2HV6A

Crystal structure of the phosphotyrosyl phosphatase activator
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
301
Chain Sequence
NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 2A, regulatory subunit B
publication title Structure and mechanism of the phosphotyrosyl phosphatase activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 110
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2hv6A02
2IXNA 2HV7A 2IXMA 2HV6A 2IXOA 2G62A 4NY3A 4LACB 2IXPA
chains in the Genus database with same CATH superfamily
1B68A 1SYQA 2HV7A 3H65A 4E0IA 3U2MA 3EH2A 4J32B 2PFDA 4EWCA 4P9FA 1L3PA 3S29A 1H6GA 1TWGA 4DVZA 4YL3A 3JRMO 4CS8A 4YK5A 2YL7A 2D4UA 2HJMA 1J8MF 3LEOA 3NMIA 4I1OB 3VYWA 2M64A 1U6HA 2J9VA 2YHSA 4HE8D 3RKOF 4AE4A 4B6IA 4DRIB 4U5GA 4FX5A 2CGEA 3SXMA 4J30B 4O7GA 5JUAA 4JZAA 5L0CA 3FAJA 4LLEA 2NUTB 3PMRA 2R03A 2KW3C 3TJ5A 2H7OA 2NPUA 3EZIA 4Q5SF 3W2VA 3FMSA 4A4AA 2QNLA 2VCBA 1QSPA 2JX0A 1BR4A 2R05A 3DKAA 3IQ6A 4P9TA 1HE9A 4YN0B 2ZXRA 4BJ5C 3A9CA 3EH1A 3TK0A 3BEHA 4CSAA 2R7XA 3Q6NA 3C18A 2XLVA 5BQIA 3IQTA 3H2VA 4ONSA 3GORA 3ABMC 1YYJA 4K7BA 4LDKA 2CNWD 2PBEA 3R2PA 4C3BA 3ZG1A 1MMNA 2MWQA 3GODA 4M63A 3SXYA 3EQLF 1K05A 3C7JA 4DBRA 1RMVA 2A6EF 1PD1A 2J45A 2OJQA 3ZDLA 2J9BA 3LAYA 5L0DA 2IXPA 3EHMA 1M6TA 4DVYP 5L3QA 3F46A 3LLIA 256BA 3B0PA 1ZHWA 1D0ZA 3SEOA 4WJ0A 2EIKC 1RKCA 2ZXWC 4E18A 2OU6A 3ASOC 2R9RB 4PJLA 3QZCA 1TR2A 3W4YA 4WGZA 2NUTA 1W2WA 1JR8A 5L3VA 1FNTc 4PACA 2BC5A 2OQMA 3B29A 3LLKA 2GFHA 3DE9A 4O79A 3W2WA 1T6UA 1YJGA 3CSKA 4K0DA 3NRHA 1H9GA 2Y3GA 2CYDA 1K04A 2XXAA 2F22A 4RDAA 1WGWA 3T4RA 1TFOB 3U3FA 4MNDA 4OIOF 2FGYA 1DOVA 2GAQA 3LEVA 3L8IA 3RQFA 2V26A 3T6JA 2Q00A 3ABLC 3DD7A 4ER9A 1CPQA 3K66A 2R7SA 3ZTMA 3HLZA 3LJBA 4U5DE 1NZEA 4D4NA 4U5HA 5KYXA 3JZ0A 1JOGA 2QTVA 3U5SA 1HY5A 1OXKA 2D5RB 2R7OA 4HFFB 4QI0A 4E0HA 2OKUA 2P1AA 1ZYRF 3ZTZA 2KNHA 2L7AA 2WL8A 1YDIA 1HW2A 3FVYA 3TOMA 2C03A 1R5ID 3M4BA 1IZMA 2CW0F 1K40A 2IYLD 4JTDB 4MVZA 3SYNA 1VYIA 1YZAA 1Q0KA 1OCOC 5KYWA 1O5HA 3VM6A 4YJWA 1OKKD 1QKRA 1BZ4A 2PX0A 4O6NA 3RW0A 4ANJA 4R32A 1D0YA 2Q9AA 3B71A 2XL4A 4G78A 1ZU5A 3EHNA 3GM2A 4KC9A 1RJ9B 2YKZA 1D1AA 3L0IA 2Z15A 1NFOA 1EA8A 1PV3A 1YA9A 1D1BA 3GEEA 4W8KA 2J0XA 4JURI 4O6MA 2R7WA 2HMQA 4JTAB 2HKVA 2HZ8A 4FESA 4GQHA 2I15A 3MBGA 1APCA 1GQAA 2B0JA 4ZLDA 4DXWA 4E7SA 1BDJB 1ZVZA 3S28A 2B0HA 1E2XA 2LCHA 1YA7O 3OA1A 1VLSA 2L81A 3V5YA 3KYJA 1E86A 2G62A 5JSLA 4MTFA 3L8JA 4LDQA 1Z23A 3NYJA 3O6XA 1G8XA 2NUPB 3PCVA 4W8PA 4ULVA 1VLTA 3C8GB 1C02A 4MVMA 4O6YA 2W4MA 5JP7A 3UMKA 1EQ1A 3Q7LA 3AJMA 3ZSUA 3RVZA 2H7VC 3TOLA 1QPUA 2PP4A 1BR1A 5JS5A 1Q0DA 5DVWA 2R7RA 4OIQF 1NLXA 4XQ1A 1C03A 4JW1A 4G7ZF 3U9MA 2HMZA 2YVKA 4EHPA 2Y39A 3HKKA 3X2QC 2NSGA 2VCCA 3JRTA 4PJJA 4IWBA 5DLJA 1OXBA 3NMKA 2HSQA 4J7TA 2VASA 1CGOA 3C8ZA 5JVEA 2VH3A 2WVOA 5KYNA 1MMGA 3FOOA 3NG1A 4JE9A 2CDQA 3GM3A 3HNIA 1RJ9A 3LS0A 5E33A 4BEJA 5AC5A 2ICWG 1BBHA 1HMDA 3G4ZA 1N1CA 5F5FA 3I5QA 1WASA 1LI5A 2VC9A 3DE8A 2ZD9A 4IAQA 4U5BE 3DAFA 2J9WA 3DXJF 1LS1A 2YLDA 3E70C 3JYHA 1T6IA 3EG9B 1I4ZA 2A69F 5A6AA 2EIMC 2H7BA 3CZ6A 4N4WA 3RQEA 3IQCA 1T5OA 1H9TA 3SXZA 3MX3A 4DBQA 3CEXA 1LIHA 1WOLA 2DYSC 4CDAA 3ITFA 3SP1A 2LFFA 4JEAA 3UNGC 4U5EE 1A0BA 2EPMX 3T6GB 3V7OA 2NUPA 3T9OA 1Y4CA 1MNEA 5L0IA 2OEVA 3C8GA 1MMAA 2G3VA 3GANA 3U3BA 3U9JA 3L34A 1WWPA 4CS9C 1FR0A 4MS2A 1T01A 4JRZA 3ZWIA 3KKBA 4PR9A 5F5HA 4D4XA 5B3IA 3K6BA 4Z9HA 2Q3TA 3UR3C 1H7IA 2LP4A 2TMVP 2XS8A 4N6CA 4NTBA 2XLMA 1KTMA 1VB5A 4LDRA 1WATA 1VK5A 3IPMO 3RFYA 4CX9A 3KMIA 2RSEB 2RD9A 4GEHA 1T6QA 3TJ6A 4XPYA 1ZW2A 2KYHA 4OIRF 1Q0MA 2IXOA 4H54A 4MVSA 3GM1A 1V54C 4MVRA 4BJ6C 4KBLA 5B1BC 3K33A 3K7DA 4I3MA 4DRJB 4YT2A 3DAGA 1JMWA 1LE4A 3IQ5A 3QVZA 5DS4A 3EFOB 1AEPA 1SMYF 1MMDA 1QQ3A 2IM8A 1OW6A 2J7PA 3O55A 3TULA 3VRCA 3GWLA 1LS4A 3JSEO 3K1HA 4EBBA 3EG9A 3S90A 1Z3IX 2CCYA 3KH2A 2YLGA 1FMWA 3IHUA 4EUKB 2XLOA 3M15A 5CIVA 1OR2A 3C63A 4QDLA 1A41A 4JEBA 5E2QA 3ZC4A 3HNLA 4ZLCA 3QTHA 2A6HF 1AVOB 1HMOA 2FAPB 1E84A 1M57C 4IRUA 2XM4A 4L6RA 1PCXA 2WZLA 3FDQA 1LKXA 3FHDA 2MYSA 3UGOA 3JTLO 3A11A 1Z6AA 5DS5A 1GM5A 3LUTB 1E83A 3M1CB 3EPVA 1DOWA 3MLGA 3Q6MA 3B0UX 4CS8C 1OQCA 4LACB 2P61A 1BR2A 2QY9A 5T3WA 2QUPA 2ETSA 3HTKC 4FAPB 4NQFA 5A69A 5A6JA 1Z63A 4X0RA 3E9VA 4EBJA 2EPKX 3UMIA 4CS7A 1M2OA 4G7HF 1ZHXA 4NTFA 2AU5A 4XWJA 1ORYA 4JJGA 3PDMP 3AG2C 1CGME 2NG1A 3OWTA 2YQYA 4XEKA 1Q0GA 5JRAA 2QE9A 3DM9B 4PFOA 3U2LA 1IW7F 4JJFA 4IB4A 4MVQA 4IARA 5E3AA 3NKEA 3WG7C 4OD5A 3FAPB 3FOPA 3EFOA 1Y6DA 1TWAA 2OJED 3LS1A 4U5FE 5A6BA 4CSAC 1R4TA 4JIOA 4NC3A 2IXMA 4YWQA 2R7QA 5HV9A 2HUJA 3K1IA 1JPNA 2XL6A 4BEMJ 2C04A 2HS5A 5TJ5E 4YT8A 3C62A 4KI2A 4J7YA 4I44A 4Q7CA 3RYLA 1QZXA 3S27A 2W45A 3W8IA 3KPHA 1A7DA 3U8VA 5K0IA 2KK1A 2XS1A 5T3TA 3DZAA 3ZVRA 2XLEA 1U89A 4U9EA 4BJTA 1O87A 4I1MA 3JYYA 5L0FA 2L6HA 3M4CA 2W4BA 2AWYA 1E85A 4MVOA 1JPJA 1CGNA 2PF4E 2WVNA 4BJ5A 1ZW3A 4KNWA 4AL0A 2IXNA 3WHNA 2P7VA 4CDYA 2PNOA 2KSFA 4EKWA 5D92A 3X1OA 4AL1A 3QMKA 3DJUB 4AE4B 1NSGB 2V3CC 4LERA 1OW8A 2XSEA 5EGYA 1GS9A 4GYTA 3AGTA 1M2VB 3QVYA 3HJCA 1CPRA 2HV6A 5GPGB 3AG4C 3O10A 1ORJA 2DGJA 1RXQA 1M56C 1SF8A 1YAUO 3RF3A 3HNKA 4H4KC 2E87A 3JT1A 5E3CA 3S9OA 2I8BA 2J8WA 2O9XA 3B9QA 4KNVA 1JRAA 5COFA 1VOMA 1Z5ZA 1ZHZA 1FTSA 3WODF 1NU9C 4MVUA 3NYMA 5HSWA 2YL0A 1VMAA 1JAFA 1I5NA 3AQBA 4MQ9F 1S7ZA 1NBBA 4FWVA 5COMA 5DS6A 2EIJC 3WAQA 5EK0A 4UDVA 3HNJA 2HFIA 3LNRA 1XZPA 3BRJA 4E17A 1C17M 2GWWA 3MYFA 2OEXA 1S05A 1A7EA 2AVKA 3DMDA 5CI8A 4XLPF 4LLCA 1FAPB 2M4EA 2XLDA 2WVQA 3CAXA 3DI5A 4PJNA 2EPOA 3GEIA 4YT5A 3B0VC 2PX3A 5KYYB 1D0XA 2XL8A 3ZQYA 2J7PD 2X51A 2DYRC 2A1DD 3POVA 3OEOA 2UUHA 4F4BA 3AOUA 3K1IC 4PK4A 2EILC 4MTOA 1J8YF 4IAOA 1NFNA 1M2VA 3GEHA 4G0HA 4PFPA 2UUIA 1GGQA 2OOCA 2Y3DA 1G4US 2KJGA 5D91A 3DM5A 2LIGA 2HSBA 3MFNA 2R7UA 1EI7A 3EGXB 3ECSA 4DRHB 1QVXA 5JLIA 4MTGA 5JT4A 2YEVA 1TWHA 2LK4A 2J0WA 2L9JA 2Y69C 5KYUB 2KGOA 2QLAA 4HFKB 3UGPA 1YVIA 4CIHA 2XXAB 3EGDB 1LPEA 4CJGA 2XLWA 3FXHA 5L0HA 2HJ3A 4YL0A 1XWJA 3QW0A 3AGUA 4XPXA 4OINF 3ZIBA 5B3SC 3PHF2 2R7TA 4OD4A 4U9DA 2AP3A 3JSZA 2JD3A 2Q4FA 5AC4A 5KYXB 1TKNA 3SZRA 4Q4ZF 1FFHA 1YLMA 5BUOA 4XLNF 1TFKB 2ASRA 1OCCC 2AWCA 3G50A 3I4UA 4JKVA 4N6HA 2YL1A 2WZFA 3T6BA 4NTAA 1RCPA 1V4AA 5IY5C 4N06A 4OIPF 1ZHTA 3RQGA 1O3UA 3RVYA 2JPUA 4RD9A 1YYXA 2LSEA 2WZGA 1QLEC 5KYYA 1SZIA 5A6BD 5KYWB 4JCZA 4XEFA 3EZHA 1Z7Qc 3RH3A 1RKEB 1F1MA 5T1DB 3S84A 1G5ZA 1TQGA 2Y3HA 4C3DA 4NCQA 3L1MA 5COGA 2ZXPA 3MYIA 2EPLX 2LD6A 3N24A 5AGFA 4IGGA 1EKYA 1OW7A 5L0GA 2CNWA 2IOQA 2XM0A 4AX2A 2W9YA 3QW1A 3AG1C 5BQGA 3US6A 5FZTA 1LE2A 1LM3B 3V5ZA 2DB4A 2A0UA 4HEAJ 4CIPA 3EGXA 3JCUQ 3KYIA 3TQOA 1U0BB 1LVKA 5FCLA 1T9KA 1OR3A 2DI3A 2A68F 3LNMB 3ZQVA 4EIYA 2YRFA 2J46A 2VB6A 4JCHA 5KYUA 3N2ZB 1OCRC 4XTKA 2L6GA 3SNHA 3EGDA 4BPMA 3I5PA 1ST6A 4JC7A 4JTCB 3H2UA 1ZZPA 2MHRA 3F47A 1V55C 1KU2A 2YZSA 3Q7GA 3W8HA 4C7OB 2Y3BA 3UMHA 1WTYA 3AG3C 4DJ9A 4QI2A 4NY3A 1A7VA 4AK9A 1MQVA 1PD0A 1YZCA 2FFHA 3NDBB 1HW1A 1MNDA 1UFBA 1D1CA 1AUEA 1UG7A 2KC3A 2WB7A 1OCZC 2ZPAA 3KL4A 3NYLA 3U8PA 1NG1A 4BG0A 3IEEA 4CDVA 4G7OF 2GDCA 2LQGA 4JVSA 1VYKA 2ZXOA 3DJNB 3G4XA 3S0XA 5BQHA 2A0BA 3R7CA 2LFDA 4EBKA 3J06A 4K1OA 2Q9CA 3LESA 3DWWA 3GWNA 3O39A 4Z9IA 1XZQA 1RKEA 1LI7A 4WABA 4YL1A 4YT4A 3ATPA 4MW3A 1HE1A 3CQZA 5B1AC 4CS9A 2R25A 5A6KA 1TWCA 4U5CE 4MW8A 2VCAA 3V5XA 4RBNA 3NKDA 4P6IC 4ULWA 4BJ1A 2OG2A 3EJNA 4CJOA 4E7ZA 1KNYA 1L7CA 2BL2A 3ABKC 4XEVA 5DQTA 2EINC 5DQZA 1FMVA 4XPWA 2KQ9A 4IJJA 4WGYA 3U0CA 2Q7RA 2YWAA 4CBEA 5L0JA 2H8AA 1YARO 2P6VA 1ORSC 3TD7A 2GA0A 3AQCA 2X0CA 3VF0A 4BJ6A 2XRHA 3N0TA 3C8GD 3NMJA 4Z9JA 2P0NA 1VTMP 5F28E 1OKKA 1ZU4A 2XLHA 1G4WR 2BE5F 2L6FA 5CI9A 4C7OA 1SR2A 1Q0FA 1FFTC 1NU7D 1ZHYA 3VAYA 4C3EA 5EHHA 2Q9BA 1V74B 4DOZA 3ASNC 1WN0A 2G3KA 2EPNA 2IBFA 4PJMA 1I4YA 2YLIA 3SXKA 2R02A 3RIPA 2J9UA 2R7VA 4A2NB 2NSFA 2YL3A 2OCCC 3M79A
chains in the Genus database with same CATH topology
2HV7A 3H65A 3EH2A 4J32B 2PFDA 4EWCA 3S29A 4DVZA 1TWGA 4CS8A 3VYWA 1J8MF 4I1OB 4HE8D 2J9VA 2YHSA 3RKOF 4AE4A 4B6IA 4U5GA 4FX5A 2CGEA 4J30B 4O7GA 4JZAA 3FAJA 4LLEA 2NUTB 3PMRA 2KW3C 2H7OA 3EZIA 4Q5SF 3W2VA 1BR4A 4YN0B 2ZXRA 4BJ5C 4CSAA 3EH1A 2R7XA 3Q6NA 3ABMC 4K7BA 2CNWD 4C3BA 3ZG1A 1MMNA 2MWQA 3GODA 4M63A 3EQLF 4DBRA 2A6EF 1PD1A 2J45A 3LAYA 2IXPA 3EHMA 4DVYP 5L3QA 3F46A 3LLIA 3B0PA 1ZHWA 1D0ZA 3SEOA 4WJ0A 2EIKC 2ZXWC 3ASOC 4PJLA 3QZCA 1TR2A 2NUTA 1W2WA 5L3VA 3LLKA 2GFHA 4O79A 3W2WA 3CSKA 4K0DA 3NRHA 2Y3GA 2XXAA 4RDAA 1WGWA 3T4RA 4OIOF 4MNDA 2FGYA 3LEVA 3T6JA 2V26A 3ABLC 3DD7A 3K66A 2R7SA 3HLZA 3LJBA 4U5DE 1NZEA 5KYXA 4U5HA 2QTVA 2D5RB 2R7OA 4HFFB 4QI0A 1ZYRF 2KNHA 2WL8A 3FVYA 2C03A 1IZMA 2CW0F 2IYLD 3SYNA 5KYWA 1VYIA 1OCOC 1O5HA 4YJWA 1OKKD 2PX0A 4O6NA 4ANJA 1D0YA 2Q9AA 2XL4A 1ZU5A 3EHNA 4KC9A 1RJ9B 3L0IA 1D1AA 2Z15A 4W8KA 1D1BA 2J0XA 4JURI 4O6MA 2R7WA 4FESA 2B0JA 4ZLDA 4E7SA 3S28A 3OA1A 2L81A 2G62A 1Z23A 3NYJA 3O6XA 1G8XA 2NUPB 4O6YA 2W4MA 3UMKA 3Q7LA 3ZSUA 2H7VC 2PP4A 1BR1A 4OIQF 5DVWA 2R7RA 4G7ZF 4JW1A 2Y39A 3X2QC 3JRTA 4PJJA 4IWBA 5DLJA 2VASA 2VH3A 2WVOA 5KYNA 1MMGA 3NG1A 2CDQA 3LS0A 5E33A 1RJ9A 4BEJA 1N1CA 5F5FA 3I5QA 4U5BE 3DAFA 2J9WA 3DXJF 1LS1A 3E70C 3JYHA 3KKBA 3EG9B 2A69F 2EIMC 2H7BA 3CZ6A 3MX3A 4DBQA 2DYSC 3ITFA 3SP1A 3UNGC 4U5EE 2NUPA 1MNEA 1MMAA 2G3VA 3GANA 3L34A 4CS9C 5F5HA 3K6BA 2Q3TA 3UR3C 1VK5A 3RFYA 3KMIA 4GEHA 4OIRF 2IXOA 4BJ6C 1V54C 4KBLA 5B1BC 3K33A 3K7DA 4I3MA 4YT2A 3DAGA 5DS4A 3EFOB 1SMYF 1MMDA 2J7PA 4EBBA 3K1HA 3EG9A 3KH2A 1Z3IX 1FMWA 4QDLA 4ZLCA 5E2QA 3ZC4A 2A6HF 1M57C 4IRUA 1PCXA 2WZLA 1LKXA 3FHDA 2MYSA 3UGOA 5DS5A 1Z6AA 3M1CB 3EPVA 3MLGA 3Q6MA 3B0UX 4CS8C 4LACB 2QY9A 1BR2A 5T3WA 3HTKC 1Z63A 4X0RA 3E9VA 3UMIA 4CS7A 1M2OA 4G7HF 1ZHXA 4XWJA 4JJGA 3AG2C 2NG1A 3OWTA 3DM9B 4PFOA 1IW7F 4JJFA 5E3AA 3NKEA 3WG7C 4OD5A 3EFOA 1TWAA 3LS1A 4U5FE 4CSAC 2IXMA 4YWQA 2R7QA 1JPNA 2C04A 4KI2A 4YT8A 4I44A 4Q7CA 3RYLA 1QZXA 3S27A 2W45A 3W8IA 5T3TA 3DZAA 3ZVRA 4BJTA 1O87A 4I1MA 2W4BA 1JPJA 2WVNA 2PF4E 4BJ5A 4KNWA 2IXNA 2P7VA 5D92A 3X1OA 3QMKA 3DJUB 4AE4B 2V3CC 4LERA 2XSEA 5EGYA 4GYTA 1M2VB 3HJCA 2HV6A 3AG4C 2DGJA 1M56C 1SF8A 2R7UA 4BJ1A 4H4KC 2E87A 3JT1A 5E3CA 2I8BA 2O9XA 3B9QA 4KNVA 1VOMA 1Z5ZA 1ZHZA 1FTSA 3WODF 1NU9C 3NYMA 5HSWA 4MQ9F 1VMAA 3AQBA 5DS6A 1S7ZA 4FWVA 2EIJC 3LNRA 3DMDA 5CI8A 4XLPF 4LLCA 2M4EA 2WVQA 4PJNA 4YT5A 3B0VC 2PX3A 5KYYB 1D0XA 3POVA 2J7PD 2X51A 2DYRC 2A1DD 3OEOA 4F4BA 3K1IC 4PK4A 2EILC 1J8YF 4IAOA 1M2VA 4G0HA 4PFPA 2Y3DA 2KJGA 5D91A 3DM5A 3EGXB 3ECSA 2YEVA 1TWHA 2J0WA 2L9JA 2Y69C 5KYUB 2KGOA 4HFKB 3UGPA 2XXAB 4CIHA 3EGDB 4OINF 3ZIBA 5B3SC 3PHF2 2R7TA 4OD4A 3JSZA 2JD3A 5KYXB 1TKNA 3SZRA 4Q4ZF 1FFHA 5BUOA 4XLNF 3V7OA 3T6BA 1OCCC 3I4UA 3FDQA 2WZFA 5IY5C 4N06A 4OIPF 1ZHTA 4RD9A 2LSEA 2WZGA 5KYWB 1QLEC 5KYYA 1SZIA 3EZHA 3RH3A 5T1DB 2Y3HA 4C3DA 2ZXPA 3N24A 2CNWA 2IOQA 4AX2A 2W9YA 3AG1C 4HEAJ 3EGXA 3JCUQ 1LVKA 5FCLA 2A68F 2J46A 2VB6A 4JCHA 5KYUA 3N2ZB 1OCRC 4XTKA 3SNHA 3EGDA 3I5PA 1ST6A 3F47A 1V55C 1KU2A 2YZSA 3Q7GA 3W8HA 4C7OB 2Y3BA 3UMHA 3AG3C 4QI2A 4NY3A 4AK9A 1PD0A 2FFHA 3NDBB 1MNDA 2WB7A 1D1CA 2ZPAA 4BG0A 1OCZC 3KL4A 3NYLA 1NG1A 3IEEA 4G7OF 4JVSA 1VYKA 2ZXOA 3DJNB 3S0XA 2Q9CA 3LESA 3O39A 4YT4A 3CQZA 5B1AC 4CS9A 1TWCA 4U5CE 4RBNA 3NKDA 4P6IC 4ULWA 2OG2A 3EJNA 4E7ZA 3ABKC 5DQTA 2EINC 5DQZA 1FMVA 2KQ9A 4IJJA 4CBEA 2P6VA 3TD7A 3AQCA 4BJ6A 2XRHA 3N0TA 1OKKA 1ZU4A 4C7OA 2BE5F 5CI9A 1FFTC 4C3EA 1NU7D 1ZHYA 3VAYA 5EHHA 2Q9BA 4DOZA 3ASNC 2G3KA 4PJMA 3RIPA 2J9UA 2R7VA 4A2NB 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXN A;  2HV7 A;  2IXM A;  2HV6 A;  2IXO A;  2G62 A;  4NY3 A;  4LAC B;  2IXP A; 
#chains in the Genus database with same CATH topology
 1B68 A;  1SYQ A;  2HV7 A;  3H65 A;  4E0I A;  3U2M A;  3EH2 A;  4J32 B;  2PFD A;  4EWC A;  4P9F A;  1L3P A;  3S29 A;  1H6G A;  1TWG A;  4DVZ A;  4YL3 A;  3JRM O;  4CS8 A;  4YK5 A;  2YL7 A;  2D4U A;  2HJM A;  1J8M F;  3LEO A;  3NMI A;  4I1O B;  3VYW A;  2M64 A;  1U6H A;  2J9V A;  2YHS A;  4HE8 D;  3RKO F;  4AE4 A;  4B6I A;  4DRI B;  4U5G A;  4FX5 A;  2CGE A;  3SXM A;  4J30 B;  4O7G A;  5JUA A;  4JZA A;  5L0C A;  3FAJ A;  4LLE A;  2NUT B;  3PMR A;  2R03 A;  2KW3 C;  3TJ5 A;  2H7O A;  2NPU A;  3EZI A;  4Q5S F;  3W2V A;  3FMS A;  4A4A A;  2QNL A;  2VCB A;  1QSP A;  2JX0 A;  1BR4 A;  2R05 A;  3DKA A;  3IQ6 A;  4P9T A;  1HE9 A;  4YN0 B;  2ZXR A;  4BJ5 C;  3A9C A;  3EH1 A;  3TK0 A;  3BEH A;  4CSA A;  2R7X A;  3Q6N A;  3C18 A;  2XLV A;  5BQI A;  3IQT A;  3H2V A;  4ONS A;  3GOR A;  3ABM C;  1YYJ A;  4K7B A;  4LDK A;  2CNW D;  2PBE A;  3R2P A;  4C3B A;  3ZG1 A;  1MMN A;  2MWQ A;  3GOD A;  4M63 A;  3SXY A;  3EQL F;  1K05 A;  3C7J A;  4DBR A;  1RMV A;  2A6E F;  1PD1 A;  2J45 A;  2OJQ A;  3ZDL A;  2J9B A;  3LAY A;  5L0D A;  2IXP A;  3EHM A;  1M6T A;  4DVY P;  5L3Q A;  3F46 A;  3LLI A;  256B A;  3B0P A;  1ZHW A;  1D0Z A;  3SEO A;  4WJ0 A;  2EIK C;  1RKC A;  2ZXW C;  4E18 A;  2OU6 A;  3ASO C;  2R9R B;  4PJL A;  3QZC A;  1TR2 A;  3W4Y A;  4WGZ A;  2NUT A;  1W2W A;  1JR8 A;  5L3V A;  1FNT c;  4PAC A;  2BC5 A;  2OQM A;  3B29 A;  3LLK A;  2GFH A;  3DE9 A;  4O79 A;  3W2W A;  1T6U A;  1YJG A;  3CSK A;  4K0D A;  3NRH A;  1H9G A;  2Y3G A;  2CYD A;  1K04 A;  2XXA A;  2F22 A;  4RDA A;  1WGW A;  3T4R A;  1TFO B;  3U3F A;  4MND A;  4OIO F;  2FGY A;  1DOV A;  2GAQ A;  3LEV A;  3L8I A;  3RQF A;  2V26 A;  3T6J A;  2Q00 A;  3ABL C;  3DD7 A;  4ER9 A;  1CPQ A;  3K66 A;  2R7S A;  3ZTM A;  3HLZ A;  3LJB A;  4U5D E;  1NZE A;  4D4N A;  4U5H A;  5KYX A;  3JZ0 A;  1JOG A;  2QTV A;  3U5S A;  1HY5 A;  1OXK A;  2D5R B;  2R7O A;  4HFF B;  4QI0 A;  4E0H A;  2OKU A;  2P1A A;  1ZYR F;  3ZTZ A;  2KNH A;  2L7A A;  2WL8 A;  1YDI A;  1HW2 A;  3FVY A;  3TOM A;  2C03 A;  1R5I D;  3M4B A;  1IZM A;  2CW0 F;  1K40 A;  2IYL D;  4JTD B;  4MVZ A;  3SYN A;  1VYI A;  1YZA A;  1Q0K A;  1OCO C;  5KYW A;  1O5H A;  3VM6 A;  4YJW A;  1OKK D;  1QKR A;  1BZ4 A;  2PX0 A;  4O6N A;  3RW0 A;  4ANJ A;  4R32 A;  1D0Y A;  2Q9A A;  3B71 A;  2XL4 A;  4G78 A;  1ZU5 A;  3EHN A;  3GM2 A;  4KC9 A;  1RJ9 B;  2YKZ A;  1D1A A;  3L0I A;  2Z15 A;  1NFO A;  1EA8 A;  1PV3 A;  1YA9 A;  1D1B A;  3GEE A;  4W8K A;  2J0X A;  4JUR I;  4O6M A;  2R7W A;  2HMQ A;  4JTA B;  2HKV A;  2HZ8 A;  4FES A;  4GQH A;  2I15 A;  3MBG A;  1APC A;  1GQA A;  2B0J A;  4ZLD A;  4DXW A;  4E7S A;  1BDJ B;  1ZVZ A;  3S28 A;  2B0H A;  1E2X A;  2LCH A;  1YA7 O;  3OA1 A;  1VLS A;  2L81 A;  3V5Y A;  3KYJ A;  1E86 A;  2G62 A;  5JSL A;  4MTF A;  3L8J A;  4LDQ A;  1Z23 A;  3NYJ A;  3O6X A;  1G8X A;  2NUP B;  3PCV A;  4W8P A;  4ULV A;  1VLT A;  3C8G B;  1C02 A;  4MVM A;  4O6Y A;  2W4M A;  5JP7 A;  3UMK A;  1EQ1 A;  3Q7L A;  3AJM A;  3ZSU A;  3RVZ A;  2H7V C;  3TOL A;  1QPU A;  2PP4 A;  1BR1 A;  5JS5 A;  1Q0D A;  5DVW A;  2R7R A;  4OIQ F;  1NLX A;  4XQ1 A;  1C03 A;  4JW1 A;  4G7Z F;  3U9M A;  2HMZ A;  2YVK A;  4EHP A;  2Y39 A;  3HKK A;  3X2Q C;  2NSG A;  2VCC A;  3JRT A;  4PJJ A;  4IWB A;  5DLJ A;  1OXB A;  3NMK A;  2HSQ A;  4J7T A;  2VAS A;  1CGO A;  3C8Z A;  5JVE A;  2VH3 A;  2WVO A;  5KYN A;  1MMG A;  3FOO A;  3NG1 A;  4JE9 A;  2CDQ A;  3GM3 A;  3HNI A;  1RJ9 A;  3LS0 A;  5E33 A;  4BEJ A;  5AC5 A;  2ICW G;  1BBH A;  1HMD A;  3G4Z A;  1N1C A;  5F5F A;  3I5Q A;  1WAS A;  1LI5 A;  2VC9 A;  3DE8 A;  2ZD9 A;  4IAQ A;  4U5B E;  3DAF A;  2J9W A;  3DXJ F;  1LS1 A;  2YLD A;  3E70 C;  3JYH A;  1T6I A;  3EG9 B;  1I4Z A;  2A69 F;  5A6A A;  2EIM C;  2H7B A;  3CZ6 A;  4N4W A;  3RQE A;  3IQC A;  1T5O A;  1H9T A;  3SXZ A;  3MX3 A;  4DBQ A;  3CEX A;  1LIH A;  1WOL A;  2DYS C;  4CDA A;  3ITF A;  3SP1 A;  2LFF A;  4JEA A;  3UNG C;  4U5E E;  1A0B A;  2EPM X;  3T6G B;  3V7O A;  2NUP A;  3T9O A;  1Y4C A;  1MNE A;  5L0I A;  2OEV A;  3C8G A;  1MMA A;  2G3V A;  3GAN A;  3U3B A;  3U9J A;  3L34 A;  1WWP A;  4CS9 C;  1FR0 A;  4MS2 A;  1T01 A;  4JRZ A;  3ZWI A;  3KKB A;  4PR9 A;  5F5H A;  4D4X A;  5B3I A;  3K6B A;  4Z9H A;  2Q3T A;  3UR3 C;  1H7I A;  2LP4 A;  2TMV P;  2XS8 A;  4N6C A;  4NTB A;  2XLM A;  1KTM A;  1VB5 A;  4LDR A;  1WAT A;  1VK5 A;  3IPM O;  3RFY A;  4CX9 A;  3KMI A;  2RSE B;  2RD9 A;  4GEH A;  1T6Q A;  3TJ6 A;  4XPY A;  1ZW2 A;  2KYH A;  4OIR F;  1Q0M A;  2IXO A;  4H54 A;  4MVS A;  3GM1 A;  1V54 C;  4MVR A;  4BJ6 C;  4KBL A;  5B1B C;  3K33 A;  3K7D A;  4I3M A;  4DRJ B;  4YT2 A;  3DAG A;  1JMW A;  1LE4 A;  3IQ5 A;  3QVZ A;  5DS4 A;  3EFO B;  1AEP A;  1SMY F;  1MMD A;  1QQ3 A;  2IM8 A;  1OW6 A;  2J7P A;  3O55 A;  3TUL A;  3VRC A;  3GWL A;  1LS4 A;  3JSE O;  3K1H A;  4EBB A;  3EG9 A;  3S90 A;  1Z3I X;  2CCY A;  3KH2 A;  2YLG A;  1FMW A;  3IHU A;  4EUK B;  2XLO A;  3M15 A;  5CIV A;  1OR2 A;  3C63 A;  4QDL A;  1A41 A;  4JEB A;  5E2Q A;  3ZC4 A;  3HNL A;  4ZLC A;  3QTH A;  2A6H F;  1AVO B;  1HMO A;  2FAP B;  1E84 A;  1M57 C;  4IRU A;  2XM4 A;  4L6R A;  1PCX A;  2WZL A;  3FDQ A;  1LKX A;  3FHD A;  2MYS A;  3UGO A;  3JTL O;  3A11 A;  1Z6A A;  5DS5 A;  1GM5 A;  3LUT B;  1E83 A;  3M1C B;  3EPV A;  1DOW A;  3MLG A;  3Q6M A;  3B0U X;  4CS8 C;  1OQC A;  4LAC B;  2P61 A;  1BR2 A;  2QY9 A;  5T3W A;  2QUP A;  2ETS A;  3HTK C;  4FAP B;  4NQF A;  5A69 A;  5A6J A;  1Z63 A;  4X0R A;  3E9V A;  4EBJ A;  2EPK X;  3UMI A;  4CS7 A;  1M2O A;  4G7H F;  1ZHX A;  4NTF A;  2AU5 A;  4XWJ A;  1ORY A;  4JJG A;  3PDM P;  3AG2 C;  1CGM E;  2NG1 A;  3OWT A;  2YQY A;  4XEK A;  1Q0G A;  5JRA A;  2QE9 A;  3DM9 B;  4PFO A;  3U2L A;  1IW7 F;  4JJF A;  4IB4 A;  4MVQ A;  4IAR A;  5E3A A;  3NKE A;  3WG7 C;  4OD5 A;  3FAP B;  3FOP A;  3EFO A;  1Y6D A;  1TWA A;  2OJE D;  3LS1 A;  4U5F E;  5A6B A;  4CSA C;  1R4T A;  4JIO A;  4NC3 A;  2IXM A;  4YWQ A;  2R7Q A;  5HV9 A;  2HUJ A;  3K1I A;  1JPN A;  2XL6 A;  4BEM J;  2C04 A;  2HS5 A;  5TJ5 E;  4YT8 A;  3C62 A;  4KI2 A;  4J7Y A;  4I44 A;  4Q7C A;  3RYL A;  1QZX A;  3S27 A;  2W45 A;  3W8I A;  3KPH A;  1A7D A;  3U8V A;  5K0I A;  2KK1 A;  2XS1 A;  5T3T A;  3DZA A;  3ZVR A;  2XLE A;  1U89 A;  4U9E A;  4BJT A;  1O87 A;  4I1M A;  3JYY A;  5L0F A;  2L6H A;  3M4C A;  2W4B A;  2AWY A;  1E85 A;  4MVO A;  1JPJ A;  1CGN A;  2PF4 E;  2WVN A;  4BJ5 A;  1ZW3 A;  4KNW A;  4AL0 A;  2IXN A;  3WHN A;  2P7V A;  4CDY A;  2PNO A;  2KSF A;  4EKW A;  5D92 A;  3X1O A;  4AL1 A;  3QMK A;  3DJU B;  4AE4 B;  1NSG B;  2V3C C;  4LER A;  1OW8 A;  2XSE A;  5EGY A;  1GS9 A;  4GYT A;  3AGT A;  1M2V B;  3QVY A;  3HJC A;  1CPR A;  2HV6 A;  5GPG B;  3AG4 C;  3O10 A;  1ORJ A;  2DGJ A;  1RXQ A;  1M56 C;  1SF8 A;  1YAU O;  3RF3 A;  3HNK A;  4H4K C;  2E87 A;  3JT1 A;  5E3C A;  3S9O A;  2I8B A;  2J8W A;  2O9X A;  3B9Q A;  4KNV A;  1JRA A;  5COF A;  1VOM A;  1Z5Z A;  1ZHZ A;  1FTS A;  3WOD F;  1NU9 C;  4MVU A;  3NYM A;  5HSW A;  2YL0 A;  1VMA A;  1JAF A;  1I5N A;  3AQB A;  4MQ9 F;  1S7Z A;  1NBB A;  4FWV A;  5COM A;  5DS6 A;  2EIJ C;  3WAQ A;  5EK0 A;  4UDV A;  3HNJ A;  2HFI A;  3LNR A;  1XZP A;  3BRJ A;  4E17 A;  1C17 M;  2GWW A;  3MYF A;  2OEX A;  1S05 A;  1A7E A;  2AVK A;  3DMD A;  5CI8 A;  4XLP F;  4LLC A;  1FAP B;  2M4E A;  2XLD A;  2WVQ A;  3CAX A;  3DI5 A;  4PJN A;  2EPO A;  3GEI A;  4YT5 A;  3B0V C;  2PX3 A;  5KYY B;  1D0X A;  2XL8 A;  3ZQY A;  2J7P D;  2X51 A;  2DYR C;  2A1D D;  3POV A;  3OEO A;  2UUH A;  4F4B A;  3AOU A;  3K1I C;  4PK4 A;  2EIL C;  4MTO A;  1J8Y F;  4IAO A;  1NFN A;  1M2V A;  3GEH A;  4G0H A;  4PFP A;  2UUI A;  1GGQ A;  2OOC A;  2Y3D A;  1G4U S;  2KJG A;  5D91 A;  3DM5 A;  2LIG A;  2HSB A;  3MFN A;  2R7U A;  1EI7 A;  3EGX B;  3ECS A;  4DRH B;  1QVX A;  5JLI A;  4MTG A;  5JT4 A;  2YEV A;  1TWH A;  2LK4 A;  2J0W A;  2L9J A;  2Y69 C;  5KYU B;  2KGO A;  2QLA A;  4HFK B;  3UGP A;  1YVI A;  4CIH A;  2XXA B;  3EGD B;  1LPE A;  4CJG A;  2XLW A;  3FXH A;  5L0H A;  2HJ3 A;  4YL0 A;  1XWJ A;  3QW0 A;  3AGU A;  4XPX A;  4OIN F;  3ZIB A;  5B3S C;  3PHF 2;  2R7T A;  4OD4 A;  4U9D A;  2AP3 A;  3JSZ A;  2JD3 A;  2Q4F A;  5AC4 A;  5KYX B;  1TKN A;  3SZR A;  4Q4Z F;  1FFH A;  1YLM A;  5BUO A;  4XLN F;  1TFK B;  2ASR A;  1OCC C;  2AWC A;  3G50 A;  3I4U A;  4JKV A;  4N6H A;  2YL1 A;  2WZF A;  3T6B A;  4NTA A;  1RCP A;  1V4A A;  5IY5 C;  4N06 A;  4OIP F;  1ZHT A;  3RQG A;  1O3U A;  3RVY A;  2JPU A;  4RD9 A;  1YYX A;  2LSE A;  2WZG A;  1QLE C;  5KYY A;  1SZI A;  5A6B D;  5KYW B;  4JCZ A;  4XEF A;  3EZH A;  1Z7Q c;  3RH3 A;  1RKE B;  1F1M A;  5T1D B;  3S84 A;  1G5Z A;  1TQG A;  2Y3H A;  4C3D A;  4NCQ A;  3L1M A;  5COG A;  2ZXP A;  3MYI A;  2EPL X;  2LD6 A;  3N24 A;  5AGF A;  4IGG A;  1EKY A;  1OW7 A;  5L0G A;  2CNW A;  2IOQ A;  2XM0 A;  4AX2 A;  2W9Y A;  3QW1 A;  3AG1 C;  5BQG A;  3US6 A;  5FZT A;  1LE2 A;  1LM3 B;  3V5Z A;  2DB4 A;  2A0U A;  4HEA J;  4CIP A;  3EGX A;  3JCU Q;  3KYI A;  3TQO A;  1U0B B;  1LVK A;  5FCL A;  1T9K A;  1OR3 A;  2DI3 A;  2A68 F;  3LNM B;  3ZQV A;  4EIY A;  2YRF A;  2J46 A;  2VB6 A;  4JCH A;  5KYU A;  3N2Z B;  1OCR C;  4XTK A;  2L6G A;  3SNH A;  3EGD A;  4BPM A;  3I5P A;  1ST6 A;  4JC7 A;  4JTC B;  3H2U A;  1ZZP A;  2MHR A;  3F47 A;  1V55 C;  1KU2 A;  2YZS A;  3Q7G A;  3W8H A;  4C7O B;  2Y3B A;  3UMH A;  1WTY A;  3AG3 C;  4DJ9 A;  4QI2 A;  4NY3 A;  1A7V A;  4AK9 A;  1MQV A;  1PD0 A;  1YZC A;  2FFH A;  3NDB B;  1HW1 A;  1MND A;  1UFB A;  1D1C A;  1AUE A;  1UG7 A;  2KC3 A;  2WB7 A;  1OCZ C;  2ZPA A;  3KL4 A;  3NYL A;  3U8P A;  1NG1 A;  4BG0 A;  3IEE A;  4CDV A;  4G7O F;  2GDC A;  2LQG A;  4JVS A;  1VYK A;  2ZXO A;  3DJN B;  3G4X A;  3S0X A;  5BQH A;  2A0B A;  3R7C A;  2LFD A;  4EBK A;  3J06 A;  4K1O A;  2Q9C A;  3LES A;  3DWW A;  3GWN A;  3O39 A;  4Z9I A;  1XZQ A;  1RKE A;  1LI7 A;  4WAB A;  4YL1 A;  4YT4 A;  3ATP A;  4MW3 A;  1HE1 A;  3CQZ A;  5B1A C;  4CS9 A;  2R25 A;  5A6K A;  1TWC A;  4U5C E;  4MW8 A;  2VCA A;  3V5X A;  4RBN A;  3NKD A;  4P6I C;  4ULW A;  4BJ1 A;  2OG2 A;  3EJN A;  4CJO A;  4E7Z A;  1KNY A;  1L7C A;  2BL2 A;  3ABK C;  4XEV A;  5DQT A;  2EIN C;  5DQZ A;  1FMV A;  4XPW A;  2KQ9 A;  4IJJ A;  4WGY A;  3U0C A;  2Q7R A;  2YWA A;  4CBE A;  5L0J A;  2H8A A;  1YAR O;  2P6V A;  1ORS C;  3TD7 A;  2GA0 A;  3AQC A;  2X0C A;  3VF0 A;  4BJ6 A;  2XRH A;  3N0T A;  3C8G D;  3NMJ A;  4Z9J A;  2P0N A;  1VTM P;  5F28 E;  1OKK A;  1ZU4 A;  2XLH A;  1G4W R;  2BE5 F;  2L6F A;  5CI9 A;  4C7O A;  1SR2 A;  1Q0F A;  1FFT C;  1NU7 D;  1ZHY A;  3VAY A;  4C3E A;  5EHH A;  2Q9B A;  1V74 B;  4DOZ A;  3ASN C;  1WN0 A;  2G3K A;  2EPN A;  2IBF A;  4PJM A;  1I4Y A;  2YLI A;  3SXK A;  2R02 A;  3RIP A;  2J9U A;  2R7V A;  4A2N B;  2NSF A;  2YL3 A;  2OCC C;  3M79 A; 
#chains in the Genus database with same CATH homology
 2HV7 A;  3H65 A;  3EH2 A;  4J32 B;  2PFD A;  4EWC A;  3S29 A;  4DVZ A;  1TWG A;  4CS8 A;  3VYW A;  1J8M F;  4I1O B;  4HE8 D;  2J9V A;  2YHS A;  3RKO F;  4AE4 A;  4B6I A;  4U5G A;  4FX5 A;  2CGE A;  4J30 B;  4O7G A;  4JZA A;  3FAJ A;  4LLE A;  2NUT B;  3PMR A;  2KW3 C;  2H7O A;  3EZI A;  4Q5S F;  3W2V A;  1BR4 A;  4YN0 B;  2ZXR A;  4BJ5 C;  4CSA A;  3EH1 A;  2R7X A;  3Q6N A;  3ABM C;  4K7B A;  2CNW D;  4C3B A;  3ZG1 A;  1MMN A;  2MWQ A;  3GOD A;  4M63 A;  3EQL F;  4DBR A;  2A6E F;  1PD1 A;  2J45 A;  3LAY A;  2IXP A;  3EHM A;  4DVY P;  5L3Q A;  3F46 A;  3LLI A;  3B0P A;  1ZHW A;  1D0Z A;  3SEO A;  4WJ0 A;  2EIK C;  2ZXW C;  3ASO C;  4PJL A;  3QZC A;  1TR2 A;  2NUT A;  1W2W A;  5L3V A;  3LLK A;  2GFH A;  4O79 A;  3W2W A;  3CSK A;  4K0D A;  3NRH A;  2Y3G A;  2XXA A;  4RDA A;  1WGW A;  3T4R A;  4OIO F;  4MND A;  2FGY A;  3LEV A;  3T6J A;  2V26 A;  3ABL C;  3DD7 A;  3K66 A;  2R7S A;  3HLZ A;  3LJB A;  4U5D E;  1NZE A;  5KYX A;  4U5H A;  2QTV A;  2D5R B;  2R7O A;  4HFF B;  4QI0 A;  1ZYR F;  2KNH A;  2WL8 A;  3FVY A;  2C03 A;  1IZM A;  2CW0 F;  2IYL D;  3SYN A;  5KYW A;  1VYI A;  1OCO C;  1O5H A;  4YJW A;  1OKK D;  2PX0 A;  4O6N A;  4ANJ A;  1D0Y A;  2Q9A A;  2XL4 A;  1ZU5 A;  3EHN A;  4KC9 A;  1RJ9 B;  3L0I A;  1D1A A;  2Z15 A;  4W8K A;  1D1B A;  2J0X A;  4JUR I;  4O6M A;  2R7W A;  4FES A;  2B0J A;  4ZLD A;  4E7S A;  3S28 A;  3OA1 A;  2L81 A;  2G62 A;  1Z23 A;  3NYJ A;  3O6X A;  1G8X A;  2NUP B;  4O6Y A;  2W4M A;  3UMK A;  3Q7L A;  3ZSU A;  2H7V C;  2PP4 A;  1BR1 A;  4OIQ F;  5DVW A;  2R7R A;  4G7Z F;  4JW1 A;  2Y39 A;  3X2Q C;  3JRT A;  4PJJ A;  4IWB A;  5DLJ A;  2VAS A;  2VH3 A;  2WVO A;  5KYN A;  1MMG A;  3NG1 A;  2CDQ A;  3LS0 A;  5E33 A;  1RJ9 A;  4BEJ A;  1N1C A;  5F5F A;  3I5Q A;  4U5B E;  3DAF A;  2J9W A;  3DXJ F;  1LS1 A;  3E70 C;  3JYH A;  3KKB A;  3EG9 B;  2A69 F;  2EIM C;  2H7B A;  3CZ6 A;  3MX3 A;  4DBQ A;  2DYS C;  3ITF A;  3SP1 A;  3UNG C;  4U5E E;  2NUP A;  1MNE A;  1MMA A;  2G3V A;  3GAN A;  3L34 A;  4CS9 C;  5F5H A;  3K6B A;  2Q3T A;  3UR3 C;  1VK5 A;  3RFY A;  3KMI A;  4GEH A;  4OIR F;  2IXO A;  4BJ6 C;  1V54 C;  4KBL A;  5B1B C;  3K33 A;  3K7D A;  4I3M A;  4YT2 A;  3DAG A;  5DS4 A;  3EFO B;  1SMY F;  1MMD A;  2J7P A;  4EBB A;  3K1H A;  3EG9 A;  3KH2 A;  1Z3I X;  1FMW A;  4QDL A;  4ZLC A;  5E2Q A;  3ZC4 A;  2A6H F;  1M57 C;  4IRU A;  1PCX A;  2WZL A;  1LKX A;  3FHD A;  2MYS A;  3UGO A;  5DS5 A;  1Z6A A;  3M1C B;  3EPV A;  3MLG A;  3Q6M A;  3B0U X;  4CS8 C;  4LAC B;  2QY9 A;  1BR2 A;  5T3W A;  3HTK C;  1Z63 A;  4X0R A;  3E9V A;  3UMI A;  4CS7 A;  1M2O A;  4G7H F;  1ZHX A;  4XWJ A;  4JJG A;  3AG2 C;  2NG1 A;  3OWT A;  3DM9 B;  4PFO A;  1IW7 F;  4JJF A;  5E3A A;  3NKE A;  3WG7 C;  4OD5 A;  3EFO A;  1TWA A;  3LS1 A;  4U5F E;  4CSA C;  2IXM A;  4YWQ A;  2R7Q A;  1JPN A;  2C04 A;  4KI2 A;  4YT8 A;  4I44 A;  4Q7C A;  3RYL A;  1QZX A;  3S27 A;  2W45 A;  3W8I A;  5T3T A;  3DZA A;  3ZVR A;  4BJT A;  1O87 A;  4I1M A;  2W4B A;  1JPJ A;  2WVN A;  2PF4 E;  4BJ5 A;  4KNW A;  2IXN A;  2P7V A;  5D92 A;  3X1O A;  3QMK A;  3DJU B;  4AE4 B;  2V3C C;  4LER A;  2XSE A;  5EGY A;  4GYT A;  1M2V B;  3HJC A;  2HV6 A;  3AG4 C;  2DGJ A;  1M56 C;  1SF8 A;  2R7U A;  4BJ1 A;  4H4K C;  2E87 A;  3JT1 A;  5E3C A;  2I8B A;  2O9X A;  3B9Q A;  4KNV A;  1VOM A;  1Z5Z A;  1ZHZ A;  1FTS A;  3WOD F;  1NU9 C;  3NYM A;  5HSW A;  4MQ9 F;  1VMA A;  3AQB A;  5DS6 A;  1S7Z A;  4FWV A;  2EIJ C;  3LNR A;  3DMD A;  5CI8 A;  4XLP F;  4LLC A;  2M4E A;  2WVQ A;  4PJN A;  4YT5 A;  3B0V C;  2PX3 A;  5KYY B;  1D0X A;  3POV A;  2J7P D;  2X51 A;  2DYR C;  2A1D D;  3OEO A;  4F4B A;  3K1I C;  4PK4 A;  2EIL C;  1J8Y F;  4IAO A;  1M2V A;  4G0H A;  4PFP A;  2Y3D A;  2KJG A;  5D91 A;  3DM5 A;  3EGX B;  3ECS A;  2YEV A;  1TWH A;  2J0W A;  2L9J A;  2Y69 C;  5KYU B;  2KGO A;  4HFK B;  3UGP A;  2XXA B;  4CIH A;  3EGD B;  4OIN F;  3ZIB A;  5B3S C;  3PHF 2;  2R7T A;  4OD4 A;  3JSZ A;  2JD3 A;  5KYX B;  1TKN A;  3SZR A;  4Q4Z F;  1FFH A;  5BUO A;  4XLN F;  3V7O A;  3T6B A;  1OCC C;  3I4U A;  3FDQ A;  2WZF A;  5IY5 C;  4N06 A;  4OIP F;  1ZHT A;  4RD9 A;  2LSE A;  2WZG A;  5KYW B;  1QLE C;  5KYY A;  1SZI A;  3EZH A;  3RH3 A;  5T1D B;  2Y3H A;  4C3D A;  2ZXP A;  3N24 A;  2CNW A;  2IOQ A;  4AX2 A;  2W9Y A;  3AG1 C;  4HEA J;  3EGX A;  3JCU Q;  1LVK A;  5FCL A;  2A68 F;  2J46 A;  2VB6 A;  4JCH A;  5KYU A;  3N2Z B;  1OCR C;  4XTK A;  3SNH A;  3EGD A;  3I5P A;  1ST6 A;  3F47 A;  1V55 C;  1KU2 A;  2YZS A;  3Q7G A;  3W8H A;  4C7O B;  2Y3B A;  3UMH A;  3AG3 C;  4QI2 A;  4NY3 A;  4AK9 A;  1PD0 A;  2FFH A;  3NDB B;  1MND A;  2WB7 A;  1D1C A;  2ZPA A;  4BG0 A;  1OCZ C;  3KL4 A;  3NYL A;  1NG1 A;  3IEE A;  4G7O F;  4JVS A;  1VYK A;  2ZXO A;  3DJN B;  3S0X A;  2Q9C A;  3LES A;  3O39 A;  4YT4 A;  3CQZ A;  5B1A C;  4CS9 A;  1TWC A;  4U5C E;  4RBN A;  3NKD A;  4P6I C;  4ULW A;  2OG2 A;  3EJN A;  4E7Z A;  3ABK C;  5DQT A;  2EIN C;  5DQZ A;  1FMV A;  2KQ9 A;  4IJJ A;  4CBE A;  2P6V A;  3TD7 A;  3AQC A;  4BJ6 A;  2XRH A;  3N0T A;  1OKK A;  1ZU4 A;  4C7O A;  2BE5 F;  5CI9 A;  1FFT C;  4C3E A;  1NU7 D;  1ZHY A;  3VAY A;  5EHH A;  2Q9B A;  4DOZ A;  3ASN C;  2G3K A;  4PJM A;  3RIP A;  2J9U A;  2R7V A;  4A2N B;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...