2ZD9A

Structure of a bacterial cyclic-nucleotide regulated ion channel
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
APLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQLVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Mll3241 protein
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
total genus 59
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zd9A02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 2zd9A01
3SPGA 2HG5C 2OCCC 5EBLC 2NLJC 3RW0A 5KUMA 2QKSA 2WLKA 4ZBMA 2A79B 2AHYA 5B3SC 3SPJA 2R9RB 3OR6C 3LDCA 4GX2A 3IFXA 5CBFA 3ZRSA 1S5HC 1XL4A 3SPHA 3HPLC 3T1CA 3VOUA 2AHZA 3OR7C 4MVUA 1OCZC 3F7YC 4PA7A 1XL6A 4QE7A 3E8HA 3PJSK 2K1EA 3LDDA 4J9YB 4PDLA 3TCUA 3K04A 4LP8A 1P7BA 3AG2C 3JYCA 4GX0A 2Q68A 3ABKC 4XDKA 2HVJC 3AG4C 2HFEC 4I9WA 4WFEA 4BW5A 4R50A 3E89A 2ZD9A 2Q67A 4MVQA 2P7TC 4TWKA 3K0GA 3RBZA 3SYPA 3RVZA 2WLJA 1M56C 4MVOA 4P2ZA 4WFHA 4X89A 3GB7C 2X6BA 3SJQC 2Q69A 4P9OA 3E8BA 4LBEC 1K4DC 4WFFA 4UUJC 4X8AA 5KUKA 4J9ZB 2DWEC 2ITDC 2EILC 4R7CA 4RUFA 3FB8C 3ZJZA 2A0LA 1LNQA 2DYRC 2WLLA 3STZC 4MVSA 3ASNC 3IGAC 4XDLA 3EFFK 4G28B 4JTAB 4QE9A 4PA3A 2WLLB 2EIKC 2IH1C 4LCUC 2ITCC 5J9PC 3K06A 3RVYA 4MVMA 4PDMA 4MTGA 3R65A 5EBMC 1OCRC 2EIMC 2YEVA 3SYOA 4R6ZA 2DWDC 5EC1C 4PDVA 4F4LA 1OCOC 1R3KC 2EIJC 3FB5C 2JK5C 4XDJA 3K08A 4H37A 4MW3A 1G4YB 5CBGA 4PDRA 2BOCC 3LNMB 4KFMA 4P30A 3STLC 4MVZA 1KKDA 2ATKC 3AG3C 2WLMA 4PA6A 2ZXWC 2WLNA 3ASOC 4MTOA 1BL8A 1OCCC 3ABLC 4MVRA 3OUSA 4P9PA 5E1AC 3BEHA 4MW8A 3K03A 5EBWC 4MS2A 3KG2A 4PA9A 2W0FC 4JTDB 5IY5C 4H33A 4GX1A 3LDEA 3F5WC 2H8PC 3X2QC 4RUEA 3E83A 4G27B 3FB6C 3WG7C 3SYAA 4DXWA 4MTFA 1JVMA 3UM7A 1R3LC 1R3JC 3K0DA 5B1BC 1QLEC 3LUTB 4RAIA 5EC2C 1K4CC 4HYOA 5EK0A 2IH3C 1M57C 3E8GA 3SPIA 3T4DA 3AG1C 1J95A 3SYQA 5BZBA 2WLIA 3OGCC 4OXSA 2HJFC 1V55C 2A9HA 4CBCA 3T4ZA 2QTOA 5CBHA 3FB7C 2KB1A 1V54C 1ZWIC 4R8CA 4RO2A 3SPCA 2X6AA 4X88A 2Q6AA 2WLIB 3OUFA 1ORQC 2DYSC 4JTCB 4PA4A 5B1AC 3T2MA 3SYCA 2EINC 3E86A 3UKMA 4EKWA 3E8FA 3F7VC 2Y69C 2WLHA 2X6CA 4GX5A 4MSWC 4WFGA 4QNHB 3TETA 2BOBC 3ABMC 1R3IC 2HVKC 4HZ3A
chains in the Genus database with same CATH superfamily
1YJNV 4C3BA 1AJQA 3HNLA 1EQ1A 2A0BA 2HV7A 3CCJV 4CZZA 4I7ZB 3B40A 3D36C 3SPJA 4DR5O 2W9YA 3UMKA 4JI8O 2DYSB 5CBFA 3HNKA 4JEBA 3SDLA 5DS4A 3H2VA 1PV0A 3L75H 2Y69B 1BBHA 1BMFG 1K7DA 3D36A 3MHSC 3AK2A 5E79Z 4AK9A 3X2QB 5LOVA 2ZM6B 5CMUA 2OOCA 4GX0A 1V74B 1ZW3A 2LGQA 2R7OA 4YT2A 2Q68A 4DUYO 2ZR3A 5BUOA 2E75B 1BHAA 1VF5B 1TWHA 5LGTA 1OCZB 2OG2A 3RBZA 1EZVH 4NTAA 1IZMA 4EBBA 5CA0B 4Z2WA 2A3QA 3FAJA 1QBZA 4K8XA 1NBBA 1YA7O 5LA6A 4EB6A 4UUJC 3CXCU 1AJPA 5BXZA 1RPRA 3ABUA 4JI7B 3G6BA 4LWSA 5J2UA 2LO1A 2BSKA 3K9AA 2CNWD 4ONSA 4FVMA 3EFOB 2D2CB 4NC3A 4D4NA 5KHIA 2LFFA 3WFVA 5H9CA 1KYOF 4ASUG 4NXNO 1I4YA 3JCUQ 3UCSC 1TQGA 1AI7A 3SYNA 1SERA 2MYSA 3X1OA 5KYNA 1H6GA 1WA8A 4QPJA 4I55B 1L0NH 2YEVB 3G80A 1GRJA 1VQ6V 4RQEA 3STLC 4MVZA 2ATKC 2CH7A 2ADQB 4DR5B 1N0NA 1OCCC 4JI8B 5KYYB 4RWUA 4EFEA 3GM3A 1J8MF 4LDRA 5JUAA 2YZSA 2JEUA 2XNDG 3JAWA 5IWAO 1ORJA 3GM2A 4PFOA 1ZHTA 1CPRA 1RKCA 4DXWA 2QUPA 2Y39A 1H8EG 3OMNB 1R3JC 5K0IA 2G3KA 4UCRA 2DMXA 3B4SA 4JJFA 3A0RA 4WABA 4LERA 1WP7A 1YXBA 1YIJV 1A7EA 4R8CA 3A8TA 1JFFB 3EJNA 2DYSC 3QVYA 4NVPA 3A11A 3AOUA 2Y69C 2GTAA 3A0HZ 3Q4HB 2BC5A 1R3IC 1F51A 4DK0A 4A5UB 3AG3B 4UCSA 1VQ4V 5L3EA 2Y0IA 4DV5O 2G62A 4O4IB 1FJGO 5JLIA 3ZRSA 1Z23A 5KMGB 1BQ0A 2JEXA 1L7CA 1PNKA 1OCZC 4LF7O 2R9AA 3L9DA 1LVKA 5J2TB 1S5LZ 1LM3B 1H2GA 1Q90D 4QIWF 1N32O 2F95B 5CA0A 2VASA 1I4ZA 4DR1O 3BPZA 4JCHA 2Q69A 1V54B 1Q0FA 5E33A 1N36O 3CX5F 1HNXB 1XMQB 1CPYA 3EH2A 4LF9B 2QNLA 2QLAA 1B06A 2AXTZ 2LCHA 2GWWA 1XHXA 3S28A 2YSUB 3EFOA 3S0XA 4X64B 3TJ5A 2DYRC 2JVDA 2FB5A 4XDLA 2X7RB 1Z7Qc 1H9TA 2WLLB 4G7OF 1Q0MA 2KG7B 1D5AA 1K40A 4DR2O 4I55A 1ZVZA 3JALB 3C18A 2YEVA 4PACA 2EIJC 4I3MA 1R6TA 1KECA 1XNQO 4H37A 3C63A 1KD1W 4P30A 3QW0A 5KYYA 1S77D 2ZCEA 4OINF 3UO3A 4DV5B 4CX9A 3ZHSA 5DVWA 1BL8A 1VF6A 2R02A 3FKSG 3H1IH 2G3VA 5LP6C 2H7VC 1AVMA 2R9IA 1N34O 3NR7A 3B71A 4LF7B 3DWWA 1D0XA 3LDEA 1XREA 2F43G 2BTQB 1QVXA 3EZHA 2YIBD 3FB6C 2VCBA 3FDQA 4K35A 1C02A 3UM7A 1R3LC 3CCUV 2Q0OC 4FX5A 2KC3A 1N32B 5EC2C 1JFFA 4DR1B 2QTOA 4D7TA 1HR0O 3DJNB 1N36B 3Q4HA 5D5PA 3ZEDA 2W6JG 4FFKA 1WLEA 2QEXV 3L1MA 2LQTA 4NXMO 2L7AA 4A2NB 1ZLZA 1S7ZA 4EUKB 4O4IA 5IJ9B 1IW7F 4NY3A 1OXBA 1U96A 5KMGA 4JYAO 1Z5ZA 2A79B 3DSQA 3CRAA 2A1DD 1Z6AA 3DI5A 3ZBHA 2OYQA 1WB8A 4MVUA 4PA7A 5J2TA 4TUYB 1YZBA 5DS6A 4PDLA 2GBOA 4FZ1A 5JSLA 1PP9H 3ZIAG 1YARO 2CDQA 2YLGA 2CUGA 1XNQB 3GWNA 4BW5A 3E89A 4JAAA 2Q67A 5D5QA 2P61A 3IJ4A 2V1DA 3SXZA 4JC7A 2NG1A 1RP3B 4P9OA 2UUBB 1YITV 2PYLA 1NH2B 1N34B 3L73H 3JSNA 4I1MA 1ZHXA 1LI5A 3RQEA 4JURI 2CYDA 4B7EA 4DBQA 1M2VB 3K6BA 3R2PA 3NXSA 1URFA 2WLLA 1SYQA 1SF8A 1OXKA 2KG7A 5LMNB 2UUCO 4WFBV 2R7QA 4XWJA 4NKGB 1IDSA 3JALA 4JI6O 4B3SB 3H2UA 4CH6A 2EILB 2PY5A 5EBMC 1HR0B 2EJ7A 5JJNB 1PNMA 4U5BE 4R6ZA 2PX3A 1F7YA 5BY1A 1HMDA 1SRYA 2Y48A 3G67A 4FLXA 4XDJA 1J8YF 2FFHA 3CE2A 4NXMB 3ZC4A 3PCVA 4UCOA 3ZMVA 2RSEB 1GN6A 2WAMA 1HW7A 3CWBH 1SQBH 4I5SA 1H2LA 4U7NA 4AQYO 2ZKOA 2BTQA 2RNBA 2HP8A 2W0FC 2Y3DA 4H33A 4GX1A 2EJRA 2D4UA 3R66A 4YN0B 1MABG 3HNIA 3ETQA 1JRAA 1N8RW 1OV9A 2PYJA 1QQCA 1SC5B 3ASNB 4IYIA 1M1KW 2XSEA 1AI5A 3ZMZA 1O9HA 4UVBA 3OW2U 4J7JA 2CTPA 4FLVA 5IE9A 3DGEA 1HNWO 4FLWA 4WGYA 2KB1A 2LFRA 1TWGA 1ORQC 5IJ9A 2EINC 3E86A 3KCXA 1NZEA 4IJJA 4P6IC 1YTFB 4BG0A 2OCHA 1NTKH 4EIYA 4I1OB 2IU3A 3CCVV 1RPOA 1DLBA 3OR6C 1YYJA 5LYJB 3E35A 4TUYA 4PJMA 2UUCB 4XEKA 4JI6B 2Q7RA 1XL6A 1IXBA 4DO2A 3ATPA 1VQLV 4DV0B 1I08A 2J0XA 4NQFA 1ZU4A 1FS0G 1FTSA 1E86A 3ZMSA 4HE8D 4NTXA 3AGUA 5KA5A 1JAFA 2HVJC 3OMIB 4UB6Z 5IYDO 4Z9IA 5GPGB 1ROPA 1XQ8A 1YDXA 1F4NA 1TAEA 1G5ZA 1T5OA 4IRUA 3CD6V 3DKAA 1VP7A 2EPLX 1I5NA 4IT5A 3Q6MA 4AQYB 3ABKB 3DD7A 1M2VA 4YWQA 3H1JH 4G0HA 4X8AA 3MYIA 2YI8A 1JR8A 2EILC 2QY9A 2YLIA 5JQGB 3O9OA 1LNQA 2ZNIA 3FAPB 4G28B 2ZT9B 1SZIA 4LF6O 3FFQA 4HFKB 4DV7O 1FYJA 4OD5A 2P67A 2QM4A 2WVOA 2Y4TA 3MYFA 3T1HO 1JCHA 2VC9A 1B04A 1SS3A 3K06A 3RVYA 3SZRA 1HNWB 2IW5A 3TQOA 1I5XA 5HFLA 4KNVA 2A69F 3HNJA 3SXYA 3RGBA 5JWPA 1I7FA 4LFCO 4X1IB 2IXMA 1GS9A 4YL3A 1O5HA 1ZZPA 4IIJB 1R4TA 2KSFA 3ZWIA 3LS0A 1M90W 4B6IA 4ZKIA 4XLNF 2J9WA 4KC9A 4X1YB 1Y4MA 4P9FA 4P9PA 5EBWC 3ETEA 4PA9A 3V5YA 4DR3B 1NTZH 1VTMP 3CC2V 2LGWA 2HHHO 1JVMA 1HDJA 2QE9A 3P30A 3US6A 4NTYA 3TXSA 5CI9A 4PI2A 3Q7LA 2JS3A 4FM0A 5HSWA 3OGCC 2MWQA 3EQLF 2Q4FA 1OR3A 3T4ZA 1IBMO 2D3OW 4CDVA 4YXWG 3E2EA 1YVWA 1Q81W 2WLIB 3U3FA 2XASA 2YI9A 5JH7B 4TQDA 1AR1B 4B3TB 2NN4A 2GA0A 1CGOA 5LYJA 4FM1A 1HW1A 2R7TA 2ZDIC 1B6QA 2A6EF 3H9VA 4J42A 4K8ZA 2HKOA 4BJTA 3CS5A 2CK3G 3H1KH 4JE9A 4EHPA 3OMAB 4DUZB 1WTYA 3OTOO 4OGQB 2Q00A 2K1EA 3LDDA 2MK3A 3K5MA 4LP8A 1P7BA 3AG2C 2DW4A 3NMJA 3UMIA 4DV2O 1YEWA 2OTLV 2R70A 3ABKC 3I56V 3I5DA 1RCPA 3ZDLA 1SKVA 2RN9A 1J5EB 1X59A 4FLTA 1FKAO 1MZEA 3RYHB 3U9JA 3T6JA 3GVMA 4OD4A 3HKEB 1D5NA 1NR1A 2R7VA 2BTOA 4H54A 4DRHB 5JQGA 2J7PD 2XAQA 4DR4B 3ZQVA 3JSEO 2NSGA 3SJAC 2XOKG 1VOMA 1R5ID 4YL0A 1T9KA 3STZC 2YL1A 3FYIB 4O2BB 1TR2A 3U2LA 4UCVA 4CJOA 4TQFA 4JV5O 3CRCA 1Q43A 2ITCC 2KQ9A 4HFFB 1H2SB 2P06A 2KW3C 3WHNA 5L0HA 3MBGA 1NVPB 4K0KO 4X1IA 5AGFA 4JI0B 4IIJA 4X65O 3EHMA 4GT1A 1FAFA 1IX9A 4P9TA 2PI5A 3AGTA 3LSUA 4X1YA 4GZRB 4CSAC 1KKDA 3IAYA 2QKAA 4XQ1A 1MA1A 3ICXA 3JCZA 3GODA 3TK1A 4DRJB 4J7YA 1JQ0A 2IM8A 4CSAA 2YL0A 3B8MA 2P6JA 3C90A 3OTOB 3OFNG 4IL6Z 3VRCA 2AZ0A 2CTQA 1LS4A 4G27B 2XM4A 2HR3A 2B0HA 1GN4A 2ZM6O 3BY6A 1VMAA 5B1BC 2UUAO 4C3EA 1GN2A 3QF7A 2F93B 3ZHVA 2EPMX 4FJCC 2WLIA 4Q5SF 4PR9A 4I44A 3SXKA 5JH7A 2OJED 1K73W 3GM1A 3VM6A 1KU9A 1MSWD 2AZ2A 2WL8A 1NH2D 3VYWA 3EH1A 1SMYF 4BPMA 4MSWC 1VMGA 3UQ8A 3NG1A 2HJ3A 2OJQA 2B1IA 3K3WA 1FXKB 1FNTc 4JI7O 2CGNA 1OCCB 1B3QA 2JPUA 2AHZA 3JRMO 2HFIA 2J45A 4HEAJ 4CS9C 4JV5B 1C17M 2GAQA 2PFDA 2CW0F 2WSSG 4LF5O 3RF3A 1TFKB 4K0KB 1GM8A 2UU9B 2W0XA 2FL4A 4U3JB 1N33B 4X65B 1G4WR 5C8YB 1MOFA 3AG4C 3RYHA 2A0UA 3QTCA 1NI8A 1O3UA 3HKEA 1NKDA 3PMRA 1NR7A 1RFYA 3TXQA 1K04A 3BRJA 3SJQC 2Q3TA 4FESA 1QR9A 1P49A 3B2EE 1M93A 3APQA 3W8IA 4AL0A 3ZCCA 1HMOA 3IQ6A 1OKKD 3EGDB 2EZOA 3G4XA 4J30B 5KAIZ 3ZN0A 3WB1A 2IXOA 2YICA 2YUAA 3MDSA 4O2BA 4B3RB 1PV3A 4G7ZF 1D1CA 1IBKB 4WCEV 2UUAB 1YYXA 4GCZA 4GEHA 2X0CA 1UFIA 2QWRB 4YT8A 5C93A 2AP3A 1K3EA 5L0FA 4B7KA 2EIKC 2CGEA 1GK9A 4PK4A 3G71V 2XLWA 2B5UA 4OIPF 2KQXA 3J80N 3BABA 2Y3HA 2E5LB 5JP7A 1Y6DA 2DGJA 2EBOA 2DJVA 3OAAG 4C3DA 3NRHA 2UUHA 5GONB 4FLYA 1OW8A 3B0PA 3ABLC 4G2KA 5EIBD 4IHJB 2JS5A 2IJIA 3Q7GA 3CMEV 4TSFG 2KGOA 4J41A 2H8PC 1GM9A 2XAGA 2HJDA 4UB8Z 2B0JA 3IQCA 4LF5B 1BSMA 2Z0AA 4IB4A 2F4VB 4MTFA 2IOQA 3CCMV 3I5PA 3C8GB 2DYRB 3RFRA 1MMDA 3FOPA 1PKXA 5IYZB 1I0HA 3RYFB 4PI0A 3ETGA 5L0IA 2Z15A 5A2QN 5CBHA 2L6HA 1FXKC 4K3AA 3C62A 1FFHA 2QDOA 2EIJB 4JI2O 2DQ0A 1HNXO 1XMQO 3UKMA 2YXYA 1Y6XA 1JA8A 4LF9O 2QWOB 1FXKA 4BIZA 3BCCH 3NDBB 4X66O 3N2ZB 5FNVB 4UDVA 2VWKA 4X64O 1GN3A 3T1CA 3U0CA 1KUQA 3OR7C 3D3IA 5LP6B 3ZG1A 2YXLA 2ZNJA 4K1OA 2C04A 4TV9B 2WZLA 3ABMB 4U3JA 5C8YA 3D3QA 3LESA 4DOZA 1KTMA 2LFSA 2CCYA 5IT9N 3WAQA 3MLGA 4HBNA 2QWPB 1N0JA 3ML0A 1UJWB 3T1YO 3L34A 3NYJA 4E18A 1Y76B 3SYPA 4N6CA 5L3QA 5CA1B 4MVOA 2LP7A 3RT3C 3EGDA 3GB7C 2W6IG 3F46A 3W7WA 2XLHA 4JI5B 3ITFA 1M5IA 3E8BA 3JD4A 4E4EA 3K5NA 3S9OA 3L71H 2EX3A 2QWNB 3CCQV 2YKZA 3ETDA 4LR3A 3EG9B 3EFFK 4DVZA 4FLZA 4Q20A 4F4BA 4JYYA 3O6XA 5LMUB 1MMGA 1SETA 2A6HF 4DV3B 1D2DA 3DMDA 2DWDC 3L72H 4FIPC 1X4TA 4F4LA 1R3KC 4QGPA 3FB5C 4NYKA 1DF4A 4JI2B 3ZQYA 1RKEB 5A6AA 5GONA 1FXVA 2LSEA 2OTJV 3LNMB 1G1XB 3JD2A 2DB4A 4IHJA 4X66B 1KQSU 2WLNA 2YIAA 4X20B 1OCOB 4YK5A 1NLXA 3NKEA 1XWJA 3VQWA 3ABTA 4YT4A 1HWYA 1R73A 1H38A 3H01A 4LFBB 2QJ1A 4Q6GA 2NR5A 3C8GA 3NKDA 1CGNA 1CXZB 2A7WA 1T6UA 5IYZA 5AC4A 4E17A 1APCA 3RYFA 1RSOB 4KHPO 5JJEB 3SXMA 1QLEC 3T1YB 3SR2C 2XAFA 1EFRG 3TJ6A 3QO7A 3E8GA 3KMIA 3NYLA 2YQYA 1K5QA 1SA0B 3AK1A 3SPCA 1AI4A 4O4LB 4JTCB 4FWVA 2YC0A 4PA4A 3ZMTA 2UUBO 3QO5A 3JSZA 1NU9C 5CIVA 2QR4A 5FNVA 3K5LA 5H6QA 1Y66A 3ABMC 5GTHZ 3RFYA 4HZ3A 3CB2A 1TVKB 2WLKA 3MAQA 5LP6A 5LHHA 4JIOA 2PTMA 3O55A 5KAFZ 3DZAA 4TV9A 5A6JA 1V9PA 1NZ6A 3HPLC 4AHCA 4CH3A 1AVOB 4AX2A 5LMNO 3IPMO 2XLDA 3E8HA 5LGNA 4FFBB 1NVPD 4B3SO 3OEOA 4IARA 2XHBA 2VS0A 4H44B 1ORYA 1WP8A 1Y76A 4QDLA 3GEIA 5CA1A 4WFEA 2LIGA 3K7DA 4O6NA 3M7MX 1BZ4A 1DTOA 2G38A 3K0GA 1SR2A 2P4KA 3JCUZ 1QVGU 4LFAB 1PD1A 2AU5A 2L9JA 4QJFB 2Q9AA 4QI0A 4N06A 1Y74B 1DGSA 3U2MA 2PP4A 3DM9B 2EINB 1XOUA 2L6LA 1ZHZA 4KNWA 4PJJA 4BEMJ 2L35A 2L81A 3EG9A 5KUKA 5T3TA 3TULA 2MW2B 1EN4A 5KHGA 1HE1A 1BT8A 4ZOLB 1VQ5V 4CS2A 4KHPB 1KNYA 1V4AA 4XPXA 2ZXPA 5FPOA 4PELA 1L1FA 1VQ7V 4QE9A 2CTWA 1PD0A 2WVQA 4D6TH 4XLPF 4JASA 2H3OA 5J9PC 5JCOC 2Y3BA 2OIEA 2Z3YA 5BR8B 1RKEA 1A32A 4L87A 1S0VA 2J9BA 2H7BA 2VCCA 1OCOC 3FVYA 4U9DA 4AILC 1YLMA 5JCOA 1YJGA 2ZR2A 2VB6A 1IXMA 4PDRA 4X20A 1ZX3A 3CEXA 2ZE5A 1EN5A 2VRZA 4J7ZA 1CGME 2WLMA 2J9UA 1YVIA 4KBLA 1OCRB 3AJMA 4KL1A 2Q7HA 1JPNA 5E1AC 2XRHA 3OEEG 2GDCA 1JX9A 4MS2A 4NR1A 2HUJA 4NTWA 1LPEA 4WJ0A 1RSOA 2LW7A 1EN6A 3E83A 3N24A 3EPVA 4IAOA 4A4AA 4DV0O 1D0ZA 3UNGC 3ZTZA 5H5NA 3ZSUA 3R7CA 2IBZH 4DR7O 1Q86W 1OW7A 3QNEA 3HTKC 1SA0A 4RBNA 4U5HA 1E83A 4O4LA 3K58A 4JJGA 3H1LH 1J95A 1FFTC 4GLXA 4OXSA 4LH7A 2A9HA 2VQFO 5KX5B 4NB5A 4O79A 4G78A 2Y0PA 2YL3A 2WA3A 3CHXA 2Q5ZA 4ZIBA 3CJHB 1Q0KA 1Q0GA 5FPRA 4U5EE 3G4SV 1TVKA 1ZAUA 2AWCA 1M57B 3CXHF 2DOSA 3SJBC 1SQQH 1T5EA 1PD3A 1PNLA 3RW0A 4LF8B 2QKSA 1GQAA 1AUEA 3IHUA 3H1HH 1A7VA 1FXHA 4FFBA 2WZGA 1BQZA 4PJLA 5HV9A 4PV1B 1KKCA 4CBEA 1D0YA 5B1NA 3CCSV 5BQGA 2GSMB 2P5OA 3K04A 4DW1A 4L6RA 1QR8A 2XM0A 1XMOB 1WN7A 3T9OA 4I9WA 4BEJA 2O57A 3JAKB 3LSSA 1OHHG 4R50A 4DK1A 2HS5A 3T4RA 1K97A 1F1MA 4Q7CA 4QI2A 1Y74A 3FAVB 2X51A 3JD1A 1Q6IA 1TWCA 4AL1A 2N04A 1ZYRF 2PUSA 1U0BB 4O7GA 1YF2A 4ZOLA 2KYHA 4BIUA 4W4LA 4LH6A 4DR3O 4EEQA 4OX9O 1NU1H 1WB7A 3C8GD 1OW6A 2E3CA 1XZQA 5L0DA 4BJ5C 4DR7B 2XS8A 4CJGA 5JRAA 3CCEV 3M8AA 3HJCA 3W8HA 1KBHA 5DLJA 2IH1C 1EA8A 1E1RG 4DW0A 3OD4A 3N2KB 2VQFB 3DJUB 1E85A 5B66Z 2RQ6A 1OCRC 2EIMC 1E2XA 3VQYA 3AG2B 1U97A 5D91A 4X1KB 4W8KA 1BR1A 2AVKA 2TMVP 4B3TO 4KFMA 3W7SA 1VIBA 5F5FA 4X9QA 4CIHA 4JVSA 1I94B 4MVRA 2W4MA 5D92A 1O87A 1B68A 1ZL8B 1Q82W 5IDJA 1A41A 3OEHG 3RN4A 1VARA 4NTBA 2IBFA 2JD3A 2HLDG 1MMNA 4X0RA 3DXRB 4DUZO 2HZ8A 4N6HA 2EPNA 1S5JA 3E22B 2NUTB 5A6BA 1T6QA 4X62O 3CSKA 4XTKA 2LD6A 4LACB 1SZXA 1P4RA 2Q8VA 5GTIZ 5KX5A 4CH5A 1QNMA 1M57C 1J5EO 5BZBA 2H8AA 3CJHA 4LLCA 4YT5A 2XLOA 1PL4A 5B1AC 2VH3A 2I8BA 2RD9A 3O39A 2WVNA 3RYLA 2BOBC 4B3MO 1M56C 2QKCA 4DR4O 4OX9B 4YIPA 3AQBA 4RQFA 1OZ0A 2N74A 2NNUA 2QM7A 3WU2Z 2YDEA 5L0CA 4EBKA 1GM7A 1XL4A 2OEVA 3W2VA 2JRIA 5KYXB 3EHNA 3F7YC 4LF4B 3PJSK 1XNRB 3N27A 1WPXA 3PN1A 1LI7A 1VEWA 5F2VO 3JZ0A 3QO8A 2V3CC 3JAKA 4JI0O 3JATB 5B1BB 2WA4A 3FAVA 5DQZA 1XUQA 2ZD9A 4LLEA 4QPKA 1NU7D 3G6EV 1DOVA 3VBBA 4LC1A 3QW1A 4P2ZA 1Z3IX 3V5XA 1NS1A 1JPXA 3D8CA 3K5OA 3QVZA 4J80A 4O4HB 1PCXA 3PDMP 2ZDIA 3M4CA 4RD9A 3J06A 5KHHA 4J9ZB 1U89A 3JYYA 3RYCB 4X62B 3JYHA 3A0BZ 2F66C 2C03A 3C8ZA 4C7OB 1JMWA 2XUMA 1KP3A 3N2KA 1Y67A 2ZPAA 3TOMA 5KHKA 4DJ9A 4PHZA 4JI1B 2CNWA 4J11A 4MTGA 4PDMA 2ODMA 3VQVA 4X1KA 1DOWA 3BFRA 4I50B 2QTVA 2P0NA 5LBQA 2UXBB 1JMKC 2JK5C 5BQHA 2NUPB 3OM3B 1S72V 1K34A 2ADPA 3AG4B 3RYIB 3CAXA 3B09A 4GYCB 4BIOA 4B3MB 3LAYA 5DQTA 2JJ1G 3UGOA 1ZL8A 1TWAA 4PA6A 2N05A 1NJIW 1BDJB 3ZN1A 3ASOC 1QCEA 3LNRA 5DECA 3OA1A 4JI4B 1AROP 1XILA 4DYLA 1M9NA 2VWJA 3DXRA 1YI2V 1MNEA 3E22A 3W2WA 4WFAV 2V26A 2NUTA 1KC8W 4BW9A 3P3NA 4DR6B 2M64A 2P1AA 2LW1A 3SYAA 2L6FA 1E1QG 2FTKA 2QWQB 5TISZ 2OEXA 1LE4A 2UU9O 1Q3EA 2DE0X 4RAIA 1N33O 5B3IA 1TKNA 4HYOA 1WAZA 3W7XA 1U6HA 3SYQA 2EIKB 4D4XA 4FZ0A 1H8HG 3G4ZA 3FD9A 1ZHWA 5LGUA 2X6AA 4ZHQB 3OUFA 1K8AW 3WB2A 2L6GA 4GKKO 5L0JA 2X6CA 4GX5A 4QNHB 1CPQA 1N4CA 1ZHYA 1RM1C 4J32B 1F23A 4ZBMA 5LHIA 5FLXN 2AHYA 4B3RO 5KYXA 1BR4A 3IQTA 2A06H 3ABLB 2CAZC 1S5HC 2OIGA 1IBKO 3VOUA 2UXDO 2BE3A 3CSXA 5K1PA 1YZCA 2D5RB 2YWAA 2ZINA 4CS8C 4O2AB 3JATA 1XDCA 4JKVA 1P7GA 1SF9A 4U5DE 3I55V 3DTUB 1G8XA 2Q9CA 1ENVA 4YY3B 5DS5A 1WWPA 3CCLV 2CDYA 2E5LO 1FAPB 2EPKX 4W8PA 3P32A 3RVZA 4DVYP 2P4VA 4AI8A 4O4HA 3CRRA 4X89A 2C2AA 4ZLDA 5B1OA 1NFNA 1QLNA 3B29A 3N0TA 3RYCA 2M6YA 2OU6A 2R25A 1MQVA 1MG1A 4C7OA 5CI8A 2HV6A 2ITDC 3IC9A 3U8VA 1LKXA 3ZJZA 3FMSA 1XHZA 3CQZA 2F4VO 4MVSA 2ICWG 4CS9A 3QMKA 4CC6A 5T3WA 3F47A 1UFBA 1JPJA 3LEOA 1YA9A 4I50A 4DRIB 2YHSA 1US6A 3QZCA 2NUPA 3SYOA 3RYIA 5DM6V 4OIRF 1PL0A 4GKKB 4EWCA 4TT3G 5EGYA 3U10A 4YJ3B 1I5YA 4YHHO 3DE8A 3BEHA 1LUVA 2XL8A 2UXCO 2UXDB 3KG2A 256BA 1GTOA 3EVKA 2H94A 3B8NA 4FMTA 2OT5A 1TUEB 5L3VA 1DK1A 4YJWA 3P3PA 4O6YA 2XAHA 2IJHA 5KYWB 1TGOA 3JARB 3L70H 2YIBA 3KH2A 3FX7A 5EK0A 4PFPA 1YTFD 3T4DA 3KL4A 4ZHQA 2VQEB 2XL6A 4UCUA 5F5HA 3FB7C 1ZWIC 5H6RA 2JX0A 1DF5A 2KK1A 1G6UA 4OPAA 1W59A 3U0ZA 1VLSA 1QPUA 3EGXB 4JI5O 1YSCA 3AG1B 1EKYA 3FXHA 3SPGA 3CPWU 2OCCC 1OR2A 3CMAV 4O4JB 2QM8A 2ZXOA 4FLUA 3DC6A 1MMAA 4GX2A 1Z5WA 2CGOA 3SPHA 3S3XA 4O2AA 3N2GB 1THZA 2EULA 5EYPB 1AP6A 3K57A 5LMUO 3GORA 2DI3A 4LDQA 4DV3O 4IWBA 2YL7A 1VLTA 1D1AA 2PF4E 1FMWA 2YVKA 1QLEB 5DN6G 4H0LB 1GO3F 3BVOA 4YJ2B 4YHHB 1JJ2U 4WFHA 2Q4PA 2UXCB 2Q73A 5K1XA 4NCQA 2WPDG 2XL4A 3U5SA 2NSFA 5E3AA 4LFBO 1R6KA 5ITZB 4ABMA 4BWAA 4BJ6C 4CC5A 4PD4F 3TOLA 2IM9A 1WNSA 1R1BA 3ZRWB 2FAPB 3JRTA 1XBLA 1ORSC 3MD0A 4DV6O 4BJ6A 3HR0A 4PA3A 1W2BU 1AP5A 1FD9A 1H2KA 3I5QA 3S90A 4JGSA 2LK4A 4DUYB 4YJ3A 4PDVA 3NYMA 4JF3A 3U9MA 3A2FA 1JJOA 4MW3A 1ST6A 2RMKB 2IJKA 3UGPA 5L3CA 3ZRXA 1Q0DA 1YAUO 3DXJF 3GWLA 1GH6A 4MTOA 4XPWA 1HE9A 1KP2A 1QVFU 1TFOB 1Q7YW 1TA8A 2R03A 1WASA 3X2QC 3AQCA 4OIOF 1ZSPA 1XI1A 2UXXA 5KYWA 3JARA 4Z1VA 1XZPA 3JAMN 2XLVA 3JT1A 3AG7A 5L3FA 4NXNB 5CA3A 1SQXH 3L74H 2HJMA 1PM9A 1QHTA 1E84A 5H2FZ 2E74B 3AG1C 1Q8IA 3IQ5A 2W45A 1WPBA 4RO2A 1VQPV 1HNZO 4AE4B 4LFAO 3ECSA 3EGXA 2PZSA 1BHBA 5JVEA 3POVA 1YZAA 1O9GA 2ZE8A 3TJTA 4O4JA 3E8FA 3WB0A 5AG2A 3HKBB 2E87A 3CP1A 2KNHA 3WODF 5EBLC 2BE5F 2QE7G 4TV8B 1VF7A 3UR3C 3N2GA 5EYPA 3M4BA 4GQHA 3K1HA 4ER9A 3VQXA 3LDCA 2LP4A 4DV6B 3NMKA 2XS1A 1BZKA 3HKKA 5IWAB 1MMMA 1VQKV 2PNOA 4YIOA 3MFNA 1WJZA 4G7HF 5L0GA 4OIQF 2W4BA 5BR8O 1BCCH 4C7UA 1LR1A 1YJ9V 1G4US 1NQTA 4ZI7B 1VK5A 1UPGA 4YJ2A 4U5CE 1Z63A 1VQ8V 3ZHTA 3RQGA 1SQVH 1NSGB 1QSPA 2QSAA 3LJBA 3FYEB 1FFTB 2WLJA 1VQ9V 3AEIA 3UT5B 1K5SA 4NTFA 5ITZA 4B08A 3U8PA 1GM5A 3THOA 5JJJB 1VF6C 3C3TA 1VYIA 4JYBA 2FKXA 5E3CA 5LXTB 3ZRWA 5HFMA 1H2MA 1VQNV 2R72A 2A0LA 4MTXA 1FJGB 2IYLD 3IGAC 2X0LA 3DE9A 2Q7EA 2FYUH 1LUWA 1RXQA 3R65A 3HB3B 3NMIA 1HNZB 3W4YA 3RQFA 1VQOV 3E70C 5EC1C 3HLZA 5IYBO 5A9GA 3KPHA 2JIZG 1E79G 2HMZA 3QG5A 3T6BA 2CTRA 3BA8A 3AG3C 1AEPA 2FMLA 2M4EA 3S27A 3PHF2 3B9QA 4LF8O 1CEZA 2XLMA 2Y3GA 2H7OA 3ZHUA 3K03A 3HKDB 1VYKA 5EHHA 3CEIA 4UCTA 2HEPA 4U7OA 3DC5A 1AI6A 2ZXWB 4JEAA 2Q0AA 1TUBB 3LUTB 1SQGA 4PJ0Z 1XMOO 1WN0A 1CP9A 2IH3C 3MHHC 5IY5B 3DAGA 3M79A 4UV9A 3SPIA 4AE4A 4BJ1A 4DR2B 2GDSA 5CN0A 2HJFC 2R7RA 4JW1A 1XEQA 1AB3A 1EI7A 1V54C 3EZIA 3B0UX 1F4MA 2AWYA 4H13B 2EIMB 4X88A 2Q6AA 3HKBA 4KUMA 1D1BA 4ULVA 3SYCA 3G50A 5F28E 4TV8A 3SEOA 2VCAA 5A69A 1SZTA 4D7SA 5B5EZ 3H65A 3TK0A 2GFHA 5KUMA 4K0DA 1Z5VA 1VB5A 1K33A 2R9RB 3IFXA 2DN9A 4N4WA 1GAXA 1JOGA 2JGUA 4WGZA 5CB4B 1JR9A 3TGUH 4ZI7A 2JDIG 4BR6A 3TCUA 5KYUB 3GEEA 5B3SB 1UG7A 4CS7A 5T1DB 1IZ3A 3HKCB 3J7AU 4R32A 1Z2GA 2Z5UA 4I0XB 2ETSA 3DAFA 3OTFA 5JS5A 4I4TB 2P7TC 3V5ZA 1A7DA 1AR5A 3UT5A 2ZXRA 2LFDA 2X6BA 1FR0A 1G8MA 5LXTA 4LNUB 1I94O 4JAVA 3W7UA 1T01A 5B1AB 1K05A 2XLEA 4O6MA 2WZFA 3JASB 5EZYB 4F6RB 4LBEC 2QA4V 4JZGA 1K4DC 4JYAB 2DWEC 4RUFA 1M56B 1S76D 2ZE6A 3FB8C 2UUIA 3CRQA 2J7PA 2BCCH 3JD0A 1P84F 4JTAB 1T6IA 1FFXB 3B77A 1WGWA 1YCIA 2QTSA 2HSBA 4LCUC 2A68F 1M2OA 2ARHA 1L3PA 1OQCA 2YLDA 3ZVRA 2HKVA 1S05A 3KKBA 3K79A 2QGNA 4I9QA 3BRCA 3SJCC 3OGIB 1K92A 2NPUA 1QQ3A 1KB9F 4J7KA 4JCZA 1MZFA 1RJ9B 2ZQMA 3BAAA 2ZXWC 2M7WA 1H9GA 4GKJO 3HKDA 3LEVA 2JJ2G 2YRFA 4MW8A 3GWKC 1IURA 4IGGA 5JT4A 3C7JA 3LSQA 3S29A 2GV9A 4ICGA 3ZHRA 5IY5C 1ZW2A 4E7ZA 2EZPA 3ZRVA 4L8JA 1FPOA 4UFZA 4LF4O 1TUBA 3UMHA 1XNRO 1C03A 3TD7A 4BJ5A 2F23A 2YS8A 5BMVB 3U11A 1ZU5A 3K0DA 2XXAB 4JRZA 3RH3A 2ZIMA 1K4CC 4DBRA 1EM1A 3QVNA 1RMVA 3B0VC 4IAQA 2B1GA 3SP1A 5E2QA 3VF0A 3T6GB 3LS1A 5IJ0B 2YIDA 4U5GA 4HNAB 3KKYA 4DRXB 1KU2A 2R7SA 2OQMA 2GTSA 5GW7A 3KCYA 1BR2A 1S3JA 3F5TA 2R05A 2HG5C 1V55B 2I15A 5IYCO 3E9VA 5B3SC 1AR4A 5CB4A 3ASOB 3A9CA 4GYTA 1HP8A 5TJ5E 4UVCA 3OT7A 4YL1A 5KYUA 2IU0A 2E76B 3JD3A 4QE7A 3K59A 1IBLO 5BQIA 2B9ZA 3HKCA 3KZIZ 4J9YB 4JI1O 3UO2A 4XEFA 3ZHQA 4I0XA 2PI4A 3JYCA 1WOLA 1LIHA 4I4TA 3FOOA 4MT8A 1YDIA 2Q9BA 2F22A 5KHJA 2HFEC 2UXBO 3K9SA 4MVQA 4TWKA 3RWRD 2IXNA 4LNUA 3LLIA 4GKJB 3ZX6A 1W2WA 3KYJA 2J0WA 3CYOA 3JASA 5EZYA 1AJNA 4F6RA 2V7QG 4W4KA 4JI4O 4J7TA 5COGA 4CIPA 4WFFA 1Y4CA 3MX3A 1COWG 1RM1B 4DR6O 1W0KG 1FFXA 1OKKA 2ILMA 3ASNC 5FL7G 2PBEA 1BS3A 4F6EA 4Z1MG 3O10A 2MHRA 1MNGA 1H7IA 1OJHA 1KMIZ 4MVMA 4MNDA 1EBOA 4DV1O 2Q9LA 3DM5A 3ZS8C 4U9EA 3FHDA 1R6NA 1MSDA 1RJ9A 3K08A 3GWOA 2YXHA 3GEHA 2KKWA 2R7UA 1IVSA 3K1IC 1K9MW 3V7OA 3KYIA 4FAPB 5COFA 1EZJA 1N1CA 3OUSA 5EIBC 3ZMUA 4U3FH 4K7BA 4HAMA 2AW9A 1NG1A 2ASRA 2OWOA 3K1IA 2GUZB 1M6TA 1YHQV 3QTHA 5JVDB 1IBLB 4CDYA 4Q4ZF 3L0IA 5BMVA 4Z9HA 2XXAA 2K9PA 4LF6B 4DV7B 4JZ2A 4YY3O 3T1HB 2ETNA 3IEEA 3AK3A 5IJ0A 4KP4A 4HNAA 2J8WA 1L8DA 4DV4O 1V55C 1BGYH 2FGYA 4OPHA 4DRXA 3WG7B 4JI3O 4BAYA 4CS3A 4FM2A 3CCRV 2O9XA 3L8JA 2JGDB 4WBNB 3M15A 4RDAA 3T2MA 3LLKA 1YJWV 4LFCB 2LQGA 1FMVA 3SNHA 4GUNA 4EKWA 4M63A 3F7VC 4WFGA 1H2NA 4JAUA 2HVKC 3M1CB 3LNNA 2NLJC 2P90A 1BE3H 1NBMG 2V4DA 5A6KA 4FPPA 2PX0A 3BA9A 3JSLA 3CC4V 3J81N 4N21A 4XPYA 3ZTMA 1GMGA 5KA6A 2IXPA 3CC7V 4E0HA 4JZAA 2P22C 4FK5C 1W0JG 2Q7GA 1SQFA 5L3DA 2HHHB 5COMA 4DV1B 4E7SA 2UXNA 3EHBB 5FZTA 2XT9A 4EFBA 4JPRA 5LOVB 4ULWA 4XDKA 5DEDA 2J9VA 3O65A 1PPJH 3APOA 2AGAA 1SQPH 2KJGA 1IBMB 2DQ3A 1ZUQA 4E0IA 3OWTA 3I4UA 2RJZA 1HW2A 4PJNA 1GKFA 1M4UA 4H4KC 1ZTEA 4ZLCA 2WB7A 3S84A 1QU7A 2RCVA 2R7WA 3U3BA 1A0BA 3ZIBA 3SGIA 4R7CA 5LA6B 3RKOF 3RIPA 4EB6B 2OCCB 5LL6Y 1L0LH 4UVAA 3IC7A 4KXRA 4UV8A 1Q6UA 1QKRA 4LWSB 5FCLA 5J2UB 4E2LA 4CS8A 3S3WA 2OKUA 2BSKB 5KLVH 4Z9JA 2LJ2A 2J46A 2EPOA 4DV4B 4WF9V 5LHGA 2R7XA 1GGQA 4JI3B 4XEVA 2PGGA 3K33A 1NTMH 4JYCA 2VQEO 4DV2B 1LE2A 2P7VA 3VAYA 3OE7G 3CZ6A 2WWWA 1VQMV 2XAJA 4UXNA 1HY5A 4MQ9F 2HSQA 1G4YB 5CBGA 1WA8B 4J10A 2BOCC 2P6VA 3EXAA 2F1MA 1LS1A 3W7TA 2GUZA 4CDAA 4XBFA 1AILA 2ZE7A 5JVDA 2CH7B 2RDCA 1QZXA 5A6BD 5L3BA 4JTDB 2IJJA 3F5WC 1MNDA 4RUEA 3C3SA 4IYHA 3M99B 3WG7C 3JAWB 3JTLO 1Q6HA 4LDKA 4ANJA 2XTAA 2GHYA 3CRMA 3Q6NA 2ZIOA 4KI2A 2CE4A 4CS4A 2JGDA 4WBNA 1NFOA 2HMQA 4CBCA 3K66A 4N23A 2KSDA 1SESA 3GANA 5AC5A 5L3GA 1NT2B 1WATA 3L8IA 4TOIA 4EBJA 3BHPA 2WLHA 2BL2A 4U5FE 3TETA 4CH4A 1JOYA 1Q5OA 2Y4UA
chains in the Genus database with same CATH topology
1YJNV 5EBLC 1AJQA 1B6QA 1PD3A 1PNLA 2ZDIC 2QE7G 2QKSA 3RW0A 3CCJV 4CZZA 2HKOA 3SPJA 3LDCA 2DYSB 1FXHA 5CBFA 2CK3G 2Y69B 1VQKV 3OMAB 1BMFG 1K7DA 3D36A 3MHSC 2K1EA 3LDDA 5B1NA 3X2QB 2MK3A 3CCSV 2GSMB 5CMUA 3K04A 4LP8A 1P7BA 3AG2C 4GX0A 2DW4A 1QR8A 2Q68A 1YJ9V 1NQTA 2OTLV 3I56V 2ZR3A 3ABKC 1BHAA 1VQ8V 4I9WA 4R50A 3LSSA 1OCZB 1OHHG 5LGTA 3RBZA 1K97A 3FYEB 1FFTB 2WLJA 3JD1A 1VQ9V 3AEIA 1K5SA 1NR1A 1QBZA 4JYBA 2XAQA 4BIUA 4UUJC 3ZRWA 5HFMA 1AJPA 2XOKG 3CXCU 1RPRA 3ABUA 1VQNV 2A0LA 4MTXA 3STZC 3K9AA 3IGAC 3FYIB 2X0LA 3WFVA 5H9CA 4ASUG 3CCEV 2IH1C 2ITCC 1E1RG 1AI7A 1SERA 3R65A 3HB3B 1OCRC 2EIMC 1NVPB 1VQOV 5EC1C 3AG2B 4QPJA 5IYBO 4GT1A 2JIZG 1E79G 2YEVB 1VQ6V 2PI5A 4KFMA 4RQEA 3W7SA 3STLC 4MVZA 1KKDA 2ATKC 3AG3C 3JCZA 1OCCC 4MVRA 1CEZA 3TK1A 1Q82W 5IDJA 1JQ0A 3K03A 3OEHG 3B8MA 2P6JA 2HLDG 2JEUA 2XNDG 3OFNG 4U7OA 4G27B 1AI6A 2HR3A 2ZXWB 4DXWA 1H8EG 3BY6A 3OMNB 1R3JC 5B1BC 3LUTB 1P4RA 1CP9A 3A0RA 2IH3C 3MHHC 5IY5B 1M57C 4FJCC 4UV9A 3SPIA 5BZBA 2WLIA 5CN0A 1YIJV 2HJFC 1K73W 1V54C 4R8CA 1F4MA 2EIMB 4X88A 1MSWD 2Q6AA 4KUMA 2DYSC 5B1AC 1NH2D 3SYCA 2Y69C 4MSWC 1SZTA 2BOBC 1R3IC 1M56C 1F51A 2B1IA 3K3WA 3AG3B 1OZ0A 5KUMA 1FXKB 2NNUA 4RQFA 5L3EA 1K33A 1VQ4V 2QM7A 2R9RB 1OCCB 1GM7A 3IFXA 3ZRSA 1XL4A 2AHZA 2JEXA 1PNKA 1OCZC 3F7YC 3PJSK 2WSSG 1WPXA 2JDIG 3TCUA 1GM8A 3QO8A 5B3SB 1H2GA 1MOFA 4QIWF 5B1BB 2Z5UA 3AG4C 2ZD9A 2P7TC 1NKDA 4QPKA 1NR7A 3G6EV 3VBBA 4LC1A 4P2ZA 2X6BA 3SJQC 1JPXA 1QR9A 1V54B 2Q69A 1G8MA 1CPYA 4JAVA 3ZCCA 3W7UA 5B1AB 2ZDIA 4LBEC 2EZOA 2QA4V 1K4DC 3ZN0A 2YSUB 4J9ZB 2DWEC 4RUFA 1M56B 1S76D 3FB8C 2DYRC 3JD0A 4WCEV 4GCZA 4XDLA 1KP3A 4JTAB 2X7RB 3B77A 5C93A 1K3EA 2WLLB 2EIKC 4LCUC 1GK9A 3G71V 4PDMA 2B5UA 4MTGA 2YEVA 3K79A 2EIJC 5LBQA 1KECA 2JK5C 3OM3B 4H37A 1K34A 1K92A 3AG4B 1S72V 2EBOA 4P30A 1KD1W 2JJ1G 3OAAG 1S77D 4PA6A 2ZQMA 2ZXWC 2M7WA 1NJIW 3ZN1A 3ASOC 1QCEA 1BL8A 3ABLC 2JJ2G 3FKSG 4G2KA 1AROP 4MW8A 1YI2V 1M9NA 2IJIA 2R9IA 3CMEV 4TSFG 3LSQA 4WFAV 5IY5C 1KC8W 2EZPA 3LDEA 3ZRVA 2H8PC 1GM9A 2F43G 2XAGA 3FB6C 3SYAA 4MTFA 1E1QG 2FTKA 3UM7A 3CCMV 1R3LC 2DYRB 3CCUV 3K0DA 4RAIA 1PKXA 5EC2C 1K4CC 4HYOA 3W7XA 3SYQA 2EIKB 2B1GA 3ETGA 2QTOA 5CBHA 1H8HG 1FXKC 5LGUA 2X6AA 3OUFA 2W6JG 2EIJB 1K8AW 2DQ0A 1WLEA 2QEXV 3UKMA 2X6CA 4GX5A 4QNHB 5GW7A 1FXKA 4BIZA 1S3JA 1RM1C 2HG5C 1V55B 1F23A 5IYCO 4ZBMA 5LHIA 2A79B 2AHYA 5B3SC 3ASOB 3ABLB 1S5HC 3T1CA 4UVCA 3VOUA 3OR7C 3D3IA 4MVUA 2IU0A 3JD3A 4PA7A 4QE7A 3ABMB 4J9YB 4PDLA 2LFSA 2PI4A 3JYCA 3ZIAG 3I55V 3DTUB 4MT8A 1ENVA 3ML0A 2HFEC 1UJWB 3CCLV 4BW5A 3E89A 2Q67A 4MVQA 4TWKA 3P32A 3SYPA 3RVZA 2V1DA 4MVOA 2LP7A 4X89A 2C2AA 3GB7C 5B1OA 3CYOA 1QLNA 4P9OA 1AJNA 2W6IG 2V7QG 1YITV 3W7WA 1NH2B 3E8BA 3JD4A 1MG1A 4WFFA 3CCQV 2ITDC 1COWG 1RM1B 3ETDA 3NXSA 1W0KG 3ZJZA 2WLLA 4MVSA 3ASNC 5FL7G 3EFFK 4Z1MG 4Q20A 4WFBV 1SETA 4MVMA 2EILB 1EBOA 5EBMC 1PNMA 3SYOA 4R6ZA 2DWDC 5DM6V 4FIPC 4F4LA 1R3KC 3FB5C 1DF4A 1SRYA 2Y48A 1PL0A 4XDJA 1R6NA 4TT3G 3K08A 3GWOA 1FXVA 1I5YA 2OTJV 3LNMB 3JD2A 3ZMVA 1K9MW 2WAMA 1KQSU 2WLNA 1EZJA 1OCOB 3OUSA 3ZMUA 4I5SA 3BEHA 4U7NA 3ABTA 4HAMA 1HWYA 1R73A 1H38A 3H01A 3KG2A 2W0FC 1GTOA 1YHQV 4H33A 4GX1A 2EJRA 2H94A 3B8NA 4FMTA 2OT5A 1MABG 1TUEB 1N8RW 2XAHA 2IJHA 3ASNB 1QLEC 1M1KW 1AI5A 3ZMZA 2XAFA 4UVBA 3OW2U 1EFRG 5EK0A 3QO7A 1YTFD 3E8GA 3T4DA 4KP4A 3DGEA 1V55C 1K5QA 3FB7C 2KB1A 2LFRA 1ZWIC 5H6RA 1AI4A 3SPCA 3WG7B 4BAYA 3CCRV 1DF5A 4JTCB 3T2MA 1ORQC 1YJWV 4PA4A 3ZMTA 2EINC 3E86A 3QO5A 4EKWA 3F7VC 4WFGA 1YTFB 5H6QA 1YSCA 3AG1B 1Y66A 3ABMC 4JAUA 2HVKC 4HZ3A 3SPGA 3CPWU 2OCCC 3CMAV 2NLJC 2IU3A 2QM8A 2WLKA 2P90A 3CCVV 1NBMG 5LHHA 1RPOA 1DLBA 3OR6C 4FPPA 3E35A 4GX2A 3CC4V 4N21A 3SPHA 3HPLC 1GMGA 1THZA 5KA6A 3CC7V 1XL6A 3E8HA 5LGNA 4DO2A 4FK5C 1W0JG 5L3DA 1VQLV 1NVPD 2UXNA 3EHBB 1FS0G 3ZMSA 4JPRA 5KA5A 4XDKA 2HVJC 3OMIB 5IYDO 1QLEB 1ROPA 4WFEA 1F4NA 5DN6G 1DTOA 3K0GA 1GO3F 3CD6V 2DQ3A 1JJ2U 1QVGU 4WFHA 4QJFB 1GKFA 3ABKB 2WPDG 2EINB 1R6KA 4X8AA 5KUKA 4R7CA 2EILC 2OCCB 1LNQA 1VQ5V 4UVAA 3IC7A 3ZRWB 4UV8A 4G28B 3MD0A 4PELA 1L1FA 1VQ7V 4QE9A 4PA3A 4E2LA 2P67A 4JASA 1JCHA 1W2BU 5J9PC 3K06A 3RVYA 4WF9V 5LHGA 2Z3YA 2IW5A 4L87A 4JGSA 1S0VA 1I5XA 4JYCA 5HFLA 4PDVA 1OCOC 3OE7G 2WWWA 1VQMV 2XAJA 4UXNA 2ZR2A 4JF3A 4MW3A 1IXMA 1G4YB 4PDRA 5CBGA 2BOCC 2IJKA 2WLMA 1M90W 5L3CA 3ZRXA 1OCRB 4ZKIA 3W7TA 4XBFA 4MTOA 1Y4MA 1KP2A 1QVFU 4P9PA 5E1AC 5EBWC 1Q7YW 3OEEG 3ETEA 1JX9A 4MS2A 4PA9A 5L3BA 4JTDB 2IJJA 3F5WC 3X2QC 2UXXA 4RUEA 3CC2V 3E83A 3WG7C 3M99B 1JVMA 3P30A 5L3FA 2GHYA 1Q86W 3QNEA 5CA3A 3AG1C 1J95A 4OXSA 3OGCC 2A9HA 4CBCA 3T4ZA 4N23A 4RO2A 1VQPV 2D3OW 4YXWG 3E2EA 1SESA 1Q81W 5L3GA 2WLIB 1BHBA 2XASA 3G4SV 1AR1B 3E8FA 2WLHA 1M57B 3TETA 1JOYA 3CP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPG A;  2HG5 C;  2OCC C;  5EBL C;  2NLJ C;  3RW0 A;  5KUM A;  2QKS A;  2WLK A;  4ZBM A;  2A79 B;  2AHY A;  5B3S C;  3SPJ A;  2R9R B;  3OR6 C;  3LDC A;  4GX2 A;  3IFX A;  5CBF A;  3ZRS A;  1S5H C;  1XL4 A;  3SPH A;  3HPL C;  3T1C A;  3VOU A;  2AHZ A;  3OR7 C;  4MVU A;  1OCZ C;  3F7Y C;  4PA7 A;  1XL6 A;  4QE7 A;  3E8H A;  3PJS K;  2K1E A;  3LDD A;  4J9Y B;  4PDL A;  3TCU A;  3K04 A;  4LP8 A;  1P7B A;  3AG2 C;  3JYC A;  4GX0 A;  2Q68 A;  3ABK C;  4XDK A;  2HVJ C;  3AG4 C;  2HFE C;  4I9W A;  4WFE A;  4BW5 A;  4R50 A;  3E89 A;  2ZD9 A;  2Q67 A;  4MVQ A;  2P7T C;  4TWK A;  3K0G A;  3RBZ A;  3SYP A;  3RVZ A;  2WLJ A;  1M56 C;  4MVO A;  4P2Z A;  4WFH A;  4X89 A;  3GB7 C;  2X6B A;  3SJQ C;  2Q69 A;  4P9O A;  3E8B A;  4LBE C;  1K4D C;  4WFF A;  4UUJ C;  4X8A A;  5KUK A;  4J9Z B;  2DWE C;  2ITD C;  2EIL C;  4R7C A;  4RUF A;  3FB8 C;  3ZJZ A;  2A0L A;  1LNQ A;  2DYR C;  2WLL A;  3STZ C;  4MVS A;  3ASN C;  3IGA C;  4XDL A;  3EFF K;  4G28 B;  4JTA B;  4QE9 A;  4PA3 A;  2WLL B;  2EIK C;  2IH1 C;  4LCU C;  2ITC C;  5J9P C;  3K06 A;  3RVY A;  4MVM A;  4PDM A;  4MTG A;  3R65 A;  5EBM C;  1OCR C;  2EIM C;  2YEV A;  3SYO A;  4R6Z A;  2DWD C;  5EC1 C;  4PDV A;  4F4L A;  1OCO C;  1R3K C;  2EIJ C;  3FB5 C;  2JK5 C;  4XDJ A;  3K08 A;  4H37 A;  4MW3 A;  1G4Y B;  5CBG A;  4PDR A;  2BOC C;  3LNM B;  4KFM A;  4P30 A;  3STL C;  4MVZ A;  1KKD A;  2ATK C;  3AG3 C;  2WLM A;  4PA6 A;  2ZXW C;  2WLN A;  3ASO C;  4MTO A;  1BL8 A;  1OCC C;  3ABL C;  4MVR A;  3OUS A;  4P9P A;  5E1A C;  3BEH A;  4MW8 A;  3K03 A;  5EBW C;  4MS2 A;  3KG2 A;  4PA9 A;  2W0F C;  4JTD B;  5IY5 C;  4H33 A;  4GX1 A;  3LDE A;  3F5W C;  2H8P C;  3X2Q C;  4RUE A;  3E83 A;  4G27 B;  3FB6 C;  3WG7 C;  3SYA A;  4DXW A;  4MTF A;  1JVM A;  3UM7 A;  1R3L C;  1R3J C;  3K0D A;  5B1B C;  1QLE C;  3LUT B;  4RAI A;  5EC2 C;  1K4C C;  4HYO A;  5EK0 A;  2IH3 C;  1M57 C;  3E8G A;  3SPI A;  3T4D A;  3AG1 C;  1J95 A;  3SYQ A;  5BZB A;  2WLI A;  3OGC C;  4OXS A;  2HJF C;  1V55 C;  2A9H A;  4CBC A;  3T4Z A;  2QTO A;  5CBH A;  3FB7 C;  2KB1 A;  1V54 C;  1ZWI C;  4R8C A;  4RO2 A;  3SPC A;  2X6A A;  4X88 A;  2Q6A A;  2WLI B;  3OUF A;  1ORQ C;  2DYS C;  4JTC B;  4PA4 A;  5B1A C;  3T2M A;  3SYC A;  2EIN C;  3E86 A;  3UKM A;  4EKW A;  3E8F A;  3F7V C;  2Y69 C;  2WLH A;  2X6C A;  4GX5 A;  4MSW C;  4WFG A;  4QNH B;  3TET A;  2BOB C;  3ABM C;  1R3I C;  2HVK C;  4HZ3 A; 
#chains in the Genus database with same CATH topology
 1YJN V;  4C3B A;  1AJQ A;  3HNL A;  1EQ1 A;  2A0B A;  2HV7 A;  3CCJ V;  4CZZ A;  4I7Z B;  3B40 A;  3D36 C;  3SPJ A;  4DR5 O;  2W9Y A;  3UMK A;  4JI8 O;  2DYS B;  5CBF A;  3HNK A;  4JEB A;  3SDL A;  5DS4 A;  3H2V A;  1PV0 A;  3L75 H;  2Y69 B;  1BBH A;  1BMF G;  1K7D A;  3D36 A;  3MHS C;  3AK2 A;  5E79 Z;  4AK9 A;  3X2Q B;  5LOV A;  2ZM6 B;  5CMU A;  2OOC A;  4GX0 A;  1V74 B;  1ZW3 A;  2LGQ A;  2R7O A;  4YT2 A;  2Q68 A;  4DUY O;  2ZR3 A;  5BUO A;  2E75 B;  1BHA A;  1VF5 B;  1TWH A;  5LGT A;  1OCZ B;  2OG2 A;  3RBZ A;  1EZV H;  4NTA A;  1IZM A;  4EBB A;  5CA0 B;  4Z2W A;  2A3Q A;  3FAJ A;  1QBZ A;  4K8X A;  1NBB A;  1YA7 O;  5LA6 A;  4EB6 A;  4UUJ C;  3CXC U;  1AJP A;  5BXZ A;  1RPR A;  3ABU A;  4JI7 B;  3G6B A;  4LWS A;  5J2U A;  2LO1 A;  2BSK A;  3K9A A;  2CNW D;  4ONS A;  4FVM A;  3EFO B;  2D2C B;  4NC3 A;  4D4N A;  5KHI A;  2LFF A;  3WFV A;  5H9C A;  1KYO F;  4ASU G;  4NXN O;  1I4Y A;  3JCU Q;  3UCS C;  1TQG A;  1AI7 A;  3SYN A;  1SER A;  2MYS A;  3X1O A;  5KYN A;  1H6G A;  1WA8 A;  4QPJ A;  4I55 B;  1L0N H;  2YEV B;  3G80 A;  1GRJ A;  1VQ6 V;  4RQE A;  3STL C;  4MVZ A;  2ATK C;  2CH7 A;  2ADQ B;  4DR5 B;  1N0N A;  1OCC C;  4JI8 B;  5KYY B;  4RWU A;  4EFE A;  3GM3 A;  1J8M F;  4LDR A;  5JUA A;  2YZS A;  2JEU A;  2XND G;  3JAW A;  5IWA O;  1ORJ A;  3GM2 A;  4PFO A;  1ZHT A;  1CPR A;  1RKC A;  4DXW A;  2QUP A;  2Y39 A;  1H8E G;  3OMN B;  1R3J C;  5K0I A;  2G3K A;  4UCR A;  2DMX A;  3B4S A;  4JJF A;  3A0R A;  4WAB A;  4LER A;  1WP7 A;  1YXB A;  1YIJ V;  1A7E A;  4R8C A;  3A8T A;  1JFF B;  3EJN A;  2DYS C;  3QVY A;  4NVP A;  3A11 A;  3AOU A;  2Y69 C;  2GTA A;  3A0H Z;  3Q4H B;  2BC5 A;  1R3I C;  1F51 A;  4DK0 A;  4A5U B;  3AG3 B;  4UCS A;  1VQ4 V;  5L3E A;  2Y0I A;  4DV5 O;  2G62 A;  4O4I B;  1FJG O;  5JLI A;  3ZRS A;  1Z23 A;  5KMG B;  1BQ0 A;  2JEX A;  1L7C A;  1PNK A;  1OCZ C;  4LF7 O;  2R9A A;  3L9D A;  1LVK A;  5J2T B;  1S5L Z;  1LM3 B;  1H2G A;  1Q90 D;  4QIW F;  1N32 O;  2F95 B;  5CA0 A;  2VAS A;  1I4Z A;  4DR1 O;  3BPZ A;  4JCH A;  2Q69 A;  1V54 B;  1Q0F A;  5E33 A;  1N36 O;  3CX5 F;  1HNX B;  1XMQ B;  1CPY A;  3EH2 A;  4LF9 B;  2QNL A;  2QLA A;  1B06 A;  2AXT Z;  2LCH A;  2GWW A;  1XHX A;  3S28 A;  2YSU B;  3EFO A;  3S0X A;  4X64 B;  3TJ5 A;  2DYR C;  2JVD A;  2FB5 A;  4XDL A;  2X7R B;  1Z7Q c;  1H9T A;  2WLL B;  4G7O F;  1Q0M A;  2KG7 B;  1D5A A;  1K40 A;  4DR2 O;  4I55 A;  1ZVZ A;  3JAL B;  3C18 A;  2YEV A;  4PAC A;  2EIJ C;  4I3M A;  1R6T A;  1KEC A;  1XNQ O;  4H37 A;  3C63 A;  1KD1 W;  4P30 A;  3QW0 A;  5KYY A;  1S77 D;  2ZCE A;  4OIN F;  3UO3 A;  4DV5 B;  4CX9 A;  3ZHS A;  5DVW A;  1BL8 A;  1VF6 A;  2R02 A;  3FKS G;  3H1I H;  2G3V A;  5LP6 C;  2H7V C;  1AVM A;  2R9I A;  1N34 O;  3NR7 A;  3B71 A;  4LF7 B;  3DWW A;  1D0X A;  3LDE A;  1XRE A;  2F43 G;  2BTQ B;  1QVX A;  3EZH A;  2YIB D;  3FB6 C;  2VCB A;  3FDQ A;  4K35 A;  1C02 A;  3UM7 A;  1R3L C;  3CCU V;  2Q0O C;  4FX5 A;  2KC3 A;  1N32 B;  5EC2 C;  1JFF A;  4DR1 B;  2QTO A;  4D7T A;  1HR0 O;  3DJN B;  1N36 B;  3Q4H A;  5D5P A;  3ZED A;  2W6J G;  4FFK A;  1WLE A;  2QEX V;  3L1M A;  2LQT A;  4NXM O;  2L7A A;  4A2N B;  1ZLZ A;  1S7Z A;  4EUK B;  4O4I A;  5IJ9 B;  1IW7 F;  4NY3 A;  1OXB A;  1U96 A;  5KMG A;  4JYA O;  1Z5Z A;  2A79 B;  3DSQ A;  3CRA A;  2A1D D;  1Z6A A;  3DI5 A;  3ZBH A;  2OYQ A;  1WB8 A;  4MVU A;  4PA7 A;  5J2T A;  4TUY B;  1YZB A;  5DS6 A;  4PDL A;  2GBO A;  4FZ1 A;  5JSL A;  1PP9 H;  3ZIA G;  1YAR O;  2CDQ A;  2YLG A;  2CUG A;  1XNQ B;  3GWN A;  4BW5 A;  3E89 A;  4JAA A;  2Q67 A;  5D5Q A;  2P61 A;  3IJ4 A;  2V1D A;  3SXZ A;  4JC7 A;  2NG1 A;  1RP3 B;  4P9O A;  2UUB B;  1YIT V;  2PYL A;  1NH2 B;  1N34 B;  3L73 H;  3JSN A;  4I1M A;  1ZHX A;  1LI5 A;  3RQE A;  4JUR I;  2CYD A;  4B7E A;  4DBQ A;  1M2V B;  3K6B A;  3R2P A;  3NXS A;  1URF A;  2WLL A;  1SYQ A;  1SF8 A;  1OXK A;  2KG7 A;  5LMN B;  2UUC O;  4WFB V;  2R7Q A;  4XWJ A;  4NKG B;  1IDS A;  3JAL A;  4JI6 O;  4B3S B;  3H2U A;  4CH6 A;  2EIL B;  2PY5 A;  5EBM C;  1HR0 B;  2EJ7 A;  5JJN B;  1PNM A;  4U5B E;  4R6Z A;  2PX3 A;  1F7Y A;  5BY1 A;  1HMD A;  1SRY A;  2Y48 A;  3G67 A;  4FLX A;  4XDJ A;  1J8Y F;  2FFH A;  3CE2 A;  4NXM B;  3ZC4 A;  3PCV A;  4UCO A;  3ZMV A;  2RSE B;  1GN6 A;  2WAM A;  1HW7 A;  3CWB H;  1SQB H;  4I5S A;  1H2L A;  4U7N A;  4AQY O;  2ZKO A;  2BTQ A;  2RNB A;  2HP8 A;  2W0F C;  2Y3D A;  4H33 A;  4GX1 A;  2EJR A;  2D4U A;  3R66 A;  4YN0 B;  1MAB G;  3HNI A;  3ETQ A;  1JRA A;  1N8R W;  1OV9 A;  2PYJ A;  1QQC A;  1SC5 B;  3ASN B;  4IYI A;  1M1K W;  2XSE A;  1AI5 A;  3ZMZ A;  1O9H A;  4UVB A;  3OW2 U;  4J7J A;  2CTP A;  4FLV A;  5IE9 A;  3DGE A;  1HNW O;  4FLW A;  4WGY A;  2KB1 A;  2LFR A;  1TWG A;  1ORQ C;  5IJ9 A;  2EIN C;  3E86 A;  3KCX A;  1NZE A;  4IJJ A;  4P6I C;  1YTF B;  4BG0 A;  2OCH A;  1NTK H;  4EIY A;  4I1O B;  2IU3 A;  3CCV V;  1RPO A;  1DLB A;  3OR6 C;  1YYJ A;  5LYJ B;  3E35 A;  4TUY A;  4PJM A;  2UUC B;  4XEK A;  4JI6 B;  2Q7R A;  1XL6 A;  1IXB A;  4DO2 A;  3ATP A;  1VQL V;  4DV0 B;  1I08 A;  2J0X A;  4NQF A;  1ZU4 A;  1FS0 G;  1FTS A;  1E86 A;  3ZMS A;  4HE8 D;  4NTX A;  3AGU A;  5KA5 A;  1JAF A;  2HVJ C;  3OMI B;  4UB6 Z;  5IYD O;  4Z9I A;  5GPG B;  1ROP A;  1XQ8 A;  1YDX A;  1F4N A;  1TAE A;  1G5Z A;  1T5O A;  4IRU A;  3CD6 V;  3DKA A;  1VP7 A;  2EPL X;  1I5N A;  4IT5 A;  3Q6M A;  4AQY B;  3ABK B;  3DD7 A;  1M2V A;  4YWQ A;  3H1J H;  4G0H A;  4X8A A;  3MYI A;  2YI8 A;  1JR8 A;  2EIL C;  2QY9 A;  2YLI A;  5JQG B;  3O9O A;  1LNQ A;  2ZNI A;  3FAP B;  4G28 B;  2ZT9 B;  1SZI A;  4LF6 O;  3FFQ A;  4HFK B;  4DV7 O;  1FYJ A;  4OD5 A;  2P67 A;  2QM4 A;  2WVO A;  2Y4T A;  3MYF A;  3T1H O;  1JCH A;  2VC9 A;  1B04 A;  1SS3 A;  3K06 A;  3RVY A;  3SZR A;  1HNW B;  2IW5 A;  3TQO A;  1I5X A;  5HFL A;  4KNV A;  2A69 F;  3HNJ A;  3SXY A;  3RGB A;  5JWP A;  1I7F A;  4LFC O;  4X1I B;  2IXM A;  1GS9 A;  4YL3 A;  1O5H A;  1ZZP A;  4IIJ B;  1R4T A;  2KSF A;  3ZWI A;  3LS0 A;  1M90 W;  4B6I A;  4ZKI A;  4XLN F;  2J9W A;  4KC9 A;  4X1Y B;  1Y4M A;  4P9F A;  4P9P A;  5EBW C;  3ETE A;  4PA9 A;  3V5Y A;  4DR3 B;  1NTZ H;  1VTM P;  3CC2 V;  2LGW A;  2HHH O;  1JVM A;  1HDJ A;  2QE9 A;  3P30 A;  3US6 A;  4NTY A;  3TXS A;  5CI9 A;  4PI2 A;  3Q7L A;  2JS3 A;  4FM0 A;  5HSW A;  3OGC C;  2MWQ A;  3EQL F;  2Q4F A;  1OR3 A;  3T4Z A;  1IBM O;  2D3O W;  4CDV A;  4YXW G;  3E2E A;  1YVW A;  1Q81 W;  2WLI B;  3U3F A;  2XAS A;  2YI9 A;  5JH7 B;  4TQD A;  1AR1 B;  4B3T B;  2NN4 A;  2GA0 A;  1CGO A;  5LYJ A;  4FM1 A;  1HW1 A;  2R7T A;  2ZDI C;  1B6Q A;  2A6E F;  3H9V A;  4J42 A;  4K8Z A;  2HKO A;  4BJT A;  3CS5 A;  2CK3 G;  3H1K H;  4JE9 A;  4EHP A;  3OMA B;  4DUZ B;  1WTY A;  3OTO O;  4OGQ B;  2Q00 A;  2K1E A;  3LDD A;  2MK3 A;  3K5M A;  4LP8 A;  1P7B A;  3AG2 C;  2DW4 A;  3NMJ A;  3UMI A;  4DV2 O;  1YEW A;  2OTL V;  2R70 A;  3ABK C;  3I56 V;  3I5D A;  1RCP A;  3ZDL A;  1SKV A;  2RN9 A;  1J5E B;  1X59 A;  4FLT A;  1FKA O;  1MZE A;  3RYH B;  3U9J A;  3T6J A;  3GVM A;  4OD4 A;  3HKE B;  1D5N A;  1NR1 A;  2R7V A;  2BTO A;  4H54 A;  4DRH B;  5JQG A;  2J7P D;  2XAQ A;  4DR4 B;  3ZQV A;  3JSE O;  2NSG A;  3SJA C;  2XOK G;  1VOM A;  1R5I D;  4YL0 A;  1T9K A;  3STZ C;  2YL1 A;  3FYI B;  4O2B B;  1TR2 A;  3U2L A;  4UCV A;  4CJO A;  4TQF A;  4JV5 O;  3CRC A;  1Q43 A;  2ITC C;  2KQ9 A;  4HFF B;  1H2S B;  2P06 A;  2KW3 C;  3WHN A;  5L0H A;  3MBG A;  1NVP B;  4K0K O;  4X1I A;  5AGF A;  4JI0 B;  4IIJ A;  4X65 O;  3EHM A;  4GT1 A;  1FAF A;  1IX9 A;  4P9T A;  2PI5 A;  3AGT A;  3LSU A;  4X1Y A;  4GZR B;  4CSA C;  1KKD A;  3IAY A;  2QKA A;  4XQ1 A;  1MA1 A;  3ICX A;  3JCZ A;  3GOD A;  3TK1 A;  4DRJ B;  4J7Y A;  1JQ0 A;  2IM8 A;  4CSA A;  2YL0 A;  3B8M A;  2P6J A;  3C90 A;  3OTO B;  3OFN G;  4IL6 Z;  3VRC A;  2AZ0 A;  2CTQ A;  1LS4 A;  4G27 B;  2XM4 A;  2HR3 A;  2B0H A;  1GN4 A;  2ZM6 O;  3BY6 A;  1VMA A;  5B1B C;  2UUA O;  4C3E A;  1GN2 A;  3QF7 A;  2F93 B;  3ZHV A;  2EPM X;  4FJC C;  2WLI A;  4Q5S F;  4PR9 A;  4I44 A;  3SXK A;  5JH7 A;  2OJE D;  1K73 W;  3GM1 A;  3VM6 A;  1KU9 A;  1MSW D;  2AZ2 A;  2WL8 A;  1NH2 D;  3VYW A;  3EH1 A;  1SMY F;  4BPM A;  4MSW C;  1VMG A;  3UQ8 A;  3NG1 A;  2HJ3 A;  2OJQ A;  2B1I A;  3K3W A;  1FXK B;  1FNT c;  4JI7 O;  2CGN A;  1OCC B;  1B3Q A;  2JPU A;  2AHZ A;  3JRM O;  2HFI A;  2J45 A;  4HEA J;  4CS9 C;  4JV5 B;  1C17 M;  2GAQ A;  2PFD A;  2CW0 F;  2WSS G;  4LF5 O;  3RF3 A;  1TFK B;  4K0K B;  1GM8 A;  2UU9 B;  2W0X A;  2FL4 A;  4U3J B;  1N33 B;  4X65 B;  1G4W R;  5C8Y B;  1MOF A;  3AG4 C;  3RYH A;  2A0U A;  3QTC A;  1NI8 A;  1O3U A;  3HKE A;  1NKD A;  3PMR A;  1NR7 A;  1RFY A;  3TXQ A;  1K04 A;  3BRJ A;  3SJQ C;  2Q3T A;  4FES A;  1QR9 A;  1P49 A;  3B2E E;  1M93 A;  3APQ A;  3W8I A;  4AL0 A;  3ZCC A;  1HMO A;  3IQ6 A;  1OKK D;  3EGD B;  2EZO A;  3G4X A;  4J30 B;  5KAI Z;  3ZN0 A;  3WB1 A;  2IXO A;  2YIC A;  2YUA A;  3MDS A;  4O2B A;  4B3R B;  1PV3 A;  4G7Z F;  1D1C A;  1IBK B;  4WCE V;  2UUA B;  1YYX A;  4GCZ A;  4GEH A;  2X0C A;  1UFI A;  2QWR B;  4YT8 A;  5C93 A;  2AP3 A;  1K3E A;  5L0F A;  4B7K A;  2EIK C;  2CGE A;  1GK9 A;  4PK4 A;  3G71 V;  2XLW A;  2B5U A;  4OIP F;  2KQX A;  3J80 N;  3BAB A;  2Y3H A;  2E5L B;  5JP7 A;  1Y6D A;  2DGJ A;  2EBO A;  2DJV A;  3OAA G;  4C3D A;  3NRH A;  2UUH A;  5GON B;  4FLY A;  1OW8 A;  3B0P A;  3ABL C;  4G2K A;  5EIB D;  4IHJ B;  2JS5 A;  2IJI A;  3Q7G A;  3CME V;  4TSF G;  2KGO A;  4J41 A;  2H8P C;  1GM9 A;  2XAG A;  2HJD A;  4UB8 Z;  2B0J A;  3IQC A;  4LF5 B;  1BSM A;  2Z0A A;  4IB4 A;  2F4V B;  4MTF A;  2IOQ A;  3CCM V;  3I5P A;  3C8G B;  2DYR B;  3RFR A;  1MMD A;  3FOP A;  1PKX A;  5IYZ B;  1I0H A;  3RYF B;  4PI0 A;  3ETG A;  5L0I A;  2Z15 A;  5A2Q N;  5CBH A;  2L6H A;  1FXK C;  4K3A A;  3C62 A;  1FFH A;  2QDO A;  2EIJ B;  4JI2 O;  2DQ0 A;  1HNX O;  1XMQ O;  3UKM A;  2YXY A;  1Y6X A;  1JA8 A;  4LF9 O;  2QWO B;  1FXK A;  4BIZ A;  3BCC H;  3NDB B;  4X66 O;  3N2Z B;  5FNV B;  4UDV A;  2VWK A;  4X64 O;  1GN3 A;  3T1C A;  3U0C A;  1KUQ A;  3OR7 C;  3D3I A;  5LP6 B;  3ZG1 A;  2YXL A;  2ZNJ A;  4K1O A;  2C04 A;  4TV9 B;  2WZL A;  3ABM B;  4U3J A;  5C8Y A;  3D3Q A;  3LES A;  4DOZ A;  1KTM A;  2LFS A;  2CCY A;  5IT9 N;  3WAQ A;  3MLG A;  4HBN A;  2QWP B;  1N0J A;  3ML0 A;  1UJW B;  3T1Y O;  3L34 A;  3NYJ A;  4E18 A;  1Y76 B;  3SYP A;  4N6C A;  5L3Q A;  5CA1 B;  4MVO A;  2LP7 A;  3RT3 C;  3EGD A;  3GB7 C;  2W6I G;  3F46 A;  3W7W A;  2XLH A;  4JI5 B;  3ITF A;  1M5I A;  3E8B A;  3JD4 A;  4E4E A;  3K5N A;  3S9O A;  3L71 H;  2EX3 A;  2QWN B;  3CCQ V;  2YKZ A;  3ETD A;  4LR3 A;  3EG9 B;  3EFF K;  4DVZ A;  4FLZ A;  4Q20 A;  4F4B A;  4JYY A;  3O6X A;  5LMU B;  1MMG A;  1SET A;  2A6H F;  4DV3 B;  1D2D A;  3DMD A;  2DWD C;  3L72 H;  4FIP C;  1X4T A;  4F4L A;  1R3K C;  4QGP A;  3FB5 C;  4NYK A;  1DF4 A;  4JI2 B;  3ZQY A;  1RKE B;  5A6A A;  5GON A;  1FXV A;  2LSE A;  2OTJ V;  3LNM B;  1G1X B;  3JD2 A;  2DB4 A;  4IHJ A;  4X66 B;  1KQS U;  2WLN A;  2YIA A;  4X20 B;  1OCO B;  4YK5 A;  1NLX A;  3NKE A;  1XWJ A;  3VQW A;  3ABT A;  4YT4 A;  1HWY A;  1R73 A;  1H38 A;  3H01 A;  4LFB B;  2QJ1 A;  4Q6G A;  2NR5 A;  3C8G A;  3NKD A;  1CGN A;  1CXZ B;  2A7W A;  1T6U A;  5IYZ A;  5AC4 A;  4E17 A;  1APC A;  3RYF A;  1RSO B;  4KHP O;  5JJE B;  3SXM A;  1QLE C;  3T1Y B;  3SR2 C;  2XAF A;  1EFR G;  3TJ6 A;  3QO7 A;  3E8G A;  3KMI A;  3NYL A;  2YQY A;  1K5Q A;  1SA0 B;  3AK1 A;  3SPC A;  1AI4 A;  4O4L B;  4JTC B;  4FWV A;  2YC0 A;  4PA4 A;  3ZMT A;  2UUB O;  3QO5 A;  3JSZ A;  1NU9 C;  5CIV A;  2QR4 A;  5FNV A;  3K5L A;  5H6Q A;  1Y66 A;  3ABM C;  5GTH Z;  3RFY A;  4HZ3 A;  3CB2 A;  1TVK B;  2WLK A;  3MAQ A;  5LP6 A;  5LHH A;  4JIO A;  2PTM A;  3O55 A;  5KAF Z;  3DZA A;  4TV9 A;  5A6J A;  1V9P A;  1NZ6 A;  3HPL C;  4AHC A;  4CH3 A;  1AVO B;  4AX2 A;  5LMN O;  3IPM O;  2XLD A;  3E8H A;  5LGN A;  4FFB B;  1NVP D;  4B3S O;  3OEO A;  4IAR A;  2XHB A;  2VS0 A;  4H44 B;  1ORY A;  1WP8 A;  1Y76 A;  4QDL A;  3GEI A;  5CA1 A;  4WFE A;  2LIG A;  3K7D A;  4O6N A;  3M7M X;  1BZ4 A;  1DTO A;  2G38 A;  3K0G A;  1SR2 A;  2P4K A;  3JCU Z;  1QVG U;  4LFA B;  1PD1 A;  2AU5 A;  2L9J A;  4QJF B;  2Q9A A;  4QI0 A;  4N06 A;  1Y74 B;  1DGS A;  3U2M A;  2PP4 A;  3DM9 B;  2EIN B;  1XOU A;  2L6L A;  1ZHZ A;  4KNW A;  4PJJ A;  4BEM J;  2L35 A;  2L81 A;  3EG9 A;  5KUK A;  5T3T A;  3TUL A;  2MW2 B;  1EN4 A;  5KHG A;  1HE1 A;  1BT8 A;  4ZOL B;  1VQ5 V;  4CS2 A;  4KHP B;  1KNY A;  1V4A A;  4XPX A;  2ZXP A;  5FPO A;  4PEL A;  1L1F A;  1VQ7 V;  4QE9 A;  2CTW A;  1PD0 A;  2WVQ A;  4D6T H;  4XLP F;  4JAS A;  2H3O A;  5J9P C;  5JCO C;  2Y3B A;  2OIE A;  2Z3Y A;  5BR8 B;  1RKE A;  1A32 A;  4L87 A;  1S0V A;  2J9B A;  2H7B A;  2VCC A;  1OCO C;  3FVY A;  4U9D A;  4AIL C;  1YLM A;  5JCO A;  1YJG A;  2ZR2 A;  2VB6 A;  1IXM A;  4PDR A;  4X20 A;  1ZX3 A;  3CEX A;  2ZE5 A;  1EN5 A;  2VRZ A;  4J7Z A;  1CGM E;  2WLM A;  2J9U A;  1YVI A;  4KBL A;  1OCR B;  3AJM A;  4KL1 A;  2Q7H A;  1JPN A;  5E1A C;  2XRH A;  3OEE G;  2GDC A;  1JX9 A;  4MS2 A;  4NR1 A;  2HUJ A;  4NTW A;  1LPE A;  4WJ0 A;  1RSO A;  2LW7 A;  1EN6 A;  3E83 A;  3N24 A;  3EPV A;  4IAO A;  4A4A A;  4DV0 O;  1D0Z A;  3UNG C;  3ZTZ A;  5H5N A;  3ZSU A;  3R7C A;  2IBZ H;  4DR7 O;  1Q86 W;  1OW7 A;  3QNE A;  3HTK C;  1SA0 A;  4RBN A;  4U5H A;  1E83 A;  4O4L A;  3K58 A;  4JJG A;  3H1L H;  1J95 A;  1FFT C;  4GLX A;  4OXS A;  4LH7 A;  2A9H A;  2VQF O;  5KX5 B;  4NB5 A;  4O79 A;  4G78 A;  2Y0P A;  2YL3 A;  2WA3 A;  3CHX A;  2Q5Z A;  4ZIB A;  3CJH B;  1Q0K A;  1Q0G A;  5FPR A;  4U5E E;  3G4S V;  1TVK A;  1ZAU A;  2AWC A;  1M57 B;  3CXH F;  2DOS A;  3SJB C;  1SQQ H;  1T5E A;  1PD3 A;  1PNL A;  3RW0 A;  4LF8 B;  2QKS A;  1GQA A;  1AUE A;  3IHU A;  3H1H H;  1A7V A;  1FXH A;  4FFB A;  2WZG A;  1BQZ A;  4PJL A;  5HV9 A;  4PV1 B;  1KKC A;  4CBE A;  1D0Y A;  5B1N A;  3CCS V;  5BQG A;  2GSM B;  2P5O A;  3K04 A;  4DW1 A;  4L6R A;  1QR8 A;  2XM0 A;  1XMO B;  1WN7 A;  3T9O A;  4I9W A;  4BEJ A;  2O57 A;  3JAK B;  3LSS A;  1OHH G;  4R50 A;  4DK1 A;  2HS5 A;  3T4R A;  1K97 A;  1F1M A;  4Q7C A;  4QI2 A;  1Y74 A;  3FAV B;  2X51 A;  3JD1 A;  1Q6I A;  1TWC A;  4AL1 A;  2N04 A;  1ZYR F;  2PUS A;  1U0B B;  4O7G A;  1YF2 A;  4ZOL A;  2KYH A;  4BIU A;  4W4L A;  4LH6 A;  4DR3 O;  4EEQ A;  4OX9 O;  1NU1 H;  1WB7 A;  3C8G D;  1OW6 A;  2E3C A;  1XZQ A;  5L0D A;  4BJ5 C;  4DR7 B;  2XS8 A;  4CJG A;  5JRA A;  3CCE V;  3M8A A;  3HJC A;  3W8H A;  1KBH A;  5DLJ A;  2IH1 C;  1EA8 A;  1E1R G;  4DW0 A;  3OD4 A;  3N2K B;  2VQF B;  3DJU B;  1E85 A;  5B66 Z;  2RQ6 A;  1OCR C;  2EIM C;  1E2X A;  3VQY A;  3AG2 B;  1U97 A;  5D91 A;  4X1K B;  4W8K A;  1BR1 A;  2AVK A;  2TMV P;  4B3T O;  4KFM A;  3W7S A;  1VIB A;  5F5F A;  4X9Q A;  4CIH A;  4JVS A;  1I94 B;  4MVR A;  2W4M A;  5D92 A;  1O87 A;  1B68 A;  1ZL8 B;  1Q82 W;  5IDJ A;  1A41 A;  3OEH G;  3RN4 A;  1VAR A;  4NTB A;  2IBF A;  2JD3 A;  2HLD G;  1MMN A;  4X0R A;  3DXR B;  4DUZ O;  2HZ8 A;  4N6H A;  2EPN A;  1S5J A;  3E22 B;  2NUT B;  5A6B A;  1T6Q A;  4X62 O;  3CSK A;  4XTK A;  2LD6 A;  4LAC B;  1SZX A;  1P4R A;  2Q8V A;  5GTI Z;  5KX5 A;  4CH5 A;  1QNM A;  1M57 C;  1J5E O;  5BZB A;  2H8A A;  3CJH A;  4LLC A;  4YT5 A;  2XLO A;  1PL4 A;  5B1A C;  2VH3 A;  2I8B A;  2RD9 A;  3O39 A;  2WVN A;  3RYL A;  2BOB C;  4B3M O;  1M56 C;  2QKC A;  4DR4 O;  4OX9 B;  4YIP A;  3AQB A;  4RQF A;  1OZ0 A;  2N74 A;  2NNU A;  2QM7 A;  3WU2 Z;  2YDE A;  5L0C A;  4EBK A;  1GM7 A;  1XL4 A;  2OEV A;  3W2V A;  2JRI A;  5KYX B;  3EHN A;  3F7Y C;  4LF4 B;  3PJS K;  1XNR B;  3N27 A;  1WPX A;  3PN1 A;  1LI7 A;  1VEW A;  5F2V O;  3JZ0 A;  3QO8 A;  2V3C C;  3JAK A;  4JI0 O;  3JAT B;  5B1B B;  2WA4 A;  3FAV A;  5DQZ A;  1XUQ A;  2ZD9 A;  4LLE A;  4QPK A;  1NU7 D;  3G6E V;  1DOV A;  3VBB A;  4LC1 A;  3QW1 A;  4P2Z A;  1Z3I X;  3V5X A;  1NS1 A;  1JPX A;  3D8C A;  3K5O A;  3QVZ A;  4J80 A;  4O4H B;  1PCX A;  3PDM P;  2ZDI A;  3M4C A;  4RD9 A;  3J06 A;  5KHH A;  4J9Z B;  1U89 A;  3JYY A;  3RYC B;  4X62 B;  3JYH A;  3A0B Z;  2F66 C;  2C03 A;  3C8Z A;  4C7O B;  1JMW A;  2XUM A;  1KP3 A;  3N2K A;  1Y67 A;  2ZPA A;  3TOM A;  5KHK A;  4DJ9 A;  4PHZ A;  4JI1 B;  2CNW A;  4J11 A;  4MTG A;  4PDM A;  2ODM A;  3VQV A;  4X1K A;  1DOW A;  3BFR A;  4I50 B;  2QTV A;  2P0N A;  5LBQ A;  2UXB B;  1JMK C;  2JK5 C;  5BQH A;  2NUP B;  3OM3 B;  1S72 V;  1K34 A;  2ADP A;  3AG4 B;  3RYI B;  3CAX A;  3B09 A;  4GYC B;  4BIO A;  4B3M B;  3LAY A;  5DQT A;  2JJ1 G;  3UGO A;  1ZL8 A;  1TWA A;  4PA6 A;  2N05 A;  1NJI W;  1BDJ B;  3ZN1 A;  3ASO C;  1QCE A;  3LNR A;  5DEC A;  3OA1 A;  4JI4 B;  1ARO P;  1XIL A;  4DYL A;  1M9N A;  2VWJ A;  3DXR A;  1YI2 V;  1MNE A;  3E22 A;  3W2W A;  4WFA V;  2V26 A;  2NUT A;  1KC8 W;  4BW9 A;  3P3N A;  4DR6 B;  2M64 A;  2P1A A;  2LW1 A;  3SYA A;  2L6F A;  1E1Q G;  2FTK A;  2QWQ B;  5TIS Z;  2OEX A;  1LE4 A;  2UU9 O;  1Q3E A;  2DE0 X;  4RAI A;  1N33 O;  5B3I A;  1TKN A;  4HYO A;  1WAZ A;  3W7X A;  1U6H A;  3SYQ A;  2EIK B;  4D4X A;  4FZ0 A;  1H8H G;  3G4Z A;  3FD9 A;  1ZHW A;  5LGU A;  2X6A A;  4ZHQ B;  3OUF A;  1K8A W;  3WB2 A;  2L6G A;  4GKK O;  5L0J A;  2X6C A;  4GX5 A;  4QNH B;  1CPQ A;  1N4C A;  1ZHY A;  1RM1 C;  4J32 B;  1F23 A;  4ZBM A;  5LHI A;  5FLX N;  2AHY A;  4B3R O;  5KYX A;  1BR4 A;  3IQT A;  2A06 H;  3ABL B;  2CAZ C;  1S5H C;  2OIG A;  1IBK O;  3VOU A;  2UXD O;  2BE3 A;  3CSX A;  5K1P A;  1YZC A;  2D5R B;  2YWA A;  2ZIN A;  4CS8 C;  4O2A B;  3JAT A;  1XDC A;  4JKV A;  1P7G A;  1SF9 A;  4U5D E;  3I55 V;  3DTU B;  1G8X A;  2Q9C A;  1ENV A;  4YY3 B;  5DS5 A;  1WWP A;  3CCL V;  2CDY A;  2E5L O;  1FAP B;  2EPK X;  4W8P A;  3P32 A;  3RVZ A;  4DVY P;  2P4V A;  4AI8 A;  4O4H A;  3CRR A;  4X89 A;  2C2A A;  4ZLD A;  5B1O A;  1NFN A;  1QLN A;  3B29 A;  3N0T A;  3RYC A;  2M6Y A;  2OU6 A;  2R25 A;  1MQV A;  1MG1 A;  4C7O A;  5CI8 A;  2HV6 A;  2ITD C;  3IC9 A;  3U8V A;  1LKX A;  3ZJZ A;  3FMS A;  1XHZ A;  3CQZ A;  2F4V O;  4MVS A;  2ICW G;  4CS9 A;  3QMK A;  4CC6 A;  5T3W A;  3F47 A;  1UFB A;  1JPJ A;  3LEO A;  1YA9 A;  4I50 A;  4DRI B;  2YHS A;  1US6 A;  3QZC A;  2NUP A;  3SYO A;  3RYI A;  5DM6 V;  4OIR F;  1PL0 A;  4GKK B;  4EWC A;  4TT3 G;  5EGY A;  3U10 A;  4YJ3 B;  1I5Y A;  4YHH O;  3DE8 A;  3BEH A;  1LUV A;  2XL8 A;  2UXC O;  2UXD B;  3KG2 A;  256B A;  1GTO A;  3EVK A;  2H94 A;  3B8N A;  4FMT A;  2OT5 A;  1TUE B;  5L3V A;  1DK1 A;  4YJW A;  3P3P A;  4O6Y A;  2XAH A;  2IJH A;  5KYW B;  1TGO A;  3JAR B;  3L70 H;  2YIB A;  3KH2 A;  3FX7 A;  5EK0 A;  4PFP A;  1YTF D;  3T4D A;  3KL4 A;  4ZHQ A;  2VQE B;  2XL6 A;  4UCU A;  5F5H A;  3FB7 C;  1ZWI C;  5H6R A;  2JX0 A;  1DF5 A;  2KK1 A;  1G6U A;  4OPA A;  1W59 A;  3U0Z A;  1VLS A;  1QPU A;  3EGX B;  4JI5 O;  1YSC A;  3AG1 B;  1EKY A;  3FXH A;  3SPG A;  3CPW U;  2OCC C;  1OR2 A;  3CMA V;  4O4J B;  2QM8 A;  2ZXO A;  4FLU A;  3DC6 A;  1MMA A;  4GX2 A;  1Z5W A;  2CGO A;  3SPH A;  3S3X A;  4O2A A;  3N2G B;  1THZ A;  2EUL A;  5EYP B;  1AP6 A;  3K57 A;  5LMU O;  3GOR A;  2DI3 A;  4LDQ A;  4DV3 O;  4IWB A;  2YL7 A;  1VLT A;  1D1A A;  2PF4 E;  1FMW A;  2YVK A;  1QLE B;  5DN6 G;  4H0L B;  1GO3 F;  3BVO A;  4YJ2 B;  4YHH B;  1JJ2 U;  4WFH A;  2Q4P A;  2UXC B;  2Q73 A;  5K1X A;  4NCQ A;  2WPD G;  2XL4 A;  3U5S A;  2NSF A;  5E3A A;  4LFB O;  1R6K A;  5ITZ B;  4ABM A;  4BWA A;  4BJ6 C;  4CC5 A;  4PD4 F;  3TOL A;  2IM9 A;  1WNS A;  1R1B A;  3ZRW B;  2FAP B;  3JRT A;  1XBL A;  1ORS C;  3MD0 A;  4DV6 O;  4BJ6 A;  3HR0 A;  4PA3 A;  1W2B U;  1AP5 A;  1FD9 A;  1H2K A;  3I5Q A;  3S90 A;  4JGS A;  2LK4 A;  4DUY B;  4YJ3 A;  4PDV A;  3NYM A;  4JF3 A;  3U9M A;  3A2F A;  1JJO A;  4MW3 A;  1ST6 A;  2RMK B;  2IJK A;  3UGP A;  5L3C A;  3ZRX A;  1Q0D A;  1YAU O;  3DXJ F;  3GWL A;  1GH6 A;  4MTO A;  4XPW A;  1HE9 A;  1KP2 A;  1QVF U;  1TFO B;  1Q7Y W;  1TA8 A;  2R03 A;  1WAS A;  3X2Q C;  3AQC A;  4OIO F;  1ZSP A;  1XI1 A;  2UXX A;  5KYW A;  3JAR A;  4Z1V A;  1XZP A;  3JAM N;  2XLV A;  3JT1 A;  3AG7 A;  5L3F A;  4NXN B;  5CA3 A;  1SQX H;  3L74 H;  2HJM A;  1PM9 A;  1QHT A;  1E84 A;  5H2F Z;  2E74 B;  3AG1 C;  1Q8I A;  3IQ5 A;  2W45 A;  1WPB A;  4RO2 A;  1VQP V;  1HNZ O;  4AE4 B;  4LFA O;  3ECS A;  3EGX A;  2PZS A;  1BHB A;  5JVE A;  3POV A;  1YZA A;  1O9G A;  2ZE8 A;  3TJT A;  4O4J A;  3E8F A;  3WB0 A;  5AG2 A;  3HKB B;  2E87 A;  3CP1 A;  2KNH A;  3WOD F;  5EBL C;  2BE5 F;  2QE7 G;  4TV8 B;  1VF7 A;  3UR3 C;  3N2G A;  5EYP A;  3M4B A;  4GQH A;  3K1H A;  4ER9 A;  3VQX A;  3LDC A;  2LP4 A;  4DV6 B;  3NMK A;  2XS1 A;  1BZK A;  3HKK A;  5IWA B;  1MMM A;  1VQK V;  2PNO A;  4YIO A;  3MFN A;  1WJZ A;  4G7H F;  5L0G A;  4OIQ F;  2W4B A;  5BR8 O;  1BCC H;  4C7U A;  1LR1 A;  1YJ9 V;  1G4U S;  1NQT A;  4ZI7 B;  1VK5 A;  1UPG A;  4YJ2 A;  4U5C E;  1Z63 A;  1VQ8 V;  3ZHT A;  3RQG A;  1SQV H;  1NSG B;  1QSP A;  2QSA A;  3LJB A;  3FYE B;  1FFT B;  2WLJ A;  1VQ9 V;  3AEI A;  3UT5 B;  1K5S A;  4NTF A;  5ITZ A;  4B08 A;  3U8P A;  1GM5 A;  3THO A;  5JJJ B;  1VF6 C;  3C3T A;  1VYI A;  4JYB A;  2FKX A;  5E3C A;  5LXT B;  3ZRW A;  5HFM A;  1H2M A;  1VQN V;  2R72 A;  2A0L A;  4MTX A;  1FJG B;  2IYL D;  3IGA C;  2X0L A;  3DE9 A;  2Q7E A;  2FYU H;  1LUW A;  1RXQ A;  3R65 A;  3HB3 B;  3NMI A;  1HNZ B;  3W4Y A;  3RQF A;  1VQO V;  3E70 C;  5EC1 C;  3HLZ A;  5IYB O;  5A9G A;  3KPH A;  2JIZ G;  1E79 G;  2HMZ A;  3QG5 A;  3T6B A;  2CTR A;  3BA8 A;  3AG3 C;  1AEP A;  2FML A;  2M4E A;  3S27 A;  3PHF 2;  3B9Q A;  4LF8 O;  1CEZ A;  2XLM A;  2Y3G A;  2H7O A;  3ZHU A;  3K03 A;  3HKD B;  1VYK A;  5EHH A;  3CEI A;  4UCT A;  2HEP A;  4U7O A;  3DC5 A;  1AI6 A;  2ZXW B;  4JEA A;  2Q0A A;  1TUB B;  3LUT B;  1SQG A;  4PJ0 Z;  1XMO O;  1WN0 A;  1CP9 A;  2IH3 C;  3MHH C;  5IY5 B;  3DAG A;  3M79 A;  4UV9 A;  3SPI A;  4AE4 A;  4BJ1 A;  4DR2 B;  2GDS A;  5CN0 A;  2HJF C;  2R7R A;  4JW1 A;  1XEQ A;  1AB3 A;  1EI7 A;  1V54 C;  3EZI A;  3B0U X;  1F4M A;  2AWY A;  4H13 B;  2EIM B;  4X88 A;  2Q6A A;  3HKB A;  4KUM A;  1D1B A;  4ULV A;  3SYC A;  3G50 A;  5F28 E;  4TV8 A;  3SEO A;  2VCA A;  5A69 A;  1SZT A;  4D7S A;  5B5E Z;  3H65 A;  3TK0 A;  2GFH A;  5KUM A;  4K0D A;  1Z5V A;  1VB5 A;  1K33 A;  2R9R B;  3IFX A;  2DN9 A;  4N4W A;  1GAX A;  1JOG A;  2JGU A;  4WGZ A;  5CB4 B;  1JR9 A;  3TGU H;  4ZI7 A;  2JDI G;  4BR6 A;  3TCU A;  5KYU B;  3GEE A;  5B3S B;  1UG7 A;  4CS7 A;  5T1D B;  1IZ3 A;  3HKC B;  3J7A U;  4R32 A;  1Z2G A;  2Z5U A;  4I0X B;  2ETS A;  3DAF A;  3OTF A;  5JS5 A;  4I4T B;  2P7T C;  3V5Z A;  1A7D A;  1AR5 A;  3UT5 A;  2ZXR A;  2LFD A;  2X6B A;  1FR0 A;  1G8M A;  5LXT A;  4LNU B;  1I94 O;  4JAV A;  3W7U A;  1T01 A;  5B1A B;  1K05 A;  2XLE A;  4O6M A;  2WZF A;  3JAS B;  5EZY B;  4F6R B;  4LBE C;  2QA4 V;  4JZG A;  1K4D C;  4JYA B;  2DWE C;  4RUF A;  1M56 B;  1S76 D;  2ZE6 A;  3FB8 C;  2UUI A;  3CRQ A;  2J7P A;  2BCC H;  3JD0 A;  1P84 F;  4JTA B;  1T6I A;  1FFX B;  3B77 A;  1WGW A;  1YCI A;  2QTS A;  2HSB A;  4LCU C;  2A68 F;  1M2O A;  2ARH A;  1L3P A;  1OQC A;  2YLD A;  3ZVR A;  2HKV A;  1S05 A;  3KKB A;  3K79 A;  2QGN A;  4I9Q A;  3BRC A;  3SJC C;  3OGI B;  1K92 A;  2NPU A;  1QQ3 A;  1KB9 F;  4J7K A;  4JCZ A;  1MZF A;  1RJ9 B;  2ZQM A;  3BAA A;  2ZXW C;  2M7W A;  1H9G A;  4GKJ O;  3HKD A;  3LEV A;  2JJ2 G;  2YRF A;  4MW8 A;  3GWK C;  1IUR A;  4IGG A;  5JT4 A;  3C7J A;  3LSQ A;  3S29 A;  2GV9 A;  4ICG A;  3ZHR A;  5IY5 C;  1ZW2 A;  4E7Z A;  2EZP A;  3ZRV A;  4L8J A;  1FPO A;  4UFZ A;  4LF4 O;  1TUB A;  3UMH A;  1XNR O;  1C03 A;  3TD7 A;  4BJ5 A;  2F23 A;  2YS8 A;  5BMV B;  3U11 A;  1ZU5 A;  3K0D A;  2XXA B;  4JRZ A;  3RH3 A;  2ZIM A;  1K4C C;  4DBR A;  1EM1 A;  3QVN A;  1RMV A;  3B0V C;  4IAQ A;  2B1G A;  3SP1 A;  5E2Q A;  3VF0 A;  3T6G B;  3LS1 A;  5IJ0 B;  2YID A;  4U5G A;  4HNA B;  3KKY A;  4DRX B;  1KU2 A;  2R7S A;  2OQM A;  2GTS A;  5GW7 A;  3KCY A;  1BR2 A;  1S3J A;  3F5T A;  2R05 A;  2HG5 C;  1V55 B;  2I15 A;  5IYC O;  3E9V A;  5B3S C;  1AR4 A;  5CB4 A;  3ASO B;  3A9C A;  4GYT A;  1HP8 A;  5TJ5 E;  4UVC A;  3OT7 A;  4YL1 A;  5KYU A;  2IU0 A;  2E76 B;  3JD3 A;  4QE7 A;  3K59 A;  1IBL O;  5BQI A;  2B9Z A;  3HKC A;  3KZI Z;  4J9Y B;  4JI1 O;  3UO2 A;  4XEF A;  3ZHQ A;  4I0X A;  2PI4 A;  3JYC A;  1WOL A;  1LIH A;  4I4T A;  3FOO A;  4MT8 A;  1YDI A;  2Q9B A;  2F22 A;  5KHJ A;  2HFE C;  2UXB O;  3K9S A;  4MVQ A;  4TWK A;  3RWR D;  2IXN A;  4LNU A;  3LLI A;  4GKJ B;  3ZX6 A;  1W2W A;  3KYJ A;  2J0W A;  3CYO A;  3JAS A;  5EZY A;  1AJN A;  4F6R A;  2V7Q G;  4W4K A;  4JI4 O;  4J7T A;  5COG A;  4CIP A;  4WFF A;  1Y4C A;  3MX3 A;  1COW G;  1RM1 B;  4DR6 O;  1W0K G;  1FFX A;  1OKK A;  2ILM A;  3ASN C;  5FL7 G;  2PBE A;  1BS3 A;  4F6E A;  4Z1M G;  3O10 A;  2MHR A;  1MNG A;  1H7I A;  1OJH A;  1KMI Z;  4MVM A;  4MND A;  1EBO A;  4DV1 O;  2Q9L A;  3DM5 A;  3ZS8 C;  4U9E A;  3FHD A;  1R6N A;  1MSD A;  1RJ9 A;  3K08 A;  3GWO A;  2YXH A;  3GEH A;  2KKW A;  2R7U A;  1IVS A;  3K1I C;  1K9M W;  3V7O A;  3KYI A;  4FAP B;  5COF A;  1EZJ A;  1N1C A;  3OUS A;  5EIB C;  3ZMU A;  4U3F H;  4K7B A;  4HAM A;  2AW9 A;  1NG1 A;  2ASR A;  2OWO A;  3K1I A;  2GUZ B;  1M6T A;  1YHQ V;  3QTH A;  5JVD B;  1IBL B;  4CDY A;  4Q4Z F;  3L0I A;  5BMV A;  4Z9H A;  2XXA A;  2K9P A;  4LF6 B;  4DV7 B;  4JZ2 A;  4YY3 O;  3T1H B;  2ETN A;  3IEE A;  3AK3 A;  5IJ0 A;  4KP4 A;  4HNA A;  2J8W A;  1L8D A;  4DV4 O;  1V55 C;  1BGY H;  2FGY A;  4OPH A;  4DRX A;  3WG7 B;  4JI3 O;  4BAY A;  4CS3 A;  4FM2 A;  3CCR V;  2O9X A;  3L8J A;  2JGD B;  4WBN B;  3M15 A;  4RDA A;  3T2M A;  3LLK A;  1YJW V;  4LFC B;  2LQG A;  1FMV A;  3SNH A;  4GUN A;  4EKW A;  4M63 A;  3F7V C;  4WFG A;  1H2N A;  4JAU A;  2HVK C;  3M1C B;  3LNN A;  2NLJ C;  2P90 A;  1BE3 H;  1NBM G;  2V4D A;  5A6K A;  4FPP A;  2PX0 A;  3BA9 A;  3JSL A;  3CC4 V;  3J81 N;  4N21 A;  4XPY A;  3ZTM A;  1GMG A;  5KA6 A;  2IXP A;  3CC7 V;  4E0H A;  4JZA A;  2P22 C;  4FK5 C;  1W0J G;  2Q7G A;  1SQF A;  5L3D A;  2HHH B;  5COM A;  4DV1 B;  4E7S A;  2UXN A;  3EHB B;  5FZT A;  2XT9 A;  4EFB A;  4JPR A;  5LOV B;  4ULW A;  4XDK A;  5DED A;  2J9V A;  3O65 A;  1PPJ H;  3APO A;  2AGA A;  1SQP H;  2KJG A;  1IBM B;  2DQ3 A;  1ZUQ A;  4E0I A;  3OWT A;  3I4U A;  2RJZ A;  1HW2 A;  4PJN A;  1GKF A;  1M4U A;  4H4K C;  1ZTE A;  4ZLC A;  2WB7 A;  3S84 A;  1QU7 A;  2RCV A;  2R7W A;  3U3B A;  1A0B A;  3ZIB A;  3SGI A;  4R7C A;  5LA6 B;  3RKO F;  3RIP A;  4EB6 B;  2OCC B;  5LL6 Y;  1L0L H;  4UVA A;  3IC7 A;  4KXR A;  4UV8 A;  1Q6U A;  1QKR A;  4LWS B;  5FCL A;  5J2U B;  4E2L A;  4CS8 A;  3S3W A;  2OKU A;  2BSK B;  5KLV H;  4Z9J A;  2LJ2 A;  2J46 A;  2EPO A;  4DV4 B;  4WF9 V;  5LHG A;  2R7X A;  1GGQ A;  4JI3 B;  4XEV A;  2PGG A;  3K33 A;  1NTM H;  4JYC A;  2VQE O;  4DV2 B;  1LE2 A;  2P7V A;  3VAY A;  3OE7 G;  3CZ6 A;  2WWW A;  1VQM V;  2XAJ A;  4UXN A;  1HY5 A;  4MQ9 F;  2HSQ A;  1G4Y B;  5CBG A;  1WA8 B;  4J10 A;  2BOC C;  2P6V A;  3EXA A;  2F1M A;  1LS1 A;  3W7T A;  2GUZ A;  4CDA A;  4XBF A;  1AIL A;  2ZE7 A;  5JVD A;  2CH7 B;  2RDC A;  1QZX A;  5A6B D;  5L3B A;  4JTD B;  2IJJ A;  3F5W C;  1MND A;  4RUE A;  3C3S A;  4IYH A;  3M99 B;  3WG7 C;  3JAW B;  3JTL O;  1Q6H A;  4LDK A;  4ANJ A;  2XTA A;  2GHY A;  3CRM A;  3Q6N A;  2ZIO A;  4KI2 A;  2CE4 A;  4CS4 A;  2JGD A;  4WBN A;  1NFO A;  2HMQ A;  4CBC A;  3K66 A;  4N23 A;  2KSD A;  1SES A;  3GAN A;  5AC5 A;  5L3G A;  1NT2 B;  1WAT A;  3L8I A;  4TOI A;  4EBJ A;  3BHP A;  2WLH A;  2BL2 A;  4U5F E;  3TET A;  4CH4 A;  1JOY A;  1Q5O A;  2Y4U A; 
#chains in the Genus database with same CATH homology
 1YJN V;  5EBL C;  1AJQ A;  1B6Q A;  1PD3 A;  1PNL A;  2ZDI C;  2QE7 G;  2QKS A;  3RW0 A;  3CCJ V;  4CZZ A;  2HKO A;  3SPJ A;  3LDC A;  2DYS B;  1FXH A;  5CBF A;  2CK3 G;  2Y69 B;  1VQK V;  3OMA B;  1BMF G;  1K7D A;  3D36 A;  3MHS C;  2K1E A;  3LDD A;  5B1N A;  3X2Q B;  2MK3 A;  3CCS V;  2GSM B;  5CMU A;  3K04 A;  4LP8 A;  1P7B A;  3AG2 C;  4GX0 A;  2DW4 A;  1QR8 A;  2Q68 A;  1YJ9 V;  1NQT A;  2OTL V;  3I56 V;  2ZR3 A;  3ABK C;  1BHA A;  1VQ8 V;  4I9W A;  4R50 A;  3LSS A;  1OCZ B;  1OHH G;  5LGT A;  3RBZ A;  1K97 A;  3FYE B;  1FFT B;  2WLJ A;  3JD1 A;  1VQ9 V;  3AEI A;  1K5S A;  1NR1 A;  1QBZ A;  4JYB A;  2XAQ A;  4BIU A;  4UUJ C;  3ZRW A;  5HFM A;  1AJP A;  2XOK G;  3CXC U;  1RPR A;  3ABU A;  1VQN V;  2A0L A;  4MTX A;  3STZ C;  3K9A A;  3IGA C;  3FYI B;  2X0L A;  3WFV A;  5H9C A;  4ASU G;  3CCE V;  2IH1 C;  2ITC C;  1E1R G;  1AI7 A;  1SER A;  3R65 A;  3HB3 B;  1OCR C;  2EIM C;  1NVP B;  1VQO V;  5EC1 C;  3AG2 B;  4QPJ A;  5IYB O;  4GT1 A;  2JIZ G;  1E79 G;  2YEV B;  1VQ6 V;  2PI5 A;  4KFM A;  4RQE A;  3W7S A;  3STL C;  4MVZ A;  1KKD A;  2ATK C;  3AG3 C;  3JCZ A;  1OCC C;  4MVR A;  1CEZ A;  3TK1 A;  1Q82 W;  5IDJ A;  1JQ0 A;  3K03 A;  3OEH G;  3B8M A;  2P6J A;  2HLD G;  2JEU A;  2XND G;  3OFN G;  4U7O A;  4G27 B;  1AI6 A;  2HR3 A;  2ZXW B;  4DXW A;  1H8E G;  3BY6 A;  3OMN B;  1R3J C;  5B1B C;  3LUT B;  1P4R A;  1CP9 A;  3A0R A;  2IH3 C;  3MHH C;  5IY5 B;  1M57 C;  4FJC C;  4UV9 A;  3SPI A;  5BZB A;  2WLI A;  5CN0 A;  1YIJ V;  2HJF C;  1K73 W;  1V54 C;  4R8C A;  1F4M A;  2EIM B;  4X88 A;  1MSW D;  2Q6A A;  4KUM A;  2DYS C;  5B1A C;  1NH2 D;  3SYC A;  2Y69 C;  4MSW C;  1SZT A;  2BOB C;  1R3I C;  1M56 C;  1F51 A;  2B1I A;  3K3W A;  3AG3 B;  1OZ0 A;  5KUM A;  1FXK B;  2NNU A;  4RQF A;  5L3E A;  1K33 A;  1VQ4 V;  2QM7 A;  2R9R B;  1OCC B;  1GM7 A;  3IFX A;  3ZRS A;  1XL4 A;  2AHZ A;  2JEX A;  1PNK A;  1OCZ C;  3F7Y C;  3PJS K;  2WSS G;  1WPX A;  2JDI G;  3TCU A;  1GM8 A;  3QO8 A;  5B3S B;  1H2G A;  1MOF A;  4QIW F;  5B1B B;  2Z5U A;  3AG4 C;  2ZD9 A;  2P7T C;  1NKD A;  4QPK A;  1NR7 A;  3G6E V;  3VBB A;  4LC1 A;  4P2Z A;  2X6B A;  3SJQ C;  1JPX A;  1QR9 A;  1V54 B;  2Q69 A;  1G8M A;  1CPY A;  4JAV A;  3ZCC A;  3W7U A;  5B1A B;  2ZDI A;  4LBE C;  2EZO A;  2QA4 V;  1K4D C;  3ZN0 A;  2YSU B;  4J9Z B;  2DWE C;  4RUF A;  1M56 B;  1S76 D;  3FB8 C;  2DYR C;  3JD0 A;  4WCE V;  4GCZ A;  4XDL A;  1KP3 A;  4JTA B;  2X7R B;  3B77 A;  5C93 A;  1K3E A;  2WLL B;  2EIK C;  4LCU C;  1GK9 A;  3G71 V;  4PDM A;  2B5U A;  4MTG A;  2YEV A;  3K79 A;  2EIJ C;  5LBQ A;  1KEC A;  2JK5 C;  3OM3 B;  4H37 A;  1K34 A;  1K92 A;  3AG4 B;  1S72 V;  2EBO A;  4P30 A;  1KD1 W;  2JJ1 G;  3OAA G;  1S77 D;  4PA6 A;  2ZQM A;  2ZXW C;  2M7W A;  1NJI W;  3ZN1 A;  3ASO C;  1QCE A;  1BL8 A;  3ABL C;  2JJ2 G;  3FKS G;  4G2K A;  1ARO P;  4MW8 A;  1YI2 V;  1M9N A;  2IJI A;  2R9I A;  3CME V;  4TSF G;  3LSQ A;  4WFA V;  5IY5 C;  1KC8 W;  2EZP A;  3LDE A;  3ZRV A;  2H8P C;  1GM9 A;  2F43 G;  2XAG A;  3FB6 C;  3SYA A;  4MTF A;  1E1Q G;  2FTK A;  3UM7 A;  3CCM V;  1R3L C;  2DYR B;  3CCU V;  3K0D A;  4RAI A;  1PKX A;  5EC2 C;  1K4C C;  4HYO A;  3W7X A;  3SYQ A;  2EIK B;  2B1G A;  3ETG A;  2QTO A;  5CBH A;  1H8H G;  1FXK C;  5LGU A;  2X6A A;  3OUF A;  2W6J G;  2EIJ B;  1K8A W;  2DQ0 A;  1WLE A;  2QEX V;  3UKM A;  2X6C A;  4GX5 A;  4QNH B;  5GW7 A;  1FXK A;  4BIZ A;  1S3J A;  1RM1 C;  2HG5 C;  1V55 B;  1F23 A;  5IYC O;  4ZBM A;  5LHI A;  2A79 B;  2AHY A;  5B3S C;  3ASO B;  3ABL B;  1S5H C;  3T1C A;  4UVC A;  3VOU A;  3OR7 C;  3D3I A;  4MVU A;  2IU0 A;  3JD3 A;  4PA7 A;  4QE7 A;  3ABM B;  4J9Y B;  4PDL A;  2LFS A;  2PI4 A;  3JYC A;  3ZIA G;  3I55 V;  3DTU B;  4MT8 A;  1ENV A;  3ML0 A;  2HFE C;  1UJW B;  3CCL V;  4BW5 A;  3E89 A;  2Q67 A;  4MVQ A;  4TWK A;  3P32 A;  3SYP A;  3RVZ A;  2V1D A;  4MVO A;  2LP7 A;  4X89 A;  2C2A A;  3GB7 C;  5B1O A;  3CYO A;  1QLN A;  4P9O A;  1AJN A;  2W6I G;  2V7Q G;  1YIT V;  3W7W A;  1NH2 B;  3E8B A;  3JD4 A;  1MG1 A;  4WFF A;  3CCQ V;  2ITD C;  1COW G;  1RM1 B;  3ETD A;  3NXS A;  1W0K G;  3ZJZ A;  2WLL A;  4MVS A;  3ASN C;  5FL7 G;  3EFF K;  4Z1M G;  4Q20 A;  4WFB V;  1SET A;  4MVM A;  2EIL B;  1EBO A;  5EBM C;  1PNM A;  3SYO A;  4R6Z A;  2DWD C;  5DM6 V;  4FIP C;  4F4L A;  1R3K C;  3FB5 C;  1DF4 A;  1SRY A;  2Y48 A;  1PL0 A;  4XDJ A;  1R6N A;  4TT3 G;  3K08 A;  3GWO A;  1FXV A;  1I5Y A;  2OTJ V;  3LNM B;  3JD2 A;  3ZMV A;  1K9M W;  2WAM A;  1KQS U;  2WLN A;  1EZJ A;  1OCO B;  3OUS A;  3ZMU A;  4I5S A;  3BEH A;  4U7N A;  3ABT A;  4HAM A;  1HWY A;  1R73 A;  1H38 A;  3H01 A;  3KG2 A;  2W0F C;  1GTO A;  1YHQ V;  4H33 A;  4GX1 A;  2EJR A;  2H94 A;  3B8N A;  4FMT A;  2OT5 A;  1MAB G;  1TUE B;  1N8R W;  2XAH A;  2IJH A;  3ASN B;  1QLE C;  1M1K W;  1AI5 A;  3ZMZ A;  2XAF A;  4UVB A;  3OW2 U;  1EFR G;  5EK0 A;  3QO7 A;  1YTF D;  3E8G A;  3T4D A;  4KP4 A;  3DGE A;  1V55 C;  1K5Q A;  3FB7 C;  2KB1 A;  2LFR A;  1ZWI C;  5H6R A;  1AI4 A;  3SPC A;  3WG7 B;  4BAY A;  3CCR V;  1DF5 A;  4JTC B;  3T2M A;  1ORQ C;  1YJW V;  4PA4 A;  3ZMT A;  2EIN C;  3E86 A;  3QO5 A;  4EKW A;  3F7V C;  4WFG A;  1YTF B;  5H6Q A;  1YSC A;  3AG1 B;  1Y66 A;  3ABM C;  4JAU A;  2HVK C;  4HZ3 A;  3SPG A;  3CPW U;  2OCC C;  3CMA V;  2NLJ C;  2IU3 A;  2QM8 A;  2WLK A;  2P90 A;  3CCV V;  1NBM G;  5LHH A;  1RPO A;  1DLB A;  3OR6 C;  4FPP A;  3E35 A;  4GX2 A;  3CC4 V;  4N21 A;  3SPH A;  3HPL C;  1GMG A;  1THZ A;  5KA6 A;  3CC7 V;  1XL6 A;  3E8H A;  5LGN A;  4DO2 A;  4FK5 C;  1W0J G;  5L3D A;  1VQL V;  1NVP D;  2UXN A;  3EHB B;  1FS0 G;  3ZMS A;  4JPR A;  5KA5 A;  4XDK A;  2HVJ C;  3OMI B;  5IYD O;  1QLE B;  1ROP A;  4WFE A;  1F4N A;  5DN6 G;  1DTO A;  3K0G A;  1GO3 F;  3CD6 V;  2DQ3 A;  1JJ2 U;  1QVG U;  4WFH A;  4QJF B;  1GKF A;  3ABK B;  2WPD G;  2EIN B;  1R6K A;  4X8A A;  5KUK A;  4R7C A;  2EIL C;  2OCC B;  1LNQ A;  1VQ5 V;  4UVA A;  3IC7 A;  3ZRW B;  4UV8 A;  4G28 B;  3MD0 A;  4PEL A;  1L1F A;  1VQ7 V;  4QE9 A;  4PA3 A;  4E2L A;  2P67 A;  4JAS A;  1JCH A;  1W2B U;  5J9P C;  3K06 A;  3RVY A;  4WF9 V;  5LHG A;  2Z3Y A;  2IW5 A;  4L87 A;  4JGS A;  1S0V A;  1I5X A;  4JYC A;  5HFL A;  4PDV A;  1OCO C;  3OE7 G;  2WWW A;  1VQM V;  2XAJ A;  4UXN A;  2ZR2 A;  4JF3 A;  4MW3 A;  1IXM A;  1G4Y B;  4PDR A;  5CBG A;  2BOC C;  2IJK A;  2WLM A;  1M90 W;  5L3C A;  3ZRX A;  1OCR B;  4ZKI A;  3W7T A;  4XBF A;  4MTO A;  1Y4M A;  1KP2 A;  1QVF U;  4P9P A;  5E1A C;  5EBW C;  1Q7Y W;  3OEE G;  3ETE A;  1JX9 A;  4MS2 A;  4PA9 A;  5L3B A;  4JTD B;  2IJJ A;  3F5W C;  3X2Q C;  2UXX A;  4RUE A;  3CC2 V;  3E83 A;  3WG7 C;  3M99 B;  1JVM A;  3P30 A;  5L3F A;  2GHY A;  1Q86 W;  3QNE A;  5CA3 A;  3AG1 C;  1J95 A;  4OXS A;  3OGC C;  2A9H A;  4CBC A;  3T4Z A;  4N23 A;  4RO2 A;  1VQP V;  2D3O W;  4YXW G;  3E2E A;  1SES A;  1Q81 W;  5L3G A;  2WLI B;  1BHB A;  2XAS A;  3G4S V;  1AR1 B;  3E8F A;  2WLH A;  1M57 B;  3TET A;  1JOY A;  3CP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...