1WGWA

Solution structure of the n-terminal domain of mouse putative signal recognition particle 54 (srp54)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
GSSGSSGADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKVKVYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 'Signal Recognition Particle 54
publication title Solution Structure of the N-terminal Domain of Mouse Putative Signal Recognition Particle 54 (SRP54)
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1wgwA00
3DM5A 2Q9BA 4C7OA 2CNWA 2NG1A 3DM9B 3E70C 1WGWA 1J8YF 2XXAB 1RJ9B 1JPNA 1ZU5A 5L3VA 2OG2A 1LS1A 2J45A 5L3QA 2YHSA 1ZU4A 3NG1A 1QZXA 3KL4A 1RJ9A 2XXAA 3NDBB 1JPJA 2Q9CA 1OKKD 2Q9AA 3DMDA 2J7PD 1O87A 2IYLD 4AK9A 1J8MF 4C7OB 2FFHA 2J46A 3B9QA 1NG1A 1FTSA 2C03A 2CNWD 2V3CC 1OKKA 2QY9A 1VMAA 2C04A 1FFHA 2J7PA
chains in the Genus database with same CATH superfamily
3V7OA 4RBNA 5AC4A 1CPRA 2OKUA 2G3VA 3QMKA 4P6IC 5KYXA 1TWGA 3RFYA 2A6HF 3K1HA 2NUPA 2IXPA 1VOMA 3F46A 2R05A 1QKRA 4NTBA 3TD7A 4R32A 3DXJF 4G7HF 1NU9C 3AGTA 3IQTA 3I5PA 1Q0KA 5KYYB 1Z23A 2R7WA 3JT1A 3UR3C 2EIMC 3DE8A 2BC5A 2OJQA 3EHMA 4XTKA 4LDQA 4DRIB 2QLAA 1E2XA 3DJNB 3OA1A 3FAPB 2WVOA 4YL1A 3CZ6A 2HJ3A 4LERA 1HW2A 4YWQA 1OCRC 2KC3A 4CDVA 2D4UA 2L81A 1U6HA 2PNOA 3LS0A 4MVZA 2CW0F 4B6IA 3QVYA 1HMDA 2L9JA 1NSGB 3EHNA 2DI3A 2XL8A 3GODA 5HV9A 3S90A 3US6A 2WZGA 1T01A 4I1OB 1DOWA 3VRCA 2LFDA 1WOLA 4KNVA 3ASNC 3K7DA 1RJ9B 4JKVA 3JRTA 3AG1C 1G4WR 2HJMA 1GQAA 4M63A 4N06A 3TJ6A 1BBHA 1HE1A 4FX5A 2EIJC 2ZXOA 3JYHA 3TQOA 2AWYA 2PF4E 1TWAA 4OD5A 3KPHA 3ZG1A 3RQFA 4D4NA 1JOGA 4QI2A 3C8GD 4XPYA 4C7OB 2V26A 2AP3A 1Y4CA 3UNGC 4AE4A 1NBBA 4W8PA 5EK0A 3GWLA 4JEBA 2GAQA 3M4CA 3POVA 3EH2A 4JURI 4IJJA 5B1BC 2LK4A 1QQ3A 2I8BA 3DJUB 1GGQA 4G0HA 5K0IA 1M57C 2VCAA 3NYMA 2Q4FA 3ZC4A 2R03A 1NU7D 4JTAB 3LAYA 4Z9HA 2WVQA 1E83A 1ORYA 1YJGA 2XRHA 3Q6NA 4C3BA 1OCZC 1JPNA 2HSQA 2QE9A 1ZU5A 2WL8A 4P9TA 2MWQA 4DVZA 2KJGA 3LUTB 5L0CA 2ZXPA 3X1OA 3S27A 2VCBA 2MHRA 1JR8A 4ANJA 3O10A 2KSFA 4JE9A 3ASOC 2ASRA 1M2VB 3GANA 1EKYA 3BEHA 5T3WA 2CGEA 4JTCB 4BJ6C 5A6KA 3AG2C 1TFOB 1ZHYA 3B9QA 3LLKA 4HFKB 5FCLA 1M2OA 1H9GA 4K0DA 4JCZA 5COGA 4JRZA 5D91A 2KNHA 3A9CA 3L0IA 4IAQA 4AL1A 2R9RB 5DS5A 2LD6A 3G4ZA 4ZLDA 5KYUA 1T9KA 1A0BA 4FESA 2YL1A 4HFFB 4BJ6A 1KNYA 1G4US 3U3FA 4BG0A 3LEOA 3QW1A 1T5OA 1OR3A 3OEOA 4GEHA 5DQZA 2ICWG 3EFOA 3L8JA 4MVMA 1YDIA 2BE5F 2R7XA 4CJOA 5IY5C 3RF3A 1CGOA 1VLSA 3L1MA 1U0BB 4MTFA 3ABKC 1OQCA 3O55A 1M56C 3NDBB 4CBEA 2EPMX 3G50A 1Z5ZA 2EPLX 4YT2A 3T4RA 1OCOC 3HLZA 2J7PD 3RVYA 2UUIA 4AK9A 3AG4C 3IEEA 2DGJA 4DBRA 5KYYA 2C03A 4WJ0A 5TJ5E 1LIHA 1FMVA 3LLIA 4IRUA 1APCA 2XLEA 2YL7A 3QZCA 4CX9A 2JD3A 2GA0A 4JJGA 2XLVA 1A7DA 3SP1A 1C02A 1TFKB 4K1OA 3H2UA 4L6RA 3TK0A 4F4BA 1ZVZA 3HNLA 1RKEA 3N2ZB 4JW1A 4EHPA 5B3SC 1WTYA 4MVOA 2CCYA 2DYRC 3UGOA 3AQCA 3EZIA 1Q0GA 1Y6DA 2YLIA 2AVKA 2P6VA 2YKZA 3TJ5A 4CS7A 2E87A 4XPXA 4U9DA 2KQ9A 4GYTA 1XWJA 3C18A 3SXYA 1MMDA 1XZQA 2Q7RA 4PJLA 3SNHA 2KGOA 3MFNA 1A7EA 2YVKA 3W4YA 3ZDLA 2CDQA 1Q0FA 3DAGA 2ZPAA 3S84A 4XPWA 1BZ4A 2AWCA 3B0VC 2P1AA 2NUTB 2LIGA 4MTOA 4FWVA 4WGYA 1R5ID 5EHHA 3NYLA 3S29A 3LNMB 4MW8A 5E3AA 2L6FA 5JVEA 4CS8C 5EGYA 4W8KA 2J7PA 1NLXA 1ZHWA 5GPGB 3EPVA 2GFHA 4C7OA 5DLJA 1W2WA 3KKBA 3FDQA 3WHNA 3DM9B 3AJMA 2Y39A 2OEVA 2XLDA 4PJJA 1D1BA 2B0HA 2G3KA 1ZHXA 2Y3BA 4QDLA 3SXZA 1VK5A 5KYWB 4LLEA 2OG2A 2J45A 2OOCA 2KYHA 4H54A 5DVWA 2HSBA 2OQMA 3HNKA 3KH2A 3RIPA 4ULVA 3SEOA 4CS8A 2Y69C 3FOOA 2IXOA 2R7SA 5BUOA 1EI7A 3RVZA 3RH3A 5JLIA 4H4KC 2JPUA 3PHF2 3ZQVA 1PCXA 4EUKB 1MNDA 1PD0A 1J8MF 3MLGA 4XEFA 2PX0A 1NG1A 5E2QA 3U5SA 3VAYA 1ZYRF 1RKEB 2XL4A 4PACA 5A6BD 1OCCC 5F5HA 2Y3HA 3A11A 1M2VA 4JC7A 4MVRA 5DS4A 1V54C 2WZFA 3GM3A 4LDKA 3SXKA 1OXBA 2HFIA 2R7OA 4KC9A 4G7OF 1HMOA 1VYIA 3QVZA 1MQVA 3EGXB 5BQIA 1FFTC 1Q0DA 1D0YA 1IZMA 2LFFA 3NMKA 3NRHA 4RDAA 2VB6A 4IB4A 4PFPA 1T6IA 2P7VA 4YJWA 3B29A 3UGPA 5JUAA 3DAFA 4MS2A 2TMVP 5JP7A 2J9WA 3NMIA 2M4EA 1EA8A 3WODF 1K05A 5DQTA 2HV6A 5E33A 1LS4A 3W2WA 3EG9B 5BQHA 1FTSA 2L6HA 2NSFA 4XEVA 1ZHZA 1BR2A 2EPNA 1LVKA 2QY9A 2IM8A 4YT5A 1MMAA 3W2VA 3LNRA 3IQ6A 3WG7C 2EINC 3U9JA 3VF0A 2CYDA 2I15A 2XLMA 2HMZA 3X2QC 5A6BA 3OWTA 4AL0A 1H6GA 1TKNA 4NY3A 4O7GA 3UMIA 3V5ZA 4G7ZF 1OW8A 2YHSA 1ZZPA 4U5GA 3E9VA 1OR2A 4ER9A 4J7YA 1RMVA 3AGUA 3KL4A 2W45A 2P0NA 4J30B 4XLPF 1HW1A 1JPJA 2ZXRA 3NKDA 5F28E 3Q6MA 1VLTA 2YL3A 2H7BA 3RQGA 1CGME 3L8IA 1GM5A 2QNLA 4BJ1A 2J46A 2A0UA 3EGDB 4EBKA 1WATA 2H7OA 2PFDA 4CS9C 2W4MA 1JRAA 1VMAA 5L0FA 2XL6A 4PJMA 5JT4A 3C63A 2VC9A 1HE9A 2ZXWC 4N6HA 2NUTA 3VYWA 3U0CA 2HV7A 2J8WA 2QUPA 1J8YF 2ETSA 2OU6A 4K7BA 4Z9IA 1N1CA 4QI0A 4CS9A 3NMJA 4KNWA 5L3QA 4Q5SF 3ZTZA 2J9UA 4CIPA 3DKAA 1UG7A 4LDRA 5CI9A 4E17A 4OD4A 1QVXA 2HMQA 3RKOF 1T6QA 1TR2A 4E0IA 3U8VA 4OIOF 3ABMC 5KYWA 3ITFA 1E85A 4HE8D 5A69A 1H7IA 3C8ZA 3U8PA 3DI5A 5FZTA 2M64A 3EQLF 4CDYA 3Q7GA 4WABA 1YARO 4BEMJ 5F5FA 1OKKA 1JAFA 2XLOA 1KU2A 3RW0A 2J9BA 1QSPA 3QW0A 4U5DE 4A4AA 4CSAC 3M4BA 3W8IA 5CIVA 2KK1A 4J7TA 4LLCA 2EIKC 1C17M 1CPQA 2XS8A 3DD7A 5E3CA 2VH3A 2A68F 5BQGA 4N4WA 4YK5A 2A69F 3ZIBA 4N6CA 3GEEA 3AG3C 2XS1A 4ULWA 4NQFA 4BJTA 1LS1A 4I3MA 3T6BA 4MVQA 4BEJA 2H8AA 4YN0B 2WVNA 3LJBA 3JYYA 1GS9A 5B1AC 1AVOB 3EGXA 2X0CA 1QLEC 1SYQA 1YYJA 1K40A 1YLMA 4HEAJ 1MMGA 2WB7A 3FXHA 3HNJA 3SXMA 1T6UA 2DB4A 4WGZA 1ZW3A 3ABLC 4MNDA 5B3IA 4P9FA 2VCCA 1D0ZA 3MBGA 4I44A 1H9TA 3J06A 4IARA 2H7VC 3GEHA 3NKEA 4O6MA 4DRHB 2V3CC 3DE9A 2R25A 1U89A 3TOLA 1ST6A 1B68A 1PV3A 1YAUO 2L7AA 2GDCA 3DM5A 3SZRA 4C3EA 1NZEA 2CNWA 3EG9A 3FHDA 4UDVA 4XLNF 2EILC 2J0WA 1A41A 5COFA 3T6GB 4O79A 2LSEA 1LE4A 2P61A 2RSEB 1UFBA 3ECSA 4RD9A 1YVIA 3BRJA 1G8XA 1M6TA 4U5BE 2R7RA 1OXKA 1QZXA 1MNEA 3TOMA 2YLDA 3C62A 1CGNA 1ZHTA 2W4BA 3ATPA 5L0DA 3FMSA 1YA7O 4KI2A 3C8GB 3DMDA 4ONSA 3UMKA 4Q4ZF 2IYLD 3CEXA 5D92A 4YL3A 1PD1A 3SYNA 3JRMO 1LM3B 1L3PA 4JVSA 3HJCA 4Q7CA 4PFOA 3KMIA 3RYLA 3W8HA 4E7ZA 2AU5A 3FOPA 4MW3A 4IWBA 3H65A 3EZHA 5KYNA 2BL2A 1O3UA 4OIQF 3EGDA 5JS5A 4G78A 3CSKA 3IQCA 2Y3DA 2JX0A 1YZCA 2XLWA 4PJNA 3H2VA 1ORJA 5L3VA 5L0HA 4O6YA 3KYIA 3KYJA 1C03A 3B0PA 2D5RB 4EBJA 3I5QA 3DWWA 3F47A 3T6JA 3U3BA 4E18A 1IW7F 4E7SA 1VYKA 2Q9AA 4IAOA 3PDMP 3K6BA 2R7UA 1WASA 3N0TA 3O39A 4JJFA 3S0XA 3R2PA 1LI5A 3GM2A 3Q7LA 256BA 5L0JA 1SF8A 3G4XA 1SZIA 1G5ZA 1Z3IX 3LS1A 1S7ZA 4NC3A 4YL0A 1NFOA 2Q9BA 2HS5A 1BR4A 3PMRA 2YL0A 1RCPA 3GWNA 3AQBA 4MTGA 4JCHA 1R4TA 1Q0MA 2Q3TA 3CQZA 2XXAB 2OJED 5T1DB 2ZD9A 3M79A 2OEXA 3JCUQ 4ZLCA 3AOUA 3NYJA 1V4AA 2G62A 4JEAA 2B0JA 5JSLA 3NG1A 1DOVA 1OW6A 5L0GA 3JZ0A 3EH1A 3T9OA 4IGGA 1BDJB 1V74B 1ORSC 3V5XA 3WAQA 4DBQA 2FGYA 4EWCA 4U5FE 3RQEA 1OKKD 3IPMO 4NTFA 5A6AA 1LKXA 2R7TA 2YWAA 2R02A 1O87A 2Y3GA 1VTMP 5KYXB 2FFHA 5A6JA 1TQGA 2F22A 1I4ZA 1BR1A 2NUPB 1K04A 2RD9A 1AUEA 3TULA 5JRAA 3S9OA 5COMA 3K33A 4I1MA 3ZTMA 1WWPA 1YZAA 3GM1A 1FAPB 1XZPA 4XQ1A 4PR9A 1WN0A 2HZ8A 3E70C 2XSEA 5L0IA 2W9YA 2OCCC 4OIRF 3U9MA 2A6EF 1SR2A 4O6NA 4FAPB 1RKCA 1RXQA 4X0RA 1SMYF 2IXMA 5HSWA 1ZW2A 1JMWA 4CIHA 3JSEO 1FNTc 1O5HA 3MYFA 4JZAA 1V55C 1FMWA 3U2LA 2YZSA 1LI7A 2KW3C 3HNIA 4EKWA 1I5NA 2YQYA 3PCVA 4JIOA 4BPMA 4EIYA 2DYSC 3I4UA 4U5EE 4EBBA 3FAJA 3ZSUA 3K1IC 2R7VA 4MVSA 2MYSA 2CNWD 4LACB 4NTAA 4DOZA 5AGFA 2PX3A 4D4XA 4Z9JA 3C8GA 1OW7A 1FFHA 2L6GA 3V5YA 4XEKA 5AC5A 2EPOA 2R7QA 2WZLA 4XWJA 1A7VA 3LEVA 3ZVRA 4J32B 5CI8A 3K1IA 2A1DD 3L34A 1F1MA 2XM0A 4PK4A 4E0HA 3B0UX 1FR0A 2PBEA 2IBFA 1HY5A 2HKVA 2J0XA 3JSZA 3U2MA 1E86A 4A2NB 3M1CB 2NSGA 2LCHA 1D1CA 4CSAA 4AE4B 3O6XA 2X51A 3JTLO 3M15A 1I4YA 1TWHA 2A0BA 4GQHA 1MMNA 2GWWA 2O9XA 3GORA 4BJ5C 2IXNA 4KBLA 4U5CE 4OINF 2Z15A 2NPUA 3DZAA 5T3TA 2YLGA 2EPKX 1D0XA 1LPEA 2C04A 1YYXA 4DXWA 1TWCA 1YA9A 2LQGA 3FVYA 1E84A 1AEPA 1Z6AA 3LESA 1Z7Qc 2NG1A 4DRJB 4BJ5A 2XM4A 1L7CA 1WGWA 3GEIA 4YT8A 2XLHA 3EJNA 2YEVA 3R7CA 1KTMA 2PP4A 2HUJA 4CJGA 2UUHA 1VB5A 2Q00A 3B71A 3C7JA 3K66A 4JTDB 1ZU4A 1QPUA 2IOQA 2LP4A 2YRFA 3ZQYA 3ZWIA 5DS6A 3IHUA 4U5HA 1RJ9A 4AX2A 1Z63A 2XXAA 3QTHA 1LE2A 1NFNA 2Q9CA 3HTKC 3UMHA 3CAXA 1S05A 1D1AA 2VASA 4DJ9A 5KYUB 4NCQA 3S28A 4MQ9F 4U9EA 3VM6A 2J9VA 4C3DA 3MX3A 3HKKA 4YT4A 4DVYP 3N24A 2QTVA 3IQ5A 4CDAA 4MVUA 2FAPB 3MYIA 4OIPF 3EFOB 1EQ1A
chains in the Genus database with same CATH topology
3V7OA 4RBNA 3QMKA 2G3VA 4P6IC 5KYXA 1TWGA 3RFYA 2A6HF 3K1HA 2NUPA 2IXPA 1VOMA 3F46A 3TD7A 3DXJF 4G7HF 1NU9C 3I5PA 5KYYB 1Z23A 2R7WA 3JT1A 3UR3C 2EIMC 3EHMA 4XTKA 3DJNB 3OA1A 2WVOA 3CZ6A 4LERA 4YWQA 1OCRC 2L81A 3LS0A 2CW0F 4B6IA 2L9JA 3EHNA 3GODA 2WZGA 4I1OB 4KNVA 3ASNC 1RJ9B 3JRTA 3AG1C 4M63A 4N06A 4FX5A 2EIJC 2ZXOA 3JYHA 2PF4E 3ZG1A 1TWAA 4OD5A 4C7OB 2V26A 3UNGC 4AE4A 3POVA 3EH2A 4JURI 4IJJA 5B1BC 2I8BA 3DJUB 4G0HA 1M57C 3NYMA 3ZC4A 1NU7D 3LAYA 2WVQA 2XRHA 4C3BA 3Q6NA 1OCZC 1JPNA 2WL8A 1ZU5A 2MWQA 4DVZA 2KJGA 2ZXPA 3X1OA 3S27A 4ANJA 3ASOC 1M2VB 3GANA 5T3WA 4BJ6C 2CGEA 3AG2C 1ZHYA 3B9QA 3LLKA 4HFKB 5FCLA 1M2OA 4K0DA 5D91A 2KNHA 3L0IA 5DS5A 4ZLDA 5KYUA 4FESA 4HFFB 4BJ6A 4BG0A 3OEOA 4GEHA 5DQZA 3EFOA 2BE5F 2R7XA 5IY5C 3ABKC 1M56C 3NDBB 4CBEA 1Z5ZA 4YT2A 3T4RA 1OCOC 3HLZA 2J7PD 4AK9A 3AG4C 3IEEA 2DGJA 4DBRA 5KYYA 2C03A 4WJ0A 1FMVA 3LLIA 4IRUA 3QZCA 2JD3A 4JJGA 3SP1A 4F4BA 3N2ZB 4JW1A 5B3SC 2DYRC 3UGOA 3AQCA 3EZIA 2P6VA 4CS7A 2E87A 2KQ9A 4GYTA 1MMDA 4PJLA 3SNHA 2KGOA 2CDQA 3DAGA 2ZPAA 3B0VC 2NUTB 4FWVA 5EHHA 3NYLA 3S29A 5E3AA 4CS8C 5EGYA 4W8KA 2J7PA 1ZHWA 3EPVA 2GFHA 4C7OA 5DLJA 1W2WA 3KKBA 3FDQA 3DM9B 2Y39A 4PJJA 4QDLA 2Y3BA 1D1BA 2G3KA 1ZHXA 5KYWB 1VK5A 4LLEA 2OG2A 2J45A 5DVWA 3RIPA 3SEOA 3KH2A 4CS8A 2Y69C 2IXOA 2R7SA 5BUOA 3RH3A 4H4KC 3PHF2 1PCXA 1MNDA 1PD0A 1J8MF 3MLGA 2PX0A 1NG1A 5E2QA 3VAYA 1ZYRF 2XL4A 1OCCC 5F5HA 2Y3HA 5DS4A 1M2VA 1V54C 2WZFA 4KC9A 2R7OA 4G7OF 1VYIA 3EGXB 1FFTC 1D0YA 1IZMA 3NRHA 4RDAA 2VB6A 4PFPA 2P7VA 4YJWA 3UGPA 3DAFA 2J9WA 2M4EA 3WODF 5DQTA 2HV6A 5E33A 3W2WA 3EG9B 1FTSA 1ZHZA 1BR2A 1LVKA 2QY9A 4YT5A 1MMAA 3W2VA 3LNRA 3WG7C 2EINC 3X2QC 3OWTA 1TKNA 4NY3A 4O7GA 4G7ZF 3UMIA 2YHSA 4U5GA 3E9VA 4J30B 3KL4A 2W45A 4XLPF 1JPJA 2ZXRA 3NKDA 3Q6MA 2H7BA 4BJ1A 2J46A 3EGDB 2H7OA 2PFDA 4CS9C 2W4MA 1VMAA 4PJMA 2ZXWC 2NUTA 3VYWA 2HV7A 1J8YF 4K7BA 1N1CA 4QI0A 4CS9A 4KNWA 5L3QA 4Q5SF 2J9UA 5CI9A 4OD4A 4OIOF 3RKOF 1TR2A 3ABMC 5KYWA 3ITFA 4HE8D 3EQLF 3Q7GA 5F5FA 1OKKA 4QI2A 1KU2A 4CSAC 4U5DE 3W8IA 4LLCA 2EIKC 3DD7A 5E3CA 2VH3A 2A68F 2A69F 3ZIBA 3AG3C 4ULWA 4BJTA 1LS1A 4I3MA 3T6BA 4BEJA 4YN0B 2WVNA 3LJBA 5B1AC 3EGXA 1QLEC 4HEAJ 1MMGA 2WB7A 3ABLC 4MNDA 1D0ZA 4I44A 2H7VC 4O6MA 3NKEA 2V3CC 1ST6A 3DM5A 4C3EA 3SZRA 1NZEA 2CNWA 3EG9A 3FHDA 4XLNF 2EILC 2J0WA 4O79A 2LSEA 3ECSA 4RD9A 1G8XA 4U5BE 2R7RA 1QZXA 1MNEA 1ZHTA 2W4BA 4KI2A 3DMDA 3UMKA 4Q4ZF 2IYLD 5D92A 1PD1A 3SYNA 4JVSA 3HJCA 4Q7CA 4PFOA 3KMIA 3RYLA 3W8HA 4E7ZA 4IWBA 3H65A 3EZHA 5KYNA 4OIQF 3EGDA 3CSKA 2Y3DA 4PJNA 5L3VA 4O6YA 3B0PA 2D5RB 3I5QA 3F47A 3T6JA 1IW7F 4E7SA 1VYKA 2Q9AA 4IAOA 2R7UA 3K6BA 3O39A 3N0TA 4JJFA 3S0XA 3Q7LA 1SF8A 1SZIA 1Z3IX 3LS1A 1S7ZA 2Q9BA 1BR4A 3PMRA 3AQBA 4JCHA 2Q3TA 3CQZA 2XXAB 5T1DB 3JCUQ 4ZLCA 3NYJA 2G62A 2B0JA 3NG1A 3EH1A 4DBQA 2FGYA 4EWCA 4U5FE 1OKKD 1LKXA 2R7TA 1O87A 2Y3GA 5KYXB 2FFHA 2NUPB 1BR1A 3K33A 4I1MA 3E70C 2XSEA 2W9YA 2OCCC 4OIRF 2A6EF 4O6NA 4X0RA 1SMYF 2IXMA 5HSWA 4CIHA 1O5HA 4JZAA 1V55C 1FMWA 2YZSA 2KW3C 2DYSC 3I4UA 4U5EE 4EBBA 3FAJA 3ZSUA 3K1IC 2R7VA 2MYSA 2CNWD 4LACB 4DOZA 2PX3A 1FFHA 2R7QA 2WZLA 4XWJA 3LEVA 3ZVRA 4J32B 5CI8A 3L34A 2A1DD 3B0UX 4PK4A 2J0XA 3JSZA 4A2NB 3M1CB 1D1CA 4CSAA 4AE4B 3O6XA 2X51A 1TWHA 1MMNA 2O9XA 4BJ5C 2IXNA 4KBLA 4U5CE 4OINF 2Z15A 3DZAA 5T3TA 1D0XA 2C04A 1TWCA 3FVYA 1Z6AA 3LESA 2NG1A 4BJ5A 1WGWA 4YT8A 3EJNA 2YEVA 2PP4A 3K66A 5DS6A 1ZU4A 2IOQA 4U5HA 1RJ9A 4AX2A 1Z63A 2XXAA 2Q9CA 3HTKC 3UMHA 2VASA 1D1AA 5KYUB 3S28A 4C3DA 4MQ9F 2J9VA 3MX3A 4YT4A 4DVYP 3N24A 2QTVA 3K7DA 4OIPF 3EFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM5 A;  2Q9B A;  4C7O A;  2CNW A;  2NG1 A;  3DM9 B;  3E70 C;  1WGW A;  1J8Y F;  2XXA B;  1RJ9 B;  1JPN A;  1ZU5 A;  5L3V A;  2OG2 A;  1LS1 A;  2J45 A;  5L3Q A;  2YHS A;  1ZU4 A;  3NG1 A;  1QZX A;  3KL4 A;  1RJ9 A;  2XXA A;  3NDB B;  1JPJ A;  2Q9C A;  1OKK D;  2Q9A A;  3DMD A;  2J7P D;  1O87 A;  2IYL D;  4AK9 A;  1J8M F;  4C7O B;  2FFH A;  2J46 A;  3B9Q A;  1NG1 A;  1FTS A;  2C03 A;  2CNW D;  2V3C C;  1OKK A;  2QY9 A;  1VMA A;  2C04 A;  1FFH A;  2J7P A; 
#chains in the Genus database with same CATH topology
 3V7O A;  4RBN A;  5AC4 A;  1CPR A;  2OKU A;  2G3V A;  3QMK A;  4P6I C;  5KYX A;  1TWG A;  3RFY A;  2A6H F;  3K1H A;  2NUP A;  2IXP A;  1VOM A;  3F46 A;  2R05 A;  1QKR A;  4NTB A;  3TD7 A;  4R32 A;  3DXJ F;  4G7H F;  1NU9 C;  3AGT A;  3IQT A;  3I5P A;  1Q0K A;  5KYY B;  1Z23 A;  2R7W A;  3JT1 A;  3UR3 C;  2EIM C;  3DE8 A;  2BC5 A;  2OJQ A;  3EHM A;  4XTK A;  4LDQ A;  4DRI B;  2QLA A;  1E2X A;  3DJN B;  3OA1 A;  3FAP B;  2WVO A;  4YL1 A;  3CZ6 A;  2HJ3 A;  4LER A;  1HW2 A;  4YWQ A;  1OCR C;  2KC3 A;  4CDV A;  2D4U A;  2L81 A;  1U6H A;  2PNO A;  3LS0 A;  4MVZ A;  2CW0 F;  4B6I A;  3QVY A;  1HMD A;  2L9J A;  1NSG B;  3EHN A;  2DI3 A;  2XL8 A;  3GOD A;  5HV9 A;  3S90 A;  3US6 A;  2WZG A;  1T01 A;  4I1O B;  1DOW A;  3VRC A;  2LFD A;  1WOL A;  4KNV A;  3ASN C;  3K7D A;  1RJ9 B;  4JKV A;  3JRT A;  3AG1 C;  1G4W R;  2HJM A;  1GQA A;  4M63 A;  4N06 A;  3TJ6 A;  1BBH A;  1HE1 A;  4FX5 A;  2EIJ C;  2ZXO A;  3JYH A;  3TQO A;  2AWY A;  2PF4 E;  1TWA A;  4OD5 A;  3KPH A;  3ZG1 A;  3RQF A;  4D4N A;  1JOG A;  4QI2 A;  3C8G D;  4XPY A;  4C7O B;  2V26 A;  2AP3 A;  1Y4C A;  3UNG C;  4AE4 A;  1NBB A;  4W8P A;  5EK0 A;  3GWL A;  4JEB A;  2GAQ A;  3M4C A;  3POV A;  3EH2 A;  4JUR I;  4IJJ A;  5B1B C;  2LK4 A;  1QQ3 A;  2I8B A;  3DJU B;  1GGQ A;  4G0H A;  5K0I A;  1M57 C;  2VCA A;  3NYM A;  2Q4F A;  3ZC4 A;  2R03 A;  1NU7 D;  4JTA B;  3LAY A;  4Z9H A;  2WVQ A;  1E83 A;  1ORY A;  1YJG A;  2XRH A;  3Q6N A;  4C3B A;  1OCZ C;  1JPN A;  2HSQ A;  2QE9 A;  1ZU5 A;  2WL8 A;  4P9T A;  2MWQ A;  4DVZ A;  2KJG A;  3LUT B;  5L0C A;  2ZXP A;  3X1O A;  3S27 A;  2VCB A;  2MHR A;  1JR8 A;  4ANJ A;  3O10 A;  2KSF A;  4JE9 A;  3ASO C;  2ASR A;  1M2V B;  3GAN A;  1EKY A;  3BEH A;  5T3W A;  2CGE A;  4JTC B;  4BJ6 C;  5A6K A;  3AG2 C;  1TFO B;  1ZHY A;  3B9Q A;  3LLK A;  4HFK B;  5FCL A;  1M2O A;  1H9G A;  4K0D A;  4JCZ A;  5COG A;  4JRZ A;  5D91 A;  2KNH A;  3A9C A;  3L0I A;  4IAQ A;  4AL1 A;  2R9R B;  5DS5 A;  2LD6 A;  3G4Z A;  4ZLD A;  5KYU A;  1T9K A;  1A0B A;  4FES A;  2YL1 A;  4HFF B;  4BJ6 A;  1KNY A;  1G4U S;  3U3F A;  4BG0 A;  3LEO A;  3QW1 A;  1T5O A;  1OR3 A;  3OEO A;  4GEH A;  5DQZ A;  2ICW G;  3EFO A;  3L8J A;  4MVM A;  1YDI A;  2BE5 F;  2R7X A;  4CJO A;  5IY5 C;  3RF3 A;  1CGO A;  1VLS A;  3L1M A;  1U0B B;  4MTF A;  3ABK C;  1OQC A;  3O55 A;  1M56 C;  3NDB B;  4CBE A;  2EPM X;  3G50 A;  1Z5Z A;  2EPL X;  4YT2 A;  3T4R A;  1OCO C;  3HLZ A;  2J7P D;  3RVY A;  2UUI A;  4AK9 A;  3AG4 C;  3IEE A;  2DGJ A;  4DBR A;  5KYY A;  2C03 A;  4WJ0 A;  5TJ5 E;  1LIH A;  1FMV A;  3LLI A;  4IRU A;  1APC A;  2XLE A;  2YL7 A;  3QZC A;  4CX9 A;  2JD3 A;  2GA0 A;  4JJG A;  2XLV A;  1A7D A;  3SP1 A;  1C02 A;  1TFK B;  4K1O A;  3H2U A;  4L6R A;  3TK0 A;  4F4B A;  1ZVZ A;  3HNL A;  1RKE A;  3N2Z B;  4JW1 A;  4EHP A;  5B3S C;  1WTY A;  4MVO A;  2CCY A;  2DYR C;  3UGO A;  3AQC A;  3EZI A;  1Q0G A;  1Y6D A;  2YLI A;  2AVK A;  2P6V A;  2YKZ A;  3TJ5 A;  4CS7 A;  2E87 A;  4XPX A;  4U9D A;  2KQ9 A;  4GYT A;  1XWJ A;  3C18 A;  3SXY A;  1MMD A;  1XZQ A;  2Q7R A;  4PJL A;  3SNH A;  2KGO A;  3MFN A;  1A7E A;  2YVK A;  3W4Y A;  3ZDL A;  2CDQ A;  1Q0F A;  3DAG A;  2ZPA A;  3S84 A;  4XPW A;  1BZ4 A;  2AWC A;  3B0V C;  2P1A A;  2NUT B;  2LIG A;  4MTO A;  4FWV A;  4WGY A;  1R5I D;  5EHH A;  3NYL A;  3S29 A;  3LNM B;  4MW8 A;  5E3A A;  2L6F A;  5JVE A;  4CS8 C;  5EGY A;  4W8K A;  2J7P A;  1NLX A;  1ZHW A;  5GPG B;  3EPV A;  2GFH A;  4C7O A;  5DLJ A;  1W2W A;  3KKB A;  3FDQ A;  3WHN A;  3DM9 B;  3AJM A;  2Y39 A;  2OEV A;  2XLD A;  4PJJ A;  1D1B A;  2B0H A;  2G3K A;  1ZHX A;  2Y3B A;  4QDL A;  3SXZ A;  1VK5 A;  5KYW B;  4LLE A;  2OG2 A;  2J45 A;  2OOC A;  2KYH A;  4H54 A;  5DVW A;  2HSB A;  2OQM A;  3HNK A;  3KH2 A;  3RIP A;  4ULV A;  3SEO A;  4CS8 A;  2Y69 C;  3FOO A;  2IXO A;  2R7S A;  5BUO A;  1EI7 A;  3RVZ A;  3RH3 A;  5JLI A;  4H4K C;  2JPU A;  3PHF 2;  3ZQV A;  1PCX A;  4EUK B;  1MND A;  1PD0 A;  1J8M F;  3MLG A;  4XEF A;  2PX0 A;  1NG1 A;  5E2Q A;  3U5S A;  3VAY A;  1ZYR F;  1RKE B;  2XL4 A;  4PAC A;  5A6B D;  1OCC C;  5F5H A;  2Y3H A;  3A11 A;  1M2V A;  4JC7 A;  4MVR A;  5DS4 A;  1V54 C;  2WZF A;  3GM3 A;  4LDK A;  3SXK A;  1OXB A;  2HFI A;  2R7O A;  4KC9 A;  4G7O F;  1HMO A;  1VYI A;  3QVZ A;  1MQV A;  3EGX B;  5BQI A;  1FFT C;  1Q0D A;  1D0Y A;  1IZM A;  2LFF A;  3NMK A;  3NRH A;  4RDA A;  2VB6 A;  4IB4 A;  4PFP A;  1T6I A;  2P7V A;  4YJW A;  3B29 A;  3UGP A;  5JUA A;  3DAF A;  4MS2 A;  2TMV P;  5JP7 A;  2J9W A;  3NMI A;  2M4E A;  1EA8 A;  3WOD F;  1K05 A;  5DQT A;  2HV6 A;  5E33 A;  1LS4 A;  3W2W A;  3EG9 B;  5BQH A;  1FTS A;  2L6H A;  2NSF A;  4XEV A;  1ZHZ A;  1BR2 A;  2EPN A;  1LVK A;  2QY9 A;  2IM8 A;  4YT5 A;  1MMA A;  3W2V A;  3LNR A;  3IQ6 A;  3WG7 C;  2EIN C;  3U9J A;  3VF0 A;  2CYD A;  2I15 A;  2XLM A;  2HMZ A;  3X2Q C;  5A6B A;  3OWT A;  4AL0 A;  1H6G A;  1TKN A;  4NY3 A;  4O7G A;  3UMI A;  3V5Z A;  4G7Z F;  1OW8 A;  2YHS A;  1ZZP A;  4U5G A;  3E9V A;  1OR2 A;  4ER9 A;  4J7Y A;  1RMV A;  3AGU A;  3KL4 A;  2W45 A;  2P0N A;  4J30 B;  4XLP F;  1HW1 A;  1JPJ A;  2ZXR A;  3NKD A;  5F28 E;  3Q6M A;  1VLT A;  2YL3 A;  2H7B A;  3RQG A;  1CGM E;  3L8I A;  1GM5 A;  2QNL A;  4BJ1 A;  2J46 A;  2A0U A;  3EGD B;  4EBK A;  1WAT A;  2H7O A;  2PFD A;  4CS9 C;  2W4M A;  1JRA A;  1VMA A;  5L0F A;  2XL6 A;  4PJM A;  5JT4 A;  3C63 A;  2VC9 A;  1HE9 A;  2ZXW C;  4N6H A;  2NUT A;  3VYW A;  3U0C A;  2HV7 A;  2J8W A;  2QUP A;  1J8Y F;  2ETS A;  2OU6 A;  4K7B A;  4Z9I A;  1N1C A;  4QI0 A;  4CS9 A;  3NMJ A;  4KNW A;  5L3Q A;  4Q5S F;  3ZTZ A;  2J9U A;  4CIP A;  3DKA A;  1UG7 A;  4LDR A;  5CI9 A;  4E17 A;  4OD4 A;  1QVX A;  2HMQ A;  3RKO F;  1T6Q A;  1TR2 A;  4E0I A;  3U8V A;  4OIO F;  3ABM C;  5KYW A;  3ITF A;  1E85 A;  4HE8 D;  5A69 A;  1H7I A;  3C8Z A;  3U8P A;  3DI5 A;  5FZT A;  2M64 A;  3EQL F;  4CDY A;  3Q7G A;  4WAB A;  1YAR O;  4BEM J;  5F5F A;  1OKK A;  1JAF A;  2XLO A;  1KU2 A;  3RW0 A;  2J9B A;  1QSP A;  3QW0 A;  4U5D E;  4A4A A;  4CSA C;  3M4B A;  3W8I A;  5CIV A;  2KK1 A;  4J7T A;  4LLC A;  2EIK C;  1C17 M;  1CPQ A;  2XS8 A;  3DD7 A;  5E3C A;  2VH3 A;  2A68 F;  5BQG A;  4N4W A;  4YK5 A;  2A69 F;  3ZIB A;  4N6C A;  3GEE A;  3AG3 C;  2XS1 A;  4ULW A;  4NQF A;  4BJT A;  1LS1 A;  4I3M A;  3T6B A;  4MVQ A;  4BEJ A;  2H8A A;  4YN0 B;  2WVN A;  3LJB A;  3JYY A;  1GS9 A;  5B1A C;  1AVO B;  3EGX A;  2X0C A;  1QLE C;  1SYQ A;  1YYJ A;  1K40 A;  1YLM A;  4HEA J;  1MMG A;  2WB7 A;  3FXH A;  3HNJ A;  3SXM A;  1T6U A;  2DB4 A;  4WGZ A;  1ZW3 A;  3ABL C;  4MND A;  5B3I A;  4P9F A;  2VCC A;  1D0Z A;  3MBG A;  4I44 A;  1H9T A;  3J06 A;  4IAR A;  2H7V C;  3GEH A;  3NKE A;  4O6M A;  4DRH B;  2V3C C;  3DE9 A;  2R25 A;  1U89 A;  3TOL A;  1ST6 A;  1B68 A;  1PV3 A;  1YAU O;  2L7A A;  2GDC A;  3DM5 A;  3SZR A;  4C3E A;  1NZE A;  2CNW A;  3EG9 A;  3FHD A;  4UDV A;  4XLN F;  2EIL C;  2J0W A;  1A41 A;  5COF A;  3T6G B;  4O79 A;  2LSE A;  1LE4 A;  2P61 A;  2RSE B;  1UFB A;  3ECS A;  4RD9 A;  1YVI A;  3BRJ A;  1G8X A;  1M6T A;  4U5B E;  2R7R A;  1OXK A;  1QZX A;  1MNE A;  3TOM A;  2YLD A;  3C62 A;  1CGN A;  1ZHT A;  2W4B A;  3ATP A;  5L0D A;  3FMS A;  1YA7 O;  4KI2 A;  3C8G B;  3DMD A;  4ONS A;  3UMK A;  4Q4Z F;  2IYL D;  3CEX A;  5D92 A;  4YL3 A;  1PD1 A;  3SYN A;  3JRM O;  1LM3 B;  1L3P A;  4JVS A;  3HJC A;  4Q7C A;  4PFO A;  3KMI A;  3RYL A;  3W8H A;  4E7Z A;  2AU5 A;  3FOP A;  4MW3 A;  4IWB A;  3H65 A;  3EZH A;  5KYN A;  2BL2 A;  1O3U A;  4OIQ F;  3EGD A;  5JS5 A;  4G78 A;  3CSK A;  3IQC A;  2Y3D A;  2JX0 A;  1YZC A;  2XLW A;  4PJN A;  3H2V A;  1ORJ A;  5L3V A;  5L0H A;  4O6Y A;  3KYI A;  3KYJ A;  1C03 A;  3B0P A;  2D5R B;  4EBJ A;  3I5Q A;  3DWW A;  3F47 A;  3T6J A;  3U3B A;  4E18 A;  1IW7 F;  4E7S A;  1VYK A;  2Q9A A;  4IAO A;  3PDM P;  3K6B A;  2R7U A;  1WAS A;  3N0T A;  3O39 A;  4JJF A;  3S0X A;  3R2P A;  1LI5 A;  3GM2 A;  3Q7L A;  256B A;  5L0J A;  1SF8 A;  3G4X A;  1SZI A;  1G5Z A;  1Z3I X;  3LS1 A;  1S7Z A;  4NC3 A;  4YL0 A;  1NFO A;  2Q9B A;  2HS5 A;  1BR4 A;  3PMR A;  2YL0 A;  1RCP A;  3GWN A;  3AQB A;  4MTG A;  4JCH A;  1R4T A;  1Q0M A;  2Q3T A;  3CQZ A;  2XXA B;  2OJE D;  5T1D B;  2ZD9 A;  3M79 A;  2OEX A;  3JCU Q;  4ZLC A;  3AOU A;  3NYJ A;  1V4A A;  2G62 A;  4JEA A;  2B0J A;  5JSL A;  3NG1 A;  1DOV A;  1OW6 A;  5L0G A;  3JZ0 A;  3EH1 A;  3T9O A;  4IGG A;  1BDJ B;  1V74 B;  1ORS C;  3V5X A;  3WAQ A;  4DBQ A;  2FGY A;  4EWC A;  4U5F E;  3RQE A;  1OKK D;  3IPM O;  4NTF A;  5A6A A;  1LKX A;  2R7T A;  2YWA A;  2R02 A;  1O87 A;  2Y3G A;  1VTM P;  5KYX B;  2FFH A;  5A6J A;  1TQG A;  2F22 A;  1I4Z A;  1BR1 A;  2NUP B;  1K04 A;  2RD9 A;  1AUE A;  3TUL A;  5JRA A;  3S9O A;  5COM A;  3K33 A;  4I1M A;  3ZTM A;  1WWP A;  1YZA A;  3GM1 A;  1FAP B;  1XZP A;  4XQ1 A;  4PR9 A;  1WN0 A;  2HZ8 A;  3E70 C;  2XSE A;  5L0I A;  2W9Y A;  2OCC C;  4OIR F;  3U9M A;  2A6E F;  1SR2 A;  4O6N A;  4FAP B;  1RKC A;  1RXQ A;  4X0R A;  1SMY F;  2IXM A;  5HSW A;  1ZW2 A;  1JMW A;  4CIH A;  3JSE O;  1FNT c;  1O5H A;  3MYF A;  4JZA A;  1V55 C;  1FMW A;  3U2L A;  2YZS A;  1LI7 A;  2KW3 C;  3HNI A;  4EKW A;  1I5N A;  2YQY A;  3PCV A;  4JIO A;  4BPM A;  4EIY A;  2DYS C;  3I4U A;  4U5E E;  4EBB A;  3FAJ A;  3ZSU A;  3K1I C;  2R7V A;  4MVS A;  2MYS A;  2CNW D;  4LAC B;  4NTA A;  4DOZ A;  5AGF A;  2PX3 A;  4D4X A;  4Z9J A;  3C8G A;  1OW7 A;  1FFH A;  2L6G A;  3V5Y A;  4XEK A;  5AC5 A;  2EPO A;  2R7Q A;  2WZL A;  4XWJ A;  1A7V A;  3LEV A;  3ZVR A;  4J32 B;  5CI8 A;  3K1I A;  2A1D D;  3L34 A;  1F1M A;  2XM0 A;  4PK4 A;  4E0H A;  3B0U X;  1FR0 A;  2PBE A;  2IBF A;  1HY5 A;  2HKV A;  2J0X A;  3JSZ A;  3U2M A;  1E86 A;  4A2N B;  3M1C B;  2NSG A;  2LCH A;  1D1C A;  4CSA A;  4AE4 B;  3O6X A;  2X51 A;  3JTL O;  3M15 A;  1I4Y A;  1TWH A;  2A0B A;  4GQH A;  1MMN A;  2GWW A;  2O9X A;  3GOR A;  4BJ5 C;  2IXN A;  4KBL A;  4U5C E;  4OIN F;  2Z15 A;  2NPU A;  3DZA A;  5T3T A;  2YLG A;  2EPK X;  1D0X A;  1LPE A;  2C04 A;  1YYX A;  4DXW A;  1TWC A;  1YA9 A;  2LQG A;  3FVY A;  1E84 A;  1AEP A;  1Z6A A;  3LES A;  1Z7Q c;  2NG1 A;  4DRJ B;  4BJ5 A;  2XM4 A;  1L7C A;  1WGW A;  3GEI A;  4YT8 A;  2XLH A;  3EJN A;  2YEV A;  3R7C A;  1KTM A;  2PP4 A;  2HUJ A;  4CJG A;  2UUH A;  1VB5 A;  2Q00 A;  3B71 A;  3C7J A;  3K66 A;  4JTD B;  1ZU4 A;  1QPU A;  2IOQ A;  2LP4 A;  2YRF A;  3ZQY A;  3ZWI A;  5DS6 A;  3IHU A;  4U5H A;  1RJ9 A;  4AX2 A;  1Z63 A;  2XXA A;  3QTH A;  1LE2 A;  1NFN A;  2Q9C A;  3HTK C;  3UMH A;  3CAX A;  1S05 A;  1D1A A;  2VAS A;  4DJ9 A;  5KYU B;  4NCQ A;  3S28 A;  4MQ9 F;  4U9E A;  3VM6 A;  2J9V A;  4C3D A;  3MX3 A;  3HKK A;  4YT4 A;  4DVY P;  3N24 A;  2QTV A;  3IQ5 A;  4CDA A;  4MVU A;  2FAP B;  3MYI A;  4OIP F;  3EFO B;  1EQ1 A; 
#chains in the Genus database with same CATH homology
 3V7O A;  4RBN A;  3QMK A;  2G3V A;  4P6I C;  5KYX A;  1TWG A;  3RFY A;  2A6H F;  3K1H A;  2NUP A;  2IXP A;  1VOM A;  3F46 A;  3TD7 A;  3DXJ F;  4G7H F;  1NU9 C;  3I5P A;  5KYY B;  1Z23 A;  2R7W A;  3JT1 A;  3UR3 C;  2EIM C;  3EHM A;  4XTK A;  3DJN B;  3OA1 A;  2WVO A;  3CZ6 A;  4LER A;  4YWQ A;  1OCR C;  2L81 A;  3LS0 A;  2CW0 F;  4B6I A;  2L9J A;  3EHN A;  3GOD A;  2WZG A;  4I1O B;  4KNV A;  3ASN C;  1RJ9 B;  3JRT A;  3AG1 C;  4M63 A;  4N06 A;  4FX5 A;  2EIJ C;  2ZXO A;  3JYH A;  2PF4 E;  3ZG1 A;  1TWA A;  4OD5 A;  4C7O B;  2V26 A;  3UNG C;  4AE4 A;  3POV A;  3EH2 A;  4JUR I;  4IJJ A;  5B1B C;  2I8B A;  3DJU B;  4G0H A;  1M57 C;  3NYM A;  3ZC4 A;  1NU7 D;  3LAY A;  2WVQ A;  2XRH A;  4C3B A;  3Q6N A;  1OCZ C;  1JPN A;  2WL8 A;  1ZU5 A;  2MWQ A;  4DVZ A;  2KJG A;  2ZXP A;  3X1O A;  3S27 A;  4ANJ A;  3ASO C;  1M2V B;  3GAN A;  5T3W A;  4BJ6 C;  2CGE A;  3AG2 C;  1ZHY A;  3B9Q A;  3LLK A;  4HFK B;  5FCL A;  1M2O A;  4K0D A;  5D91 A;  2KNH A;  3L0I A;  5DS5 A;  4ZLD A;  5KYU A;  4FES A;  4HFF B;  4BJ6 A;  4BG0 A;  3OEO A;  4GEH A;  5DQZ A;  3EFO A;  2BE5 F;  2R7X A;  5IY5 C;  3ABK C;  1M56 C;  3NDB B;  4CBE A;  1Z5Z A;  4YT2 A;  3T4R A;  1OCO C;  3HLZ A;  2J7P D;  4AK9 A;  3AG4 C;  3IEE A;  2DGJ A;  4DBR A;  5KYY A;  2C03 A;  4WJ0 A;  1FMV A;  3LLI A;  4IRU A;  3QZC A;  2JD3 A;  4JJG A;  3SP1 A;  4F4B A;  3N2Z B;  4JW1 A;  5B3S C;  2DYR C;  3UGO A;  3AQC A;  3EZI A;  2P6V A;  4CS7 A;  2E87 A;  2KQ9 A;  4GYT A;  1MMD A;  4PJL A;  3SNH A;  2KGO A;  2CDQ A;  3DAG A;  2ZPA A;  3B0V C;  2NUT B;  4FWV A;  5EHH A;  3NYL A;  3S29 A;  5E3A A;  4CS8 C;  5EGY A;  4W8K A;  2J7P A;  1ZHW A;  3EPV A;  2GFH A;  4C7O A;  5DLJ A;  1W2W A;  3KKB A;  3FDQ A;  3DM9 B;  2Y39 A;  4PJJ A;  4QDL A;  2Y3B A;  1D1B A;  2G3K A;  1ZHX A;  5KYW B;  1VK5 A;  4LLE A;  2OG2 A;  2J45 A;  5DVW A;  3RIP A;  3SEO A;  3KH2 A;  4CS8 A;  2Y69 C;  2IXO A;  2R7S A;  5BUO A;  3RH3 A;  4H4K C;  3PHF 2;  1PCX A;  1MND A;  1PD0 A;  1J8M F;  3MLG A;  2PX0 A;  1NG1 A;  5E2Q A;  3VAY A;  1ZYR F;  2XL4 A;  1OCC C;  5F5H A;  2Y3H A;  5DS4 A;  1M2V A;  1V54 C;  2WZF A;  4KC9 A;  2R7O A;  4G7O F;  1VYI A;  3EGX B;  1FFT C;  1D0Y A;  1IZM A;  3NRH A;  4RDA A;  2VB6 A;  4PFP A;  2P7V A;  4YJW A;  3UGP A;  3DAF A;  2J9W A;  2M4E A;  3WOD F;  5DQT A;  2HV6 A;  5E33 A;  3W2W A;  3EG9 B;  1FTS A;  1ZHZ A;  1BR2 A;  1LVK A;  2QY9 A;  4YT5 A;  1MMA A;  3W2V A;  3LNR A;  3WG7 C;  2EIN C;  3X2Q C;  3OWT A;  1TKN A;  4NY3 A;  4O7G A;  4G7Z F;  3UMI A;  2YHS A;  4U5G A;  3E9V A;  4J30 B;  3KL4 A;  2W45 A;  4XLP F;  1JPJ A;  2ZXR A;  3NKD A;  3Q6M A;  2H7B A;  4BJ1 A;  2J46 A;  3EGD B;  2H7O A;  2PFD A;  4CS9 C;  2W4M A;  1VMA A;  4PJM A;  2ZXW C;  2NUT A;  3VYW A;  2HV7 A;  1J8Y F;  4K7B A;  1N1C A;  4QI0 A;  4CS9 A;  4KNW A;  5L3Q A;  4Q5S F;  2J9U A;  5CI9 A;  4OD4 A;  4OIO F;  3RKO F;  1TR2 A;  3ABM C;  5KYW A;  3ITF A;  4HE8 D;  3EQL F;  3Q7G A;  5F5F A;  1OKK A;  4QI2 A;  1KU2 A;  4CSA C;  4U5D E;  3W8I A;  4LLC A;  2EIK C;  3DD7 A;  5E3C A;  2VH3 A;  2A68 F;  2A69 F;  3ZIB A;  3AG3 C;  4ULW A;  4BJT A;  1LS1 A;  4I3M A;  3T6B A;  4BEJ A;  4YN0 B;  2WVN A;  3LJB A;  5B1A C;  3EGX A;  1QLE C;  4HEA J;  1MMG A;  2WB7 A;  3ABL C;  4MND A;  1D0Z A;  4I44 A;  2H7V C;  4O6M A;  3NKE A;  2V3C C;  1ST6 A;  3DM5 A;  4C3E A;  3SZR A;  1NZE A;  2CNW A;  3EG9 A;  3FHD A;  4XLN F;  2EIL C;  2J0W A;  4O79 A;  2LSE A;  3ECS A;  4RD9 A;  1G8X A;  4U5B E;  2R7R A;  1QZX A;  1MNE A;  1ZHT A;  2W4B A;  4KI2 A;  3DMD A;  3UMK A;  4Q4Z F;  2IYL D;  5D92 A;  1PD1 A;  3SYN A;  4JVS A;  3HJC A;  4Q7C A;  4PFO A;  3KMI A;  3RYL A;  3W8H A;  4E7Z A;  4IWB A;  3H65 A;  3EZH A;  5KYN A;  4OIQ F;  3EGD A;  3CSK A;  2Y3D A;  4PJN A;  5L3V A;  4O6Y A;  3B0P A;  2D5R B;  3I5Q A;  3F47 A;  3T6J A;  1IW7 F;  4E7S A;  1VYK A;  2Q9A A;  4IAO A;  2R7U A;  3K6B A;  3O39 A;  3N0T A;  4JJF A;  3S0X A;  3Q7L A;  1SF8 A;  1SZI A;  1Z3I X;  3LS1 A;  1S7Z A;  2Q9B A;  1BR4 A;  3PMR A;  3AQB A;  4JCH A;  2Q3T A;  3CQZ A;  2XXA B;  5T1D B;  3JCU Q;  4ZLC A;  3NYJ A;  2G62 A;  2B0J A;  3NG1 A;  3EH1 A;  4DBQ A;  2FGY A;  4EWC A;  4U5F E;  1OKK D;  1LKX A;  2R7T A;  1O87 A;  2Y3G A;  5KYX B;  2FFH A;  2NUP B;  1BR1 A;  3K33 A;  4I1M A;  3E70 C;  2XSE A;  2W9Y A;  2OCC C;  4OIR F;  2A6E F;  4O6N A;  4X0R A;  1SMY F;  2IXM A;  5HSW A;  4CIH A;  1O5H A;  4JZA A;  1V55 C;  1FMW A;  2YZS A;  2KW3 C;  2DYS C;  3I4U A;  4U5E E;  4EBB A;  3FAJ A;  3ZSU A;  3K1I C;  2R7V A;  2MYS A;  2CNW D;  4LAC B;  4DOZ A;  2PX3 A;  1FFH A;  2R7Q A;  2WZL A;  4XWJ A;  3LEV A;  3ZVR A;  4J32 B;  5CI8 A;  3L34 A;  2A1D D;  3B0U X;  4PK4 A;  2J0X A;  3JSZ A;  4A2N B;  3M1C B;  1D1C A;  4CSA A;  4AE4 B;  3O6X A;  2X51 A;  1TWH A;  1MMN A;  2O9X A;  4BJ5 C;  2IXN A;  4KBL A;  4U5C E;  4OIN F;  2Z15 A;  3DZA A;  5T3T A;  1D0X A;  2C04 A;  1TWC A;  3FVY A;  1Z6A A;  3LES A;  2NG1 A;  4BJ5 A;  1WGW A;  4YT8 A;  3EJN A;  2YEV A;  2PP4 A;  3K66 A;  5DS6 A;  1ZU4 A;  2IOQ A;  4U5H A;  1RJ9 A;  4AX2 A;  1Z63 A;  2XXA A;  2Q9C A;  3HTK C;  3UMH A;  2VAS A;  1D1A A;  5KYU B;  3S28 A;  4C3D A;  4MQ9 F;  2J9V A;  3MX3 A;  4YT4 A;  4DVY P;  3N24 A;  2QTV A;  3K7D A;  4OIP F;  3EFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...