1WGWA

Solution structure of the n-terminal domain of mouse putative signal recognition particle 54 (srp54)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKVKVYSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 'Signal Recognition Particle 54
publication title Solution Structure of the N-terminal Domain of Mouse Putative Signal Recognition Particle 54 (SRP54)
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1wgwA00
2J45A 3DM9B 2XXAB 3E70C 2Q9BA 3KL4A 4AK9A 2J46A 2OG2A 1WGWA 1J8YF 2FFHA 3NDBB 2Q9CA 2CNWD 2J7PD 2IYLD 1VMAA 3B9QA 2C03A 1QZXA 5L3VA 1J8MF 1OKKD 1LS1A 1RJ9A 5L3QA 2Q9AA 1JPNA 4C7OA 2CNWA 2J7PA 1ZU4A 1ZU5A 1FFHA 3DM5A 1RJ9B 1FTSA 2QY9A 1NG1A 2XXAA 2C04A 3NG1A 2NG1A 2V3CC 4C7OB 1OKKA 2YHSA 1O87A 3DMDA 1JPJA
chains in the Genus database with same CATH superfamily
3M4BA 4KNWA 2A6HF 5CIVA 3MYIA 2FGYA 4FESA 2R7UA 1OXKA 3JRMO 3EG9B 2J46A 3RQGA 1YVIA 1BR2A 4EHPA 1WN0A 2QTVA 3US6A 4DRHB 2Q9CA 2NSFA 2G3VA 1NSGB 1ZVZA 1OQCA 2R25A 3HNLA 3K1IA 3TOLA 3WG7C 5COFA 1FAPB 2VASA 4E7SA 4YT4A 2KSFA 2PP4A 3ITFA 2XLEA 3B0VC 1LE4A 5JP7A 2OCCC 2ZXRA 2XM4A 1WOLA 2P0NA 1K40A 4MVMA 4NTAA 3RYLA 3B71A 2Q4FA 3IQ6A 2WZLA 3VYWA 4CSAA 3MBGA 4OIQF 3S0XA 1FFHA 4CSAC 3I5PA 3NKEA 1MNDA 2I8BA 4LDKA 3ABLC 5L0IA 2HJMA 3LEOA 3RW0A 5L0GA 1V55C 3U3BA 4YK5A 3X1OA 3S27A 1H7IA 3ASNC 5DQTA 1YLMA 2HSBA 5A6AA 4MVRA 1MMAA 1VLSA 3DAGA 3CEXA 3DM9B 1NU9C 3VM6A 4OIOF 1VB5A 2WZFA 2ZPAA 3Q7LA 4MQ9F 2W9YA 2D5RB 2P1AA 4KNVA 1Z7Qc 1C17M 3HJCA 1OCCC 5KYXA 2OOCA 3EH2A 1VK5A 2J0XA 1MNEA 1T6UA 1BZ4A 1D1CA 4YN0B 3RQFA 3U9JA 4DRIB 1ZHYA 3DE9A 3T9OA 4CDYA 5DS5A 2R7QA 4P9FA 2ASRA 1Q0MA 3EGDA 3ZG1A 5A6BA 5JRAA 2ZXPA 2UUHA 4JE9A 3PMRA 1LKXA 2XM0A 1YYXA 3NMJA 4CDAA 4YL0A 3EZHA 2KW3C 2EPNA 1XWJA 5BQGA 4O6MA 3RIPA 1QKRA 2R05A 3A11A 4ZLCA 2KNHA 1SR2A 2PNOA 2PFDA 2JX0A 2XL8A 3OWTA 4KBLA 5L0HA 2IXPA 3KH2A 4JEAA 4KI2A 1HW2A 3N2ZB 4IAOA 1KU2A 3F46A 3AGUA 4OD4A 2Q7RA 2HV6A 3FDQA 2L6HA 5T3TA 3ABKC 3EHNA 4O6NA 3MYFA 2R7TA 2EIMC 1J8MF 2GAQA 2LSEA 2WVQA 3CZ6A 2WL8A 4JJFA 1LS1A 3T6BA 4PK4A 4FX5A 1ORJA 3BEHA 2AP3A 1SMYF 1QLEC 5L0FA 4MTFA 4N6HA 4ZLDA 1Q0GA 1NFNA 2EPOA 2PX3A 1D0XA 2KJGA 4XEFA 3DAFA 3WAQA 1G4WR 1OXBA 4J32B 2YL1A 1MMGA 1D0YA 5AGFA 4YT8A 3GM2A 3CSKA 4PJJA 1XZPA 3B0PA 1FFTC 3LAYA 2H7BA 4MVQA 1QPUA 3M79A 4X0RA 5EHHA 3SXZA 3FXHA 3GEHA 4D4NA 1N1CA 2TMVP 3W8HA 5KYYA 2LFDA 5JT4A 1G8XA 2G3KA 1OR3A 2Y39A 2YL0A 4N06A 4ONSA 2OQMA 2YL3A 1OR2A 3T6GB 1SF8A 2J8WA 2LCHA 4CIPA 4YL3A 1Y4CA 2YLDA 5JLIA 1CPQA 3H65A 4ER9A 1CPRA 5K0IA 1T5OA 5FCLA 3ZTMA 4C7OA 1JR8A 4B6IA 2DYRC 5B3IA 4F4BA 3IPMO 4IARA 4EKWA 1MMNA 2VCAA 3GM1A 4U5GA 4EBJA 3DMDA 3BRJA 1VLTA 3W4YA 1OCZC 2F22A 1S7ZA 1TKNA 2XL4A 1OW8A 4DVZA 4AK9A 2EIKC 1MQVA 5IY5C 5KYWA 5B3SC 3C18A 2IXMA 1LS4A 4PJLA 3H2UA 2YZSA 2IYLD 1HY5A 3RF3A 4MVZA 1YYJA 2RSEB 2XS8A 4JC7A 3AG1C 5KYWB 1Q0DA 2RD9A 2JPUA 4W8KA 1OKKD 3AQCA 4NQFA 3C8GA 5JSLA 4C3EA 5A69A 2YLIA 1E84A 4U9EA 2H7VC 3JT1A 5DS6A 3DI5A 5CI9A 4OINF 4H4KC 4IJJA 4MTOA 3EG9A 3RVYA 3Q6MA 2EIJC 5FZTA 3ZDLA 2XLWA 2AWCA 4Z9JA 5F5HA 4CX9A 1VYIA 2P7VA 3IEEA 3TULA 2J45A 3ASOC 2ZXOA 1PV3A 1GQAA 3FVYA 3UGOA 1T9KA 3NRHA 3QVYA 4RBNA 2J9VA 3U2MA 5B1AC 3POVA 2CNWD 3G50A 4G0HA 3GWNA 4XPYA 2QE9A 2D4UA 2L9JA 3KYIA 3S29A 3I4UA 1QZXA 3HLZA 1M6TA 2WB7A 5E3CA 2CGEA 5L0DA 1OW6A 4Z9IA 5HV9A 2Y69C 4ULVA 4K7BA 1YJGA 4BPMA 4Q4ZF 4P9TA 4DOZA 2B0JA 3CAXA 4YL1A 3TJ5A 1TWHA 3FAPB 1ZU5A 3AG3C 1QVXA 2HFIA 3JRTA 3RKOF 4G7OF 4LLEA 3S84A 2JD3A 1ZZPA 1WTYA 3FOOA 4MW8A 4E18A 2ICWG 4EIYA 1UFBA 2PF4E 1H6GA 3U5SA 2FAPB 1JMWA 2CW0F 2WZGA 5BQHA 2YLGA 2XXAB 3E70C 1D0ZA 4PJNA 4RD9A 2VB6A 3U3FA 1D1AA 1YARO 3NYJA 2GFHA 2OJQA 4YT2A 2FFHA 3K7DA 3O6XA 5B1BC 4U5DE 4CBEA 4JTAB 4HEAJ 4PFPA 3LNMB 4DBQA 2CDQA 4Q5SF 1Q0KA 2DYSC 2ZD9A 2CCYA 3M1CB 4R32A 3SXMA 2NSGA 2VCCA 4MW3A 3UNGC 1YA7O 2J9UA 3JYYA 2G62A 3LJBA 3QVZA 3NMIA 1FMWA 1YZAA 1NFOA 1JPNA 2YKZA 4HE8D 4G7HF 3DKAA 2J7PA 2QNLA 4U5FE 1HMDA 1RJ9B 2KC3A 2KQ9A 2NUTB 3C62A 2A6EF 2AVKA 3QZCA 4I44A 5T3WA 3TOMA 2R7OA 3GM3A 1IZMA 2R9RB 2OKUA 1R5ID 3IHUA 3DWWA 4DBRA 1UG7A 3K1HA 5EGYA 2BL2A 5DS4A 1C02A 1RKEB 2W4BA 3OA1A 3S28A 2CYDA 2NUPB 3TK0A 1K05A 4MVUA 3GWLA 3O39A 2XLVA 1DOVA 3EFOB 3KPHA 4GEHA 4Q7CA 1D1BA 1TWGA 1ZYRF 1BR1A 3AOUA 2YEVA 4ANJA 3SXKA 2HMQA 3NYMA 3C8ZA 2E87A 4IRUA 1EI7A 4MVOA 3ZSUA 5D92A 2MWQA 1WASA 3JSEO 1VOMA 4JKVA 4OIPF 2QY9A 3HKKA 1EQ1A 4XEVA 3IQTA 1TFOB 2XLOA 3DJUB 3HNKA 1BDJB 1ZW2A 4LERA 3SXYA 3ZIBA 3SZRA 4C3BA 1LM3B 4E17A 1C03A 4W8PA 1V4AA 2ETSA 3HTKC 3FAJA 1NZEA 4LLCA 1I4YA 2J0WA 4WABA 3PCVA 3QMKA 2OG2A 4I3MA 2J9BA 4XQ1A 1VMAA 5KYUB 2GDCA 3L8IA 4PFOA 1T6QA 3UR3C 1YAUO 1LE2A 3Q7GA 2NPUA 3RH3A 1G5ZA 4LDRA 4P6IC 4IB4A 2A68F 2MYSA 3B29A 1VYKA 2YL7A 3LUTB 1Z6AA 1M2VA 3B0UX 3FHDA 2ZXWC 3X2QC 3VRCA 3GANA 4JVSA 4FWVA 4E0IA 3NG1A 2EPKX 3FOPA 256BA 4JCZA 4QDLA 1M2VB 3W2WA 1CGNA 1YA9A 2PBEA 5A6JA 3ZVRA 4G7ZF 3KL4A 1LI7A 5HSWA 3U0CA 2HJ3A 3M4CA 4NC3A 1TFKB 4OD5A 1WATA 1HMOA 1I4ZA 2OU6A 3ZQVA 3DJNB 5A6BD 1M2OA 4C3DA 4E7ZA 4U5HA 2Y3BA 1RXQA 4XTKA 1A41A 5A6KA 3AJMA 3QTHA 1PD1A 3LS0A 2KGOA 4CS7A 4N4WA 4BEMJ 2Q00A 5CI8A 2HV7A 3K6BA 5E3AA 4JZAA 1FR0A 1S05A 2XLMA 2XL6A 1KNYA 4HFKB 4CJOA 4E0HA 1TR2A 3G4XA 3SYNA 4U9DA 4GYTA 4AE4B 4IAQA 3IQ5A 4K0DA 2V26A 1O5HA 4QI0A 5DLJA 2YRFA 3V5ZA 3ZWIA 2HUJA 3PHF2 2A0UA 1FMVA 4RDAA 2L7AA 5JUAA 2XRHA 4EBBA 3QW1A 2I15A 3ZC4A 4L6RA 1JOGA 1H9GA 2AU5A 3B9QA 3EJNA 4XLNF 1NU7D 4G78A 2Y3GA 4BG0A 1QSPA 3F47A 3PDMP 4IWBA 1GS9A 2OEXA 2HS5A 2OEVA 3OEOA 3U8VA 2Y3DA 4JCHA 2R02A 2LIGA 1ZU4A 2J9WA 4DXWA 3N0TA 3W2VA 3O10A 2R7RA 4LACB 4MTGA 5COMA 1AEPA 3A9CA 1E83A 1IW7F 2XXAA 1Y6DA 2KK1A 1V74B 3EGXB 3KKBA 3L34A 4XPXA 2YHSA 1TQGA 1GGQA 5EK0A 4FAPB 2M4EA 3UGPA 1JPJA 3GEIA 4DJ9A 3WODF 2DB4A 1DOWA 2LP4A 3NYLA 4U5BE 3J06A 1YDIA 4MS2A 2IBFA 2PX0A 1Z5ZA 2WVOA 4M63A 4NCQA 2O9XA 5L0JA 1O3UA 3JSZA 4BJ1A 4BJTA 4HFFB 4KC9A 3K1IC 1PCXA 2Q3TA 3RFYA 1EKYA 2W45A 2HMZA 4U5CE 3N24A 1RJ9A 3LS1A 4WJ0A 2NUTA 3TD7A 5JVEA 4AL1A 4JW1A 4CS8C 3SEOA 4UDVA 2A69F 1E85A 2L6FA 3LLIA 1Z63A 3UMIA 3K33A 3NMKA 1FTSA 1U6HA 3MLGA 5AC5A 3EQLF 3JTLO 2P6VA 1ZHTA 3Q6NA 4BJ5A 2V3CC 3UMHA 4D4XA 1ORSC 3AGTA 4BJ5C 1VTMP 1RKEA 4J30B 2IM8A 4XEKA 1V54C 2NUPA 3DXJF 2LQGA 1CGOA 3EPVA 3FMSA 3NKDA 1ZHXA 1Z3IX 3C8GD 1G4US 1LVKA 3EFOA 2EILC 2XSEA 4NY3A 1A0BA 4PJMA 3EZIA 1MMDA 4CJGA 5DVWA 2BC5A 1JAFA 3ATPA 4DRJB 2EPLX 3GORA 3EH1A 3LEVA 4O79A 3U2LA 1HE1A 2A1DD 4I1OB 2YQYA 2LFFA 3I5QA 1U0BB 4K1OA 1BBHA 4CS9A 3U8PA 1RKCA 2X0CA 5KYXB 3E9VA 4CS9C 2MHRA 3UMKA 3G4ZA 5TJ5E 2OJED 1FNTc 1GM5A 3GODA 2R7SA 3SNHA 1E86A 4J7YA 1YZCA 3VAYA 2B0HA 5COGA 4O7GA 3DM5A 2QLAA 3U9MA 3CQZA 2YWAA 4OIRF 4O6YA 1NG1A 1WWPA 1OW7A 1ZHZA 3R7CA 2NG1A 4WGZA 2QUPA 4EUKB 3L8JA 1OKKA 3KYJA 1O87A 2X51A 3ZQYA 1W2WA 5D91A 4Z9HA 4DVYP 1XZQA 3EGDB 4A4AA 4YWQA 3DE8A 3C63A 2AWYA 5KYUA 1LI5A 2Q9BA 4GQHA 1CGME 1JRAA 5E2QA 4BJ6A 1ZW3A 4YJWA 4JIOA 4ULWA 4BJ6C 4LDQA 1PD0A 1H9TA 1NBBA 2LD6A 2Y3HA 4WGYA 3M15A 3RVZA 3RQEA 2KYHA 2H7OA 1APCA 4NTFA 2M64A 1HW1A 2IXOA 4IGGA 3TQOA 1L3PA 5L3VA 3ABMC 4U5EE 3S90A 2Z15A 3T6JA 1AVOB 2BE5F 2Q9AA 3GEEA 4CIHA 2CNWA 2VCBA 1HE9A 4JTCB 3EHMA 3V5XA 1NLXA 1RMVA 3T4RA 1A7EA 1F1MA 2A0BA 2C04A 2VH3A 2IOQA 2R7WA 1T01A 3K66A 3HNIA 2HSQA 4MNDA 2XLHA 3ECSA 2UUIA 1U89A 3LESA 3W8IA 1ORYA 2WVNA 4EBKA 5T1DB 1J8YF 1LIHA 4PACA 4YT5A 1OCRC 1RCPA 5GPGB 2J7PD 3NDBB 2VC9A 3L0IA 2GA0A 2H8AA 3LLKA 3V5YA 2C03A 1E2XA 5F28E 1TWAA 3TJ6A 2HZ8A 3MX3A 2IXNA 2HKVA 1AUEA 4XLPF 3H2VA 5KYYB 3S9OA 5L3QA 4AE4A 5BUOA 3AG4C 2R7VA 1KTMA 1T6IA 1EA8A 2DGJA 2P61A 3QW0A 4NTBA 3WHNA 2W4MA 3L1MA 1BR4A 3MFNA 1L7CA 3JZ0A 4PR9A 4XPWA 1TWCA 3IQCA 1M56C 3O55A 1A7DA 4C7OB 1SZIA 4BEJA 5F5FA 2R03A 4I1MA 3JYHA 3LNRA 5E33A 3SP1A 1OCOC 4N6CA 3DD7A 1ST6A 3HNJA 1M57C 4H54A 5AC4A 1WGWA 4AL0A 3ZTZA 4A2NB 5DQZA 3VF0A 2XS1A 2R7XA 2L81A 3R2PA 5L0CA 3AG2C 5KYNA 4XWJA 3C7JA 1SYQA 1Z23A 4CDVA 4CS8A 4JURI 2XLDA 3V7OA 5JS5A 4EWCA 1B68A 2DI3A 3JCUQ 1R4TA 4J7TA 1I5NA 1ZHWA 2YVKA 3EGXA 4JJGA 1LPEA 4AX2A 1K04A 4JTDB 3KMIA 2EINC 1QQ3A 1Q0FA 2L6GA 5BQIA 3AQBA 3C8GB 4QI2A 1A7VA 4JEBA 2LK4A 2EPMX 4JRZA 2GWWA 3DZAA 4MVSA
chains in the Genus database with same CATH topology
4KNWA 2A6HF 2R7UA 2FGYA 4FESA 3EG9B 2J46A 1BR2A 2QTVA 2Q9CA 2G3VA 3WG7C 2VASA 4E7SA 4YT4A 2PP4A 3ITFA 3B0VC 2OCCC 2ZXRA 4CS8A 3RYLA 2WZLA 3VYWA 4CSAA 4OIQF 3S0XA 1FFHA 4CSAC 3I5PA 3NKEA 1MNDA 2I8BA 3ABLC 1V55C 3X1OA 3S27A 3ASNC 5DQTA 1MMAA 3DAGA 4OIOF 3DM9B 1NU9C 2WZFA 2ZPAA 3Q7LA 4MQ9F 2W9YA 2D5RB 4KNVA 3HJCA 1OCCC 5KYXA 3EH2A 1VK5A 2J0XA 1MNEA 1D1CA 4YN0B 1ZHYA 5DS5A 2R7QA 3ZG1A 3EGDA 2ZXPA 3PMRA 1LKXA 3EZHA 2KW3C 3RIPA 4O6MA 4ZLCA 2KNHA 2PFDA 3OWTA 4KBLA 2IXPA 3KH2A 4KI2A 3N2ZB 4IAOA 1KU2A 3F46A 4OD4A 2HV6A 3FDQA 5T3TA 2R7TA 3ABKC 3EHNA 4O6NA 2EIMC 1J8MF 2LSEA 2WVQA 3CZ6A 2WL8A 4JJFA 1LS1A 3T6BA 4PK4A 4FX5A 1SMYF 1QLEC 4ZLDA 2PX3A 1D0XA 2KJGA 3DAFA 4J32B 1MMGA 1D0YA 4YT8A 3CSKA 4PJJA 3B0PA 1FFTC 3LAYA 2H7BA 4X0RA 5EHHA 1N1CA 3W8HA 5KYYA 1G8XA 2G3KA 2Y39A 4N06A 1SF8A 3H65A 5FCLA 4C7OA 4B6IA 2DYRC 4F4BA 1MMNA 4U5GA 3DMDA 1OCZC 2XL4A 1S7ZA 1TKNA 4DVZA 4AK9A 2EIKC 5IY5C 5KYWA 5B3SC 2IXMA 4PJLA 2YZSA 2IYLD 3AG1C 5KYWB 4W8KA 1OKKD 3AQCA 4C3EA 2H7VC 3JT1A 5DS6A 5CI9A 4OINF 4H4KC 4IJJA 3EG9A 3Q6MA 2EIJC 5F5HA 1VYIA 2P7VA 3IEEA 2J45A 3ASOC 2ZXOA 3UGOA 3FVYA 3NRHA 4RBNA 2J9VA 5B1AC 3POVA 2CNWD 4G0HA 3S29A 2L9JA 3I4UA 1QZXA 3HLZA 2WB7A 5E3CA 2CGEA 2Y69C 4K7BA 4Q4ZF 4DOZA 2B0JA 1TWHA 1ZU5A 3AG3C 3JRTA 3RKOF 4G7OF 4LLEA 2JD3A 2PF4E 2CW0F 2WZGA 2XXAB 3E70C 1D0ZA 4PJNA 4RD9A 2VB6A 4YT2A 1D1AA 3NYJA 2GFHA 2FFHA 3K7DA 3O6XA 5B1BC 4U5DE 4CBEA 4HEAJ 4PFPA 4DBQA 4Q5SF 2CDQA 2DYSC 3M1CB 3UNGC 2J9UA 3LJBA 2G62A 1FMWA 1JPNA 4G7HF 4HE8D 2J7PA 4U5FE 1RJ9B 2KQ9A 2NUTB 3QZCA 2A6EF 4I44A 5T3WA 2R7OA 1IZMA 4DBRA 3K1HA 5EGYA 5DS4A 2W4BA 3OA1A 3S28A 2NUPB 3O39A 3EFOB 4GEHA 4Q7CA 1D1BA 1TWGA 1ZYRF 1BR1A 2YEVA 4ANJA 3NYMA 4IRUA 2E87A 3ZSUA 5D92A 2MWQA 1VOMA 4OIPF 2QY9A 3ZIBA 3DJUB 4LERA 3SZRA 4C3BA 3HTKC 3FAJA 1NZEA 4LLCA 2J0WA 3QMKA 2OG2A 4I3MA 1VMAA 5KYUB 4PFOA 3UR3C 3Q7GA 3RH3A 4P6IC 2A68F 2MYSA 1VYKA 1Z6AA 1M2VA 3B0UX 3FHDA 2ZXWC 3X2QC 3GANA 4JVSA 4FWVA 3NG1A 4QDLA 1M2VB 3W2WA 4G7ZF 3ZVRA 3KL4A 5HSWA 4OD5A 3DJNB 1M2OA 4C3DA 4E7ZA 4U5HA 2Y3BA 4XTKA 1PD1A 3LS0A 2KGOA 4CS7A 5CI8A 2HV7A 3K6BA 5E3AA 4JZAA 4HFKB 1TR2A 3SYNA 4GYTA 4AE4B 4K0DA 2V26A 1O5HA 4QI0A 5DLJA 3PHF2 1FMVA 4RDAA 2XRHA 4EBBA 3ZC4A 3B9QA 3EJNA 4XLNF 1NU7D 4BG0A 2Y3GA 3F47A 4IWBA 3OEOA 2Y3DA 4JCHA 1ZU4A 2J9WA 3N0TA 3W2VA 2R7RA 4LACB 2XXAA 1IW7F 3EGXB 3L34A 3KKBA 3UGPA 2YHSA 2M4EA 1JPJA 3WODF 3NYLA 4U5BE 2PX0A 1Z5ZA 2WVOA 4M63A 2O9XA 4BJ1A 3JSZA 4BJTA 4HFFB 4KC9A 3K1IC 1PCXA 2Q3TA 3RFYA 2W45A 4U5CE 3N24A 1RJ9A 3LS1A 4WJ0A 2NUTA 3TD7A 4JW1A 4CS8C 3SEOA 2A69F 3LLIA 1Z63A 3UMIA 3K33A 1FTSA 3MLGA 3EQLF 3Q6NA 2P6VA 1ZHTA 4BJ5A 2V3CC 3UMHA 4BJ5C 4J30B 1V54C 2NUPA 3DXJF 3EPVA 3NKDA 1ZHXA 1Z3IX 4NY3A 3EFOA 1LVKA 2EILC 2XSEA 4PJMA 3EZIA 1MMDA 5DVWA 3LEVA 3EH1A 4O79A 2A1DD 4I1OB 3I5QA 4CS9A 5KYXB 3E9VA 4CS9C 3UMKA 3GODA 2R7SA 3SNHA 3VAYA 4O7GA 3DM5A 3CQZA 4OIRF 4O6YA 1NG1A 1ZHZA 2NG1A 1OKKA 1O87A 2X51A 4DVYP 1W2WA 5D91A 4YWQA 3EGDB 5KYUA 2Q9BA 4BJ6A 5E2QA 4YJWA 4BJ6C 4ULWA 1PD0A 2Y3HA 2H7OA 2IXOA 5L3VA 3ABMC 4U5EE 2Z15A 3T6JA 2Q9AA 2BE5F 4CIHA 2CNWA 3EHMA 3T4RA 2C04A 2VH3A 2IOQA 2R7WA 3K66A 4MNDA 3ECSA 3LESA 3W8IA 2WVNA 5T1DB 1J8YF 3NDBB 4YT5A 1OCRC 2J7PD 3L0IA 3LLKA 2C03A 1TWAA 3MX3A 2IXNA 4XLPF 5KYYB 5L3QA 4AE4A 5BUOA 3AG4C 2R7VA 2DGJA 2W4MA 1BR4A 1TWCA 1M56C 4C7OB 1SZIA 4BEJA 5F5FA 4I1MA 3JYHA 3LNRA 5E33A 3SP1A 1OCOC 3DD7A 1ST6A 1M57C 1WGWA 4A2NB 5DQZA 2R7XA 2L81A 3AG2C 5KYNA 4XWJA 1Z23A 4JURI 3V7OA 4EWCA 3JCUQ 1ZHWA 3EGXA 4JJGA 4AX2A 3KMIA 2EINC 4QI2A 3AQBA 3DZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J45 A;  3DM9 B;  2XXA B;  3E70 C;  2Q9B A;  3KL4 A;  4AK9 A;  2J46 A;  2OG2 A;  1WGW A;  1J8Y F;  2FFH A;  3NDB B;  2Q9C A;  2CNW D;  2J7P D;  2IYL D;  1VMA A;  3B9Q A;  2C03 A;  1QZX A;  5L3V A;  1J8M F;  1OKK D;  1LS1 A;  1RJ9 A;  5L3Q A;  2Q9A A;  1JPN A;  4C7O A;  2CNW A;  2J7P A;  1ZU4 A;  1ZU5 A;  1FFH A;  3DM5 A;  1RJ9 B;  1FTS A;  2QY9 A;  1NG1 A;  2XXA A;  2C04 A;  3NG1 A;  2NG1 A;  2V3C C;  4C7O B;  1OKK A;  2YHS A;  1O87 A;  3DMD A;  1JPJ A; 
#chains in the Genus database with same CATH topology
 3M4B A;  4KNW A;  2A6H F;  5CIV A;  3MYI A;  2FGY A;  4FES A;  2R7U A;  1OXK A;  3JRM O;  3EG9 B;  2J46 A;  3RQG A;  1YVI A;  1BR2 A;  4EHP A;  1WN0 A;  2QTV A;  3US6 A;  4DRH B;  2Q9C A;  2NSF A;  2G3V A;  1NSG B;  1ZVZ A;  1OQC A;  2R25 A;  3HNL A;  3K1I A;  3TOL A;  3WG7 C;  5COF A;  1FAP B;  2VAS A;  4E7S A;  4YT4 A;  2KSF A;  2PP4 A;  3ITF A;  2XLE A;  3B0V C;  1LE4 A;  5JP7 A;  2OCC C;  2ZXR A;  2XM4 A;  1WOL A;  2P0N A;  1K40 A;  4MVM A;  4NTA A;  3RYL A;  3B71 A;  2Q4F A;  3IQ6 A;  2WZL A;  3VYW A;  4CSA A;  3MBG A;  4OIQ F;  3S0X A;  1FFH A;  4CSA C;  3I5P A;  3NKE A;  1MND A;  2I8B A;  4LDK A;  3ABL C;  5L0I A;  2HJM A;  3LEO A;  3RW0 A;  5L0G A;  1V55 C;  3U3B A;  4YK5 A;  3X1O A;  3S27 A;  1H7I A;  3ASN C;  5DQT A;  1YLM A;  2HSB A;  5A6A A;  4MVR A;  1MMA A;  1VLS A;  3DAG A;  3CEX A;  3DM9 B;  1NU9 C;  3VM6 A;  4OIO F;  1VB5 A;  2WZF A;  2ZPA A;  3Q7L A;  4MQ9 F;  2W9Y A;  2D5R B;  2P1A A;  4KNV A;  1Z7Q c;  1C17 M;  3HJC A;  1OCC C;  5KYX A;  2OOC A;  3EH2 A;  1VK5 A;  2J0X A;  1MNE A;  1T6U A;  1BZ4 A;  1D1C A;  4YN0 B;  3RQF A;  3U9J A;  4DRI B;  1ZHY A;  3DE9 A;  3T9O A;  4CDY A;  5DS5 A;  2R7Q A;  4P9F A;  2ASR A;  1Q0M A;  3EGD A;  3ZG1 A;  5A6B A;  5JRA A;  2ZXP A;  2UUH A;  4JE9 A;  3PMR A;  1LKX A;  2XM0 A;  1YYX A;  3NMJ A;  4CDA A;  4YL0 A;  3EZH A;  2KW3 C;  2EPN A;  1XWJ A;  5BQG A;  4O6M A;  3RIP A;  1QKR A;  2R05 A;  3A11 A;  4ZLC A;  2KNH A;  1SR2 A;  2PNO A;  2PFD A;  2JX0 A;  2XL8 A;  3OWT A;  4KBL A;  5L0H A;  2IXP A;  3KH2 A;  4JEA A;  4KI2 A;  1HW2 A;  3N2Z B;  4IAO A;  1KU2 A;  3F46 A;  3AGU A;  4OD4 A;  2Q7R A;  2HV6 A;  3FDQ A;  2L6H A;  5T3T A;  3ABK C;  3EHN A;  4O6N A;  3MYF A;  2R7T A;  2EIM C;  1J8M F;  2GAQ A;  2LSE A;  2WVQ A;  3CZ6 A;  2WL8 A;  4JJF A;  1LS1 A;  3T6B A;  4PK4 A;  4FX5 A;  1ORJ A;  3BEH A;  2AP3 A;  1SMY F;  1QLE C;  5L0F A;  4MTF A;  4N6H A;  4ZLD A;  1Q0G A;  1NFN A;  2EPO A;  2PX3 A;  1D0X A;  2KJG A;  4XEF A;  3DAF A;  3WAQ A;  1G4W R;  1OXB A;  4J32 B;  2YL1 A;  1MMG A;  1D0Y A;  5AGF A;  4YT8 A;  3GM2 A;  3CSK A;  4PJJ A;  1XZP A;  3B0P A;  1FFT C;  3LAY A;  2H7B A;  4MVQ A;  1QPU A;  3M79 A;  4X0R A;  5EHH A;  3SXZ A;  3FXH A;  3GEH A;  4D4N A;  1N1C A;  2TMV P;  3W8H A;  5KYY A;  2LFD A;  5JT4 A;  1G8X A;  2G3K A;  1OR3 A;  2Y39 A;  2YL0 A;  4N06 A;  4ONS A;  2OQM A;  2YL3 A;  1OR2 A;  3T6G B;  1SF8 A;  2J8W A;  2LCH A;  4CIP A;  4YL3 A;  1Y4C A;  2YLD A;  5JLI A;  1CPQ A;  3H65 A;  4ER9 A;  1CPR A;  5K0I A;  1T5O A;  5FCL A;  3ZTM A;  4C7O A;  1JR8 A;  4B6I A;  2DYR C;  5B3I A;  4F4B A;  3IPM O;  4IAR A;  4EKW A;  1MMN A;  2VCA A;  3GM1 A;  4U5G A;  4EBJ A;  3DMD A;  3BRJ A;  1VLT A;  3W4Y A;  1OCZ C;  2F22 A;  1S7Z A;  1TKN A;  2XL4 A;  1OW8 A;  4DVZ A;  4AK9 A;  2EIK C;  1MQV A;  5IY5 C;  5KYW A;  5B3S C;  3C18 A;  2IXM A;  1LS4 A;  4PJL A;  3H2U A;  2YZS A;  2IYL D;  1HY5 A;  3RF3 A;  4MVZ A;  1YYJ A;  2RSE B;  2XS8 A;  4JC7 A;  3AG1 C;  5KYW B;  1Q0D A;  2RD9 A;  2JPU A;  4W8K A;  1OKK D;  3AQC A;  4NQF A;  3C8G A;  5JSL A;  4C3E A;  5A69 A;  2YLI A;  1E84 A;  4U9E A;  2H7V C;  3JT1 A;  5DS6 A;  3DI5 A;  5CI9 A;  4OIN F;  4H4K C;  4IJJ A;  4MTO A;  3EG9 A;  3RVY A;  3Q6M A;  2EIJ C;  5FZT A;  3ZDL A;  2XLW A;  2AWC A;  4Z9J A;  5F5H A;  4CX9 A;  1VYI A;  2P7V A;  3IEE A;  3TUL A;  2J45 A;  3ASO C;  2ZXO A;  1PV3 A;  1GQA A;  3FVY A;  3UGO A;  1T9K A;  3NRH A;  3QVY A;  4RBN A;  2J9V A;  3U2M A;  5B1A C;  3POV A;  2CNW D;  3G50 A;  4G0H A;  3GWN A;  4XPY A;  2QE9 A;  2D4U A;  2L9J A;  3KYI A;  3S29 A;  3I4U A;  1QZX A;  3HLZ A;  1M6T A;  2WB7 A;  5E3C A;  2CGE A;  5L0D A;  1OW6 A;  4Z9I A;  5HV9 A;  2Y69 C;  4ULV A;  4K7B A;  1YJG A;  4BPM A;  4Q4Z F;  4P9T A;  4DOZ A;  2B0J A;  3CAX A;  4YL1 A;  3TJ5 A;  1TWH A;  3FAP B;  1ZU5 A;  3AG3 C;  1QVX A;  2HFI A;  3JRT A;  3RKO F;  4G7O F;  4LLE A;  3S84 A;  2JD3 A;  1ZZP A;  1WTY A;  3FOO A;  4MW8 A;  4E18 A;  2ICW G;  4EIY A;  1UFB A;  2PF4 E;  1H6G A;  3U5S A;  2FAP B;  1JMW A;  2CW0 F;  2WZG A;  5BQH A;  2YLG A;  2XXA B;  3E70 C;  1D0Z A;  4PJN A;  4RD9 A;  2VB6 A;  3U3F A;  1D1A A;  1YAR O;  3NYJ A;  2GFH A;  2OJQ A;  4YT2 A;  2FFH A;  3K7D A;  3O6X A;  5B1B C;  4U5D E;  4CBE A;  4JTA B;  4HEA J;  4PFP A;  3LNM B;  4DBQ A;  2CDQ A;  4Q5S F;  1Q0K A;  2DYS C;  2ZD9 A;  2CCY A;  3M1C B;  4R32 A;  3SXM A;  2NSG A;  2VCC A;  4MW3 A;  3UNG C;  1YA7 O;  2J9U A;  3JYY A;  2G62 A;  3LJB A;  3QVZ A;  3NMI A;  1FMW A;  1YZA A;  1NFO A;  1JPN A;  2YKZ A;  4HE8 D;  4G7H F;  3DKA A;  2J7P A;  2QNL A;  4U5F E;  1HMD A;  1RJ9 B;  2KC3 A;  2KQ9 A;  2NUT B;  3C62 A;  2A6E F;  2AVK A;  3QZC A;  4I44 A;  5T3W A;  3TOM A;  2R7O A;  3GM3 A;  1IZM A;  2R9R B;  2OKU A;  1R5I D;  3IHU A;  3DWW A;  4DBR A;  1UG7 A;  3K1H A;  5EGY A;  2BL2 A;  5DS4 A;  1C02 A;  1RKE B;  2W4B A;  3OA1 A;  3S28 A;  2CYD A;  2NUP B;  3TK0 A;  1K05 A;  4MVU A;  3GWL A;  3O39 A;  2XLV A;  1DOV A;  3EFO B;  3KPH A;  4GEH A;  4Q7C A;  1D1B A;  1TWG A;  1ZYR F;  1BR1 A;  3AOU A;  2YEV A;  4ANJ A;  3SXK A;  2HMQ A;  3NYM A;  3C8Z A;  2E87 A;  4IRU A;  1EI7 A;  4MVO A;  3ZSU A;  5D92 A;  2MWQ A;  1WAS A;  3JSE O;  1VOM A;  4JKV A;  4OIP F;  2QY9 A;  3HKK A;  1EQ1 A;  4XEV A;  3IQT A;  1TFO B;  2XLO A;  3DJU B;  3HNK A;  1BDJ B;  1ZW2 A;  4LER A;  3SXY A;  3ZIB A;  3SZR A;  4C3B A;  1LM3 B;  4E17 A;  1C03 A;  4W8P A;  1V4A A;  2ETS A;  3HTK C;  3FAJ A;  1NZE A;  4LLC A;  1I4Y A;  2J0W A;  4WAB A;  3PCV A;  3QMK A;  2OG2 A;  4I3M A;  2J9B A;  4XQ1 A;  1VMA A;  5KYU B;  2GDC A;  3L8I A;  4PFO A;  1T6Q A;  3UR3 C;  1YAU O;  1LE2 A;  3Q7G A;  2NPU A;  3RH3 A;  1G5Z A;  4LDR A;  4P6I C;  4IB4 A;  2A68 F;  2MYS A;  3B29 A;  1VYK A;  2YL7 A;  3LUT B;  1Z6A A;  1M2V A;  3B0U X;  3FHD A;  2ZXW C;  3X2Q C;  3VRC A;  3GAN A;  4JVS A;  4FWV A;  4E0I A;  3NG1 A;  2EPK X;  3FOP A;  256B A;  4JCZ A;  4QDL A;  1M2V B;  3W2W A;  1CGN A;  1YA9 A;  2PBE A;  5A6J A;  3ZVR A;  4G7Z F;  3KL4 A;  1LI7 A;  5HSW A;  3U0C A;  2HJ3 A;  3M4C A;  4NC3 A;  1TFK B;  4OD5 A;  1WAT A;  1HMO A;  1I4Z A;  2OU6 A;  3ZQV A;  3DJN B;  5A6B D;  1M2O A;  4C3D A;  4E7Z A;  4U5H A;  2Y3B A;  1RXQ A;  4XTK A;  1A41 A;  5A6K A;  3AJM A;  3QTH A;  1PD1 A;  3LS0 A;  2KGO A;  4CS7 A;  4N4W A;  4BEM J;  2Q00 A;  5CI8 A;  2HV7 A;  3K6B A;  5E3A A;  4JZA A;  1FR0 A;  1S05 A;  2XLM A;  2XL6 A;  1KNY A;  4HFK B;  4CJO A;  4E0H A;  1TR2 A;  3G4X A;  3SYN A;  4U9D A;  4GYT A;  4AE4 B;  4IAQ A;  3IQ5 A;  4K0D A;  2V26 A;  1O5H A;  4QI0 A;  5DLJ A;  2YRF A;  3V5Z A;  3ZWI A;  2HUJ A;  3PHF 2;  2A0U A;  1FMV A;  4RDA A;  2L7A A;  5JUA A;  2XRH A;  4EBB A;  3QW1 A;  2I15 A;  3ZC4 A;  4L6R A;  1JOG A;  1H9G A;  2AU5 A;  3B9Q A;  3EJN A;  4XLN F;  1NU7 D;  4G78 A;  2Y3G A;  4BG0 A;  1QSP A;  3F47 A;  3PDM P;  4IWB A;  1GS9 A;  2OEX A;  2HS5 A;  2OEV A;  3OEO A;  3U8V A;  2Y3D A;  4JCH A;  2R02 A;  2LIG A;  1ZU4 A;  2J9W A;  4DXW A;  3N0T A;  3W2V A;  3O10 A;  2R7R A;  4LAC B;  4MTG A;  5COM A;  1AEP A;  3A9C A;  1E83 A;  1IW7 F;  2XXA A;  1Y6D A;  2KK1 A;  1V74 B;  3EGX B;  3KKB A;  3L34 A;  4XPX A;  2YHS A;  1TQG A;  1GGQ A;  5EK0 A;  4FAP B;  2M4E A;  3UGP A;  1JPJ A;  3GEI A;  4DJ9 A;  3WOD F;  2DB4 A;  1DOW A;  2LP4 A;  3NYL A;  4U5B E;  3J06 A;  1YDI A;  4MS2 A;  2IBF A;  2PX0 A;  1Z5Z A;  2WVO A;  4M63 A;  4NCQ A;  2O9X A;  5L0J A;  1O3U A;  3JSZ A;  4BJ1 A;  4BJT A;  4HFF B;  4KC9 A;  3K1I C;  1PCX A;  2Q3T A;  3RFY A;  1EKY A;  2W45 A;  2HMZ A;  4U5C E;  3N24 A;  1RJ9 A;  3LS1 A;  4WJ0 A;  2NUT A;  3TD7 A;  5JVE A;  4AL1 A;  4JW1 A;  4CS8 C;  3SEO A;  4UDV A;  2A69 F;  1E85 A;  2L6F A;  3LLI A;  1Z63 A;  3UMI A;  3K33 A;  3NMK A;  1FTS A;  1U6H A;  3MLG A;  5AC5 A;  3EQL F;  3JTL O;  2P6V A;  1ZHT A;  3Q6N A;  4BJ5 A;  2V3C C;  3UMH A;  4D4X A;  1ORS C;  3AGT A;  4BJ5 C;  1VTM P;  1RKE A;  4J30 B;  2IM8 A;  4XEK A;  1V54 C;  2NUP A;  3DXJ F;  2LQG A;  1CGO A;  3EPV A;  3FMS A;  3NKD A;  1ZHX A;  1Z3I X;  3C8G D;  1G4U S;  1LVK A;  3EFO A;  2EIL C;  2XSE A;  4NY3 A;  1A0B A;  4PJM A;  3EZI A;  1MMD A;  4CJG A;  5DVW A;  2BC5 A;  1JAF A;  3ATP A;  4DRJ B;  2EPL X;  3GOR A;  3EH1 A;  3LEV A;  4O79 A;  3U2L A;  1HE1 A;  2A1D D;  4I1O B;  2YQY A;  2LFF A;  3I5Q A;  1U0B B;  4K1O A;  1BBH A;  4CS9 A;  3U8P A;  1RKC A;  2X0C A;  5KYX B;  3E9V A;  4CS9 C;  2MHR A;  3UMK A;  3G4Z A;  5TJ5 E;  2OJE D;  1FNT c;  1GM5 A;  3GOD A;  2R7S A;  3SNH A;  1E86 A;  4J7Y A;  1YZC A;  3VAY A;  2B0H A;  5COG A;  4O7G A;  3DM5 A;  2QLA A;  3U9M A;  3CQZ A;  2YWA A;  4OIR F;  4O6Y A;  1NG1 A;  1WWP A;  1OW7 A;  1ZHZ A;  3R7C A;  2NG1 A;  4WGZ A;  2QUP A;  4EUK B;  3L8J A;  1OKK A;  3KYJ A;  1O87 A;  2X51 A;  3ZQY A;  1W2W A;  5D91 A;  4Z9H A;  4DVY P;  1XZQ A;  3EGD B;  4A4A A;  4YWQ A;  3DE8 A;  3C63 A;  2AWY A;  5KYU A;  1LI5 A;  2Q9B A;  4GQH A;  1CGM E;  1JRA A;  5E2Q A;  4BJ6 A;  1ZW3 A;  4YJW A;  4JIO A;  4ULW A;  4BJ6 C;  4LDQ A;  1PD0 A;  1H9T A;  1NBB A;  2LD6 A;  2Y3H A;  4WGY A;  3M15 A;  3RVZ A;  3RQE A;  2KYH A;  2H7O A;  1APC A;  4NTF A;  2M64 A;  1HW1 A;  2IXO A;  4IGG A;  3TQO A;  1L3P A;  5L3V A;  3ABM C;  4U5E E;  3S90 A;  2Z15 A;  3T6J A;  1AVO B;  2BE5 F;  2Q9A A;  3GEE A;  4CIH A;  2CNW A;  2VCB A;  1HE9 A;  4JTC B;  3EHM A;  3V5X A;  1NLX A;  1RMV A;  3T4R A;  1A7E A;  1F1M A;  2A0B A;  2C04 A;  2VH3 A;  2IOQ A;  2R7W A;  1T01 A;  3K66 A;  3HNI A;  2HSQ A;  4MND A;  2XLH A;  3ECS A;  2UUI A;  1U89 A;  3LES A;  3W8I A;  1ORY A;  2WVN A;  4EBK A;  5T1D B;  1J8Y F;  1LIH A;  4PAC A;  4YT5 A;  1OCR C;  1RCP A;  5GPG B;  2J7P D;  3NDB B;  2VC9 A;  3L0I A;  2GA0 A;  2H8A A;  3LLK A;  3V5Y A;  2C03 A;  1E2X A;  5F28 E;  1TWA A;  3TJ6 A;  2HZ8 A;  3MX3 A;  2IXN A;  2HKV A;  1AUE A;  4XLP F;  3H2V A;  5KYY B;  3S9O A;  5L3Q A;  4AE4 A;  5BUO A;  3AG4 C;  2R7V A;  1KTM A;  1T6I A;  1EA8 A;  2DGJ A;  2P61 A;  3QW0 A;  4NTB A;  3WHN A;  2W4M A;  3L1M A;  1BR4 A;  3MFN A;  1L7C A;  3JZ0 A;  4PR9 A;  4XPW A;  1TWC A;  3IQC A;  1M56 C;  3O55 A;  1A7D A;  4C7O B;  1SZI A;  4BEJ A;  5F5F A;  2R03 A;  4I1M A;  3JYH A;  3LNR A;  5E33 A;  3SP1 A;  1OCO C;  4N6C A;  3DD7 A;  1ST6 A;  3HNJ A;  1M57 C;  4H54 A;  5AC4 A;  1WGW A;  4AL0 A;  3ZTZ A;  4A2N B;  5DQZ A;  3VF0 A;  2XS1 A;  2R7X A;  2L81 A;  3R2P A;  5L0C A;  3AG2 C;  5KYN A;  4XWJ A;  3C7J A;  1SYQ A;  1Z23 A;  4CDV A;  4CS8 A;  4JUR I;  2XLD A;  3V7O A;  5JS5 A;  4EWC A;  1B68 A;  2DI3 A;  3JCU Q;  1R4T A;  4J7T A;  1I5N A;  1ZHW A;  2YVK A;  3EGX A;  4JJG A;  1LPE A;  4AX2 A;  1K04 A;  4JTD B;  3KMI A;  2EIN C;  1QQ3 A;  1Q0F A;  2L6G A;  5BQI A;  3AQB A;  3C8G B;  4QI2 A;  1A7V A;  4JEB A;  2LK4 A;  2EPM X;  4JRZ A;  2GWW A;  3DZA A;  4MVS A; 
#chains in the Genus database with same CATH homology
 4KNW A;  2A6H F;  2R7U A;  2FGY A;  4FES A;  3EG9 B;  2J46 A;  1BR2 A;  2QTV A;  2Q9C A;  2G3V A;  3WG7 C;  2VAS A;  4E7S A;  4YT4 A;  2PP4 A;  3ITF A;  3B0V C;  2OCC C;  2ZXR A;  4CS8 A;  3RYL A;  2WZL A;  3VYW A;  4CSA A;  4OIQ F;  3S0X A;  1FFH A;  4CSA C;  3I5P A;  3NKE A;  1MND A;  2I8B A;  3ABL C;  1V55 C;  3X1O A;  3S27 A;  3ASN C;  5DQT A;  1MMA A;  3DAG A;  4OIO F;  3DM9 B;  1NU9 C;  2WZF A;  2ZPA A;  3Q7L A;  4MQ9 F;  2W9Y A;  2D5R B;  4KNV A;  3HJC A;  1OCC C;  5KYX A;  3EH2 A;  1VK5 A;  2J0X A;  1MNE A;  1D1C A;  4YN0 B;  1ZHY A;  5DS5 A;  2R7Q A;  3ZG1 A;  3EGD A;  2ZXP A;  3PMR A;  1LKX A;  3EZH A;  2KW3 C;  3RIP A;  4O6M A;  4ZLC A;  2KNH A;  2PFD A;  3OWT A;  4KBL A;  2IXP A;  3KH2 A;  4KI2 A;  3N2Z B;  4IAO A;  1KU2 A;  3F46 A;  4OD4 A;  2HV6 A;  3FDQ A;  5T3T A;  2R7T A;  3ABK C;  3EHN A;  4O6N A;  2EIM C;  1J8M F;  2LSE A;  2WVQ A;  3CZ6 A;  2WL8 A;  4JJF A;  1LS1 A;  3T6B A;  4PK4 A;  4FX5 A;  1SMY F;  1QLE C;  4ZLD A;  2PX3 A;  1D0X A;  2KJG A;  3DAF A;  4J32 B;  1MMG A;  1D0Y A;  4YT8 A;  3CSK A;  4PJJ A;  3B0P A;  1FFT C;  3LAY A;  2H7B A;  4X0R A;  5EHH A;  1N1C A;  3W8H A;  5KYY A;  1G8X A;  2G3K A;  2Y39 A;  4N06 A;  1SF8 A;  3H65 A;  5FCL A;  4C7O A;  4B6I A;  2DYR C;  4F4B A;  1MMN A;  4U5G A;  3DMD A;  1OCZ C;  2XL4 A;  1S7Z A;  1TKN A;  4DVZ A;  4AK9 A;  2EIK C;  5IY5 C;  5KYW A;  5B3S C;  2IXM A;  4PJL A;  2YZS A;  2IYL D;  3AG1 C;  5KYW B;  4W8K A;  1OKK D;  3AQC A;  4C3E A;  2H7V C;  3JT1 A;  5DS6 A;  5CI9 A;  4OIN F;  4H4K C;  4IJJ A;  3EG9 A;  3Q6M A;  2EIJ C;  5F5H A;  1VYI A;  2P7V A;  3IEE A;  2J45 A;  3ASO C;  2ZXO A;  3UGO A;  3FVY A;  3NRH A;  4RBN A;  2J9V A;  5B1A C;  3POV A;  2CNW D;  4G0H A;  3S29 A;  2L9J A;  3I4U A;  1QZX A;  3HLZ A;  2WB7 A;  5E3C A;  2CGE A;  2Y69 C;  4K7B A;  4Q4Z F;  4DOZ A;  2B0J A;  1TWH A;  1ZU5 A;  3AG3 C;  3JRT A;  3RKO F;  4G7O F;  4LLE A;  2JD3 A;  2PF4 E;  2CW0 F;  2WZG A;  2XXA B;  3E70 C;  1D0Z A;  4PJN A;  4RD9 A;  2VB6 A;  4YT2 A;  1D1A A;  3NYJ A;  2GFH A;  2FFH A;  3K7D A;  3O6X A;  5B1B C;  4U5D E;  4CBE A;  4HEA J;  4PFP A;  4DBQ A;  4Q5S F;  2CDQ A;  2DYS C;  3M1C B;  3UNG C;  2J9U A;  3LJB A;  2G62 A;  1FMW A;  1JPN A;  4G7H F;  4HE8 D;  2J7P A;  4U5F E;  1RJ9 B;  2KQ9 A;  2NUT B;  3QZC A;  2A6E F;  4I44 A;  5T3W A;  2R7O A;  1IZM A;  4DBR A;  3K1H A;  5EGY A;  5DS4 A;  2W4B A;  3OA1 A;  3S28 A;  2NUP B;  3O39 A;  3EFO B;  4GEH A;  4Q7C A;  1D1B A;  1TWG A;  1ZYR F;  1BR1 A;  2YEV A;  4ANJ A;  3NYM A;  4IRU A;  2E87 A;  3ZSU A;  5D92 A;  2MWQ A;  1VOM A;  4OIP F;  2QY9 A;  3ZIB A;  3DJU B;  4LER A;  3SZR A;  4C3B A;  3HTK C;  3FAJ A;  1NZE A;  4LLC A;  2J0W A;  3QMK A;  2OG2 A;  4I3M A;  1VMA A;  5KYU B;  4PFO A;  3UR3 C;  3Q7G A;  3RH3 A;  4P6I C;  2A68 F;  2MYS A;  1VYK A;  1Z6A A;  1M2V A;  3B0U X;  3FHD A;  2ZXW C;  3X2Q C;  3GAN A;  4JVS A;  4FWV A;  3NG1 A;  4QDL A;  1M2V B;  3W2W A;  4G7Z F;  3ZVR A;  3KL4 A;  5HSW A;  4OD5 A;  3DJN B;  1M2O A;  4C3D A;  4E7Z A;  4U5H A;  2Y3B A;  4XTK A;  1PD1 A;  3LS0 A;  2KGO A;  4CS7 A;  5CI8 A;  2HV7 A;  3K6B A;  5E3A A;  4JZA A;  4HFK B;  1TR2 A;  3SYN A;  4GYT A;  4AE4 B;  4K0D A;  2V26 A;  1O5H A;  4QI0 A;  5DLJ A;  3PHF 2;  1FMV A;  4RDA A;  2XRH A;  4EBB A;  3ZC4 A;  3B9Q A;  3EJN A;  4XLN F;  1NU7 D;  4BG0 A;  2Y3G A;  3F47 A;  4IWB A;  3OEO A;  2Y3D A;  4JCH A;  1ZU4 A;  2J9W A;  3N0T A;  3W2V A;  2R7R A;  4LAC B;  2XXA A;  1IW7 F;  3EGX B;  3L34 A;  3KKB A;  3UGP A;  2YHS A;  2M4E A;  1JPJ A;  3WOD F;  3NYL A;  4U5B E;  2PX0 A;  1Z5Z A;  2WVO A;  4M63 A;  2O9X A;  4BJ1 A;  3JSZ A;  4BJT A;  4HFF B;  4KC9 A;  3K1I C;  1PCX A;  2Q3T A;  3RFY A;  2W45 A;  4U5C E;  3N24 A;  1RJ9 A;  3LS1 A;  4WJ0 A;  2NUT A;  3TD7 A;  4JW1 A;  4CS8 C;  3SEO A;  2A69 F;  3LLI A;  1Z63 A;  3UMI A;  3K33 A;  1FTS A;  3MLG A;  3EQL F;  3Q6N A;  2P6V A;  1ZHT A;  4BJ5 A;  2V3C C;  3UMH A;  4BJ5 C;  4J30 B;  1V54 C;  2NUP A;  3DXJ F;  3EPV A;  3NKD A;  1ZHX A;  1Z3I X;  4NY3 A;  3EFO A;  1LVK A;  2EIL C;  2XSE A;  4PJM A;  3EZI A;  1MMD A;  5DVW A;  3LEV A;  3EH1 A;  4O79 A;  2A1D D;  4I1O B;  3I5Q A;  4CS9 A;  5KYX B;  3E9V A;  4CS9 C;  3UMK A;  3GOD A;  2R7S A;  3SNH A;  3VAY A;  4O7G A;  3DM5 A;  3CQZ A;  4OIR F;  4O6Y A;  1NG1 A;  1ZHZ A;  2NG1 A;  1OKK A;  1O87 A;  2X51 A;  4DVY P;  1W2W A;  5D91 A;  4YWQ A;  3EGD B;  5KYU A;  2Q9B A;  4BJ6 A;  5E2Q A;  4YJW A;  4BJ6 C;  4ULW A;  1PD0 A;  2Y3H A;  2H7O A;  2IXO A;  5L3V A;  3ABM C;  4U5E E;  2Z15 A;  3T6J A;  2Q9A A;  2BE5 F;  4CIH A;  2CNW A;  3EHM A;  3T4R A;  2C04 A;  2VH3 A;  2IOQ A;  2R7W A;  3K66 A;  4MND A;  3ECS A;  3LES A;  3W8I A;  2WVN A;  5T1D B;  1J8Y F;  3NDB B;  4YT5 A;  1OCR C;  2J7P D;  3L0I A;  3LLK A;  2C03 A;  1TWA A;  3MX3 A;  2IXN A;  4XLP F;  5KYY B;  5L3Q A;  4AE4 A;  5BUO A;  3AG4 C;  2R7V A;  2DGJ A;  2W4M A;  1BR4 A;  1TWC A;  1M56 C;  4C7O B;  1SZI A;  4BEJ A;  5F5F A;  4I1M A;  3JYH A;  3LNR A;  5E33 A;  3SP1 A;  1OCO C;  3DD7 A;  1ST6 A;  1M57 C;  1WGW A;  4A2N B;  5DQZ A;  2R7X A;  2L81 A;  3AG2 C;  5KYN A;  4XWJ A;  1Z23 A;  4JUR I;  3V7O A;  4EWC A;  3JCU Q;  1ZHW A;  3EGX A;  4JJG A;  4AX2 A;  3KMI A;  2EIN C;  4QI2 A;  3AQB A;  3DZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...