2HV6A

Crystal structure of the phosphotyrosyl phosphatase activator
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
301
Chain Sequence
NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein phosphatase 2A, regulatory subunit B
publication title Structure and mechanism of the phosphotyrosyl phosphatase activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2hv6A02
2IXNA 4NY3A 2HV7A 2IXMA 2HV6A 2G62A 2IXPA 4LACB 2IXOA
chains in the Genus database with same CATH superfamily
3EJNA 4DBQA 3OWTA 5DS6A 1VLSA 5HV9A 2CNWD 4WJ0A 3HNLA 2CDQA 3UMIA 1U89A 3HLZA 2L7AA 3DE9A 1ZHYA 4NY3A 4CJGA 3ZWIA 1M6TA 1MMGA 1HE1A 3AGTA 2A1DD 5L0IA 1OR3A 3T6JA 3ZTMA 4R32A 3Q6NA 3KKBA 1YA7O 2R7OA 3EGDB 3W8IA 5DLJA 4YK5A 4B6IA 1VTMP 3KPHA 2IXMA 1ST6A 1TKNA 3EFOB 3NKDA 4LLCA 2WL8A 3O10A 3CSKA 3U9MA 3ASOC 5L0GA 1ZHWA 2XM0A 4CS8A 3J06A 3V5ZA 1CGNA 4C3BA 3RH3A 3M4CA 3S0XA 4U5FE 4UDVA 5F5HA 3K33A 2XSEA 1EKYA 3U0CA 3DAGA 1EQ1A 2XLEA 1ZVZA 2Q7RA 3SXYA 1OR2A 3S28A 3IHUA 4PK4A 4G7OF 3BRJA 3DJNB 1Z63A 2L9JA 4OD4A 1ZHZA 3W2WA 2HZ8A 2IYLD 1ZU4A 3O55A 2QY9A 5KYWA 1A7VA 4ANJA 3AG3C 4U5GA 3S27A 2R7WA 4AE4B 5A6BD 1A41A 3U9JA 3B0PA 1JRAA 2P6VA 4AL1A 3LAYA 3U3FA 1DOWA 4U5BE 1I4YA 1QSPA 2ICWG 4NTAA 5DQTA 3T4RA 4E0HA 2CW0F 3V7OA 1S7ZA 2HS5A 2HV7A 3RVZA 4CX9A 2B0JA 2LFFA 4KC9A 2YHSA 4CIPA 3ZTZA 2ETSA 2GDCA 4JCZA 2XL8A 3JCUQ 2J9BA 2CCYA 3EGXA 4JZAA 4JRZA 3UNGC 3HKKA 1Q0MA 5L0CA 1BZ4A 5BUOA 4PFOA 3JTLO 5DS5A 2YL1A 3LS0A 4LLEA 1NFOA 2YLIA 1TWGA 2I8BA 1NU9C 1QVXA 5HSWA 1LS1A 2WVQA 1BDJB 5EGYA 4MTOA 4E17A 3RF3A 5IY5C 4OINF 4HFKB 3K66A 1PV3A 2NPUA 3NKEA 5B1AC 4D4XA 4LDQA 4IGGA 1HW1A 1H6GA 1A0BA 1JMWA 2C04A 3I5PA 4XLNF 3SXZA 1Y6DA 2J45A 3H2VA 5L0FA 2M64A 2IBFA 2RSEB 3KYJA 2HFIA 3K1IC 4YT4A 4C7OB 2HJMA 3NMJA 5GPGB 3PDMP 2YQYA 1WN0A 4BJ5C 5L0HA 2J0XA 3JRMO 1HY5A 2LCHA 3DJUB 1LI5A 4DRIB 1R5ID 4JTCB 3UR3C 4EBBA 4OIOF 2VB6A 3LEVA 2KC3A 3KL4A 3FOOA 4GEHA 4N4WA 4N6HA 1TFKB 2WZLA 3ABKC 3M1CB 4HE8D 1M56C 1YA9A 2QE9A 3E9VA 4I3MA 5A6JA 5KYYB 2YEVA 3EHMA 1Z23A 2EPMX 3KMIA 2AP3A 2HSBA 3HTKC 2H8AA 5KYXB 2OEVA 2XS1A 3L0IA 5AC5A 1RKCA 1T9KA 3O39A 4QDLA 4XPXA 4BJ1A 4E18A 1QQ3A 2Y39A 1M2VA 2NG1A 1RKEB 1KU2A 5D92A 2KNHA 1H9TA 4NC3A 1E86A 3S84A 1FFHA 1OCCC 2A68F 4PJJA 1JOGA 3FHDA 1LPEA 2YLDA 4M63A 4MVQA 3B29A 2R02A 2L6HA 1LVKA 1VOMA 2YKZA 2Q9CA 4JC7A 4JEAA 3GEIA 3DE8A 1T5OA 2VC9A 5T3TA 256BA 3DD7A 4K7BA 3F46A 2AWYA 1PCXA 3NYLA 4Q4ZF 4EKWA 2XL6A 4PR9A 1O87A 3I4UA 5T3WA 5KYNA 1JPJA 2LIGA 3RVYA 4DXWA 3TJ6A 3HJCA 2VH3A 2VCBA 4OIQF 1HE9A 1K04A 3ZG1A 4MQ9F 3WAQA 3G4XA 5JRAA 1BR4A 1ZHTA 3US6A 2XLMA 4EUKB 1DOVA 3G50A 4JTDB 4W8KA 1LKXA 1GQAA 2XLWA 1I5NA 2HV6A 4JIOA 5B3IA 4ER9A 3NRHA 4E7ZA 1E2XA 1FAPB 2PX0A 3QW1A 3GWNA 2VASA 4HEAJ 4KI2A 1RMVA 2H7OA 2Q3TA 3RQGA 3EQLF 3M15A 3AJMA 1NSGB 3UGOA 3FDQA 2DGJA 4IAOA 2Y69C 1SF8A 4E7SA 4YWQA 2EPKX 4U5EE 3M79A 4IARA 4G7HF 1SR2A 3AQCA 2R7QA 1B68A 2OU6A 2D4UA 4XEVA 4BJTA 3B9QA 2NUTA 4BEJA 1YYJA 3W4YA 2YLGA 5B3SC 3RYLA 1HMDA 1I4ZA 3GANA 2G62A 2UUHA 3MX3A 4NQFA 1VYKA 2LQGA 1JR8A 3C18A 3KH2A 1GS9A 3S9OA 5AC4A 3PHF2 3W8HA 5FCLA 3HNKA 1D0YA 2J9VA 4YL1A 4BEMJ 4O6YA 5JS5A 4IRUA 4BJ6A 4HFFB 3K7DA 3RIPA 4MVZA 2OJQA 3G4ZA 4L6RA 5F28E 1MMAA 5JT4A 4AK9A 1FNTc 1FTSA 1OW6A 5FZTA 4G78A 1ZZPA 2XXAB 2Q9BA 1YLMA 4P9TA 4U5CE 4DVZA 5A69A 1HW2A 3TJ5A 1LE4A 1QLEC 2ZXRA 5KYUA 4DJ9A 4WABA 1E84A 3V5YA 2W9YA 1OW7A 3B0UX 4LACB 4G7ZF 2KSFA 1T01A 3EG9A 3HNIA 3TULA 1FFTC 3ABLC 2WZGA 1M2VB 3SXKA 1TWCA 3NMIA 1ORYA 4XLPF 1RJ9B 3U5SA 4G0HA 1MNDA 4IB4A 3TD7A 1RXQA 3IEEA 5BQHA 1L7CA 1J8YF 2C03A 1C17M 2L6FA 4MTFA 2PFDA 4YL3A 3TOLA 4DVYP 3H2UA 3JYYA 3MLGA 2GAQA 4JKVA 3A9CA 2R7UA 3GORA 4D4NA 4PFPA 3N24A 2J0WA 1ORJA 1QPUA 2XLDA 3SNHA 2EIKC 4JVSA 4MVUA 3DMDA 4FWVA 1V74B 4QI0A 4IAQA 5L3QA 1CPRA 3C8GB 3TK0A 2R7XA 5CI9A 4WGZA 2R03A 1APCA 4JCHA 4K1OA 2KYHA 2V26A 1IW7F 4NCQA 3GODA 3CEXA 5JVEA 2NUPA 1MMNA 3LUTB 5F5FA 4MS2A 2YL7A 3ZQVA 2Q00A 3IQTA 3UMHA 1L3PA 1M2OA 2KK1A 5AGFA 2EPNA 4CDYA 4DBRA 3TQOA 4JEBA 2Q4FA 2OJED 3WODF 4OD5A 5TJ5E 3ZVRA 4E0IA 1R4TA 4CS7A 1Q0FA 3U2LA 3LLIA 1S05A 5COMA 2L81A 1OXBA 4YT2A 1OCOC 3Q6MA 1Z3IX 3EH2A 3AQBA 4PJLA 1MQVA 3JYHA 1OW8A 2M4EA 2MYSA 3QVYA 1K40A 2Q9AA 3JSZA 1E85A 3EGDA 1Z6AA 4MNDA 4U5HA 1KTMA 1Q0GA 2JPUA 3LESA 3EFOA 1D0ZA 3SYNA 2LK4A 1BR2A 1WATA 4MTGA 2X0CA 3IQ5A 1NZEA 3A11A 4MW3A 4CIHA 2GWWA 1XZQA 2JD3A 2XLOA 1T6QA 4JE9A 3EHNA 3AGUA 4CSAA 1SZIA 1A7EA 3VF0A 3QW0A 1D0XA 2LD6A 4CS9C 3K1IA 4J7TA 5L3VA 1YAUO 2HJ3A 1XWJA 2DI3A 2EILC 3FOPA 4BJ5A 1TR2A 2XLHA 3VAYA 1UG7A 5T1DB 4C3EA 4FESA 4RBNA 3PMRA 2PX3A 3DKAA 2P0NA 4J32B 3N2ZB 3L8JA 5B1BC 2IXPA 3GEHA 3LJBA 4AE4A 3EH1A 3SEOA 5KYWB 2EPOA 1H9GA 2QNLA 4P6IC 4OIRF 3R2PA 2ASRA 2YL3A 1G4WR 2Y3GA 4EWCA 1VMAA 4IWBA 2V3CC 2WVNA 3OEOA 2J7PD 1O3UA 4MVOA 1Y4CA 2IXNA 1VK5A 2YRFA 2LP4A 2AVKA 4FX5A 4U5DE 3RKOF 1ZW3A 3SZRA 2MHRA 5K0IA 2EIJC 3C7JA 2VCCA 1G5ZA 1G8XA 1C03A 3GEEA 1K05A 1WGWA 2OQMA 4BG0A 2LFDA 3FAPB 2R7VA 5L0DA 4XQ1A 1AEPA 2AWCA 3EGXB 4YN0B 4A2NB 2YWAA 1NLXA 4MVRA 3WHNA 1V54C 1Z5ZA 4JJGA 3LS1A 3T9OA 4XPWA 5JLIA 2PP4A 2HMZA 3IQCA 4KBLA 1SYQA 2Z15A 1ZHXA 2OKUA 1U0BB 2A6EF 2FAPB 2KQ9A 2PNOA 4Q7CA 3EPVA 1GM5A 1MNEA 4CS8C 3ATPA 2QTVA 3ASNC 3LEOA 1ZU5A 4C7OA 3POVA 4IJJA 3NYJA 3PCVA 3U2MA 1E83A 2BE5F 4H4KC 1M57C 2J8WA 3X1OA 4GYTA 4C3DA 2DB4A 1KNYA 2B0HA 3FMSA 3AG4C 3RQEA 3SXMA 1YZAA 2WVOA 4CDVA 3W2VA 3E70C 3C62A 1NBBA 4ZLCA 3IQ6A 3L1MA 2Y3BA 4PJNA 5KYYA 3GM1A 1BR1A 3MBGA 1NU7D 2KJGA 2E87A 3OA1A 5EK0A 1LS4A 4W8PA 4YL0A 2G3KA 5KYXA 3CAXA 4O79A 1LM3B 2WB7A 4J7YA 3T6GB 5D91A 4O6MA 4NTBA 1H7IA 3CQZA 1IZMA 2J9WA 2QLAA 4N06A 2BL2A 2R05A 2A0BA 4AX2A 1T6UA 3RFYA 5COFA 1RKEA 2O9XA 2P1AA 2R25A 3NYMA 4KNWA 1RCPA 1V55C 2R9RB 1W2WA 3I5QA 2BC5A 3X2QC 3ZDLA 3DWWA 1HMOA 3FXHA 2IOQA 2GFHA 4I1MA 2UUIA 3C8GD 4X0RA 3WG7C 2DYSC 4CBEA 3GM2A 3LLKA 1T6IA 4CDAA 5DQZA 5L0JA 1ZYRF 3M4BA 3EZIA 3QMKA 2YZSA 3L34A 2XRHA 3VRCA 5A6AA 3TOMA 4Q5SF 1VLTA 3GWLA 5COGA 2RD9A 2PBEA 3DAFA 1YARO 2IM8A 3JZ0A 2XLVA 2EIMC 3VYWA 3K6BA 4LDRA 3ZSUA 5DS4A 3FAJA 3H65A 3JSEO 2XL4A 3QZCA 4I1OB 1ORSC 1XZPA 4RD9A 5JP7A 1CGME 2PF4E 2NSGA 3SP1A 2H7VC 2ZXWC 3QVZA 1FMWA 2W4BA 2HKVA 3ECSA 3MYIA 4JW1A 4DRHB 1Q0KA 2WZFA 3B71A 2EINC 4MW8A 4AL0A 5JSLA 4DOZA 2FFHA 4EBJA 3CZ6A 2R7TA 2H7BA 2HSQA 2NSFA 4A4AA 3GM3A 2QUPA 2YL0A 1LIHA 4U9EA 4GQHA 1F1MA 3DI5A 3UGPA 4YJWA 1O5HA 1SMYF 2EPLX 1WTYA 2F22A 2J7PA 2LSEA 5CIVA 4ZLDA 1YJGA 3NDBB 1OKKA 2W45A 4J30B 2HMQA 4JURI 2AU5A 3ITFA 4QI2A 1MMDA 2ZXPA 4PACA 1D1AA 3S29A 4FAPB 2P61A 1D1CA 4O6NA 3T6BA 3JRTA 2CYDA 1CGOA 2OOCA 3O6XA 3RQFA 1AUEA 4XWJA 3R7CA 3ZC4A 3AOUA 4YT8A 2DYRC 3DZAA 3BEHA 3MYFA 5E3AA 3C8ZA 4CSAC 2FGYA 4P9FA 4F4BA 1QKRA 4ULWA 3U8VA 1WWPA 2OEXA 1OCRC 2MWQA 1UFBA 2P7VA 4LERA 3HNJA 2ZXOA 2XS8A 4CJOA 4EHPA 5A6KA 3B0VC 2NUTB 1JPNA 1LE2A 1PD0A 3Q7LA 2XM4A 2Y3HA 3N0TA 2G3VA 1U6HA 2W4MA 4XEFA 1LI7A 2GA0A 5E33A 4ULVA 4YT5A 5DVWA 2J46A 4EIYA 1N1CA 2Y3DA 2HUJA 2VCAA 2ZPAA 5E2QA 1YYXA 3DXJF 4KNVA 4O7GA 1FMVA 3K1HA 5E3CA 4OIPF 3LNRA 4XPYA 4PJMA 4JTAB 1TQGA 4XTKA 5BQIA 2A0UA 2XXAA 3L8IA 1TWHA 1FR0A 2CNWA 2JX0A 1NG1A 3AG2C 2IXOA 2KGOA 1Q0DA 4NTFA 4ONSA 1VB5A 1G4US 4K0DA 1D1BA 2R7SA 1J8MF 4Z9JA 5KYUB 1V4AA 3RW0A 2J9UA 3IPMO 1C02A 3AG1C 4XEKA 4Z9IA 1RJ9A 1JAFA 2TMVP 1Z7Qc 3EG9B 3NMKA 1OQCA 4MVMA 3VM6A 1CPQA 1OKKD 4DRJB 4JJFA 2D5RB 3LNMB 1NFNA 2L6GA 4LDKA 3UMKA 3Q7GA 1EI7A 1TFOB 1TWAA 2OCCC 4BPMA 4RDAA 3C63A 3MFNA 4EBKA 4U9DA 5EHHA 1YDIA 3DM5A 1OXKA 4CS9A 1GGQA 3QTHA 3DM9B 3ABMC 3V5XA 3C8GA 1BBHA 1VYIA 5JUAA 2R7RA 1YVIA 3NG1A 3S90A 2I15A 3EZHA 1A7DA 5CI8A 1WASA 2X51A 2KW3C 1WOLA 4WGYA 3U8PA 3ZIBA 3KYIA 4N6CA 3F47A 3FVYA 2YVKA 4Z9HA 2NUPB 3JT1A 3U3BA 5A6BA 1PD1A 1YZCA 2OG2A 4H54A 1EA8A 1OCZC 1QZXA 1ZW2A 2ZD9A 3ZQYA 2A69F 1AVOB 4MVSA 4I44A 4BJ6C 5BQGA 2CGEA 2A6HF
chains in the Genus database with same CATH topology
3EJNA 4DBQA 3OWTA 5DS6A 2CNWD 4WJ0A 2CDQA 3UMIA 3HLZA 1ZHYA 4NY3A 1MMGA 2A1DD 3T6JA 3Q6NA 3KKBA 2R7OA 3EGDB 3W8IA 5DLJA 4B6IA 2IXMA 1ST6A 1TKNA 3EFOB 3NKDA 4LLCA 2WL8A 3CSKA 3ASOC 1ZHWA 4CS8A 2CGEA 4C3BA 3RH3A 3S0XA 4U5FE 5F5HA 3K33A 2XSEA 3DAGA 3S28A 4PK4A 4G7OF 3DJNB 1Z63A 2L9JA 4OD4A 1ZHZA 3W2WA 2IYLD 1ZU4A 2QY9A 5KYWA 4ANJA 3AG3C 4U5GA 3S27A 2R7WA 4AE4B 3B0PA 2P6VA 3LAYA 4U5BE 5DQTA 3T4RA 2CW0F 3V7OA 1S7ZA 2HV7A 2B0JA 4KC9A 2YHSA 3JCUQ 3EGXA 4JZAA 3UNGC 5BUOA 4PFOA 5DS5A 3LS0A 4LLEA 1TWGA 2I8BA 1NU9C 5HSWA 1LS1A 2WVQA 5EGYA 5IY5C 4OINF 4HFKB 3K66A 3NKEA 5B1AC 2C04A 3I5PA 4XLNF 2J45A 4YT4A 4C7OB 3K1IC 4BJ5C 2J0XA 3DJUB 3UR3C 4EBBA 4OIOF 2VB6A 3LEVA 3KL4A 4GEHA 2WZLA 3ABKC 3M1CB 4HE8D 1M56C 4I3MA 5KYYB 3E9VA 2YEVA 3EHMA 1Z23A 3KMIA 3HTKC 5KYXB 3L0IA 4QDLA 3O39A 4BJ1A 2Y39A 1M2VA 2NG1A 1KU2A 5D92A 2KNHA 1FFHA 1OCCC 2A68F 4PJJA 3FHDA 4M63A 1LVKA 1VOMA 2Q9CA 5T3TA 3DD7A 4K7BA 3F46A 1PCXA 3NYLA 4Q4ZF 5T3WA 1O87A 3I4UA 5KYNA 1JPJA 3HJCA 2VH3A 4OIQF 3ZG1A 4MQ9F 1BR4A 1ZHTA 4W8KA 1LKXA 2HV6A 3NRHA 4E7ZA 2PX0A 2VASA 4HEAJ 4KI2A 2H7OA 2Q3TA 3EQLF 3UGOA 3FDQA 2DGJA 4IAOA 2Y69C 1SF8A 4E7SA 4YWQA 4U5EE 4G7HF 3AQCA 2R7QA 4BJTA 3B9QA 2NUTA 4BEJA 5B3SC 3RYLA 3GANA 2G62A 3MX3A 1VYKA 3KH2A 3PHF2 3W8HA 5FCLA 1D0YA 2J9VA 4O6YA 4IRUA 4BJ6A 4HFFB 3K7DA 3RIPA 1MMAA 4AK9A 1FTSA 2XXAB 2Q9BA 4DVZA 4U5CE 1QLEC 2ZXRA 5KYUA 2W9YA 3B0UX 4LACB 4G7ZF 3EG9A 1FFTC 3ABLC 2WZGA 1M2VB 1TWCA 4XLPF 1RJ9B 4G0HA 1MNDA 3TD7A 3IEEA 1J8YF 2C03A 2PFDA 4DVYP 3MLGA 2R7UA 4PFPA 3N24A 3SNHA 2EIKC 4JVSA 3DMDA 4FWVA 4QI0A 5L3QA 2R7XA 5CI9A 4JCHA 2V26A 1IW7F 3GODA 2NUPA 1MMNA 5F5FA 3UMHA 1M2OA 4DBRA 3WODF 4OD5A 3ZVRA 4CS7A 3LLIA 2L81A 4YT2A 1OCOC 3Q6MA 1Z3IX 3EH2A 3AQBA 4PJLA 3JYHA 2M4EA 2MYSA 2Q9AA 3JSZA 3EGDA 1Z6AA 4MNDA 4U5HA 3LESA 3EFOA 1D0ZA 3SYNA 1BR2A 1NZEA 4CIHA 2JD3A 3EHNA 4CSAA 1SZIA 1D0XA 4CS9C 5L3VA 4BJ5A 2EILC 1TR2A 3VAYA 5T1DB 4C3EA 4FESA 4RBNA 3PMRA 2PX3A 4J32B 3N2ZB 5B1BC 4AE4A 2IXPA 3LJBA 3EH1A 3SEOA 5KYWB 4OIRF 4P6IC 2Y3GA 4EWCA 1VMAA 4IWBA 2V3CC 2WVNA 3OEOA 2J7PD 2IXNA 1VK5A 3SZRA 4FX5A 4U5DE 3RKOF 2EIJC 1G8XA 2R7VA 4BG0A 1WGWA 3EGXB 4A2NB 4YN0B 1V54C 1Z5ZA 4JJGA 3LS1A 2PP4A 4KBLA 2Z15A 1ZHXA 2A6EF 2KQ9A 4Q7CA 3EPVA 1MNEA 4CS8C 2QTVA 3ASNC 1ZU5A 4C7OA 3POVA 4IJJA 3NYJA 2BE5F 4H4KC 1M57C 3X1OA 4C3DA 4GYTA 3AG4C 2WVOA 3W2VA 3E70C 4ZLCA 5KYYA 2Y3BA 4PJNA 1BR1A 1NU7D 2KJGA 2E87A 3OA1A 5KYXA 2G3KA 4O79A 2WB7A 5D91A 4O6MA 3CQZA 1IZMA 2J9WA 4N06A 4AX2A 3RFYA 2O9XA 3NYMA 4KNWA 1V55C 3I5QA 1W2WA 3X2QC 2IOQA 2GFHA 4I1MA 4X0RA 3WG7C 2DYSC 4CBEA 3LLKA 5DQZA 1ZYRF 3EZIA 3QMKA 2YZSA 3L34A 2XRHA 4Q5SF 3DAFA 2EIMC 3VYWA 3K6BA 3ZSUA 5DS4A 3FAJA 3H65A 2XL4A 3QZCA 4I1OB 4RD9A 2PF4E 3SP1A 2H7VC 2ZXWC 1FMWA 2W4BA 3ECSA 4JW1A 2WZFA 2EINC 4DOZA 2FFHA 3CZ6A 2R7TA 2H7BA 3UGPA 4YJWA 1O5HA 1SMYF 2J7PA 2LSEA 4ZLDA 3NDBB 1OKKA 2W45A 4J30B 4JURI 3ITFA 4QI2A 1MMDA 2ZXPA 1D1AA 3S29A 3T6BA 1D1CA 4O6NA 3JRTA 3O6XA 3ZC4A 4YT8A 4XWJA 2DYRC 3DZAA 5E3AA 4CSAC 2FGYA 4F4BA 4ULWA 1OCRC 2MWQA 2P7VA 4LERA 2ZXOA 3B0VC 2NUTB 1JPNA 1PD0A 3Q7LA 2Y3HA 3N0TA 2G3VA 2W4MA 5E33A 5DVWA 4YT5A 2J46A 1N1CA 2Y3DA 2ZPAA 5E2QA 3DXJF 4KNVA 4O7GA 1FMVA 3K1HA 5E3CA 4OIPF 3LNRA 4PJMA 4XTKA 2XXAA 1TWHA 2CNWA 1NG1A 3AG2C 2IXOA 2KGOA 4K0DA 1D1BA 2R7SA 1J8MF 5KYUB 2J9UA 3AG1C 1RJ9A 3EG9B 1OKKD 4JJFA 2D5RB 3UMKA 3Q7GA 1TWAA 2OCCC 4RDAA 5EHHA 3DM5A 4CS9A 3DM9B 3ABMC 1VYIA 2R7RA 3NG1A 3EZHA 5CI8A 2X51A 2KW3C 3ZIBA 3F47A 3FVYA 2NUPB 3JT1A 1PD1A 2OG2A 1OCZC 1QZXA 2A69F 4BJ6C 4I44A 2J0WA 2A6HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXN A;  4NY3 A;  2HV7 A;  2IXM A;  2HV6 A;  2G62 A;  2IXP A;  4LAC B;  2IXO A; 
#chains in the Genus database with same CATH topology
 3EJN A;  4DBQ A;  3OWT A;  5DS6 A;  1VLS A;  5HV9 A;  2CNW D;  4WJ0 A;  3HNL A;  2CDQ A;  3UMI A;  1U89 A;  3HLZ A;  2L7A A;  3DE9 A;  1ZHY A;  4NY3 A;  4CJG A;  3ZWI A;  1M6T A;  1MMG A;  1HE1 A;  3AGT A;  2A1D D;  5L0I A;  1OR3 A;  3T6J A;  3ZTM A;  4R32 A;  3Q6N A;  3KKB A;  1YA7 O;  2R7O A;  3EGD B;  3W8I A;  5DLJ A;  4YK5 A;  4B6I A;  1VTM P;  3KPH A;  2IXM A;  1ST6 A;  1TKN A;  3EFO B;  3NKD A;  4LLC A;  2WL8 A;  3O10 A;  3CSK A;  3U9M A;  3ASO C;  5L0G A;  1ZHW A;  2XM0 A;  4CS8 A;  3J06 A;  3V5Z A;  1CGN A;  4C3B A;  3RH3 A;  3M4C A;  3S0X A;  4U5F E;  4UDV A;  5F5H A;  3K33 A;  2XSE A;  1EKY A;  3U0C A;  3DAG A;  1EQ1 A;  2XLE A;  1ZVZ A;  2Q7R A;  3SXY A;  1OR2 A;  3S28 A;  3IHU A;  4PK4 A;  4G7O F;  3BRJ A;  3DJN B;  1Z63 A;  2L9J A;  4OD4 A;  1ZHZ A;  3W2W A;  2HZ8 A;  2IYL D;  1ZU4 A;  3O55 A;  2QY9 A;  5KYW A;  1A7V A;  4ANJ A;  3AG3 C;  4U5G A;  3S27 A;  2R7W A;  4AE4 B;  5A6B D;  1A41 A;  3U9J A;  3B0P A;  1JRA A;  2P6V A;  4AL1 A;  3LAY A;  3U3F A;  1DOW A;  4U5B E;  1I4Y A;  1QSP A;  2ICW G;  4NTA A;  5DQT A;  3T4R A;  4E0H A;  2CW0 F;  3V7O A;  1S7Z A;  2HS5 A;  2HV7 A;  3RVZ A;  4CX9 A;  2B0J A;  2LFF A;  4KC9 A;  2YHS A;  4CIP A;  3ZTZ A;  2ETS A;  2GDC A;  4JCZ A;  2XL8 A;  3JCU Q;  2J9B A;  2CCY A;  3EGX A;  4JZA A;  4JRZ A;  3UNG C;  3HKK A;  1Q0M A;  5L0C A;  1BZ4 A;  5BUO A;  4PFO A;  3JTL O;  5DS5 A;  2YL1 A;  3LS0 A;  4LLE A;  1NFO A;  2YLI A;  1TWG A;  2I8B A;  1NU9 C;  1QVX A;  5HSW A;  1LS1 A;  2WVQ A;  1BDJ B;  5EGY A;  4MTO A;  4E17 A;  3RF3 A;  5IY5 C;  4OIN F;  4HFK B;  3K66 A;  1PV3 A;  2NPU A;  3NKE A;  5B1A C;  4D4X A;  4LDQ A;  4IGG A;  1HW1 A;  1H6G A;  1A0B A;  1JMW A;  2C04 A;  3I5P A;  4XLN F;  3SXZ A;  1Y6D A;  2J45 A;  3H2V A;  5L0F A;  2M64 A;  2IBF A;  2RSE B;  3KYJ A;  2HFI A;  3K1I C;  4YT4 A;  4C7O B;  2HJM A;  3NMJ A;  5GPG B;  3PDM P;  2YQY A;  1WN0 A;  4BJ5 C;  5L0H A;  2J0X A;  3JRM O;  1HY5 A;  2LCH A;  3DJU B;  1LI5 A;  4DRI B;  1R5I D;  4JTC B;  3UR3 C;  4EBB A;  4OIO F;  2VB6 A;  3LEV A;  2KC3 A;  3KL4 A;  3FOO A;  4GEH A;  4N4W A;  4N6H A;  1TFK B;  2WZL A;  3ABK C;  3M1C B;  4HE8 D;  1M56 C;  1YA9 A;  2QE9 A;  3E9V A;  4I3M A;  5A6J A;  5KYY B;  2YEV A;  3EHM A;  1Z23 A;  2EPM X;  3KMI A;  2AP3 A;  2HSB A;  3HTK C;  2H8A A;  5KYX B;  2OEV A;  2XS1 A;  3L0I A;  5AC5 A;  1RKC A;  1T9K A;  3O39 A;  4QDL A;  4XPX A;  4BJ1 A;  4E18 A;  1QQ3 A;  2Y39 A;  1M2V A;  2NG1 A;  1RKE B;  1KU2 A;  5D92 A;  2KNH A;  1H9T A;  4NC3 A;  1E86 A;  3S84 A;  1FFH A;  1OCC C;  2A68 F;  4PJJ A;  1JOG A;  3FHD A;  1LPE A;  2YLD A;  4M63 A;  4MVQ A;  3B29 A;  2R02 A;  2L6H A;  1LVK A;  1VOM A;  2YKZ A;  2Q9C A;  4JC7 A;  4JEA A;  3GEI A;  3DE8 A;  1T5O A;  2VC9 A;  5T3T A;  256B A;  3DD7 A;  4K7B A;  3F46 A;  2AWY A;  1PCX A;  3NYL A;  4Q4Z F;  4EKW A;  2XL6 A;  4PR9 A;  1O87 A;  3I4U A;  5T3W A;  5KYN A;  1JPJ A;  2LIG A;  3RVY A;  4DXW A;  3TJ6 A;  3HJC A;  2VH3 A;  2VCB A;  4OIQ F;  1HE9 A;  1K04 A;  3ZG1 A;  4MQ9 F;  3WAQ A;  3G4X A;  5JRA A;  1BR4 A;  1ZHT A;  3US6 A;  2XLM A;  4EUK B;  1DOV A;  3G50 A;  4JTD B;  4W8K A;  1LKX A;  1GQA A;  2XLW A;  1I5N A;  2HV6 A;  4JIO A;  5B3I A;  4ER9 A;  3NRH A;  4E7Z A;  1E2X A;  1FAP B;  2PX0 A;  3QW1 A;  3GWN A;  2VAS A;  4HEA J;  4KI2 A;  1RMV A;  2H7O A;  2Q3T A;  3RQG A;  3EQL F;  3M15 A;  3AJM A;  1NSG B;  3UGO A;  3FDQ A;  2DGJ A;  4IAO A;  2Y69 C;  1SF8 A;  4E7S A;  4YWQ A;  2EPK X;  4U5E E;  3M79 A;  4IAR A;  4G7H F;  1SR2 A;  3AQC A;  2R7Q A;  1B68 A;  2OU6 A;  2D4U A;  4XEV A;  4BJT A;  3B9Q A;  2NUT A;  4BEJ A;  1YYJ A;  3W4Y A;  2YLG A;  5B3S C;  3RYL A;  1HMD A;  1I4Z A;  3GAN A;  2G62 A;  2UUH A;  3MX3 A;  4NQF A;  1VYK A;  2LQG A;  1JR8 A;  3C18 A;  3KH2 A;  1GS9 A;  3S9O A;  5AC4 A;  3PHF 2;  3W8H A;  5FCL A;  3HNK A;  1D0Y A;  2J9V A;  4YL1 A;  4BEM J;  4O6Y A;  5JS5 A;  4IRU A;  4BJ6 A;  4HFF B;  3K7D A;  3RIP A;  4MVZ A;  2OJQ A;  3G4Z A;  4L6R A;  5F28 E;  1MMA A;  5JT4 A;  4AK9 A;  1FNT c;  1FTS A;  1OW6 A;  5FZT A;  4G78 A;  1ZZP A;  2XXA B;  2Q9B A;  1YLM A;  4P9T A;  4U5C E;  4DVZ A;  5A69 A;  1HW2 A;  3TJ5 A;  1LE4 A;  1QLE C;  2ZXR A;  5KYU A;  4DJ9 A;  4WAB A;  1E84 A;  3V5Y A;  2W9Y A;  1OW7 A;  3B0U X;  4LAC B;  4G7Z F;  2KSF A;  1T01 A;  3EG9 A;  3HNI A;  3TUL A;  1FFT C;  3ABL C;  2WZG A;  1M2V B;  3SXK A;  1TWC A;  3NMI A;  1ORY A;  4XLP F;  1RJ9 B;  3U5S A;  4G0H A;  1MND A;  4IB4 A;  3TD7 A;  1RXQ A;  3IEE A;  5BQH A;  1L7C A;  1J8Y F;  2C03 A;  1C17 M;  2L6F A;  4MTF A;  2PFD A;  4YL3 A;  3TOL A;  4DVY P;  3H2U A;  3JYY A;  3MLG A;  2GAQ A;  4JKV A;  3A9C A;  2R7U A;  3GOR A;  4D4N A;  4PFP A;  3N24 A;  2J0W A;  1ORJ A;  1QPU A;  2XLD A;  3SNH A;  2EIK C;  4JVS A;  4MVU A;  3DMD A;  4FWV A;  1V74 B;  4QI0 A;  4IAQ A;  5L3Q A;  1CPR A;  3C8G B;  3TK0 A;  2R7X A;  5CI9 A;  4WGZ A;  2R03 A;  1APC A;  4JCH A;  4K1O A;  2KYH A;  2V26 A;  1IW7 F;  4NCQ A;  3GOD A;  3CEX A;  5JVE A;  2NUP A;  1MMN A;  3LUT B;  5F5F A;  4MS2 A;  2YL7 A;  3ZQV A;  2Q00 A;  3IQT A;  3UMH A;  1L3P A;  1M2O A;  2KK1 A;  5AGF A;  2EPN A;  4CDY A;  4DBR A;  3TQO A;  4JEB A;  2Q4F A;  2OJE D;  3WOD F;  4OD5 A;  5TJ5 E;  3ZVR A;  4E0I A;  1R4T A;  4CS7 A;  1Q0F A;  3U2L A;  3LLI A;  1S05 A;  5COM A;  2L81 A;  1OXB A;  4YT2 A;  1OCO C;  3Q6M A;  1Z3I X;  3EH2 A;  3AQB A;  4PJL A;  1MQV A;  3JYH A;  1OW8 A;  2M4E A;  2MYS A;  3QVY A;  1K40 A;  2Q9A A;  3JSZ A;  1E85 A;  3EGD A;  1Z6A A;  4MND A;  4U5H A;  1KTM A;  1Q0G A;  2JPU A;  3LES A;  3EFO A;  1D0Z A;  3SYN A;  2LK4 A;  1BR2 A;  1WAT A;  4MTG A;  2X0C A;  3IQ5 A;  1NZE A;  3A11 A;  4MW3 A;  4CIH A;  2GWW A;  1XZQ A;  2JD3 A;  2XLO A;  1T6Q A;  4JE9 A;  3EHN A;  3AGU A;  4CSA A;  1SZI A;  1A7E A;  3VF0 A;  3QW0 A;  1D0X A;  2LD6 A;  4CS9 C;  3K1I A;  4J7T A;  5L3V A;  1YAU O;  2HJ3 A;  1XWJ A;  2DI3 A;  2EIL C;  3FOP A;  4BJ5 A;  1TR2 A;  2XLH A;  3VAY A;  1UG7 A;  5T1D B;  4C3E A;  4FES A;  4RBN A;  3PMR A;  2PX3 A;  3DKA A;  2P0N A;  4J32 B;  3N2Z B;  3L8J A;  5B1B C;  2IXP A;  3GEH A;  3LJB A;  4AE4 A;  3EH1 A;  3SEO A;  5KYW B;  2EPO A;  1H9G A;  2QNL A;  4P6I C;  4OIR F;  3R2P A;  2ASR A;  2YL3 A;  1G4W R;  2Y3G A;  4EWC A;  1VMA A;  4IWB A;  2V3C C;  2WVN A;  3OEO A;  2J7P D;  1O3U A;  4MVO A;  1Y4C A;  2IXN A;  1VK5 A;  2YRF A;  2LP4 A;  2AVK A;  4FX5 A;  4U5D E;  3RKO F;  1ZW3 A;  3SZR A;  2MHR A;  5K0I A;  2EIJ C;  3C7J A;  2VCC A;  1G5Z A;  1G8X A;  1C03 A;  3GEE A;  1K05 A;  1WGW A;  2OQM A;  4BG0 A;  2LFD A;  3FAP B;  2R7V A;  5L0D A;  4XQ1 A;  1AEP A;  2AWC A;  3EGX B;  4YN0 B;  4A2N B;  2YWA A;  1NLX A;  4MVR A;  3WHN A;  1V54 C;  1Z5Z A;  4JJG A;  3LS1 A;  3T9O A;  4XPW A;  5JLI A;  2PP4 A;  2HMZ A;  3IQC A;  4KBL A;  1SYQ A;  2Z15 A;  1ZHX A;  2OKU A;  1U0B B;  2A6E F;  2FAP B;  2KQ9 A;  2PNO A;  4Q7C A;  3EPV A;  1GM5 A;  1MNE A;  4CS8 C;  3ATP A;  2QTV A;  3ASN C;  3LEO A;  1ZU5 A;  4C7O A;  3POV A;  4IJJ A;  3NYJ A;  3PCV A;  3U2M A;  1E83 A;  2BE5 F;  4H4K C;  1M57 C;  2J8W A;  3X1O A;  4GYT A;  4C3D A;  2DB4 A;  1KNY A;  2B0H A;  3FMS A;  3AG4 C;  3RQE A;  3SXM A;  1YZA A;  2WVO A;  4CDV A;  3W2V A;  3E70 C;  3C62 A;  1NBB A;  4ZLC A;  3IQ6 A;  3L1M A;  2Y3B A;  4PJN A;  5KYY A;  3GM1 A;  1BR1 A;  3MBG A;  1NU7 D;  2KJG A;  2E87 A;  3OA1 A;  5EK0 A;  1LS4 A;  4W8P A;  4YL0 A;  2G3K A;  5KYX A;  3CAX A;  4O79 A;  1LM3 B;  2WB7 A;  4J7Y A;  3T6G B;  5D91 A;  4O6M A;  4NTB A;  1H7I A;  3CQZ A;  1IZM A;  2J9W A;  2QLA A;  4N06 A;  2BL2 A;  2R05 A;  2A0B A;  4AX2 A;  1T6U A;  3RFY A;  5COF A;  1RKE A;  2O9X A;  2P1A A;  2R25 A;  3NYM A;  4KNW A;  1RCP A;  1V55 C;  2R9R B;  1W2W A;  3I5Q A;  2BC5 A;  3X2Q C;  3ZDL A;  3DWW A;  1HMO A;  3FXH A;  2IOQ A;  2GFH A;  4I1M A;  2UUI A;  3C8G D;  4X0R A;  3WG7 C;  2DYS C;  4CBE A;  3GM2 A;  3LLK A;  1T6I A;  4CDA A;  5DQZ A;  5L0J A;  1ZYR F;  3M4B A;  3EZI A;  3QMK A;  2YZS A;  3L34 A;  2XRH A;  3VRC A;  5A6A A;  3TOM A;  4Q5S F;  1VLT A;  3GWL A;  5COG A;  2RD9 A;  2PBE A;  3DAF A;  1YAR O;  2IM8 A;  3JZ0 A;  2XLV A;  2EIM C;  3VYW A;  3K6B A;  4LDR A;  3ZSU A;  5DS4 A;  3FAJ A;  3H65 A;  3JSE O;  2XL4 A;  3QZC A;  4I1O B;  1ORS C;  1XZP A;  4RD9 A;  5JP7 A;  1CGM E;  2PF4 E;  2NSG A;  3SP1 A;  2H7V C;  2ZXW C;  3QVZ A;  1FMW A;  2W4B A;  2HKV A;  3ECS A;  3MYI A;  4JW1 A;  4DRH B;  1Q0K A;  2WZF A;  3B71 A;  2EIN C;  4MW8 A;  4AL0 A;  5JSL A;  4DOZ A;  2FFH A;  4EBJ A;  3CZ6 A;  2R7T A;  2H7B A;  2HSQ A;  2NSF A;  4A4A A;  3GM3 A;  2QUP A;  2YL0 A;  1LIH A;  4U9E A;  4GQH A;  1F1M A;  3DI5 A;  3UGP A;  4YJW A;  1O5H A;  1SMY F;  2EPL X;  1WTY A;  2F22 A;  2J7P A;  2LSE A;  5CIV A;  4ZLD A;  1YJG A;  3NDB B;  1OKK A;  2W45 A;  4J30 B;  2HMQ A;  4JUR I;  2AU5 A;  3ITF A;  4QI2 A;  1MMD A;  2ZXP A;  4PAC A;  1D1A A;  3S29 A;  4FAP B;  2P61 A;  1D1C A;  4O6N A;  3T6B A;  3JRT A;  2CYD A;  1CGO A;  2OOC A;  3O6X A;  3RQF A;  1AUE A;  4XWJ A;  3R7C A;  3ZC4 A;  3AOU A;  4YT8 A;  2DYR C;  3DZA A;  3BEH A;  3MYF A;  5E3A A;  3C8Z A;  4CSA C;  2FGY A;  4P9F A;  4F4B A;  1QKR A;  4ULW A;  3U8V A;  1WWP A;  2OEX A;  1OCR C;  2MWQ A;  1UFB A;  2P7V A;  4LER A;  3HNJ A;  2ZXO A;  2XS8 A;  4CJO A;  4EHP A;  5A6K A;  3B0V C;  2NUT B;  1JPN A;  1LE2 A;  1PD0 A;  3Q7L A;  2XM4 A;  2Y3H A;  3N0T A;  2G3V A;  1U6H A;  2W4M A;  4XEF A;  1LI7 A;  2GA0 A;  5E33 A;  4ULV A;  4YT5 A;  5DVW A;  2J46 A;  4EIY A;  1N1C A;  2Y3D A;  2HUJ A;  2VCA A;  2ZPA A;  5E2Q A;  1YYX A;  3DXJ F;  4KNV A;  4O7G A;  1FMV A;  3K1H A;  5E3C A;  4OIP F;  3LNR A;  4XPY A;  4PJM A;  4JTA B;  1TQG A;  4XTK A;  5BQI A;  2A0U A;  2XXA A;  3L8I A;  1TWH A;  1FR0 A;  2CNW A;  2JX0 A;  1NG1 A;  3AG2 C;  2IXO A;  2KGO A;  1Q0D A;  4NTF A;  4ONS A;  1VB5 A;  1G4U S;  4K0D A;  1D1B A;  2R7S A;  1J8M F;  4Z9J A;  5KYU B;  1V4A A;  3RW0 A;  2J9U A;  3IPM O;  1C02 A;  3AG1 C;  4XEK A;  4Z9I A;  1RJ9 A;  1JAF A;  2TMV P;  1Z7Q c;  3EG9 B;  3NMK A;  1OQC A;  4MVM A;  3VM6 A;  1CPQ A;  1OKK D;  4DRJ B;  4JJF A;  2D5R B;  3LNM B;  1NFN A;  2L6G A;  4LDK A;  3UMK A;  3Q7G A;  1EI7 A;  1TFO B;  1TWA A;  2OCC C;  4BPM A;  4RDA A;  3C63 A;  3MFN A;  4EBK A;  4U9D A;  5EHH A;  1YDI A;  3DM5 A;  1OXK A;  4CS9 A;  1GGQ A;  3QTH A;  3DM9 B;  3ABM C;  3V5X A;  3C8G A;  1BBH A;  1VYI A;  5JUA A;  2R7R A;  1YVI A;  3NG1 A;  3S90 A;  2I15 A;  3EZH A;  1A7D A;  5CI8 A;  1WAS A;  2X51 A;  2KW3 C;  1WOL A;  4WGY A;  3U8P A;  3ZIB A;  3KYI A;  4N6C A;  3F47 A;  3FVY A;  2YVK A;  4Z9H A;  2NUP B;  3JT1 A;  3U3B A;  5A6B A;  1PD1 A;  1YZC A;  2OG2 A;  4H54 A;  1EA8 A;  1OCZ C;  1QZX A;  1ZW2 A;  2ZD9 A;  3ZQY A;  2A69 F;  1AVO B;  4MVS A;  4I44 A;  4BJ6 C;  5BQG A;  2CGE A;  2A6H F; 
#chains in the Genus database with same CATH homology
 3EJN A;  4DBQ A;  3OWT A;  5DS6 A;  2CNW D;  4WJ0 A;  2CDQ A;  3UMI A;  3HLZ A;  1ZHY A;  4NY3 A;  1MMG A;  2A1D D;  3T6J A;  3Q6N A;  3KKB A;  2R7O A;  3EGD B;  3W8I A;  5DLJ A;  4B6I A;  2IXM A;  1ST6 A;  1TKN A;  3EFO B;  3NKD A;  4LLC A;  2WL8 A;  3CSK A;  3ASO C;  1ZHW A;  4CS8 A;  2CGE A;  4C3B A;  3RH3 A;  3S0X A;  4U5F E;  5F5H A;  3K33 A;  2XSE A;  3DAG A;  3S28 A;  4PK4 A;  4G7O F;  3DJN B;  1Z63 A;  2L9J A;  4OD4 A;  1ZHZ A;  3W2W A;  2IYL D;  1ZU4 A;  2QY9 A;  5KYW A;  4ANJ A;  3AG3 C;  4U5G A;  3S27 A;  2R7W A;  4AE4 B;  3B0P A;  2P6V A;  3LAY A;  4U5B E;  5DQT A;  3T4R A;  2CW0 F;  3V7O A;  1S7Z A;  2HV7 A;  2B0J A;  4KC9 A;  2YHS A;  3JCU Q;  3EGX A;  4JZA A;  3UNG C;  5BUO A;  4PFO A;  5DS5 A;  3LS0 A;  4LLE A;  1TWG A;  2I8B A;  1NU9 C;  5HSW A;  1LS1 A;  2WVQ A;  5EGY A;  5IY5 C;  4OIN F;  4HFK B;  3K66 A;  3NKE A;  5B1A C;  2C04 A;  3I5P A;  4XLN F;  2J45 A;  4YT4 A;  4C7O B;  3K1I C;  4BJ5 C;  2J0X A;  3DJU B;  3UR3 C;  4EBB A;  4OIO F;  2VB6 A;  3LEV A;  3KL4 A;  4GEH A;  2WZL A;  3ABK C;  3M1C B;  4HE8 D;  1M56 C;  4I3M A;  5KYY B;  3E9V A;  2YEV A;  3EHM A;  1Z23 A;  3KMI A;  3HTK C;  5KYX B;  3L0I A;  4QDL A;  3O39 A;  4BJ1 A;  2Y39 A;  1M2V A;  2NG1 A;  1KU2 A;  5D92 A;  2KNH A;  1FFH A;  1OCC C;  2A68 F;  4PJJ A;  3FHD A;  4M63 A;  1LVK A;  1VOM A;  2Q9C A;  5T3T A;  3DD7 A;  4K7B A;  3F46 A;  1PCX A;  3NYL A;  4Q4Z F;  5T3W A;  1O87 A;  3I4U A;  5KYN A;  1JPJ A;  3HJC A;  2VH3 A;  4OIQ F;  3ZG1 A;  4MQ9 F;  1BR4 A;  1ZHT A;  4W8K A;  1LKX A;  2HV6 A;  3NRH A;  4E7Z A;  2PX0 A;  2VAS A;  4HEA J;  4KI2 A;  2H7O A;  2Q3T A;  3EQL F;  3UGO A;  3FDQ A;  2DGJ A;  4IAO A;  2Y69 C;  1SF8 A;  4E7S A;  4YWQ A;  4U5E E;  4G7H F;  3AQC A;  2R7Q A;  4BJT A;  3B9Q A;  2NUT A;  4BEJ A;  5B3S C;  3RYL A;  3GAN A;  2G62 A;  3MX3 A;  1VYK A;  3KH2 A;  3PHF 2;  3W8H A;  5FCL A;  1D0Y A;  2J9V A;  4O6Y A;  4IRU A;  4BJ6 A;  4HFF B;  3K7D A;  3RIP A;  1MMA A;  4AK9 A;  1FTS A;  2XXA B;  2Q9B A;  4DVZ A;  4U5C E;  1QLE C;  2ZXR A;  5KYU A;  2W9Y A;  3B0U X;  4LAC B;  4G7Z F;  3EG9 A;  1FFT C;  3ABL C;  2WZG A;  1M2V B;  1TWC A;  4XLP F;  1RJ9 B;  4G0H A;  1MND A;  3TD7 A;  3IEE A;  1J8Y F;  2C03 A;  2PFD A;  4DVY P;  3MLG A;  2R7U A;  4PFP A;  3N24 A;  3SNH A;  2EIK C;  4JVS A;  3DMD A;  4FWV A;  4QI0 A;  5L3Q A;  2R7X A;  5CI9 A;  4JCH A;  2V26 A;  1IW7 F;  3GOD A;  2NUP A;  1MMN A;  5F5F A;  3UMH A;  1M2O A;  4DBR A;  3WOD F;  4OD5 A;  3ZVR A;  4CS7 A;  3LLI A;  2L81 A;  4YT2 A;  1OCO C;  3Q6M A;  1Z3I X;  3EH2 A;  3AQB A;  4PJL A;  3JYH A;  2M4E A;  2MYS A;  2Q9A A;  3JSZ A;  3EGD A;  1Z6A A;  4MND A;  4U5H A;  3LES A;  3EFO A;  1D0Z A;  3SYN A;  1BR2 A;  1NZE A;  4CIH A;  2JD3 A;  3EHN A;  4CSA A;  1SZI A;  1D0X A;  4CS9 C;  5L3V A;  4BJ5 A;  2EIL C;  1TR2 A;  3VAY A;  5T1D B;  4C3E A;  4FES A;  4RBN A;  3PMR A;  2PX3 A;  4J32 B;  3N2Z B;  5B1B C;  4AE4 A;  2IXP A;  3LJB A;  3EH1 A;  3SEO A;  5KYW B;  4OIR F;  4P6I C;  2Y3G A;  4EWC A;  1VMA A;  4IWB A;  2V3C C;  2WVN A;  3OEO A;  2J7P D;  2IXN A;  1VK5 A;  3SZR A;  4FX5 A;  4U5D E;  3RKO F;  2EIJ C;  1G8X A;  2R7V A;  4BG0 A;  1WGW A;  3EGX B;  4A2N B;  4YN0 B;  1V54 C;  1Z5Z A;  4JJG A;  3LS1 A;  2PP4 A;  4KBL A;  2Z15 A;  1ZHX A;  2A6E F;  2KQ9 A;  4Q7C A;  3EPV A;  1MNE A;  4CS8 C;  2QTV A;  3ASN C;  1ZU5 A;  4C7O A;  3POV A;  4IJJ A;  3NYJ A;  2BE5 F;  4H4K C;  1M57 C;  3X1O A;  4C3D A;  4GYT A;  3AG4 C;  2WVO A;  3W2V A;  3E70 C;  4ZLC A;  5KYY A;  2Y3B A;  4PJN A;  1BR1 A;  1NU7 D;  2KJG A;  2E87 A;  3OA1 A;  5KYX A;  2G3K A;  4O79 A;  2WB7 A;  5D91 A;  4O6M A;  3CQZ A;  1IZM A;  2J9W A;  4N06 A;  4AX2 A;  3RFY A;  2O9X A;  3NYM A;  4KNW A;  1V55 C;  3I5Q A;  1W2W A;  3X2Q C;  2IOQ A;  2GFH A;  4I1M A;  4X0R A;  3WG7 C;  2DYS C;  4CBE A;  3LLK A;  5DQZ A;  1ZYR F;  3EZI A;  3QMK A;  2YZS A;  3L34 A;  2XRH A;  4Q5S F;  3DAF A;  2EIM C;  3VYW A;  3K6B A;  3ZSU A;  5DS4 A;  3FAJ A;  3H65 A;  2XL4 A;  3QZC A;  4I1O B;  4RD9 A;  2PF4 E;  3SP1 A;  2H7V C;  2ZXW C;  1FMW A;  2W4B A;  3ECS A;  4JW1 A;  2WZF A;  2EIN C;  4DOZ A;  2FFH A;  3CZ6 A;  2R7T A;  2H7B A;  3UGP A;  4YJW A;  1O5H A;  1SMY F;  2J7P A;  2LSE A;  4ZLD A;  3NDB B;  1OKK A;  2W45 A;  4J30 B;  4JUR I;  3ITF A;  4QI2 A;  1MMD A;  2ZXP A;  1D1A A;  3S29 A;  3T6B A;  1D1C A;  4O6N A;  3JRT A;  3O6X A;  3ZC4 A;  4YT8 A;  4XWJ A;  2DYR C;  3DZA A;  5E3A A;  4CSA C;  2FGY A;  4F4B A;  4ULW A;  1OCR C;  2MWQ A;  2P7V A;  4LER A;  2ZXO A;  3B0V C;  2NUT B;  1JPN A;  1PD0 A;  3Q7L A;  2Y3H A;  3N0T A;  2G3V A;  2W4M A;  5E33 A;  5DVW A;  4YT5 A;  2J46 A;  1N1C A;  2Y3D A;  2ZPA A;  5E2Q A;  3DXJ F;  4KNV A;  4O7G A;  1FMV A;  3K1H A;  5E3C A;  4OIP F;  3LNR A;  4PJM A;  4XTK A;  2XXA A;  1TWH A;  2CNW A;  1NG1 A;  3AG2 C;  2IXO A;  2KGO A;  4K0D A;  1D1B A;  2R7S A;  1J8M F;  5KYU B;  2J9U A;  3AG1 C;  1RJ9 A;  3EG9 B;  1OKK D;  4JJF A;  2D5R B;  3UMK A;  3Q7G A;  1TWA A;  2OCC C;  4RDA A;  5EHH A;  3DM5 A;  4CS9 A;  3DM9 B;  3ABM C;  1VYI A;  2R7R A;  3NG1 A;  3EZH A;  5CI8 A;  2X51 A;  2KW3 C;  3ZIB A;  3F47 A;  3FVY A;  2NUP B;  3JT1 A;  1PD1 A;  2OG2 A;  1OCZ C;  1QZX A;  2A69 F;  4BJ6 C;  4I44 A;  2J0W A;  2A6H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...