A;  4O79 A;  1ZHZ A;  1N1C A;  4K7B A;  4CBE A;  4EWC A;  4C3B A;  3Q7L A;  3CQZ A;  4EBB A;  2XXA B;  3DAF A;  3VAY A;  4G7O F;  1OKK A;  2CDQ A;  5E3C A;  2WVO A;  4BJ6 A;  1VK5 A;  4HFK B;  4JJF A;  4CS8 A;  5KYX B;  2Q9C A;  2J9V A;  3RKO F;  3NYL A;  4YT2 A;  3AQC A;  3T4R A;  4CSA C;  2W9Y A;  4AE4 A;  2IYL D;  4XTK A;  3AG1 C;  1M57 C;  3ASO C;  2J9W A;  1TR2 A;  3KKB A;  4ZLC A;  3ECS A;  1O87 A;  4AK9 A;  1JPJ A;  2X51 A;  4KI2 A;  4B6I A;  4FES A;  2EIJ C;  4O7G A;  2J0W A;  2XL4 A;  4IJJ A;  5B3S C;  4F4B A;  1M56 C;  3K1H A;  4KNV A;  2Z15 A;  4CS9 A;  4CS7 A;  4YT8 A;  4DVZ A;  3LEV A;  2ZXW C;  4ANJ A;  2R7S A;  3UGO A;  5F5F A;  4NY3 A;  3NG1 A;  4QDL A;  1M2V A;  5DS5 A;  1SMY F;  4G7Z F;  4ULW A;  1QLE C;  2NUP B;  1TWA A;  4JVS A;  4KNW A;  2KW3 C;  3HLZ A;  4IRU A;  3MLG A;  3WOD F;  3I4U A;  3PMR A;  4DBR A;  4YWQ A;  3V7O A;  4XWJ A;  4Q4Z F;  1OKK D;  4OIP F;  4RDA A;  2XXA A;  3OWT A;  3UMK A;  4YT4 A;  2E87 A;  4HFF B;  1Z5Z A;  3B9Q A;  3H65 A;  3EHN A;  4X0R A;  2VAS A;  5T3W A;  1OCC C;  4JJG A;  2H7B A;  1BR1 A;  4YN0 B;  1FFH A;  3Q6N A;  3DM5 A;  1D1C A;  4E7Z A;  2A68 F;  1MMD A;  4OD4 A;  2IOQ A;  4DBQ A;  5E3A A;  1LKX A;  3NYM A;  2R7R A;  3Q7G A;  5B1A C;  2KNH A;  3LJB A;  4OIO F;  5KYW B;  4I3M A;  2R7X A;  1FMV A;  3DZA A;  4CSA A;  2G3K A;  3FVY A;  1W2W A;  3K6B A;  4OD5 A;  1NZE A;  3W8I A;  2MWQ A;  5EGY A;  3LLI A;  3VYW A;  3KL4 A;  2QTV A;  3WG7 C;  1MMG A;  3EZH A;  2L81 A;  2KQ9 A;  3EH1 A;  1TWC A;  3LAY A;  5L3V A;  2WZF A;  1MNE A;  3LNR A;  2EIK C;  2G62 A;  1FFT C;  3EJN A;  4QI0 A;  4BJ6 C;  4G0H A;  1WGW A;  1ZHW A;  5KYY B;  2NG1 A;  5CI9 A;  4PJJ A;  1O5H A;  4C7O A;  5KYU A;  2ZXR A;  2NUT B;  4U5E E;  1VOM A;  2WB7 A;  1D0Y A;  3FAJ A;  3QZC A;  2PF4 E;  1TWG A;  2Y3B A;  3O39 A;  3SNH A;  3CZ6 A;  3UMI A;  3JT1 A;  3DAG A;  4CIH A;  3RFY A;  1PCX A;  2A1D D;  2Y39 A;  3DXJ F;  2G3V A;  1TKN A;  3JCU Q;  1IZM A;  2J46 A;  2PP4 A;  5DLJ A;  2J7P A;  2C04 A;  3AQB A;  1SZI A;  2V3C C;  3ABL C;  2GFH A;  3NRH A;  3JYH A;  1D0X A;  1OCR C;  3ITF A;  2PX3 A;  3EQL F;  4MQ9 F;  1M2V B;  3EG9 A;  1BR2 A;  1BR4 A;  4OIQ F;  3F47 A;  1KU2 A;  5KYW A;  3KH2 A;  2CNW A;  3B0P A;  1ZYR F;  3ZSU A;  4BJ5 A;  1FTS A;  2R7T A;  5IY5 C;  2A69 F;  2PFD A;  4I1O B;  3SYN A;  5B1B C;  1ZHY A;  3LLK A;  2BE5 F;  2WZG A;  1MMA A;  3EGD B;  3N2Z B;  4LLC A;  3SZR A;  2YEV A;  2R7U A;  4AX2 A;  2JD3 A;  3L34 A;  3POV A;  1Z23 A;  4U5C E;  1G8X A;  2O9X A;  1SF8 A;  5D92 A;  5HSW A;  4PJM A;  2V26 A;  2D5R B;  4PJN A;  3ASN C;  3T6B A;  1Z6A A;  3N24 A;  3UNG C;  3EG9 B;  2Y69 C;  2CNW D;  5DS4 A;  2FGY A;  4U5H A;  4Q5S F;  3FDQ A;  2W45 A;  4I44 A;  3GAN A;  2EIN C;  2IXM A;  1RJ9 B;  1MND A;  3ZG1 A;  2IXO A;  4FX5 A;  2EIM C;  3I5P A;  4O6Y A;  4IWB A;  1D1A A;  1JPN A;  4I1M A;  4XLP F;  2WL8 A;  5D91 A;  3ZVR A;  3AG2 C;  4G7H F;  2J0X A;  3K1I C;  2IXN A;  3DMD A;  2I8B A;  4LAC B;  3B0V C;  3S27 A;  5KYY A;  1FMW A;  3SEO A;  5L3Q A;  5KYN A;  1Z63 A;  4BEJ A;  4C7O B;  3EGX B;  2H7V C;  2A6E F;  4PJL A;  3UMH A;  5FCL A;  1PD0 A;  2EIL C;  2R7W A;  3RIP A;  4JW1 A;  2Q9B A;  2KJG A;  3EHM A;  1RJ9 A;  1PD1 A;  4E7S A;  1D1B A;  3EPV A;  4U5F E;  2WVQ A;  3LES A;  4W8K A;  1OCZ C;  3NKD A;  3B0U X;  3RYL A;  5DVW A;  3IEE A;  2VH3 A;  3I5Q A;  5T3T A;  2NUP A;  3KMI A;  1NU7 D;  5DQT A;  4LER A;  3EGX A;  1J8Y F;  4DOZ A;  4ZLD A;  1TWH A;  2J9U A;  4J30 B;  2DGJ A;  3CSK A;  4XLN F;  2Q3T A;  2B0J A;  3GOD A;  2H7O A;  1ZU4 A;  3UR3 C;  4CS9 C;  2Y3H A;  3W2W A;  4JZA A;  2YHS A;  3EFO A;  5BUO A;  3FHD A;  3SP1 A;  1LS1 A;  2XRH A;  4A2N B;  1S7Z A;  3UGP A;  2J45 A;  4QI2 A;  2YZS A;  3NKE A;  3X1O A;  5DQZ A;  4O6M A;  1ZHT A;  4RD9 A;  3OEO A;  5E33 A;  2NUT A;  3T6J A;  3Q6M A;  3PHF 2;  3S29 A;  1LVK A;  3K66 A;  3QMK A;  4WJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...