1WGWA

Solution structure of the n-terminal domain of mouse putative signal recognition particle 54 (srp54)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
GSSGSSGADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKVKVYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords 'Signal Recognition Particle 54
publication title Solution Structure of the N-terminal Domain of Mouse Putative Signal Recognition Particle 54 (SRP54)
rcsb
source organism Mus musculus
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1wgwA00
2V3CC 1ZU4A 2QY9A 2NG1A 3DMDA 2C03A 1WGWA 2Q9AA 3E70C 1RJ9B 2J46A 2C04A 1RJ9A 3KL4A 3B9QA 3NG1A 1OKKA 2Q9BA 1ZU5A 2XXAB 1NG1A 5L3QA 3DM9B 2XXAA 2CNWA 1O87A 5L3VA 2J7PA 3NDBB 1OKKD 1LS1A 2OG2A 2CNWD 1QZXA 2J7PD 1JPNA 2Q9CA 1J8MF 1FTSA 4C7OB 2FFHA 2IYLD 2YHSA 4C7OA 1FFHA 1VMAA 2J45A 1JPJA 3DM5A 1J8YF 4AK9A
chains in the Genus database with same CATH superfamily
1HMOA 3MLGA 4JEBA 3SYNA 5EHHA 4ZLDA 3GEIA 1WATA 3VM6A 1SMYF 1T6IA 1Z6AA 3LNRA 5AGFA 4R32A 4YWQA 2OCCC 3K1IA 2VB6A 1HW1A 2R25A 3I4UA 2H7BA 2IXMA 5DLJA 3W2WA 3H2UA 5FCLA 3U8VA 3UGPA 3AQCA 3N0TA 4XEKA 4PJMA 3AJMA 4MW3A 3C8GB 4PFOA 2OJED 3PMRA 2L9JA 1NSGB 4YT2A 5IY5C 5CI9A 2LK4A 4BJ1A 4EWCA 1D0ZA 4XLPF 2FAPB 3LEOA 5JVEA 2GFHA 4B6IA 3ITFA 1DOWA 2BC5A 3RF3A 2B0HA 4FAPB 1FTSA 4CIHA 2YHSA 2DGJA 4IJJA 1ZVZA 4YL3A 2I15A 3AG4C 2Y3HA 1YJGA 2YKZA 2KSFA 4AK9A 3BRJA 1WASA 1L3PA 1HMDA 2MHRA 3CZ6A 2IXOA 3ZG1A 4ONSA 4YL1A 3RH3A 4NQFA 4CSAC 1ZHXA 2R7TA 4E18A 1O5HA 1MMDA 2WZFA 3AG1C 3CEXA 3E70C 3GM3A 2L6GA 2YRFA 2QNLA 4IWBA 2YL0A 3NKDA 3T4RA 5B1BC 4DRJB 1GS9A 4U5EE 4PJLA 1LS4A 1MMGA 2YVKA 1OCOC 3LUTB 3C8ZA 1DOVA 3DJUB 5KYWA 3EGXB 2W9YA 1NBBA 4K1OA 4O7GA 2HV7A 5L3VA 4MVMA 2GDCA 1RXQA 2P0NA 4NTBA 1QZXA 2VASA 1LM3B 1LVKA 2KYHA 2UUIA 3AGUA 1D1BA 4Q7CA 3DXJF 4XPWA 4EHPA 5L0CA 1T6UA 3JTLO 5E3AA 2JX0A 4H54A 2OEVA 3LLIA 3HLZA 2WZGA 2EIMC 2Q3TA 3IQ5A 1U0BB 1SZIA 2PP4A 3R7CA 1EKYA 4DXWA 1ZZPA 4XWJA 1FNTc 5KYYB 3O6XA 4JW1A 3K6BA 2VC9A 4X0RA 2A69F 2EIKC 2J9WA 3S28A 2YL1A 3FAJA 4JRZA 1SR2A 2OKUA 2BE5F 4O6YA 2XS1A 5L3QA 3B0PA 2ASRA 3K1IC 3TJ6A 2O9XA 1QPUA 1D1AA 4ULWA 4BJ6A 4XEVA 3JYYA 4OIOF 4U9DA 3MBGA 4I1MA 4D4NA 5D91A 4E0IA 2W4MA 2HFIA 2XSEA 4AE4A 3AG3C 4JC7A 2HUJA 1YA7O 5T3TA 3FOPA 3QMKA 2R7UA 1E83A 3V5XA 3VRCA 1H9GA 4I1OB 2PFDA 2RD9A 1PD1A 1E85A 1CPQA 1PV3A 5JRAA 2KQ9A 3DE8A 4E7ZA 1RJ9B 2J46A 2ZXWC 4JIOA 4CS9A 5A6BA 5JLIA 1VTMP 4JCZA 4PJJA 5COMA 1R5ID 3HNIA 2R02A 2R7VA 2R7XA 3UMHA 3DM9B 4CS7A 1XWJA 3FOOA 5DS4A 3MYFA 1CGME 2LFDA 1JMWA 5BQGA 2OOCA 5EK0A 3EPVA 2V26A 3NKEA 4DJ9A 3G50A 5L0IA 5T3WA 3LJBA 1C03A 4NTFA 4WJ0A 1FFHA 3NYLA 3KMIA 3PDMP 1JAFA 2HJMA 3K7DA 4F4BA 1PD0A 3HJCA 1TQGA 4DVZA 2NUTB 3EQLF 4KNVA 2R7SA 5E3CA 1CPRA 1M6TA 3DJNB 1QSPA 4LLEA 5KYXA 5E33A 1ST6A 2Z15A 3UR3C 1E84A 4G78A 1BR2A 2NUPB 3GEHA 3Q7GA 3LESA 2J0WA 4U5HA 3U2MA 3U3BA 1LPEA 2LQGA 3ABMC 3KL4A 3M15A 4H4KC 3ZDLA 4YK5A 2R7QA 2HMQA 3EH2A 4JVSA 5HSWA 3C8GA 3ZIBA 4FWVA 1GGQA 4YT4A 3NDBB 5DQZA 4GQHA 4AX2A 2J7PD 4DBRA 1Z3IX 2GAQA 3EG9B 3TOMA 5KYUB 1MMNA 2L81A 1MNEA 2MYSA 4O6MA 3ZQYA 4C7OB 4NTAA 2KW3C 3H65A 5L0HA 3CSKA 1RKEB 2YL3A 1FR0A 2WVQA 4MTGA 1J8YF 2PX3A 3F47A 3B71A 1FMWA 4HEAJ 1BDJB 1U89A 1ZU4A 2H8AA 4XTKA 1EA8A 4BJ6C 2J9UA 1BR1A 4JZAA 1ZHYA 5GPGB 4MVRA 1G8XA 3L1MA 4CS8C 1ZYRF 1JR8A 1PCXA 2R03A 3Q6NA 4J32B 3T6BA 2Y69C 3M79A 4MVUA 3HNJA 3FMSA 4JCHA 3VYWA 3W2VA 1TWAA 4I44A 4J30B 4YL0A 1KU2A 4O79A 4CBEA 2XLMA 5A69A 3QVYA 3OEOA 3SP1A 4DRIB 1QKRA 3NRHA 3PCVA 2R7RA 2J0XA 3HTKC 4C3DA 4MVOA 1TWCA 2J7PA 4RD9A 1TWHA 3FVYA 1A7VA 4IB4A 2A68F 1F1MA 4CS9C 4G0HA 2QTVA 4MQ9F 2VCAA 2L6FA 3RKOF 2W45A 4EIYA 2VCCA 1OQCA 4JURI 2L6HA 3DKAA 2HS5A 4G7OF 3O55A 3JSEO 1M2VB 3FDQA 4BPMA 2G3KA 4CJGA 1FAPB 5EGYA 1E86A 3ATPA 4WGZA 3DMDA 1WGWA 1VLSA 4GEHA 5DVWA 2AVKA 3FAPB 1YDIA 4P9TA 4JKVA 3L0IA 4CDVA 3U5SA 4IARA 1LKXA 3EZIA 3EFOB 3QW0A 4FX5A 2NSGA 5T1DB 4XPXA 3QW1A 3U9MA 3PHF2 1ZU5A 1OCCC 3OA1A 3WODF 2M4EA 3I5QA 3GWNA 3RFYA 2YZSA 4U5CE 2IXNA 2OG2A 1NLXA 4Z9HA 4QI0A 1Z5ZA 1YA9A 1Z63A 1EQ1A 5F5HA 1A41A 2YL7A 3S27A 3X1OA 1M56C 1B68A 1LIHA 2AP3A 2CW0F 3JT1A 1T6QA 3RVYA 1S7ZA 3T6JA 2EILC 4YJWA 1QVXA 2HJ3A 2J8WA 2X51A 2HKVA 2NG1A 4O6NA 4EBBA 2EPOA 4G7ZF 2P1AA 2LFFA 2HSQA 1Z7Qc 3GANA 5DS5A 1RCPA 1KTMA 2CYDA 1U6HA 2IBFA 2XLDA 3QTHA 2Y3GA 1G5ZA 1V74B 3A11A 4W8KA 1RJ9A 1OW7A 1APCA 5DS6A 3S29A 2R9RB 4NCQA 3AOUA 4RDAA 1TFKB 5A6BD 3MYIA 4PFPA 5A6JA 1D0YA 3KYIA 1O87A 4K7BA 2YQYA 4P6IC 2ZD9A 2CGEA 1SF8A 4OINF 2FGYA 3H2VA 4BJ5A 1K05A 4MVZA 1YYJA 4RBNA 2LD6A 3RQFA 1WN0A 1Y6DA 1VMAA 1ORSC 2OEXA 2EINC 1JPJA 2YLGA 3ABLC 3GORA 2D5RB 1Q0KA 1A0BA 3JRMO 4LDQA 1LE2A 1UFBA 2F22A 2HZ8A 5TJ5E 2JPUA 5JSLA 2NUTA 5DQTA 3N2ZB 4EBKA 3C63A 2VCBA 4JJFA 5L0FA 2QE9A 5AC4A 4N06A 2J9VA 2L7AA 2NUPA 4XPYA 3U3FA 2H7VC 1NU9C 4AL0A 2PF4E 5E2QA 3ZC4A 3TULA 1RMVA 3US6A 1ZW3A 5BQHA 3C7JA 3KYJA 4L6RA 2XXAB 4N4WA 1YYXA 3EH1A 5F5FA 1T01A 4YT8A 3ABKC 3J06A 2GWWA 2XS8A 1L7CA 3C8GD 2EPNA 1T9KA 2ZXRA 4ANJA 5D92A 5KYUA 1BZ4A 1IZMA 2B0JA 4M63A 4MS2A 4Z9JA 3TQOA 2DYSC 1TR2A 2PX0A 3RVZA 1VYIA 2P7VA 2YLIA 3O39A 4C7OA 4HE8D 1RKEA 3M1CB 1OCRC 4W8PA 3K33A 4WABA 3CQZA 3K66A 1TWGA 3B29A 5COFA 3JRTA 3S9OA 2BL2A 3C18A 3NMIA 2HSBA 1VLTA 3DWWA 1G4US 2IXPA 2XLVA 4XLNF 2KC3A 1VYKA 1BR4A 3UGOA 4IAOA 1CGNA 3RQGA 1M57C 3AQBA 1KNYA 3B0UX 1I4ZA 1OKKA 1OXBA 1NFOA 1LI7A 4Q5SF 3F46A 1OW8A 1YZCA 2Y3DA 4N6CA 1G4WR 1LE4A 3SXYA 3ZQVA 2Q9CA 1WWPA 2G3VA 2JD3A 4IAQA 4KBLA 4CIPA 2XLHA 4NY3A 3V7OA 2IYLD 3JCUQ 3LS0A 2GA0A 4MW8A 4CDAA 5BUOA 1Q0MA 1ORYA 4IRUA 4LDKA 3U9JA 2R7WA 5COGA 4A4AA 3NYMA 2QY9A 4LDRA 1AEPA 2XL8A 3V5YA 4DVYP 2TMVP 4BJ5C 2D4UA 4N6HA 3S84A 1C02A 4PR9A 5JT4A 3TJ5A 2KNHA 5A6AA 2J9BA 1D0XA 2OJQA 4OIRF 1YZAA 4U5GA 1OR3A 3EFOA 2I8BA 4HFFB 3IPMO 4XEFA 1S05A 1A7DA 2VH3A 1R4TA 3L8JA 4J7TA 4BEMJ 3WAQA 1ZHTA 3W8IA 2CDQA 1Q0GA 3M4CA 3TD7A 3EGXA 1ZHWA 4ER9A 3DZAA 4NC3A 3GODA 5FZTA 256BA 2M64A 2ZXPA 1K40A 3G4XA 2YWAA 2EIJC 3NMJA 2J45A 4ULVA 5JP7A 3EHMA 4KC9A 1IW7F 1I5NA 4JTCB 1ZW2A 1YVIA 1VK5A 4PJNA 3JZ0A 1E2XA 2H7OA 5KYXB 4PK4A 4GYTA 3FHDA 3VAYA 4BEJA 5AC5A 5KYYA 1YLMA 2UUHA 2ZXOA 2LSEA 1OW6A 1FFTC 2Q4FA 4DOZA 1HY5A 3IQCA 4JTDB 3IQ6A 3B9QA 1MQVA 3V5ZA 1MMAA 1Q0DA 2DI3A 3EGDB 3RQEA 3U0CA 2KK1A 1V54C 3ECSA 1WTYA 1JPNA 5F28E 5B3IA 1I4YA 3AGTA 4U5BE 2WVNA 4MTFA 1N1CA 1YARO 3HNLA 3T6GB 3ZVRA 4OIQF 1VB5A 3SXKA 5KYNA 3DI5A 3JYHA 1HE1A 4C3BA 2A1DD 2E87A 2W4BA 4P9FA 3UNGC 3WG7C 5L0DA 2Q7RA 3NMKA 3G4ZA 4BJTA 3B0VC 3A9CA 4CX9A 4OD4A 1H7IA 2R7OA 3L34A 4MVSA 3SXMA 3KKBA 4OIPF 4ZLCA 4OD5A 3Q7LA 2Q9BA 2XLEA 1QLEC 1NG1A 3ZTMA 2XXAA 5L0GA 1LS1A 2ICWG 2CNWD 3ASNC 2XM4A 5JS5A 4YT5A 3GM2A 3GWLA 1JOGA 3QVZA 3VF0A 4E0HA 2XL4A 3IEEA 3DAFA 2ZPAA 3AG2C 3JSZA 4AL1A 2OU6A 3BEHA 3GEEA 2KGOA 3NYJA 4MVQA 3DM5A 4Z9IA 3U2LA 3SNHA 3ZWIA 4KNWA 4U5DE 3OWTA 3SEOA 1MNDA 2QUPA 4CS8A 4E17A 4DBQA 5A6KA 2Y3BA 3LLKA 1JRAA 1VOMA 3Q6MA 5CIVA 3POVA 4E7SA 2XL6A 2EPLX 2A6HF 3S90A 1GM5A 2AWYA 1TFOB 4XQ1A 5L0JA 1V4AA 1OR2A 5JUAA 2XLOA 3DAGA 1HW2A 3N24A 3IHUA 3NG1A 2LP4A 3QZCA 1LI5A 5CI8A 4UDVA 4G7HF 4EBJA 3T9OA 5KYWB 4Q4ZF 4D4XA 3DE9A 2CNWA 2P61A 1Y4CA 2XLWA 2Y39A 1NFNA 1OKKD 2OQMA 1RKCA 3DD7A 3M4BA 3TOLA 4A2NB 5B1AC 2WB7A 2P6VA 3SXZA 2WZLA 1J8MF 1WOLA 5B3SC 3EG9A 1NU7D 2LIGA 2WVOA 3W8HA 3ZSUA 4KI2A 3GM1A 1AUEA 1O3UA 2EPMX 4U5FE 3HKKA 2NSFA 5HV9A 3E9VA 2DYRC 2KJGA 3HNKA 4LERA 2C03A 4EUKB 4QI2A 1SYQA 4CJOA 1XZQA 3MX3A 1XZPA 4U9EA 1AVOB 3RYLA 4C3EA 3FXHA 2Q00A 3LNMB 3IQTA 1T5OA 3LEVA 4HFKB 4WGYA 2DB4A 3CAXA 2A0UA 1K04A 1BBHA 1NZEA 1M2OA 4JTAB 4IGGA 4MNDA 3RIPA 4EKWA 1D1CA 2CCYA 3ASOC 2MWQA 2G62A 2PBEA 2PNOA 4CSAA 2YLDA 1GQAA 1Z23A 3R2PA 3EJNA 4I3MA 4AE4B 5BQIA 2X0CA 3KPHA 3L8IA 2XM0A 4J7YA 4JJGA 1TKNA 4PACA 2QLAA 3W4YA 4DRHB 1OXKA 5K0IA 1H9TA 4CDYA 2V3CC 1QQ3A 1ORJA 1Q0FA 1M2VA 2IM8A 2WL8A 1OCZC 4FESA 3U8PA 4JEAA 2A6EF 2HV6A 2Q9AA 3K1HA 2YEVA 3KH2A 4MTOA 2RSEB 3C62A 3S0XA 3RW0A 1V55C 3MFNA 2C04A 4LACB 1W2WA 3X2QC 1CGOA 1YAUO 3LAYA 1H6GA 3ZTZA 3TK0A 2R05A 4JE9A 1A7EA 1EI7A 4BG0A 4K0DA 2HMZA 3SZRA 3I5PA 4LLCA 2A0BA 2NPUA 1FMVA 3LS1A 3EGDA 1UG7A 2LCHA 3UMIA 3UMKA 4QDLA 2AU5A 3O10A 2IOQA 2FFHA 3EZHA 2AWCA 2ETSA 4YN0B 2XRHA 3WHNA 2EPKX 1ZHZA 1C17M 3EHNA 1HE9A
chains in the Genus database with same CATH topology
3MLGA 3SYNA 5EHHA 4ZLDA 1SMYF 1Z6AA 3LNRA 4YWQA 2OCCC 3I4UA 2H7BA 2IXMA 5DLJA 3W2WA 5FCLA 3UGPA 3AQCA 3N0TA 4PJMA 4PFOA 3PMRA 2L9JA 5IY5C 4YT2A 5CI9A 4BJ1A 4EWCA 1D0ZA 2GFHA 4B6IA 3ITFA 1FTSA 4CIHA 2YHSA 2DGJA 4IJJA 3AG4C 2Y3HA 4AK9A 3CZ6A 2IXOA 3ZG1A 4CSAC 3RH3A 1ZHXA 2R7TA 1O5HA 1MMDA 2WZFA 3AG1C 3E70C 4IWBA 3T4RA 3NKDA 5B1BC 4U5EE 4PJLA 1MMGA 1OCOC 3DJUB 5KYWA 3EGXB 2W9YA 4O7GA 5L3VA 2HV7A 1QZXA 2VASA 1LVKA 1D1BA 4Q7CA 3DXJF 5E3AA 3LLIA 3HLZA 2WZGA 2EIMC 2Q3TA 1SZIA 2PP4A 4XWJA 5KYYB 3O6XA 4JW1A 3K6BA 4X0RA 2A69F 2EIKC 2J9WA 3S28A 3FAJA 2BE5F 4O6YA 5L3QA 3B0PA 3K1IC 2O9XA 1D1AA 4ULWA 4BJ6A 4OIOF 4I1MA 5D91A 2W4MA 2XSEA 4AE4A 3AG3C 5T3TA 3QMKA 2R7UA 4I1OB 2PFDA 1PD1A 2KQ9A 4E7ZA 1RJ9B 2J46A 2ZXWC 4CS9A 4PJJA 2R7VA 2R7XA 3UMHA 3DM9B 4CS7A 5DS4A 3EPVA 2V26A 3NKEA 5T3WA 3LJBA 4WJ0A 1FFHA 3NYLA 3KMIA 3K7DA 4F4BA 1PD0A 3HJCA 4DVZA 2NUTB 3EQLF 4KNVA 2R7SA 5E3CA 3DJNB 4LLEA 5KYXA 1ST6A 2Z15A 3UR3C 1BR2A 2NUPB 3Q7GA 3LESA 2J0WA 4U5HA 3ABMC 3KL4A 4H4KC 2R7QA 3EH2A 4JVSA 5HSWA 3ZIBA 4FWVA 3NDBB 4YT4A 5DQZA 4AX2A 2J7PD 4DBRA 1Z3IX 5KYUB 3EG9B 1MMNA 2L81A 1MNEA 2MYSA 4O6MA 4C7OB 2KW3C 3H65A 3CSKA 2WVQA 1J8YF 2PX3A 3F47A 1FMWA 4HEAJ 1ZU4A 4XTKA 4BJ6C 2J9UA 1BR1A 4JZAA 1ZHYA 1G8XA 1ZYRF 1PCXA 4J32B 3Q6NA 3T6BA 2Y69C 3W2VA 4JCHA 3VYWA 1TWAA 4I44A 4J30B 1KU2A 4O79A 4CBEA 3OEOA 3SP1A 3NRHA 2R7RA 2J0XA 3HTKC 4C3DA 4RD9A 1TWCA 2J7PA 1TWHA 3FVYA 4CS9C 2A68F 1ZHZA 4G0HA 2QTVA 4MQ9F 3RKOF 2W45A 4JURI 3FDQA 1M2VB 2G3KA 5EGYA 3DMDA 1WGWA 4GEHA 5DVWA 3L0IA 1LKXA 3EZIA 3EFOB 4FX5A 5T1DB 3PHF2 1ZU5A 1OCCC 3OA1A 3WODF 2M4EA 3I5QA 3RFYA 2YZSA 4U5CE 2IXNA 2OG2A 4QI0A 1Z5ZA 1Z63A 5F5HA 3S27A 3X1OA 1M56C 3JT1A 2CW0F 3T6JA 1S7ZA 2EILC 4YJWA 2X51A 2NG1A 4O6NA 4EBBA 4G7ZF 3GANA 5DS5A 5E33A 2Y3GA 4W8KA 1RJ9A 5DS6A 3S29A 4RDAA 4PFPA 1D0YA 1O87A 4K7BA 4P6IC 2CGEA 1SF8A 4OINF 2FGYA 4BJ5A 4RBNA 1VMAA 4M63A 3UGOA 2EINC 3ABLC 1JPJA 2D5RB 2NUTA 5DQTA 3N2ZB 4JJFA 4N06A 2J9VA 2NUPA 2H7VC 1NU9C 2PF4E 5E2QA 3ZC4A 2XXAB 5F5FA 3EH1A 4YT8A 3ABKC 2ZXRA 4ANJA 5D92A 5KYUA 1IZMA 2B0JA 2DYSC 1TR2A 2PX0A 4C7OA 1VYIA 2P7VA 3O39A 4HE8D 3M1CB 1OCRC 3K33A 3CQZA 3K66A 1TWGA 3JRTA 2IXPA 4XLNF 1VYKA 1BR4A 4IAOA 1M57C 3AQBA 3B0UX 1OKKA 4Q5SF 3F46A 2Y3DA 2Q9CA 2G3VA 2JD3A 4KBLA 4NY3A 3V7OA 2IYLD 3JCUQ 3LS0A 5BUOA 2R7WA 4IRUA 3NYMA 2QY9A 4DVYP 4BJ5C 2KNHA 1D0XA 4OIRF 4U5GA 3EFOA 2I8BA 4HFFB 2VH3A 1ZHTA 3W8IA 2CDQA 3TD7A 3EGXA 1ZHWA 3DZAA 3GODA 2ZXPA 2EIJC 2J45A 3EHMA 4KC9A 1IW7F 1VK5A 4PJNA 2H7OA 5KYXB 4PK4A 4GYTA 3FHDA 3VAYA 4BEJA 5KYYA 4DOZA 2ZXOA 2LSEA 1FFTC 3B9QA 1MMAA 3EGDB 1V54C 3ECSA 1JPNA 4U5BE 2WVNA 1N1CA 3ZVRA 4OIQF 5KYNA 3JYHA 4C3BA 2A1DD 2E87A 2W4BA 3UNGC 3WG7C 4BJTA 3B0VC 4OD4A 2R7OA 3L34A 4OIPF 3KKBA 4ZLCA 4OD5A 3Q7LA 2Q9BA 1QLEC 1NG1A 2XXAA 1LS1A 3ASNC 2CNWD 4YT5A 2XL4A 3IEEA 3DAFA 2ZPAA 3AG2C 3JSZA 2KGOA 3NYJA 3DM5A 3SNHA 4KNWA 4U5DE 3OWTA 3SEOA 1MNDA 4CS8A 4DBQA 2Y3BA 3LLKA 1VOMA 3Q6MA 3POVA 4E7SA 2A6HF 4G7OF 3N24A 3NG1A 3QZCA 5CI8A 4G7HF 5KYWB 4Q4ZF 2CNWA 3DD7A 2Y39A 1OKKD 4A2NB 5B1AC 2WB7A 2P6VA 2WZLA 1J8MF 5B3SC 3EG9A 1NU7D 2WVOA 3W8HA 3ZSUA 4KI2A 4U5FE 3E9VA 2DYRC 2KJGA 4LERA 2C03A 4QI2A 3MX3A 3RYLA 4C3EA 4HFKB 3LEVA 1NZEA 1M2OA 4MNDA 3RIPA 1D1CA 3ASOC 2MWQA 2G62A 4CSAA 1Z23A 3EJNA 4I3MA 4AE4B 4JJGA 4XLPF 1TKNA 2V3CC 1M2VA 2WL8A 1OCZC 4FESA 2A6EF 2HV6A 2Q9AA 3K1HA 2YEVA 3KH2A 3S0XA 1V55C 2C04A 4LACB 1W2WA 3X2QC 3LAYA 4CS8C 4BG0A 4K0DA 3SZRA 3I5PA 4LLCA 1FMVA 3LS1A 3EGDA 3UMIA 3UMKA 4QDLA 2IOQA 2FFHA 3EZHA 4YN0B 2XRHA 2VB6A 3EHNA 3DAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3C C;  1ZU4 A;  2QY9 A;  2NG1 A;  3DMD A;  2C03 A;  1WGW A;  2Q9A A;  3E70 C;  1RJ9 B;  2J46 A;  2C04 A;  1RJ9 A;  3KL4 A;  3B9Q A;  3NG1 A;  1OKK A;  2Q9B A;  1ZU5 A;  2XXA B;  1NG1 A;  5L3Q A;  3DM9 B;  2XXA A;  2CNW A;  1O87 A;  5L3V A;  2J7P A;  3NDB B;  1OKK D;  1LS1 A;  2OG2 A;  2CNW D;  1QZX A;  2J7P D;  1JPN A;  2Q9C A;  1J8M F;  1FTS A;  4C7O B;  2FFH A;  2IYL D;  2YHS A;  4C7O A;  1FFH A;  1VMA A;  2J45 A;  1JPJ A;  3DM5 A;  1J8Y F;  4AK9 A; 
#chains in the Genus database with same CATH topology
 1HMO A;  3MLG A;  4JEB A;  3SYN A;  5EHH A;  4ZLD A;  3GEI A;  1WAT A;  3VM6 A;  1SMY F;  1T6I A;  1Z6A A;  3LNR A;  5AGF A;  4R32 A;  4YWQ A;  2OCC C;  3K1I A;  2VB6 A;  1HW1 A;  2R25 A;  3I4U A;  2H7B A;  2IXM A;  5DLJ A;  3W2W A;  3H2U A;  5FCL A;  3U8V A;  3UGP A;  3AQC A;  3N0T A;  4XEK A;  4PJM A;  3AJM A;  4MW3 A;  3C8G B;  4PFO A;  2OJE D;  3PMR A;  2L9J A;  1NSG B;  4YT2 A;  5IY5 C;  5CI9 A;  2LK4 A;  4BJ1 A;  4EWC A;  1D0Z A;  4XLP F;  2FAP B;  3LEO A;  5JVE A;  2GFH A;  4B6I A;  3ITF A;  1DOW A;  2BC5 A;  3RF3 A;  2B0H A;  4FAP B;  1FTS A;  4CIH A;  2YHS A;  2DGJ A;  4IJJ A;  1ZVZ A;  4YL3 A;  2I15 A;  3AG4 C;  2Y3H A;  1YJG A;  2YKZ A;  2KSF A;  4AK9 A;  3BRJ A;  1WAS A;  1L3P A;  1HMD A;  2MHR A;  3CZ6 A;  2IXO A;  3ZG1 A;  4ONS A;  4YL1 A;  3RH3 A;  4NQF A;  4CSA C;  1ZHX A;  2R7T A;  4E18 A;  1O5H A;  1MMD A;  2WZF A;  3AG1 C;  3CEX A;  3E70 C;  3GM3 A;  2L6G A;  2YRF A;  2QNL A;  4IWB A;  2YL0 A;  3NKD A;  3T4R A;  5B1B C;  4DRJ B;  1GS9 A;  4U5E E;  4PJL A;  1LS4 A;  1MMG A;  2YVK A;  1OCO C;  3LUT B;  3C8Z A;  1DOV A;  3DJU B;  5KYW A;  3EGX B;  2W9Y A;  1NBB A;  4K1O A;  4O7G A;  2HV7 A;  5L3V A;  4MVM A;  2GDC A;  1RXQ A;  2P0N A;  4NTB A;  1QZX A;  2VAS A;  1LM3 B;  1LVK A;  2KYH A;  2UUI A;  3AGU A;  1D1B A;  4Q7C A;  3DXJ F;  4XPW A;  4EHP A;  5L0C A;  1T6U A;  3JTL O;  5E3A A;  2JX0 A;  4H54 A;  2OEV A;  3LLI A;  3HLZ A;  2WZG A;  2EIM C;  2Q3T A;  3IQ5 A;  1U0B B;  1SZI A;  2PP4 A;  3R7C A;  1EKY A;  4DXW A;  1ZZP A;  4XWJ A;  1FNT c;  5KYY B;  3O6X A;  4JW1 A;  3K6B A;  2VC9 A;  4X0R A;  2A69 F;  2EIK C;  2J9W A;  3S28 A;  2YL1 A;  3FAJ A;  4JRZ A;  1SR2 A;  2OKU A;  2BE5 F;  4O6Y A;  2XS1 A;  5L3Q A;  3B0P A;  2ASR A;  3K1I C;  3TJ6 A;  2O9X A;  1QPU A;  1D1A A;  4ULW A;  4BJ6 A;  4XEV A;  3JYY A;  4OIO F;  4U9D A;  3MBG A;  4I1M A;  4D4N A;  5D91 A;  4E0I A;  2W4M A;  2HFI A;  2XSE A;  4AE4 A;  3AG3 C;  4JC7 A;  2HUJ A;  1YA7 O;  5T3T A;  3FOP A;  3QMK A;  2R7U A;  1E83 A;  3V5X A;  3VRC A;  1H9G A;  4I1O B;  2PFD A;  2RD9 A;  1PD1 A;  1E85 A;  1CPQ A;  1PV3 A;  5JRA A;  2KQ9 A;  3DE8 A;  4E7Z A;  1RJ9 B;  2J46 A;  2ZXW C;  4JIO A;  4CS9 A;  5A6B A;  5JLI A;  1VTM P;  4JCZ A;  4PJJ A;  5COM A;  1R5I D;  3HNI A;  2R02 A;  2R7V A;  2R7X A;  3UMH A;  3DM9 B;  4CS7 A;  1XWJ A;  3FOO A;  5DS4 A;  3MYF A;  1CGM E;  2LFD A;  1JMW A;  5BQG A;  2OOC A;  5EK0 A;  3EPV A;  2V26 A;  3NKE A;  4DJ9 A;  3G50 A;  5L0I A;  5T3W A;  3LJB A;  1C03 A;  4NTF A;  4WJ0 A;  1FFH A;  3NYL A;  3KMI A;  3PDM P;  1JAF A;  2HJM A;  3K7D A;  4F4B A;  1PD0 A;  3HJC A;  1TQG A;  4DVZ A;  2NUT B;  3EQL F;  4KNV A;  2R7S A;  5E3C A;  1CPR A;  1M6T A;  3DJN B;  1QSP A;  4LLE A;  5KYX A;  5E33 A;  1ST6 A;  2Z15 A;  3UR3 C;  1E84 A;  4G78 A;  1BR2 A;  2NUP B;  3GEH A;  3Q7G A;  3LES A;  2J0W A;  4U5H A;  3U2M A;  3U3B A;  1LPE A;  2LQG A;  3ABM C;  3KL4 A;  3M15 A;  4H4K C;  3ZDL A;  4YK5 A;  2R7Q A;  2HMQ A;  3EH2 A;  4JVS A;  5HSW A;  3C8G A;  3ZIB A;  4FWV A;  1GGQ A;  4YT4 A;  3NDB B;  5DQZ A;  4GQH A;  4AX2 A;  2J7P D;  4DBR A;  1Z3I X;  2GAQ A;  3EG9 B;  3TOM A;  5KYU B;  1MMN A;  2L81 A;  1MNE A;  2MYS A;  4O6M A;  3ZQY A;  4C7O B;  4NTA A;  2KW3 C;  3H65 A;  5L0H A;  3CSK A;  1RKE B;  2YL3 A;  1FR0 A;  2WVQ A;  4MTG A;  1J8Y F;  2PX3 A;  3F47 A;  3B71 A;  1FMW A;  4HEA J;  1BDJ B;  1U89 A;  1ZU4 A;  2H8A A;  4XTK A;  1EA8 A;  4BJ6 C;  2J9U A;  1BR1 A;  4JZA A;  1ZHY A;  5GPG B;  4MVR A;  1G8X A;  3L1M A;  4CS8 C;  1ZYR F;  1JR8 A;  1PCX A;  2R03 A;  3Q6N A;  4J32 B;  3T6B A;  2Y69 C;  3M79 A;  4MVU A;  3HNJ A;  3FMS A;  4JCH A;  3VYW A;  3W2V A;  1TWA A;  4I44 A;  4J30 B;  4YL0 A;  1KU2 A;  4O79 A;  4CBE A;  2XLM A;  5A69 A;  3QVY A;  3OEO A;  3SP1 A;  4DRI B;  1QKR A;  3NRH A;  3PCV A;  2R7R A;  2J0X A;  3HTK C;  4C3D A;  4MVO A;  1TWC A;  2J7P A;  4RD9 A;  1TWH A;  3FVY A;  1A7V A;  4IB4 A;  2A68 F;  1F1M A;  4CS9 C;  4G0H A;  2QTV A;  4MQ9 F;  2VCA A;  2L6F A;  3RKO F;  2W45 A;  4EIY A;  2VCC A;  1OQC A;  4JUR I;  2L6H A;  3DKA A;  2HS5 A;  4G7O F;  3O55 A;  3JSE O;  1M2V B;  3FDQ A;  4BPM A;  2G3K A;  4CJG A;  1FAP B;  5EGY A;  1E86 A;  3ATP A;  4WGZ A;  3DMD A;  1WGW A;  1VLS A;  4GEH A;  5DVW A;  2AVK A;  3FAP B;  1YDI A;  4P9T A;  4JKV A;  3L0I A;  4CDV A;  3U5S A;  4IAR A;  1LKX A;  3EZI A;  3EFO B;  3QW0 A;  4FX5 A;  2NSG A;  5T1D B;  4XPX A;  3QW1 A;  3U9M A;  3PHF 2;  1ZU5 A;  1OCC C;  3OA1 A;  3WOD F;  2M4E A;  3I5Q A;  3GWN A;  3RFY A;  2YZS A;  4U5C E;  2IXN A;  2OG2 A;  1NLX A;  4Z9H A;  4QI0 A;  1Z5Z A;  1YA9 A;  1Z63 A;  1EQ1 A;  5F5H A;  1A41 A;  2YL7 A;  3S27 A;  3X1O A;  1M56 C;  1B68 A;  1LIH A;  2AP3 A;  2CW0 F;  3JT1 A;  1T6Q A;  3RVY A;  1S7Z A;  3T6J A;  2EIL C;  4YJW A;  1QVX A;  2HJ3 A;  2J8W A;  2X51 A;  2HKV A;  2NG1 A;  4O6N A;  4EBB A;  2EPO A;  4G7Z F;  2P1A A;  2LFF A;  2HSQ A;  1Z7Q c;  3GAN A;  5DS5 A;  1RCP A;  1KTM A;  2CYD A;  1U6H A;  2IBF A;  2XLD A;  3QTH A;  2Y3G A;  1G5Z A;  1V74 B;  3A11 A;  4W8K A;  1RJ9 A;  1OW7 A;  1APC A;  5DS6 A;  3S29 A;  2R9R B;  4NCQ A;  3AOU A;  4RDA A;  1TFK B;  5A6B D;  3MYI A;  4PFP A;  5A6J A;  1D0Y A;  3KYI A;  1O87 A;  4K7B A;  2YQY A;  4P6I C;  2ZD9 A;  2CGE A;  1SF8 A;  4OIN F;  2FGY A;  3H2V A;  4BJ5 A;  1K05 A;  4MVZ A;  1YYJ A;  4RBN A;  2LD6 A;  3RQF A;  1WN0 A;  1Y6D A;  1VMA A;  1ORS C;  2OEX A;  2EIN C;  1JPJ A;  2YLG A;  3ABL C;  3GOR A;  2D5R B;  1Q0K A;  1A0B A;  3JRM O;  4LDQ A;  1LE2 A;  1UFB A;  2F22 A;  2HZ8 A;  5TJ5 E;  2JPU A;  5JSL A;  2NUT A;  5DQT A;  3N2Z B;  4EBK A;  3C63 A;  2VCB A;  4JJF A;  5L0F A;  2QE9 A;  5AC4 A;  4N06 A;  2J9V A;  2L7A A;  2NUP A;  4XPY A;  3U3F A;  2H7V C;  1NU9 C;  4AL0 A;  2PF4 E;  5E2Q A;  3ZC4 A;  3TUL A;  1RMV A;  3US6 A;  1ZW3 A;  5BQH A;  3C7J A;  3KYJ A;  4L6R A;  2XXA B;  4N4W A;  1YYX A;  3EH1 A;  5F5F A;  1T01 A;  4YT8 A;  3ABK C;  3J06 A;  2GWW A;  2XS8 A;  1L7C A;  3C8G D;  2EPN A;  1T9K A;  2ZXR A;  4ANJ A;  5D92 A;  5KYU A;  1BZ4 A;  1IZM A;  2B0J A;  4M63 A;  4MS2 A;  4Z9J A;  3TQO A;  2DYS C;  1TR2 A;  2PX0 A;  3RVZ A;  1VYI A;  2P7V A;  2YLI A;  3O39 A;  4C7O A;  4HE8 D;  1RKE A;  3M1C B;  1OCR C;  4W8P A;  3K33 A;  4WAB A;  3CQZ A;  3K66 A;  1TWG A;  3B29 A;  5COF A;  3JRT A;  3S9O A;  2BL2 A;  3C18 A;  3NMI A;  2HSB A;  1VLT A;  3DWW A;  1G4U S;  2IXP A;  2XLV A;  4XLN F;  2KC3 A;  1VYK A;  1BR4 A;  3UGO A;  4IAO A;  1CGN A;  3RQG A;  1M57 C;  3AQB A;  1KNY A;  3B0U X;  1I4Z A;  1OKK A;  1OXB A;  1NFO A;  1LI7 A;  4Q5S F;  3F46 A;  1OW8 A;  1YZC A;  2Y3D A;  4N6C A;  1G4W R;  1LE4 A;  3SXY A;  3ZQV A;  2Q9C A;  1WWP A;  2G3V A;  2JD3 A;  4IAQ A;  4KBL A;  4CIP A;  2XLH A;  4NY3 A;  3V7O A;  2IYL D;  3JCU Q;  3LS0 A;  2GA0 A;  4MW8 A;  4CDA A;  5BUO A;  1Q0M A;  1ORY A;  4IRU A;  4LDK A;  3U9J A;  2R7W A;  5COG A;  4A4A A;  3NYM A;  2QY9 A;  4LDR A;  1AEP A;  2XL8 A;  3V5Y A;  4DVY P;  2TMV P;  4BJ5 C;  2D4U A;  4N6H A;  3S84 A;  1C02 A;  4PR9 A;  5JT4 A;  3TJ5 A;  2KNH A;  5A6A A;  2J9B A;  1D0X A;  2OJQ A;  4OIR F;  1YZA A;  4U5G A;  1OR3 A;  3EFO A;  2I8B A;  4HFF B;  3IPM O;  4XEF A;  1S05 A;  1A7D A;  2VH3 A;  1R4T A;  3L8J A;  4J7T A;  4BEM J;  3WAQ A;  1ZHT A;  3W8I A;  2CDQ A;  1Q0G A;  3M4C A;  3TD7 A;  3EGX A;  1ZHW A;  4ER9 A;  3DZA A;  4NC3 A;  3GOD A;  5FZT A;  256B A;  2M64 A;  2ZXP A;  1K40 A;  3G4X A;  2YWA A;  2EIJ C;  3NMJ A;  2J45 A;  4ULV A;  5JP7 A;  3EHM A;  4KC9 A;  1IW7 F;  1I5N A;  4JTC B;  1ZW2 A;  1YVI A;  1VK5 A;  4PJN A;  3JZ0 A;  1E2X A;  2H7O A;  5KYX B;  4PK4 A;  4GYT A;  3FHD A;  3VAY A;  4BEJ A;  5AC5 A;  5KYY A;  1YLM A;  2UUH A;  2ZXO A;  2LSE A;  1OW6 A;  1FFT C;  2Q4F A;  4DOZ A;  1HY5 A;  3IQC A;  4JTD B;  3IQ6 A;  3B9Q A;  1MQV A;  3V5Z A;  1MMA A;  1Q0D A;  2DI3 A;  3EGD B;  3RQE A;  3U0C A;  2KK1 A;  1V54 C;  3ECS A;  1WTY A;  1JPN A;  5F28 E;  5B3I A;  1I4Y A;  3AGT A;  4U5B E;  2WVN A;  4MTF A;  1N1C A;  1YAR O;  3HNL A;  3T6G B;  3ZVR A;  4OIQ F;  1VB5 A;  3SXK A;  5KYN A;  3DI5 A;  3JYH A;  1HE1 A;  4C3B A;  2A1D D;  2E87 A;  2W4B A;  4P9F A;  3UNG C;  3WG7 C;  5L0D A;  2Q7R A;  3NMK A;  3G4Z A;  4BJT A;  3B0V C;  3A9C A;  4CX9 A;  4OD4 A;  1H7I A;  2R7O A;  3L34 A;  4MVS A;  3SXM A;  3KKB A;  4OIP F;  4ZLC A;  4OD5 A;  3Q7L A;  2Q9B A;  2XLE A;  1QLE C;  1NG1 A;  3ZTM A;  2XXA A;  5L0G A;  1LS1 A;  2ICW G;  2CNW D;  3ASN C;  2XM4 A;  5JS5 A;  4YT5 A;  3GM2 A;  3GWL A;  1JOG A;  3QVZ A;  3VF0 A;  4E0H A;  2XL4 A;  3IEE A;  3DAF A;  2ZPA A;  3AG2 C;  3JSZ A;  4AL1 A;  2OU6 A;  3BEH A;  3GEE A;  2KGO A;  3NYJ A;  4MVQ A;  3DM5 A;  4Z9I A;  3U2L A;  3SNH A;  3ZWI A;  4KNW A;  4U5D E;  3OWT A;  3SEO A;  1MND A;  2QUP A;  4CS8 A;  4E17 A;  4DBQ A;  5A6K A;  2Y3B A;  3LLK A;  1JRA A;  1VOM A;  3Q6M A;  5CIV A;  3POV A;  4E7S A;  2XL6 A;  2EPL X;  2A6H F;  3S90 A;  1GM5 A;  2AWY A;  1TFO B;  4XQ1 A;  5L0J A;  1V4A A;  1OR2 A;  5JUA A;  2XLO A;  3DAG A;  1HW2 A;  3N24 A;  3IHU A;  3NG1 A;  2LP4 A;  3QZC A;  1LI5 A;  5CI8 A;  4UDV A;  4G7H F;  4EBJ A;  3T9O A;  5KYW B;  4Q4Z F;  4D4X A;  3DE9 A;  2CNW A;  2P61 A;  1Y4C A;  2XLW A;  2Y39 A;  1NFN A;  1OKK D;  2OQM A;  1RKC A;  3DD7 A;  3M4B A;  3TOL A;  4A2N B;  5B1A C;  2WB7 A;  2P6V A;  3SXZ A;  2WZL A;  1J8M F;  1WOL A;  5B3S C;  3EG9 A;  1NU7 D;  2LIG A;  2WVO A;  3W8H A;  3ZSU A;  4KI2 A;  3GM1 A;  1AUE A;  1O3U A;  2EPM X;  4U5F E;  3HKK A;  2NSF A;  5HV9 A;  3E9V A;  2DYR C;  2KJG A;  3HNK A;  4LER A;  2C03 A;  4EUK B;  4QI2 A;  1SYQ A;  4CJO A;  1XZQ A;  3MX3 A;  1XZP A;  4U9E A;  1AVO B;  3RYL A;  4C3E A;  3FXH A;  2Q00 A;  3LNM B;  3IQT A;  1T5O A;  3LEV A;  4HFK B;  4WGY A;  2DB4 A;  3CAX A;  2A0U A;  1K04 A;  1BBH A;  1NZE A;  1M2O A;  4JTA B;  4IGG A;  4MND A;  3RIP A;  4EKW A;  1D1C A;  2CCY A;  3ASO C;  2MWQ A;  2G62 A;  2PBE A;  2PNO A;  4CSA A;  2YLD A;  1GQA A;  1Z23 A;  3R2P A;  3EJN A;  4I3M A;  4AE4 B;  5BQI A;  2X0C A;  3KPH A;  3L8I A;  2XM0 A;  4J7Y A;  4JJG A;  1TKN A;  4PAC A;  2QLA A;  3W4Y A;  4DRH B;  1OXK A;  5K0I A;  1H9T A;  4CDY A;  2V3C C;  1QQ3 A;  1ORJ A;  1Q0F A;  1M2V A;  2IM8 A;  2WL8 A;  1OCZ C;  4FES A;  3U8P A;  4JEA A;  2A6E F;  2HV6 A;  2Q9A A;  3K1H A;  2YEV A;  3KH2 A;  4MTO A;  2RSE B;  3C62 A;  3S0X A;  3RW0 A;  1V55 C;  3MFN A;  2C04 A;  4LAC B;  1W2W A;  3X2Q C;  1CGO A;  1YAU O;  3LAY A;  1H6G A;  3ZTZ A;  3TK0 A;  2R05 A;  4JE9 A;  1A7E A;  1EI7 A;  4BG0 A;  4K0D A;  2HMZ A;  3SZR A;  3I5P A;  4LLC A;  2A0B A;  2NPU A;  1FMV A;  3LS1 A;  3EGD A;  1UG7 A;  2LCH A;  3UMI A;  3UMK A;  4QDL A;  2AU5 A;  3O10 A;  2IOQ A;  2FFH A;  3EZH A;  2AWC A;  2ETS A;  4YN0 B;  2XRH A;  3WHN A;  2EPK X;  1ZHZ A;  1C17 M;  3EHN A;  1HE9 A; 
#chains in the Genus database with same CATH homology
 3MLG A;  3SYN A;  5EHH A;  4ZLD A;  1SMY F;  1Z6A A;  3LNR A;  4YWQ A;  2OCC C;  3I4U A;  2H7B A;  2IXM A;  5DLJ A;  3W2W A;  5FCL A;  3UGP A;  3AQC A;  3N0T A;  4PJM A;  4PFO A;  3PMR A;  2L9J A;  5IY5 C;  4YT2 A;  5CI9 A;  4BJ1 A;  4EWC A;  1D0Z A;  2GFH A;  4B6I A;  3ITF A;  1FTS A;  4CIH A;  2YHS A;  2DGJ A;  4IJJ A;  3AG4 C;  2Y3H A;  4AK9 A;  3CZ6 A;  2IXO A;  3ZG1 A;  4CSA C;  3RH3 A;  1ZHX A;  2R7T A;  1O5H A;  1MMD A;  2WZF A;  3AG1 C;  3E70 C;  4IWB A;  3T4R A;  3NKD A;  5B1B C;  4U5E E;  4PJL A;  1MMG A;  1OCO C;  3DJU B;  5KYW A;  3EGX B;  2W9Y A;  4O7G A;  5L3V A;  2HV7 A;  1QZX A;  2VAS A;  1LVK A;  1D1B A;  4Q7C A;  3DXJ F;  5E3A A;  3LLI A;  3HLZ A;  2WZG A;  2EIM C;  2Q3T A;  1SZI A;  2PP4 A;  4XWJ A;  5KYY B;  3O6X A;  4JW1 A;  3K6B A;  4X0R A;  2A69 F;  2EIK C;  2J9W A;  3S28 A;  3FAJ A;  2BE5 F;  4O6Y A;  5L3Q A;  3B0P A;  3K1I C;  2O9X A;  1D1A A;  4ULW A;  4BJ6 A;  4OIO F;  4I1M A;  5D91 A;  2W4M A;  2XSE A;  4AE4 A;  3AG3 C;  5T3T A;  3QMK A;  2R7U A;  4I1O B;  2PFD A;  1PD1 A;  2KQ9 A;  4E7Z A;  1RJ9 B;  2J46 A;  2ZXW C;  4CS9 A;  4PJJ A;  2R7V A;  2R7X A;  3UMH A;  3DM9 B;  4CS7 A;  5DS4 A;  3EPV A;  2V26 A;  3NKE A;  5T3W A;  3LJB A;  4WJ0 A;  1FFH A;  3NYL A;  3KMI A;  3K7D A;  4F4B A;  1PD0 A;  3HJC A;  4DVZ A;  2NUT B;  3EQL F;  4KNV A;  2R7S A;  5E3C A;  3DJN B;  4LLE A;  5KYX A;  1ST6 A;  2Z15 A;  3UR3 C;  1BR2 A;  2NUP B;  3Q7G A;  3LES A;  2J0W A;  4U5H A;  3ABM C;  3KL4 A;  4H4K C;  2R7Q A;  3EH2 A;  4JVS A;  5HSW A;  3ZIB A;  4FWV A;  3NDB B;  4YT4 A;  5DQZ A;  4AX2 A;  2J7P D;  4DBR A;  1Z3I X;  5KYU B;  3EG9 B;  1MMN A;  2L81 A;  1MNE A;  2MYS A;  4O6M A;  4C7O B;  2KW3 C;  3H65 A;  3CSK A;  2WVQ A;  1J8Y F;  2PX3 A;  3F47 A;  1FMW A;  4HEA J;  1ZU4 A;  4XTK A;  4BJ6 C;  2J9U A;  1BR1 A;  4JZA A;  1ZHY A;  1G8X A;  1ZYR F;  1PCX A;  4J32 B;  3Q6N A;  3T6B A;  2Y69 C;  3W2V A;  4JCH A;  3VYW A;  1TWA A;  4I44 A;  4J30 B;  1KU2 A;  4O79 A;  4CBE A;  3OEO A;  3SP1 A;  3NRH A;  2R7R A;  2J0X A;  3HTK C;  4C3D A;  4RD9 A;  1TWC A;  2J7P A;  1TWH A;  3FVY A;  4CS9 C;  2A68 F;  1ZHZ A;  4G0H A;  2QTV A;  4MQ9 F;  3RKO F;  2W45 A;  4JUR I;  3FDQ A;  1M2V B;  2G3K A;  5EGY A;  3DMD A;  1WGW A;  4GEH A;  5DVW A;  3L0I A;  1LKX A;  3EZI A;  3EFO B;  4FX5 A;  5T1D B;  3PHF 2;  1ZU5 A;  1OCC C;  3OA1 A;  3WOD F;  2M4E A;  3I5Q A;  3RFY A;  2YZS A;  4U5C E;  2IXN A;  2OG2 A;  4QI0 A;  1Z5Z A;  1Z63 A;  5F5H A;  3S27 A;  3X1O A;  1M56 C;  3JT1 A;  2CW0 F;  3T6J A;  1S7Z A;  2EIL C;  4YJW A;  2X51 A;  2NG1 A;  4O6N A;  4EBB A;  4G7Z F;  3GAN A;  5DS5 A;  5E33 A;  2Y3G A;  4W8K A;  1RJ9 A;  5DS6 A;  3S29 A;  4RDA A;  4PFP A;  1D0Y A;  1O87 A;  4K7B A;  4P6I C;  2CGE A;  1SF8 A;  4OIN F;  2FGY A;  4BJ5 A;  4RBN A;  1VMA A;  4M63 A;  3UGO A;  2EIN C;  3ABL C;  1JPJ A;  2D5R B;  2NUT A;  5DQT A;  3N2Z B;  4JJF A;  4N06 A;  2J9V A;  2NUP A;  2H7V C;  1NU9 C;  2PF4 E;  5E2Q A;  3ZC4 A;  2XXA B;  5F5F A;  3EH1 A;  4YT8 A;  3ABK C;  2ZXR A;  4ANJ A;  5D92 A;  5KYU A;  1IZM A;  2B0J A;  2DYS C;  1TR2 A;  2PX0 A;  4C7O A;  1VYI A;  2P7V A;  3O39 A;  4HE8 D;  3M1C B;  1OCR C;  3K33 A;  3CQZ A;  3K66 A;  1TWG A;  3JRT A;  2IXP A;  4XLN F;  1VYK A;  1BR4 A;  4IAO A;  1M57 C;  3AQB A;  3B0U X;  1OKK A;  4Q5S F;  3F46 A;  2Y3D A;  2Q9C A;  2G3V A;  2JD3 A;  4KBL A;  4NY3 A;  3V7O A;  2IYL D;  3JCU Q;  3LS0 A;  5BUO A;  2R7W A;  4IRU A;  3NYM A;  2QY9 A;  4DVY P;  4BJ5 C;  2KNH A;  1D0X A;  4OIR F;  4U5G A;  3EFO A;  2I8B A;  4HFF B;  2VH3 A;  1ZHT A;  3W8I A;  2CDQ A;  3TD7 A;  3EGX A;  1ZHW A;  3DZA A;  3GOD A;  2ZXP A;  2EIJ C;  2J45 A;  3EHM A;  4KC9 A;  1IW7 F;  1VK5 A;  4PJN A;  2H7O A;  5KYX B;  4PK4 A;  4GYT A;  3FHD A;  3VAY A;  4BEJ A;  5KYY A;  4DOZ A;  2ZXO A;  2LSE A;  1FFT C;  3B9Q A;  1MMA A;  3EGD B;  1V54 C;  3ECS A;  1JPN A;  4U5B E;  2WVN A;  1N1C A;  3ZVR A;  4OIQ F;  5KYN A;  3JYH A;  4C3B A;  2A1D D;  2E87 A;  2W4B A;  3UNG C;  3WG7 C;  4BJT A;  3B0V C;  4OD4 A;  2R7O A;  3L34 A;  4OIP F;  3KKB A;  4ZLC A;  4OD5 A;  3Q7L A;  2Q9B A;  1QLE C;  1NG1 A;  2XXA A;  1LS1 A;  3ASN C;  2CNW D;  4YT5 A;  2XL4 A;  3IEE A;  3DAF A;  2ZPA A;  3AG2 C;  3JSZ A;  2KGO A;  3NYJ A;  3DM5 A;  3SNH A;  4KNW A;  4U5D E;  3OWT A;  3SEO A;  1MND A;  4CS8 A;  4DBQ A;  2Y3B A;  3LLK A;  1VOM A;  3Q6M A;  3POV A;  4E7S A;  2A6H F;  4G7O F;  3N24 A;  3NG1 A;  3QZC A;  5CI8 A;  4G7H F;  5KYW B;  4Q4Z F;  2CNW A;  3DD7 A;  2Y39 A;  1OKK D;  4A2N B;  5B1A C;  2WB7 A;  2P6V A;  2WZL A;  1J8M F;  5B3S C;  3EG9 A;  1NU7 D;  2WVO A;  3W8H A;  3ZSU A;  4KI2 A;  4U5F E;  3E9V A;  2DYR C;  2KJG A;  4LER A;  2C03 A;  4QI2 A;  3MX3 A;  3RYL A;  4C3E A;  4HFK B;  3LEV A;  1NZE A;  1M2O A;  4MND A;  3RIP A;  1D1C A;  3ASO C;  2MWQ A;  2G62 A;  4CSA A;  1Z23 A;  3EJN A;  4I3M A;  4AE4 B;  4JJG A;  4XLP F;  1TKN A;  2V3C C;  1M2V A;  2WL8 A;  1OCZ C;  4FES A;  2A6E F;  2HV6 A;  2Q9A A;  3K1H A;  2YEV A;  3KH2 A;  3S0X A;  1V55 C;  2C04 A;  4LAC B;  1W2W A;  3X2Q C;  3LAY A;  4CS8 C;  4BG0 A;  4K0D A;  3SZR A;  3I5P A;  4LLC A;  1FMV A;  3LS1 A;  3EGD A;  3UMI A;  3UMK A;  4QDL A;  2IOQ A;  2FFH A;  3EZH A;  4YN0 B;  2XRH A;  2VB6 A;  3EHN A;  3DAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...