2ZD9A

Structure of a bacterial cyclic-nucleotide regulated ion channel
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
APLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQLVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
molecule keywords Mll3241 protein
total genus 59
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zd9A02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 2zd9A01
4GX5A 4MVSA 3RVZA 4H33A 4G28B 2WLJA 1K4DC 2AHZA 2YEVA 4J9ZB 2A79B 5EBWC 4MW8A 2W0FC 3K08A 2ZD9A 3K06A 3T2MA 3JYCA 3AG4C 1R3KC 2WLLA 2EIMC 3F7VC 2A9HA 1M57C 3E8FA 3F5WC 3UKMA 3SJQC 2Q69A 4PA7A 2QKSA 2DWDC 3K0DA 4RUFA 4RAIA 5CBHA 4P30A 3OUFA 4WFGA 2HVJC 4MS2A 3X2QC 3GB7C 4EKWA 4LP8A 4QNHB 4R8CA 5KUKA 3E8HA 3HPLC 4P9OA 3UM7A 4PDRA 3SPIA 3WG7C 2Q68A 4PDMA 1V55C 2ITDC 1K4CC 3TETA 3AG1C 1LNQA 1M56C 1JVMA 2HFEC 2WLNA 1ZWIC 3K04A 5EBLC 2Y69C 4XDLA 3T4DA 3OUSA 4MVUA 1KKDA 2EINC 3AG2C 4WFFA 1R3JC 4R7CA 2QTOA 3FB6C 4XDJA 3SYAA 3IFXA 4JTDB 2DYSC 4PA4A 4P2ZA 2DYRC 4GX2A 2EIJC 2WLMA 4R50A 1OCCC 3E8GA 3OR6C 3ZJZA 2BOCC 4F4LA 4WFHA 4KFMA 2HJFC 2A0LA 4ZBMA 3STLC 2WLIB 4H37A 5KUMA 4RO2A 4PDLA 5B3SC 5J9PC 1BL8A 2EIKC 2X6BA 3SPGA 1QLEC 4CBCA 3T1CA 4J9YB 3FB8C 2WLKA 4OXSA 2NLJC 3VOUA 4QE7A 5BZBA 1G4YB 5CBGA 3SYQA 1OCZC 2ITCC 4TWKA 2Q67A 2WLLB 2Q6AA 2X6CA 4MTGA 1XL4A 3STZC 4JTAB 1V54C 3SPJA 4PA9A 2KB1A 4LCUC 4MVZA 2JK5C 4HZ3A 1ORQC 4WFEA 3E8BA 4X88A 2HG5C 4MVRA 3RVYA 1XL6A 3LUTB 3SYCA 3LDEA 1P7BA 3ABKC 5IY5C 3BEHA 3TCUA 1OCOC 4MSWC 5EC1C 3SYOA 5EC2C 3SPCA 3FB7C 4RUEA 5EK0A 1S5HC 4UUJC 3LNMB 3E83A 4QE9A 5CBFA 4GX0A 3OR7C 2IH3C 2ZXWC 2ATKC 4X89A 4XDKA 3FB5C 2AHYA 3LDDA 2H8PC 4HYOA 3K03A 3EFFK 3RBZA 4DXWA 5B1BC 2K1EA 3R65A 1R3IC 2WLHA 3PJSK 4MTOA 5B1AC 3E86A 5EBMC 2X6AA 5E1AC 2HVKC 3ASNC 4G27B 2P7TC 3KG2A 2IH1C 3ABLC 3LDCA 4R6ZA 4PA3A 2R9RB 3F7YC 3IGAC 4PDVA 2OCCC 3ZRSA 4MVQA 3OGCC 4I9WA 1J95A 4X8AA 4MVMA 2EILC 3SPHA 2DWEC 3RW0A 1OCRC 3ABMC 3SYPA 3K0GA 4MVOA 4BW5A 4LBEC 1R3LC 4GX1A 4MW3A 2BOBC 3AG3C 3E89A 3ASOC 2WLIA 3T4ZA 4JTCB 4MTFA 4P9PA 4PA6A
chains in the Genus database with same CATH superfamily
3ZMUA 1QR9A 1KECA 2V7QG 1ROPA 3JD4A 3P3NA 1JJOA 1PL4A 2W6JG 2LP4A 4E0HA 3UMKA 2EIMC 3F7VC 3K57A 3TGUH 3ZWIA 3JAWA 1W0JG 3PMRA 3NYLA 3BHPA 1W0KG 5KAFZ 4NQFA 3I4UA 2OEVA 2QEXV 4QNHB 3B77A 4EIYA 1QVGU 3HNKA 4MTXA 4PDRA 4PDMA 3LSUA 1VK5A 4BAYA 3RIPA 2TMVP 3NXSA 4DV7B 4NTAA 2H8AA 1URFA 3K04A 1YHQV 1T6IA 3QW1A 4Q7CA 4J80A 3K33A 3RFRA 5AC4A 1M4UA 1S3JA 1Y66A 2QE9A 3HNLA 3GEEA 4CJGA 1YARO 2C2AA 5L0FA 2D3OW 3QNEA 4Q20A 4IT5A 4YT2A 5JP7A 4NTWA 4FFKA 1MMDA 5KA6A 3E8GA 1M56B 4QI0A 1Z2GA 4LWSB 2IU0A 3ZRWB 4IL6Z 1U6HA 2Q9BA 5D91A 1EM1A 2F66C 4PDLA 4EB6A 1WWPA 5KYUA 3SPGA 3PN1A 4CBCA 2VC9A 3CRAA 1OCOB 3P3PA 5LMNO 5BZBA 4NC3A 3RN4A 4LC1A 4DUYB 4DV5O 4AQYO 2WLLB 5BQGA 2E75B 4MTGA 2UXBO 1V54C 3NYJA 2RN9A 1SKVA 4E7SA 3UGOA 1A0BA 4JCZA 4X66O 4MSWC 2VRZA 3ZDLA 5DQZA 3WB1A 3UT5B 4OINF 2YIAA 1Y76A 2OCCB 3Q7LA 4O4LB 3OR7C 4ZHQA 4YHHO 1YCIA 4TQDA 2IXMA 4J7TA 2Q0AA 1V4AA 3C8ZA 3LSQA 4MT8A 3R65A 3APOA 3UO2A 1EQ1A 1JR8A 2W45A 2QTSA 2UXBB 1EN6A 1IX9A 4JI3O 3G67A 3RYCB 2RNBA 1V55B 3CJHA 3QO7A 4JI2B 5GPGB 256BA 3RH3A 4FLYA 4DOZA 2YDEA 4NTBA 2ZNJA 4FESA 1VF7A 3ATPA 4FLTA 1TKNA 2Q8VA 4XPYA 2RD9A 1K33A 1O9HA 1NH2D 2JJ1G 2L6LA 2BSKA 4D7SA 1XOUA 4H54A 3A0HZ 4TUYB 1FNTc 2GFHA 2Q7EA 4LF8B 2Z15A 2L35A 2A9HA 5JJEB 4DR2B 3RYHB 5KYWA 1HY5A 3CD6V 2YLIA 5JVDA 3CE2A 1XMQB 1BE3H 1VEWA 1OW6A 2EINB 1VLTA 3NG1A 2A3QA 2UXNA 4C7UA 4YWQA 4DV4B 3E8HA 3G6BA 3JRMO 1J5EB 4KL1A 5BXZA 3SPIA 1KP2A 4BG0A 1Q90D 3ECSA 5FLXN 2ZE8A 2Z3YA 1R1BA 1NI8A 4WFBV 3QW0A 4JI4B 4O4HA 5GTHZ 4HEAJ 4YJWA 1S0VA 5L3VA 1N8RW 3CRCA 4JKVA 2BC5A 3ZC4A 4LLCA 2WLMA 4Z9IA 4AE4A 5EYPA 4C7OA 1DOWA 1M1KW 4JIOA 3IHUA 3SEOA 2WSSG 1AUEA 4DJ9A 2XL6A 3RQGA 1FD9A 2X6BA 2XNDG 1WLEA 4X62O 3EHNA 3ZVRA 3H2UA 3Q6MA 5IDJA 1CGOA 3LLIA 3FX7A 4Z9JA 3FVYA 4FIPC 2E76B 2FAPB 1XL4A 5DECA 3UCSC 2EPLX 2JK5C 1G4WR 3HKDA 4B3TO 4CIPA 2ZT9B 3CCVV 1GAXA 1JPXA 3JCUQ 3RFYA 2J0WA 3T1YB 4DR3B 3SNHA 5CBFA 1TVKA 3KCYA 4K0KO 4X62B 5IYZA 2FB5A 4WJ0A 4U9DA 1OW8A 4PR9A 2QWNB 5ITZB 2K1EA 3O10A 1ZW3A 4D4NA 1SC5B 5JS5A 3S84A 2ZDIA 2P0NA 3ASNC 2CTPA 1PKXA 4CX9A 1KKCA 3SR2C 3ZRSA 4CJOA 2GTSA 3L72H 3RF3A 1QQCA 4PJLA 3TQOA 3RGBA 4PFOA 2YC0A 1Q0MA 1K9MW 1CEZA 1A7DA 1Q81W 4DRXA 4J42A 3ABMC 3B8NA 2N74A 2YIBA 4OD4A 3W7TA 1HNZO 5J2TB 1BZKA 1ZU4A 2A1DD 4PA6A 4CS8C 3ETDA 4JYCA 4BJ6A 2AHZA 3AOUA 2GDCA 4LF7O 1ZVZA 5CI8A 1IBLO 5LYJA 3C8GD 1VQ6V 1LR1A 3OFNG 3KH2A 5HSWA 3QVNA 4DYLA 4JI7B 4X1YB 1VQOV 4YIPA 1VQ8V 2VWKA 2F95B 1QQ3A 3L9DA 1MG1A 4OX9B 2LCHA 3UQ8A 2F43G 3CCRV 3T1YO 2Q3TA 3UM7A 2G3KA 2CYDA 4DR1O 1JMKC 2R9AA 3M8AA 3F46A 4IJJA 1LNQA 4YJ2B 2GUZA 2OJQA 2P7VA 1SS3A 4LF6B 1TWAA 1BHAA 3HKCA 3RYLA 1RFYA 4U5HA 4WFFA 1NVPD 4BIOA 3FB6C 2QM8A 1RM1B 1XMOB 4JI7O 3M79A 2XAGA 2DYRC 4TV8A 5CA0A 1E2XA 2HHHO 4CH4A 4OIQF 4B3SB 4U5BE 3UMHA 3ZHSA 3NKEA 3HNJA 1AP6A 4YT5A 4ZBMA 2DOSA 4UXNA 2PFDA 1RPOA 3B09A 3ZX6A 1NU7D 2ZDIC 4G2KA 3JAKB 4JJGA 3W7SA 1JX9A 4YL1A 4G7OF 3TK1A 4X0RA 3KMIA 3Q4HB 2OG2A 2E74B 2HKVA 3R66A 3SYQA 1SF8A 3STZC 1AJNA 2XXAA 2KB1A 2J9WA 1UPGA 4JYBA 1EI7A 2HG5C 1BQ0A 1DLBA 4PJNA 1VB5A 2P06A 2JS3A 1FYJA 3EG9B 4I5SA 2WVNA 1XREA 2F4VB 2ZE7A 3HKBB 5JH7A 5KHJA 4P6IC 3ZG1A 3BVOA 4I7ZB 3AQCA 3C3TA 4XPXA 2NNUA 1FAFA 2A06H 2YXLA 2OEXA 3ITFA 1QLNA 2JEUA 4B3RO 4JI8O 1YXBA 2FMLA 1JOYA 1APCA 4IRUA 3W2WA 1B68A 1QBZA 3CEIA 2KC3A 4RD9A 4B3TB 4R32A 2UUCO 4DV3B 4BJ5C 2JGDA 4E18A 3GEIA 4LF4B 4X64O 3UGPA 2DWEC 5F28E 2MHRA 4ABMA 2EPMX 3K6BA 1WA8A 4MW3A 4PELA 5LHIA 4MTFA 4XLNF 2E5LB 3EZHA 1YI2V 5KYUB 2NN4A 1I08A 1YTFD 3ABLB 2KQ9A 1Q3EA 1NFOA 4Z1VA 1P4RA 3K3WA 2IW5A 4JI1B 2DN9A 4D4XA 4I44A 1Z7Qc 5C8YA 2WLLA 2AWYA 3JCZA 1NLXA 1AR4A 3US6A 4BJ1A 2XAHA 2OIEA 4CS9C 3ZHUA 1RXQA 2IXOA 1JJ2U 2XL8A 4DV2O 4IGGA 3S9OA 3ZTMA 4LDQA 3KKYA 4TSFG 3S3XA 2HSBA 2WZLA 1V9PA 4DK0A 4N6HA 3P30A 4FLZA 4FZ1A 4I55A 3FDQA 5EBLC 3ML0A 1UG7A 5CMUA 1YYJA 4BR6A 5LGNA 3ETQA 2F22A 5COGA 2VS0A 4N06A 4GX2A 3RYCA 1K04A 2M4EA 3T6JA 4AL1A 2H3OA 4GKJO 1LUWA 1YEWA 3NDBB 5HFLA 2P22C 2J7PA 3Q7GA 1AVOB 1Q5OA 2WLIB 2VCBA 4QJFB 5T1DB 5DN6G 4DV6B 1MNEA 2J9VA 3L8JA 5DVWA 2WLKA 4TUYA 3ICXA 4OXSA 1PV3A 3B71A 4DV6O 2JVDA 3MX3A 4BEJA 3RQFA 2Q67A 3OE7G 1JPNA 4UB6Z 4RQFA 1I5NA 4PA9A 4LCUC 3HKEB 2OT5A 4I1OB 4JPRA 1GN6A 3E9VA 2D2CB 1YA9A 2LP7A 2Q00A 1EN5A 1U96A 4E17A 1FXKB 3U10A 5EK0A 2IOQA 2J9UA 3E83A 3WFVA 4I4TB 2VQEO 4CIHA 2CUGA 1ZHZA 4LF5B 5KMGB 1SQVH 1IDSA 1OJHA 1R3IC 4O7GA 2CE4A 3E86A 3THOA 1YYXA 4O4IA 3O9OA 4CH5A 4YL0A 4ANJA 3EZIA 4C7OB 3AGUA 5DS6A 2XLWA 5JSLA 2GA0A 3T4ZA 4JTCB 3T1HO 4Q4ZF 3N24A 3PHF2 1W2WA 1KNYA 1N33O 4B7KA 2CGEA 4NYKA 4QPKA 1GTOA 4G28B 5LXTB 5IYCO 1LUVA 3SP1A 5EBWC 2ZD9A 3IQCA 2LFFA 2YL0A 4J7JA 3HKKA 4JYYA 1DOVA 1M57C 3E8FA 5E79Z 3WHNA 3HKDB 3H1HH 2Q7GA 3RYIB 2ZIMA 3OUFA 4LF4O 3E22A 2Z0AA 1AI5A 3X2QC 2OJED 4HFFB 3DMDA 5D5QA 2V4DA 1XNQB 1VQ4V 1YZCA 3D36C 4DW0A 2DYRB 4G0HA 1AR5A 3W8HA 4DV7O 3EGDA 1F1MA 2J9BA 4M63A 5L0JA 2HFEC 3SJCC 1NU1H 3OUSA 3V5XA 1YSCA 4UCUA 3CQZA 4ZI7A 2NSFA 5J2UB 4RDAA 3E35A 5H2FZ 3ZHVA 4PA4A 2DYSC 2UXCO 4P2ZA 4RBNA 1GN3A 5EIBD 2OTJV 4FPPA 3LNRA 4JI1O 1DGSA 4DRXB 1FS0G 1LS4A 5L0IA 3TOMA 1SF9A 3I5PA 4C3DA 3CXHF 4K8ZA 1MMGA 2BL2A 3I56V 4RO2A 3SGIA 4ULVA 3J81N 1T6UA 5CB4A 2H7BA 2Q4FA 5LA6B 1AJPA 2Y4TA 5KHIA 2ODMA 1XUQA 4TWKA 1FFTC 4DW1A 2Q6AA 1L3PA 4IYHA 2WVQA 2KK1A 1Q6UA 3GM1A 2PTMA 4JYAO 2ZKOA 3LDEA 1Y4MA 2NUTA 1N32O 3U9MA 4EWCA 2V3CC 4B7EA 1G5ZA 1Q8IA 2YWAA 1VQMV 4LLEA 3CSKA 1CGNA 3MBGA 4PFPA 2ZXWC 2ZINA 2IM8A 1FKAO 2CGOA 5A6JA 1VF6C 4O2BB 1VF5B 1JOGA 5A6AA 1K8AW 2CTRA 1N34O 1RJ9B 2H7OA 2LIGA 4IARA 3J06A 2PYJA 3KG2A 1RKCA 2YIDA 3O6XA 1RKEB 3I5DA 2GWWA 1J95A 4KNWA 1YLMA 1H9GA 1FAPB 4HNAA 3LSSA 4ZLDA 4YJ3B 1L8DA 1T9KA 1AR1B 1NTZH 3DXRA 2F4VO 3LS1A 1IXMA 2XAQA 1D0YA 2YI8A 4BJTA 2J0XA 5COFA 1RSOB 5A6BD 3JAKA 4BW9A 2KYHA 1VQLV 2LQGA 3QVZA 3JD1A 4D7TA 4I9QA 4MW8A 2W0FC 3K08A 1ORYA 2ASRA 1H2MA 4J7ZA 3N2GA 5AGFA 4IAOA 2HMQA 1MZFA 1FTSA 4W8PA 2NUPB 3O65A 2DWDC 2ZE5A 3FMSA 3B8MA 1EZVH 3W8IA 1T5EA 2Q5ZA 3W7UA 5KUKA 1YITV 4B3SO 5JH7B 3T4RA 3AK2A 2IU3A 2KW3C 2Q68A 5EZYB 1V55C 1K97A 1XMOO 2ZNIA 2R7QA 1S5JA 1G4US 1WB7A 4IB4A 2ZR3A 2PGGA 4DVYP 4K0KB 1N0NA 4QPJA 1KKDA 4FAPB 2QWPB 2X51A 3EH1A 2FL4A 4O6NA 4XDJA 3TOLA 3IFXA 1TWGA 3JD3A 2QWQB 3OEHG 2JGDB 3J80N 1WOLA 3B0UX 2DI3A 1AP5A 5B66Z 3CCJV 4KNVA 2LW7A 1D1CA 1MQVA 5BQIA 4NTXA 5B3SC 2YVKA 2O9XA 3I5QA 4JAUA 3FB8C 4BIUA 3TK0A 2N05A 1ZX3A 3U11A 3NKDA 2B9ZA 3JATA 4W4KA 4JRZA 2ETSA 3CXCU 2YKZA 2WZFA 3SPJA 1SMYF 3DM5A 4HZ3A 1TAEA 2Q9LA 4MVRA 4DR4O 4ZLCA 3SYCA 5JT4A 4FZ0A 1YVWA 1JA8A 2Y3DA 4GLXA 1L1FA 3CC2V 3SPCA 2HZ8A 1S5LZ 1SR2A 3FOPA 3LNMB 3L34A 3RKOF 1QPUA 2YQYA 5KYNA 4XDKA 2HKOA 4RQEA 1XMQO 4EEQA 4JVSA 4KXRA 4I50B 3WU2Z 3A9CA 5GTIZ 4DVZA 2I8BA 1Y67A 3LDCA 4PA3A 2R72A 1GM8A 4CC6A 4JI6B 4JI5B 4JJFA 3EGXA 3DC6A 4LWSA 1VQKV 3RT3C 1OCRC 2H7VC 1E83A 4LFBO 4FJCC 2Y0PA 2BOBC 1LM3B 3JD2A 3C18A 3FOOA 3EVKA 2ZXRA 1JRAA 4LFCB 2P1AA 3BFRA 3SXKA 1SZTA 5CN0A 2IYLD 2ARHA 1DK1A 4JZGA 4K8XA 2QKSA 1BHBA 4ASUG 3GB7C 5E33A 1B04A 4Q6GA 4BPMA 5L0DA 5KA5A 3UT5A 3B40A 3WG7C 3K1IA 1VMGA 1PP9H 3NMKA 5LGTA 4I4TA 1M56C 2PP4A 2FKXA 2Y69C 3T4DA 5KMGA 3J7AU 4X65O 4UDVA 2XLDA 1Z3IX 4ZKIA 2ADPA 2M7WA 4LDKA 3FAJA 3E2EA 1KBHA 4LR3A 4O4IB 1YJ9V 3EPVA 4AX2A 2A6HF 5L3EA 4CDAA 4AI8A 3BCCH 4O4JB 4DBRA 3KYJA 1TQGA 1NQTA 4ULWA 2PX3A 1YDIA 4LF8O 1EKYA 2ZXPA 1PL0A 2B5UA 5DLJA 1RP3B 4DUZB 3RWRD 4EBJA 3VYWA 2EIKC 2PYLA 4N21A 1YA7O 5B5EZ 1K5QA 5LXTA 2KGOA 1S05A 4JCHA 4KI2A 4FFBA 1K05A 2XLEA 3RYFA 2DE0X 1FR0A 5KYWB 2A68F 1VYIA 4P9TA 5JVDB 3RYIA 4DO2A 1XL6A 3TULA 2VWJA 3AG2B 2QSAA 4HFKB 3ZTZA 3ABUA 1E1QG 3TCUA 2YLDA 5LOVB 1OR2A 2PF4E 1H38A 4FVMA 1JCHA 3LAYA 1H6GA 3QTHA 4UUJC 2EIJB 1FFTB 2YI9A 3EGDB 2G3VA 2QTVA 3BA8A 2HSQA 3DI5A 3ZSUA 2JX0A 1PD3A 5B1BC 4O4HB 2WLHA 5J2UA 1QHTA 2EIKB 3JARB 4AILC 2QNLA 2IH1C 3K5LA 2R03A 4JZAA 3SYNA 4D6TH 1PNKA 1JFFB 4MVQA 1KQSU 3H2VA 4N4WA 1I4YA 4X1IB 2O57A 1Q82W 3K0GA 1R3LC 3AG3C 2HFIA 1H2NA 1A32A 1B3QA 1SQFA 4GKKB 4LDRA 4U5FE 2R7XA 4PI2A 1I5YA 5CB4B 5L3BA 1XWJA 1BSMA 3L74H 4J10A 1Z5WA 2CTWA 1NKDA 1SA0B 2R7VA 1TGOA 1WP7A 2XOKG 2E5LO 1J8YF 2B0JA 3AGTA 4DR2O 2AP3A 3T9OA 2CAZC 2EJ7A 4C3EA 4P30A 4GQHA 4WFGA 5B1BB 2YZSA 3TJ5A 3A0RA 1NH2B 3GODA 4A2NB 2UUAO 4R8CA 2L9JA 2HUJA 5JRAA 5IYDO 4GZRB 5LHGA 1IZMA 4KC9A 4WGYA 5CIVA 4OIOF 2ITDC 2UXDO 3VRCA 1Q86W 5H6QA 1VOMA 3CRRA 1QU7A 2W6IG 2QJ1A 1LIHA 1E79G 5ITZA 1R3JC 1RJ9A 2R7SA 2UUBB 1C03A 1BT8A 4JI3B 4YT4A 1PD0A 1OR3A 2KNHA 4OIPF 3C63A 1WNSA 3OAAG 1MSWD 3OR6C 2X0CA 2HEPA 1FXVA 1Z5VA 4CDVA 4U5DE 3DXRB 4ONSA 2XLMA 1NBBA 1RSOA 2FFHA 2YUAA 4JURI 1PD1A 3EJNA 1O5HA 3AK1A 2LO1A 1R6TA 1WASA 2F93B 3C62A 2R7TA 4TV9A 1KP3A 4JASA 2X6CA 1ORSC 3GANA 4JAVA 1P7GA 2HP8A 3ASOB 2NUPA 3MD0A 2GHYA 5KX5B 3K5MA 2CNWA 3HLZA 3JSEO 1M2OA 1QCEA 2Q7RA 1G6UA 1ZHWA 3CMEV 1H9TA 4B3MO 4UCRA 2EIMB 2KSDA 3PDMP 1CPYA 4X89A 5L3CA 2RQ6A 3KZIZ 1S76D 2AHYA 3MDSA 1Q0GA 2Y3HA 3HKCB 3L70H 1HNXB 1TUBB 3H1JH 2IXPA 2BE3A 3ZBHA 4BEMJ 4JZ2A 3L71H 2M64A 1L0LH 4J7YA 3H01A 4TV8B 5CA0B 1OV9A 1I94O 2ZR2A 4LH6A 2YLGA 4QIWF 2AVKA 1EBOA 5AG2A 1GQAA 4H4KC 5A6KA 1NT2B 4UVBA 3UR3C 5KLVH 4P9PA 3UNGC 1QR8A 2A7WA 4WFAV 2P6JA 2VB6A 2Z5UA 4JAAA 1NZEA 1R6NA 1K40A 2PX0A 3JATB 2BE5F 3K9SA 2E87A 1OCRB 5TISZ 4OGQB 1S72V 3UKMA 4EFBA 1BR2A 2YL1A 1XHZA 5D92A 3L0IA 3S3WA 5CBHA 5KYYA 2VCAA 4EKWA 1YF2A 4BJ6C 5JUAA 1M93A 3HKBA 4X9QA 1VP7A 1XQ8A 1E1RG 2MWQA 4NTYA 4U3JA 3ZN0A 5E3AA 3ZRVA 1SQQH 3DM9B 3VBBA 1MABG 3M4BA 4OD5A 1BCCH 4XDLA 4GYCB 3NMIA 4FM0A 4MVUA 3CC4V 4DV1B 2G62A 2LGQA 4X64B 5IJ0B 1ZHTA 4R7CA 2ZE6A 3CRQA 1NR7A 4YN0B 4UFZA 1K7DA 4LNUB 4DR3O 5JQGB 2BTOA 2UUCB 1H2SB 4U5EE 1QKRA 4LFAO 1GGQA 3GM3A 1IZ3A 2BOCC 4IHJA 1MMMA 3UO3A 2DW4A 5DQTA 5L3GA 3W7XA 1GM9A 5KHKA 3M99B 4FLWA 2R7WA 4J32B 2EULA 2R7RA 4JI6O 1ZL8B 5LBQA 1VQ7V 5CA1A 1G1XB 2D5RB 2GV9A 4F6EA 3MLGA 4DV1O 2KKWA 2ITCC 2EZOA 3WB0A 1BDJB 1GO3F 2GTAA 5H6RA 4J30B 1OZ0A 3DGEA 1XNRB 3ZMZA 4DRIB 1VLSA 2L6GA 3BRCA 1DTOA 1XILA 3QG5A 3EH2A 5EC2C 2GBOA 4KHPO 1AI4A 1NJIW 3MYFA 1B06A 1D2DA 3CCLV 3ZQVA 2G38A 4I55B 2IH3C 1THZA 2C04A 1AI7A 2AGAA 1T01A 2F23A 4NXNB 1E85A 2QLAA 3HB3B 1MNDA 2YSUB 3D36A 3IJ4A 3F7YC 3DAGA 4O4JA 3CB2A 2JD3A 1X59A 3L75H 2Q9AA 4DV4O 3CWBH 1D1AA 3CC7V 3DSQA 1DF5A 3MAQA 3SYPA 4MVOA 1CXZB 1GMGA 4DR5B 1OQCA 2OCHA 1WN0A 3N2ZB 5F5HA 2PY5A 2RJZA 2Y4UA 1OHHG 1K4DC 4Z2WA 4YK5A 1YZBA 3DTUB 4JW1A 4OX9O 2ETNA 1SQPH 4FFBB 3DAFA 2OYQA 3LESA 2V1DA 3IAYA 1PM9A 1N33B 1WJZA 3B29A 1FFXA 2ZXWB 3SJQC 4NXMO 1BZ4A 3VAYA 3CAXA 4DBQA 4RAIA 5LP6C 5K1PA 5B3IA 4L8JA 1YJGA 2PUSA 2CNWD 1FXKA 3CSXA 1ZUQA 3FAPB 5KAIZ 4Z9HA 4OPAA 3TETA 3EFOB 3CYOA 5B1OA 3S29A 4U5GA 3AG1C 4MNDA 2JS5A 5L0CA 4UVCA 2ZM6O 1WB8A 3GWOA 3U3FA 4KHPB 1AI6A 3JARA 5JJNB 3JALB 3SYAA 4LF9B 3ZEDA 2WVOA 1JFFA 1Y6XA 4R50A 2Q0OC 5IYBO 1K73W 4X1IA 3BABA 1IBKO 1P84F 3JSLA 3GORA 4X20B 2W9YA 3M7MX 1JAFA 3OTOB 2VCCA 1XBLA 1BR4A 2NLJC 3VOUA 3MFNA 2WA3A 1KTMA 2EBOA 1SA0A 1AB3A 3CMAV 1LPEA 2AU5A 4GUNA 3SJBC 1MMNA 3QZCA 3ZQYA 1RPRA 1K92A 2Y39A 2IM9A 5L0HA 1SETA 4PJ0Z 3E22B 2J8WA 3QO8A 5EC1C 3SYOA 2ICWG 3U9JA 3AEIA 1NTKH 3FB7C 4BJ5A 1OKKA 3JRTA 3POVA 3AG4B 4B3MB 3I55V 3ZIBA 2L7AA 1I5XA 2JPUA 2JRIA 3OMIB 1VMAA 2A6EF 5JLIA 3LDDA 3RBZA 4WBNA 5LP6A 3EFFK 2FGYA 5COMA 3LEVA 4ZI7B 1AEPA 4PACA 3UMIA 4YIOA 3QF7A 4AL0A 5E1AC 1SZIA 4N6CA 2VQFB 2W4MA 1VTMP 3KL4A 4PDVA 3SDLA 2OOCA 3H9VA 2XAFA 3FXHA 2F1MA 4CS3A 5H5NA 2EILC 4JI4O 3C3SA 4E0IA 2MYSA 1PNMA 2QKCA 4K7BA 2QM7A 4LERA 1SZXA 4UB8Z 2VQFO 2OU6A 5BY1A 3DC5A 4DR7O 2YRFA 4H33A 4PK4A 2CW0F 1VARA 2BTQB 4UV8A 2OWOA 4LF5O 1YTFB 2WB7A 2ZCEA 3T2MA 4TV9B 3AG4C 1HW7A 5IJ9B 4WABA 3N0TA 1K34A 4DV5B 1FMVA 1AVMA 1M2VA 1Q0KA 2PI4A 4NTFA 2Q69A 1FPOA 3LLKA 3LS0A 3K0DA 4HAMA 4O2AA 3TD7A 5KX5A 2KG7B 4UVAA 2IJJA 3HR0A 5F2VO 3NRHA 4OIRF 3OD4A 3O39A 3ZIAG 2A0BA 2DYSB 3EHBB 2YS8A 2CDYA 2LSEA 4RWUA 1M57B 2QA4V 5EHHA 2PZSA 1TWCA 1TUBA 3JT1A 3AG2C 2KJGA 4DR5O 1SRYA 2RDCA 1WPXA 3JCUZ 2B1GA 4JTDB 2AW9A 2WL8A 1RKEA 3Q6NA 4JI5O 3MYIA 3IQ5A 4KFMA 2EPOA 2A0LA 3TJ6A 4HNAB 2LW1A 2Y48A 4H0LB 2OKUA 3STLC 4CC5A 1M9NA 4DR7B 3JYYA 2YIBD 4YT8A 1QLEC 3DE8A 3FKSG 1AJQA 1A7VA 2VQEB 3H1IH 5H9CA 4LH7A 2RSEB 5IT9N 4U7NA 1R4TA 4X66B 2GAQA 3N2KA 5CBGA 3K9AA 3K7DA 2Y0IA 5LGUA 3N2GB 1KU2A 3SXMA 2B1IA 4XLPF 2CH7B 3IC9A 4IAQA 3K58A 2LFRA 1ORQC 1AILA 2AWCA 1NZ6A 5KYYB 1D0XA 1HE1A 1OCOC 4CZZA 2QWRB 3NMJA 3A8TA 4FX5A 2UUBO 5KYXA 2XT9A 3FD9A 4CS7A 1E86A 2QM4A 1WAZA 4ICGA 1ZW2A 4J7KA 3JTLO 4EBBA 4GX0A 1V54B 5TJ5E 5DEDA 2YXYA 2H8PC 4FLUA 3K03A 3ZHQA 4NCQA 1NTMH 5IJ0A 4L87A 3ZMSA 2N04A 3X1OA 4PD4F 1O3UA 1SQGA 1QLEB 1FMWA 3IC7A 4LNUA 1W2BU 2RMKB 2P6VA 1WATA 1O9GA 2OCCC 5JQGA 1PPJH 1BBHA 3U8VA 4B3RB 2ZPAA 5E2QA 2EPNA 3ZRWA 4PJMA 4DUZO 4HE8D 5B1AB 4EB6B 4IIJB 4O6MA 3K5NA 1CPQA 4MVSA 1NU9C 1JQ0A 3OMAB 5CA1B 4DV0O 3ZCCA 4F6RA 5E3CA 1R3KC 1VQ9V 1PV0A 3C8GB 1K5SA 4ZOLB 3CCQV 3QO5A 3GWLA 3IEEA 3A11A 5JJJB 2ZM6B 5BQHA 4P9OA 2LFDA 2I15A 1N36B 1K4CC 4HBNA 2JDIG 2DB4A 3WODF 3ABTA 2LK4A 2UU9B 3T6GB 2ZIOA 2EINC 2R9IA 1F4MA 4I50A 1G8MA 5L3DA 1OXBA 3DJUB 5IY5B 5B3SB 4DR6O 1O87A 3DD7A 4XQ1A 3OTFA 3NR7A 1XI1A 4XTKA 2XS8A 4UCVA 1BGYH 2ZXOA 3AG1B 2JIZG 4N23A 1HDJA 2HJMA 3EGXB 1D5AA 3TJTA 4LFCO 4P9FA 4F4LA 3G4SV 3W7WA 1BS3A 4FK5C 1YAUO 1MSDA 4LFBB 4YY3B 4K0DA 5J9PC 2CGNA 1U0BB 4W8KA 2XTAA 4O79A 1IBMO 2BSKB 3T1CA 1J8MF 2R25A 2YEVB 1RCPA 3CS5A 4WCEV 3PCVA 1A7EA 1OCCB 2L81A 4U9EA 4QI2A 1OCZC 2EJRA 4JTAB 3RYHA 4DR1B 1JR9A 1OXKA 4JEBA 5IWAO 2QDOA 1E84A 2YL7A 3GVMA 4TQFA 1P7BA 1HW1A 5IY5C 1HW2A 3B9QA 2CK3G 1Z6AA 1HNZB 3U0CA 5FNVA 1EA8A 1U97A 4JI0O 2WWWA 4RUEA 4JC7A 2RCVA 3H65A 3IQTA 3EFOA 3CRMA 1V74B 2LD6A 2EILB 4CDYA 5LL6Y 1HMDA 2UUIA 1SYQA 2LJ2A 4DXWA 3X2QB 4JF3A 1H8EG 5FPRA 1I4ZA 1N36O 4CS8A 4K3AA 2ILMA 1SQXH 4B6IA 2YHSA 4JGSA 4W4LA 2EPKX 1I0HA 5LMUO 3VQYA 3BA9A 3K1HA 1IXBA 4ZIBA 4WGZA 4UCSA 1VIBA 4XPWA 4X20A 1IBMB 4GX5A 2HS5A 1LE4A 1H2KA 4A5UB 1I94B 5EGYA 1IVSA 5DS4A 1N34B 3KYIA 3WG7B 5LHHA 1HNXO 5DS5A 3NYMA 1H8HG 3RYFB 1SESA 1NFNA 3F5WC 3FHDA 2EX3A 1LKXA 3VM6A 1QNMA 1BQZA 2W4BA 2V26A 3G4ZA 5LOVA 5A69A 3CCSV 3A0BZ 2P5OA 3ZRXA 4X1KB 1NG1A 2MK3A 3U8PA 2FTKA 1TVKB 1JVMA 4AHCA 5HV9A 1F4NA 3B4SA 2QUPA 3MHHC 2J45A 4XEVA 5IYZB 1M90W 4WBNB 4C3BA 2DGJA 3JAMN 1K3EA 2LQTA 3K5OA 3V7OA 5BR8O 1AROP 1UFIA 1QZXA 3R2PA 3CCEV 5T3TA 5KHHA 1NS1A 3ZJZA 1HR0B 1G8XA 3B0VC 5JWPA 2HJFC 1N4CA 4XEFA 1VF6A 1GN2A 3KPHA 4DRHB 4NR1A 2NSGA 4H37A 4NY3A 1B6QA 4EFEA 3APQA 3SZRA 2UXCB 4PHZA 1WTYA 3WAQA 3FYIB 1RM1C 1M6TA 4J9YB 3ZN1A 4XEKA 3TXSA 5BMVA 1DF4A 4QDLA 4FM1A 3R7CA 5LYJB 3DJNB 1TR2A 3D3IA 2H94A 3B0PA 4E7ZA 4X1YA 4CH3A 1ORJA 1VQ5V 4UCTA 3RVYA 2KG7A 4H44B 5FPOA 4GCZA 3CEXA 3A2FA 5A9GA 3IQ6A 4MQ9F 1OKKD 3WB2A 1MNGA 4PI0A 4I0XA 5HFMA 1XEQA 1YDXA 2HV7A 2IBFA 2PI5A 3ZMVA 3HTKC 4FLXA 3T1HB 2DJVA 3EHMA 1C17M 1KD1W 5FZTA 1Y4CA 1H7IA 1TFOB 4MTOA 5B1AC 5GONB 2XS1A 2HVKC 3U3BA 3ABLC 2L6FA 2D4UA 2IJHA 2BCCH 1F7YA 3GEHA 1US6A 4MVMA 4X8AA 2IBZH 3RW0A 2X7RB 2CCYA 1FJGO 1GM7A 1KUQA 4LBEC 1ZTEA 3G50A 3M4CA 2JJ2G 2XL4A 3G71V 1Y74B 1S7ZA 4GYTA 2EZPA 3H1KH 3KKBA 2M6YA 3RVZA 3S27A 2WLJA 3FAVA 4GT1A 3Q4HA 4J9ZB 1P49A 2R70A 4E2LA 2A79B 4CBEA 5FL7G 1VQNV 3N2KB 1D0ZA 1QVFU 3C90A 2XXAB 2CH7A 3CP1A 1GK9A 2HLDG 1Q6HA 4GEHA 4I3MA 4KBLA 1GM5A 4XWJA 3EG9A 2IJKA 4FMTA 5LMNB 1KB9F 3EXAA 3D8CA 5KYXB 2QY9A 4JEAA 3JD0A 3VQXA 3CZ6A 2P4KA 3OMNB 4CH6A 1MOFA 1ZWIC 3KCXA 1ZLZA 2R7UA 3ZS8C 3QMKA 3JASA 2XLOA 2XSEA 2UUAB 1ZHXA 2X0LA 1LE2A 1HNWO 3OW2U 1R5ID 1FFHA 1HNWB 3DE9A 2XLVA 3K79A 2UXDB 3BY6A 5K1XA 1BR1A 3C7JA 1Z63A 1HWYA 1OCCC 4U7OA 4WFHA 3GWNA 3L8IA 1HP8A 4EBKA 1YIJV 2W0XA 1WA8B 5JVEA 1Z5ZA 2AZ0A 4IIJA 3ASNB 3GWKC 3M15A 3ETGA 2KSFA 5C93A 4JI2O 1WN7A 1A41A 1R73A 2WAMA 4QE7A 1U89A 4F6RB 4TOIA 3CHXA 5C8YB 2P67A 3AK3A 3C8GA 3W2VA 3U2LA 4ZOLA 3B2EE 1Q43A 3JAWB 4GKKO 4DRJB 1UFBA 4U5CE 3OEOA 2VASA 1HR0O 1ZHYA 3DKAA 2XM4A 4DV2B 1Q0FA 4QGPA 4DUYO 1KMIZ 2QGNA 2P90A 1S5HC 4U3JB 5BR8B 3DZAA 1MA1A 2VH3A 1KC8W 1QSPA 1D5NA 2ATKC 5L3QA 3FB5C 3OM3B 2A0UA 1NR1A 1SQBH 4A4AA 3ETEA 3ABKB 2Y3BA 3ZHRA 1T5OA 1SERA 4AK9A 4G27B 2DQ3A 1CPRA 1FXKC 3CX5F 1EZJA 5B1NA 1L0NH 3OGCC 3S90A 4I9WA 3OGIB 4IHJB 1LS1A 1YVIA 2Y69B 4KP4A 3T6BA 4GX1A 3E89A 2CTQA 2WLIA 1TWHA 1H2GA 2OTLV 1MZEA 3SXZA 4J11A 4DV3O 1XDCA 1Q0DA 3BPZA 4GKJB 1F23A 1ZSPA 1ZL8A 1Q6IA 2YEVA 4OPHA 2GSMB 1IBKB 2OIGA 1NSGB 1NBMG 2DMXA 4G78A 3LJBA 3JYCA 1Q7YW 2K9PA 4CS2A 2NPUA 4TT3G 5FCLA 3HKEA 1W59A 3DWWA 4G7HF 1RMVA 4LF9O 3OTOO 5CI9A 2HVJC 2XM0A 4Z1MG 4G7ZF 4LP8A 1F51A 1X4TA 2IJIA 3AG7A 5LMUB 4JV5O 1L7CA 3OT7A 3EQLF 2GDSA 3O55A 1WGWA 4PJJA 2LGWA 5FNVB 3G80A 2P61A 1Y76B 2AZ2A 1HE9A 3F5TA 4L6RA 1WPBA 4O4LA 2JEXA 2WLNA 4ZHQB 4DR4B 1LVKA 2HR3A 4K35A 2NG1A 3ABMB 5JCOC 4X65B 3M1CB 2R02A 3U2MA 1FJGB 2QTOA 2UUHA 4JI0B 3SJAC 1JPJA 3VF0A 3CJHB 2AXTZ 2EIJC 2JGUA 3OWTA 2ZQMA 1LI5A 1COWG 2ADQB 3IPMO 5KUMA 1PCXA 4NXMB 4JE9A 3S28A 4U3FH 2L6HA 1ZAUA 4LF6O 2MW2B 3AQBA 1G4YB 1Z23A 1N0JA 2Q4PA 2A69F 4CS4A 1FFXB 3F47A 3LEOA 3FFQA 2HJ3A 3E8BA 1ENVA 5IE9A 4X88A 3DXJF 2HV6A 4JI8B 3OEEG 4LF7B 4NXNO 1IURA 1PNLA 1ZYRF 2QR4A 4CSAC 2KQXA 4X1KA 4QE9A 4B08A 5DM6V 4EHPA 1UJWB 5AC5A 3ZHTA 4O6YA 4YL3A 2XRHA 3SXYA 1GH6A 1TFKB 2XUMA 4HYOA 4J41A 1ZZPA 3K66A 1MMAA 5GW7A 1I7FA 2XHBA 3FYEB 1H2LA 3PJSK 1IBLB 1LI7A 1BMFG 5EBMC 4NB5A 3ZMTA 3W4YA 1VQPV 3JALA 1XZPA 4R6ZA 3QTCA 3IGAC 4KUMA 4NKGB 1XNRO 4ER9A 4Q5SF 2OQMA 4AE4B 5EYPB 4F4BA 2YICA 3VQWA 3H1LH 4IYIA 4BW5A 1C02A 5JCOA 5A6BA 4LACB 3JZ0A 1QVXA 2NR5A 4YXWG 3CCMV 2R05A 3QVYA 3HNIA 2HHHB 2QWOB 5BMVB 4DV0B 1CGME 5LA6A 1KYOF 4UV9A 1T6QA 3K06A 2PBEA 1J5EO 1HMOA 1NVPB 2IXNA 4PA7A 1WP8A 4RUFA 5D5PA 3CPWU 1ZU5A 3HJCA 4MS2A 1CP9A 2P4VA 2NUTB 3HPLC 4LFAB 1S77D 3LNNA 2HJDA 2FYUH 4I0XB 1R6KA 1OCZB 1OW7A 4JYAB 3CCUV 3V5ZA 3AJMA 5LP6B 2C03A 4O2BA 3AG3B 2DQ0A 3JSZA 5GONA 5L3FA 2LFSA 2Q73A 3E70C 4DR6B 1YZAA 1D1BA 1M5IA 4CSAA 4WF9V 4H13B 3G6EV 1GRJA 2E3CA 2UXXA 3K1IC 3S0XA 4NVPA 4FLVA 2WPDG 4FWVA 4YJ3A 2B0HA 1GS9A 3JSNA 1FXHA 1TA8A 4FM2A 1Y74A 2QE7G 5J2TA 2CDQA 4CS9A 1BL8A 1TUEB 2XAJA 1ST6A 3BAAA 2J46A 2R7OA 4YHHB 3FAVB 1EFRG 3MHSC 4JV5B 1GN4A 5T3WA 2BTQA 5BUOA 4BWAA 4UCOA 4IWBA 3OA1A 5IJ9A 5KHGA 3L1MA 3N27A 3VQVA 1M2VB 5F5FA 4DK1A 4MVZA 1KU9A 1XZQA 4WFEA 5CA3A 4O2AB 2YL3A 5IWAB 3LUTB 1JMWA 2Q7HA 3ABKC 4EUKB 3BEHA 4PV1B 4BIZA 3U5SA 1VYKA 1EN4A 4AQYB 1IW7F 1XNQO 4XBFA 5EZYA 1N1CA 2XLHA 4YY3O 4YJ2A 2GUZB 2WA4A 3P32A 2Q9CA 2J7PD 3K59A 4K1OA 2PNOA 1YJNV 3TXQA 3JASB 2HMZA 2XASA 2QKAA 3RQEA 2X6AA 2WZGA 2P7TC 5K0IA 5L0GA 1GKFA 3GM2A 3V5YA 3U0ZA 2R9RB 1Y6DA 3L73H 3JYHA 5A2QN 5EIBC 1N32B 4I1MA 1XHXA 3SPHA 3BRJA 2Y3GA 2UU9O 4E4EA 3G4XA 3D3QA 3ASOC 2YXHA 1YJWV
chains in the Genus database with same CATH topology
1QR8A 4GX5A 3ZMUA 1QR9A 1KECA 2V7QG 1ROPA 3JD4A 4QPKA 2P6JA 1GTOA 4WFAV 4G28B 2Z5UA 5IYCO 1R6NA 5EBWC 2W6JG 3WG7B 2ZD9A 5LHHA 2EIMC 1H8HG 1OCRB 1SESA 3F7VC 1S72V 1M57C 3E8FA 3F5WC 3UKMA 1W0JG 5CBHA 1W0KG 3OUFA 1AI5A 3X2QC 2QEXV 4EKWA 4QNHB 3B77A 1QVGU 1VQ4V 4MTXA 1E1RG 4PDRA 3CCSV 2DYRB 4PDMA 3ZRXA 2MK3A 3ZN0A 4BAYA 2FTKA 3ZRVA 3NXSA 1JVMA 2HFEC 3VBBA 1MABG 3K04A 1F4NA 1YHQV 3MHHC 4XDLA 3OUSA 1M90W 4MVUA 3CC4V 1YSCA 1S3JA 1Y66A 1K3EA 4R7CA 2C2AA 1NR7A 3E35A 2D3OW 1K7DA 3QNEA 4Q20A 1AROP 4PA4A 2DYSC 4P2ZA 3CCEV 5KA6A 2OTJV 3E8GA 1M56B 3ZJZA 4FPPA 2BOCC 2HJFC 1FS0G 2DW4A 2IU0A 3ZRWB 5L3GA 3W7XA 1GM9A 4H37A 3I56V 3M99B 4RO2A 4PDLA 1B6QA 3SPGA 4CBCA 3FYIB 1RM1C 4J9YB 3ZN1A 5LBQA 1OCOB 1VQ7V 1DF4A 5BZBA 1AJPA 3D3IA 2H94A 2EZOA 2ITCC 4LC1A 4TWKA 2WLLB 2Q6AA 1GO3F 4MTGA 5H6RA 1OZ0A 1V54C 3DGEA 1VQ5V 3ZMZA 3RVYA 3LDEA 1Y4MA 1DTOA 4GCZA 4MSWC 5EC2C 5HFMA 1AI4A 1NJIW 1VQMV 2PI5A 2OCCB 3ZMVA 3CCLV 3OR7C 2IH3C 1KD1W 1THZA 2ZXWC 1AI7A 3LSQA 4MT8A 3R65A 1K8AW 4MTOA 5B1AC 2HVKC 3HB3B 3KG2A 3ABLC 2YSUB 3D36A 3F7YC 3QO7A 1V55B 2IJHA 1J95A 4X8AA 4MVMA 3RW0A 3CC7V 2X7RB 1DF5A 1GM7A 3LSSA 3SYPA 4MVOA 4LBEC 1GMGA 1AR1B 1IXMA 2JJ2G 2XAQA 3G71V 2EZPA 1K33A 1NH2D 2JJ1G 3RVZA 1VQLV 2WLJA 4GT1A 1OHHG 1K4DC 4J9ZB 3DTUB 4E2LA 3JD1A 2A79B 4MW8A 2W0FC 3K08A 5FL7G 1VQNV 2V1DA 1QVFU 2A9HA 2ZXWB 3SJQC 3CD6V 3CP1A 1GK9A 2DWDC 2HLDG 4RAIA 3B8MA 2EINB 3W7UA 2UXNA 2IJKA 4FMTA 5KUKA 1YITV 3E8HA 1FXKA 2IU3A 3SPIA 2Q68A 3JD0A 1V55C 1KP2A 3TETA 3CYOA 1K97A 5B1OA 3AG1C 3OMNB 1MOFA 1ZWIC 2ZR3A 4UVCA 2Z3YA 4WFBV 4QPJA 1KKDA 2X0LA 3GWOA 3OW2U 1AI6A 1S0VA 4XDJA 3SYAA 3IFXA 3K79A 3BY6A 3JD3A 1N8RW 3OEHG 1HWYA 2WLMA 4R50A 5IYBO 1OCCC 4U7OA 1K73W 4WFHA 1M1KW 3CCJV 1YIJV 2WSSG 5B3SC 2X6BA 3ASNB 2XNDG 1WLEA 3ETGA 4JAUA 3FB8C 4BIUA 5C93A 5IDJA 1R73A 2WAMA 2NLJC 3VOUA 4QE7A 4FIPC 2EBOA 3CXCU 3CMAV 2P67A 1XL4A 3SPJA 2JK5C 4HZ3A 1RPRA 1K92A 4MVRA 3CCVV 1SETA 1JPXA 3SYCA 3QO8A 5EC1C 3SYOA 1L1FA 3CC2V 3SPCA 3AEIA 2P90A 3FB7C 1S5HC 3AG4B 3LNMB 5CBFA 3I55V 1KC8W 1I5XA 4XDKA 2ATKC 2HKOA 4RQEA 3OMIB 3FB5C 3OM3B 3LDDA 3RBZA 3EFFK 1NR1A 2K1EA 3ETEA 3ABKB 1SERA 2ZDIA 5E1AC 3ASNC 4G27B 2DQ3A 1PKXA 3LDCA 1FXKC 1EZJA 4PA3A 4PDVA 3ZRSA 1GM8A 5B1NA 3OGCC 2XAFA 4I9WA 2EILC 1K9MW 1CEZA 1VQKV 1Q81W 2Y69B 1OCRC 3ABMC 3B8NA 4FJCC 4KP4A 1PNMA 4GX1A 2BOBC 3W7TA 3E89A 2WLIA 3JD2A 1H2GA 2QM7A 2OTLV 4PA6A 3ETDA 1F23A 4JYCA 4H33A 2YEVA 2AHZA 2GSMB 4UV8A 1YTFB 3OFNG 1VQ6V 1NBMG 3T2MA 1SZTA 3JYCA 3AG4C 5CN0A 1Q7YW 1VQOV 1VQ8V 1K34A 4TT3G 2PI4A 2Q69A 2QKSA 3K0DA 1BHBA 4HAMA 2HVJC 4ASUG 3GB7C 4UVAA 4Z1MG 1MG1A 2IJJA 4LP8A 1F51A 2IJIA 2F43G 3CCRV 3ZIAG 2DYSB 3EHBB 3UM7A 5KA5A 3WG7C 5LGTA 2JEXA 1M56C 1LNQA 1M57B 2WLNA 2QA4V 2HR3A 2Y69C 3T4DA 3ABMB 1BHAA 3AG2C 4WFFA 1NVPD 4ZKIA 1SRYA 2M7WA 2QTOA 3FB6C 2QM8A 3E2EA 1WPXA 1RM1B 1YJ9V 2B1GA 4JTDB 2XAGA 5L3EA 2DYRC 2EIJC 2ZQMA 1NQTA 4KFMA 1COWG 2A0LA 4ZBMA 1PL0A 2Y48A 2B5UA 4UXNA 3STLC 1RPOA 5KUMA 1M9NA 2EIKC 2ZDIC 4G2KA 1QLEC 4N21A 3FKSG 3W7SA 1JX9A 1AJQA 3TK1A 5H9CA 1K5QA 4U7NA 1G4YB 3K9AA 3SYQA 5CBGA 5LGUA 2B1IA 1AJNA 3STZC 2KB1A 2LFRA 1ORQC 3E8BA 1ENVA 4JYBA 4X88A 2HG5C 4DO2A 1DLBA 1XL6A 3AG2B 3OEEG 3ABUA 4I5SA 1E1QG 3TCUA 1OCOC 4CZZA 1H38A 1PNLA 1JCHA 4UUJC 2EIJB 1FFTB 4QE9A 5DM6V 1UJWB 4GX0A 1V54B 2NNUA 1QLNA 2JEUA 2H8PC 4HYOA 3K03A 1PD3A 5GW7A 5B1BC 1JOYA 4L87A 3FYEB 2WLHA 3PJSK 1QBZA 3ZMSA 1BMFG 5EBMC 2EIKB 3ZMTA 1QLEB 1VQPV 2IH1C 3IC7A 1W2BU 4R6ZA 1PNKA 3IGAC 4KUMA 2OCCC 4MVQA 1KQSU 2DWEC 1Q82W 4BW5A 3K0GA 3ZRWA 1R3LC 4MW3A 3AG3C 4PELA 5LHIA 4MTFA 5B1AB 1YI2V 4MVSA 4YXWG 3CCMV 1I5YA 1JQ0A 1YTFD 3ABLB 5L3BA 3OMAB 1P4RA 3K3WA 2IW5A 4UV9A 3K06A 3ZCCA 1NKDA 1R3KC 1VQ9V 2WLLA 1NVPB 3JCZA 1K5SA 2XOKG 4PA7A 2XAHA 3CCQV 4RUFA 3QO5A 3CPWU 4P30A 4WFGA 4MS2A 1CP9A 5B1BB 3A0RA 1NH2B 1JJ2U 4R8CA 3HPLC 1S77D 5IYDO 4P9OA 5LHGA 1R6KA 4TSFG 1OCZB 1K4CC 2ITDC 1Q86W 2JDIG 5H6QA 3P30A 3CCUV 3ABTA 5EBLC 3ML0A 2W6IG 5CMUA 2EINC 3AG3B 1E79G 1F4MA 2R9IA 5LGNA 1R3JC 1G8MA 2DQ0A 5L3DA 5IY5B 5B3SB 5L3FA 2LFSA 4WF9V 3G6EV 2UXXA 4GX2A 3OAAG 3AG1B 2JIZG 4N23A 2WPDG 1MSWD 3OR6C 4F4LA 3G4SV 1FXVA 5HFLA 3W7WA 4FK5C 1FXHA 2WLIB 2QE7G 5J9PC 1BL8A 1TUEB 2XAJA 4QJFB 3T1CA 5DN6G 2WLKA 4OXSA 1EFRG 2YEVB 3MHSC 4WCEV 1OCCB 1OCZC 2EJRA 1KP3A 4JASA 2X6CA 2Q67A 3OE7G 4RQFA 4JTAB 4PA9A 4JAVA 4LCUC 4MVZA 2OT5A 3ASOB 4WFEA 3MD0A 5CA3A 2GHYA 3LUTB 4JPRA 1P7BA 3ABKC 5IY5C 3BEHA 4BIZA 2LP7A 1QCEA 2CK3G 3CMEV 1FXKB 4XBFA 2WWWA 4RUEA 5EK0A 3E83A 3WFVA 2EIMB 1CPYA 2EILB 3P32A 4X89A 5L3CA 1S76D 2AHYA 1YJNV 4DXWA 2XASA 3X2QB 1R3IC 4JF3A 1H8EG 3E86A 2X6AA 2P7TC 1GKFA 2R9RB 3H01A 4JGSA 2ZR2A 4QIWF 3SPHA 1EBOA 4UVBA 3ASOC 3T4ZA 4JTCB 4P9PA 1YJWV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX5 A;  4MVS A;  3RVZ A;  4H33 A;  4G28 B;  2WLJ A;  1K4D C;  2AHZ A;  2YEV A;  4J9Z B;  2A79 B;  5EBW C;  4MW8 A;  2W0F C;  3K08 A;  2ZD9 A;  3K06 A;  3T2M A;  3JYC A;  3AG4 C;  1R3K C;  2WLL A;  2EIM C;  3F7V C;  2A9H A;  1M57 C;  3E8F A;  3F5W C;  3UKM A;  3SJQ C;  2Q69 A;  4PA7 A;  2QKS A;  2DWD C;  3K0D A;  4RUF A;  4RAI A;  5CBH A;  4P30 A;  3OUF A;  4WFG A;  2HVJ C;  4MS2 A;  3X2Q C;  3GB7 C;  4EKW A;  4LP8 A;  4QNH B;  4R8C A;  5KUK A;  3E8H A;  3HPL C;  4P9O A;  3UM7 A;  4PDR A;  3SPI A;  3WG7 C;  2Q68 A;  4PDM A;  1V55 C;  2ITD C;  1K4C C;  3TET A;  3AG1 C;  1LNQ A;  1M56 C;  1JVM A;  2HFE C;  2WLN A;  1ZWI C;  3K04 A;  5EBL C;  2Y69 C;  4XDL A;  3T4D A;  3OUS A;  4MVU A;  1KKD A;  2EIN C;  3AG2 C;  4WFF A;  1R3J C;  4R7C A;  2QTO A;  3FB6 C;  4XDJ A;  3SYA A;  3IFX A;  4JTD B;  2DYS C;  4PA4 A;  4P2Z A;  2DYR C;  4GX2 A;  2EIJ C;  2WLM A;  4R50 A;  1OCC C;  3E8G A;  3OR6 C;  3ZJZ A;  2BOC C;  4F4L A;  4WFH A;  4KFM A;  2HJF C;  2A0L A;  4ZBM A;  3STL C;  2WLI B;  4H37 A;  5KUM A;  4RO2 A;  4PDL A;  5B3S C;  5J9P C;  1BL8 A;  2EIK C;  2X6B A;  3SPG A;  1QLE C;  4CBC A;  3T1C A;  4J9Y B;  3FB8 C;  2WLK A;  4OXS A;  2NLJ C;  3VOU A;  4QE7 A;  5BZB A;  1G4Y B;  5CBG A;  3SYQ A;  1OCZ C;  2ITC C;  4TWK A;  2Q67 A;  2WLL B;  2Q6A A;  2X6C A;  4MTG A;  1XL4 A;  3STZ C;  4JTA B;  1V54 C;  3SPJ A;  4PA9 A;  2KB1 A;  4LCU C;  4MVZ A;  2JK5 C;  4HZ3 A;  1ORQ C;  4WFE A;  3E8B A;  4X88 A;  2HG5 C;  4MVR A;  3RVY A;  1XL6 A;  3LUT B;  3SYC A;  3LDE A;  1P7B A;  3ABK C;  5IY5 C;  3BEH A;  3TCU A;  1OCO C;  4MSW C;  5EC1 C;  3SYO A;  5EC2 C;  3SPC A;  3FB7 C;  4RUE A;  5EK0 A;  1S5H C;  4UUJ C;  3LNM B;  3E83 A;  4QE9 A;  5CBF A;  4GX0 A;  3OR7 C;  2IH3 C;  2ZXW C;  2ATK C;  4X89 A;  4XDK A;  3FB5 C;  2AHY A;  3LDD A;  2H8P C;  4HYO A;  3K03 A;  3EFF K;  3RBZ A;  4DXW A;  5B1B C;  2K1E A;  3R65 A;  1R3I C;  2WLH A;  3PJS K;  4MTO A;  5B1A C;  3E86 A;  5EBM C;  2X6A A;  5E1A C;  2HVK C;  3ASN C;  4G27 B;  2P7T C;  3KG2 A;  2IH1 C;  3ABL C;  3LDC A;  4R6Z A;  4PA3 A;  2R9R B;  3F7Y C;  3IGA C;  4PDV A;  2OCC C;  3ZRS A;  4MVQ A;  3OGC C;  4I9W A;  1J95 A;  4X8A A;  4MVM A;  2EIL C;  3SPH A;  2DWE C;  3RW0 A;  1OCR C;  3ABM C;  3SYP A;  3K0G A;  4MVO A;  4BW5 A;  4LBE C;  1R3L C;  4GX1 A;  4MW3 A;  2BOB C;  3AG3 C;  3E89 A;  3ASO C;  2WLI A;  3T4Z A;  4JTC B;  4MTF A;  4P9P A;  4PA6 A; 
#chains in the Genus database with same CATH topology
 3ZMU A;  1QR9 A;  1KEC A;  2V7Q G;  1ROP A;  3JD4 A;  3P3N A;  1JJO A;  1PL4 A;  2W6J G;  2LP4 A;  4E0H A;  3UMK A;  2EIM C;  3F7V C;  3K57 A;  3TGU H;  3ZWI A;  3JAW A;  1W0J G;  3PMR A;  3NYL A;  3BHP A;  1W0K G;  5KAF Z;  4NQF A;  3I4U A;  2OEV A;  2QEX V;  4QNH B;  3B77 A;  4EIY A;  1QVG U;  3HNK A;  4MTX A;  4PDR A;  4PDM A;  3LSU A;  1VK5 A;  4BAY A;  3RIP A;  2TMV P;  3NXS A;  4DV7 B;  4NTA A;  2H8A A;  1URF A;  3K04 A;  1YHQ V;  1T6I A;  3QW1 A;  4Q7C A;  4J80 A;  3K33 A;  3RFR A;  5AC4 A;  1M4U A;  1S3J A;  1Y66 A;  2QE9 A;  3HNL A;  3GEE A;  4CJG A;  1YAR O;  2C2A A;  5L0F A;  2D3O W;  3QNE A;  4Q20 A;  4IT5 A;  4YT2 A;  5JP7 A;  4NTW A;  4FFK A;  1MMD A;  5KA6 A;  3E8G A;  1M56 B;  4QI0 A;  1Z2G A;  4LWS B;  2IU0 A;  3ZRW B;  4IL6 Z;  1U6H A;  2Q9B A;  5D91 A;  1EM1 A;  2F66 C;  4PDL A;  4EB6 A;  1WWP A;  5KYU A;  3SPG A;  3PN1 A;  4CBC A;  2VC9 A;  3CRA A;  1OCO B;  3P3P A;  5LMN O;  5BZB A;  4NC3 A;  3RN4 A;  4LC1 A;  4DUY B;  4DV5 O;  4AQY O;  2WLL B;  5BQG A;  2E75 B;  4MTG A;  2UXB O;  1V54 C;  3NYJ A;  2RN9 A;  1SKV A;  4E7S A;  3UGO A;  1A0B A;  4JCZ A;  4X66 O;  4MSW C;  2VRZ A;  3ZDL A;  5DQZ A;  3WB1 A;  3UT5 B;  4OIN F;  2YIA A;  1Y76 A;  2OCC B;  3Q7L A;  4O4L B;  3OR7 C;  4ZHQ A;  4YHH O;  1YCI A;  4TQD A;  2IXM A;  4J7T A;  2Q0A A;  1V4A A;  3C8Z A;  3LSQ A;  4MT8 A;  3R65 A;  3APO A;  3UO2 A;  1EQ1 A;  1JR8 A;  2W45 A;  2QTS A;  2UXB B;  1EN6 A;  1IX9 A;  4JI3 O;  3G67 A;  3RYC B;  2RNB A;  1V55 B;  3CJH A;  3QO7 A;  4JI2 B;  5GPG B;  256B A;  3RH3 A;  4FLY A;  4DOZ A;  2YDE A;  4NTB A;  2ZNJ A;  4FES A;  1VF7 A;  3ATP A;  4FLT A;  1TKN A;  2Q8V A;  4XPY A;  2RD9 A;  1K33 A;  1O9H A;  1NH2 D;  2JJ1 G;  2L6L A;  2BSK A;  4D7S A;  1XOU A;  4H54 A;  3A0H Z;  4TUY B;  1FNT c;  2GFH A;  2Q7E A;  4LF8 B;  2Z15 A;  2L35 A;  2A9H A;  5JJE B;  4DR2 B;  3RYH B;  5KYW A;  1HY5 A;  3CD6 V;  2YLI A;  5JVD A;  3CE2 A;  1XMQ B;  1BE3 H;  1VEW A;  1OW6 A;  2EIN B;  1VLT A;  3NG1 A;  2A3Q A;  2UXN A;  4C7U A;  4YWQ A;  4DV4 B;  3E8H A;  3G6B A;  3JRM O;  1J5E B;  4KL1 A;  5BXZ A;  3SPI A;  1KP2 A;  4BG0 A;  1Q90 D;  3ECS A;  5FLX N;  2ZE8 A;  2Z3Y A;  1R1B A;  1NI8 A;  4WFB V;  3QW0 A;  4JI4 B;  4O4H A;  5GTH Z;  4HEA J;  4YJW A;  1S0V A;  5L3V A;  1N8R W;  3CRC A;  4JKV A;  2BC5 A;  3ZC4 A;  4LLC A;  2WLM A;  4Z9I A;  4AE4 A;  5EYP A;  4C7O A;  1DOW A;  1M1K W;  4JIO A;  3IHU A;  3SEO A;  2WSS G;  1AUE A;  4DJ9 A;  2XL6 A;  3RQG A;  1FD9 A;  2X6B A;  2XND G;  1WLE A;  4X62 O;  3EHN A;  3ZVR A;  3H2U A;  3Q6M A;  5IDJ A;  1CGO A;  3LLI A;  3FX7 A;  4Z9J A;  3FVY A;  4FIP C;  2E76 B;  2FAP B;  1XL4 A;  5DEC A;  3UCS C;  2EPL X;  2JK5 C;  1G4W R;  3HKD A;  4B3T O;  4CIP A;  2ZT9 B;  3CCV V;  1GAX A;  1JPX A;  3JCU Q;  3RFY A;  2J0W A;  3T1Y B;  4DR3 B;  3SNH A;  5CBF A;  1TVK A;  3KCY A;  4K0K O;  4X62 B;  5IYZ A;  2FB5 A;  4WJ0 A;  4U9D A;  1OW8 A;  4PR9 A;  2QWN B;  5ITZ B;  2K1E A;  3O10 A;  1ZW3 A;  4D4N A;  1SC5 B;  5JS5 A;  3S84 A;  2ZDI A;  2P0N A;  3ASN C;  2CTP A;  1PKX A;  4CX9 A;  1KKC A;  3SR2 C;  3ZRS A;  4CJO A;  2GTS A;  3L72 H;  3RF3 A;  1QQC A;  4PJL A;  3TQO A;  3RGB A;  4PFO A;  2YC0 A;  1Q0M A;  1K9M W;  1CEZ A;  1A7D A;  1Q81 W;  4DRX A;  4J42 A;  3ABM C;  3B8N A;  2N74 A;  2YIB A;  4OD4 A;  3W7T A;  1HNZ O;  5J2T B;  1BZK A;  1ZU4 A;  2A1D D;  4PA6 A;  4CS8 C;  3ETD A;  4JYC A;  4BJ6 A;  2AHZ A;  3AOU A;  2GDC A;  4LF7 O;  1ZVZ A;  5CI8 A;  1IBL O;  5LYJ A;  3C8G D;  1VQ6 V;  1LR1 A;  3OFN G;  3KH2 A;  5HSW A;  3QVN A;  4DYL A;  4JI7 B;  4X1Y B;  1VQO V;  4YIP A;  1VQ8 V;  2VWK A;  2F95 B;  1QQ3 A;  3L9D A;  1MG1 A;  4OX9 B;  2LCH A;  3UQ8 A;  2F43 G;  3CCR V;  3T1Y O;  2Q3T A;  3UM7 A;  2G3K A;  2CYD A;  4DR1 O;  1JMK C;  2R9A A;  3M8A A;  3F46 A;  4IJJ A;  1LNQ A;  4YJ2 B;  2GUZ A;  2OJQ A;  2P7V A;  1SS3 A;  4LF6 B;  1TWA A;  1BHA A;  3HKC A;  3RYL A;  1RFY A;  4U5H A;  4WFF A;  1NVP D;  4BIO A;  3FB6 C;  2QM8 A;  1RM1 B;  1XMO B;  4JI7 O;  3M79 A;  2XAG A;  2DYR C;  4TV8 A;  5CA0 A;  1E2X A;  2HHH O;  4CH4 A;  4OIQ F;  4B3S B;  4U5B E;  3UMH A;  3ZHS A;  3NKE A;  3HNJ A;  1AP6 A;  4YT5 A;  4ZBM A;  2DOS A;  4UXN A;  2PFD A;  1RPO A;  3B09 A;  3ZX6 A;  1NU7 D;  2ZDI C;  4G2K A;  3JAK B;  4JJG A;  3W7S A;  1JX9 A;  4YL1 A;  4G7O F;  3TK1 A;  4X0R A;  3KMI A;  3Q4H B;  2OG2 A;  2E74 B;  2HKV A;  3R66 A;  3SYQ A;  1SF8 A;  3STZ C;  1AJN A;  2XXA A;  2KB1 A;  2J9W A;  1UPG A;  4JYB A;  1EI7 A;  2HG5 C;  1BQ0 A;  1DLB A;  4PJN A;  1VB5 A;  2P06 A;  2JS3 A;  1FYJ A;  3EG9 B;  4I5S A;  2WVN A;  1XRE A;  2F4V B;  2ZE7 A;  3HKB B;  5JH7 A;  5KHJ A;  4P6I C;  3ZG1 A;  3BVO A;  4I7Z B;  3AQC A;  3C3T A;  4XPX A;  2NNU A;  1FAF A;  2A06 H;  2YXL A;  2OEX A;  3ITF A;  1QLN A;  2JEU A;  4B3R O;  4JI8 O;  1YXB A;  2FML A;  1JOY A;  1APC A;  4IRU A;  3W2W A;  1B68 A;  1QBZ A;  3CEI A;  2KC3 A;  4RD9 A;  4B3T B;  4R32 A;  2UUC O;  4DV3 B;  4BJ5 C;  2JGD A;  4E18 A;  3GEI A;  4LF4 B;  4X64 O;  3UGP A;  2DWE C;  5F28 E;  2MHR A;  4ABM A;  2EPM X;  3K6B A;  1WA8 A;  4MW3 A;  4PEL A;  5LHI A;  4MTF A;  4XLN F;  2E5L B;  3EZH A;  1YI2 V;  5KYU B;  2NN4 A;  1I08 A;  1YTF D;  3ABL B;  2KQ9 A;  1Q3E A;  1NFO A;  4Z1V A;  1P4R A;  3K3W A;  2IW5 A;  4JI1 B;  2DN9 A;  4D4X A;  4I44 A;  1Z7Q c;  5C8Y A;  2WLL A;  2AWY A;  3JCZ A;  1NLX A;  1AR4 A;  3US6 A;  4BJ1 A;  2XAH A;  2OIE A;  4CS9 C;  3ZHU A;  1RXQ A;  2IXO A;  1JJ2 U;  2XL8 A;  4DV2 O;  4IGG A;  3S9O A;  3ZTM A;  4LDQ A;  3KKY A;  4TSF G;  3S3X A;  2HSB A;  2WZL A;  1V9P A;  4DK0 A;  4N6H A;  3P30 A;  4FLZ A;  4FZ1 A;  4I55 A;  3FDQ A;  5EBL C;  3ML0 A;  1UG7 A;  5CMU A;  1YYJ A;  4BR6 A;  5LGN A;  3ETQ A;  2F22 A;  5COG A;  2VS0 A;  4N06 A;  4GX2 A;  3RYC A;  1K04 A;  2M4E A;  3T6J A;  4AL1 A;  2H3O A;  4GKJ O;  1LUW A;  1YEW A;  3NDB B;  5HFL A;  2P22 C;  2J7P A;  3Q7G A;  1AVO B;  1Q5O A;  2WLI B;  2VCB A;  4QJF B;  5T1D B;  5DN6 G;  4DV6 B;  1MNE A;  2J9V A;  3L8J A;  5DVW A;  2WLK A;  4TUY A;  3ICX A;  4OXS A;  1PV3 A;  3B71 A;  4DV6 O;  2JVD A;  3MX3 A;  4BEJ A;  3RQF A;  2Q67 A;  3OE7 G;  1JPN A;  4UB6 Z;  4RQF A;  1I5N A;  4PA9 A;  4LCU C;  3HKE B;  2OT5 A;  4I1O B;  4JPR A;  1GN6 A;  3E9V A;  2D2C B;  1YA9 A;  2LP7 A;  2Q00 A;  1EN5 A;  1U96 A;  4E17 A;  1FXK B;  3U10 A;  5EK0 A;  2IOQ A;  2J9U A;  3E83 A;  3WFV A;  4I4T B;  2VQE O;  4CIH A;  2CUG A;  1ZHZ A;  4LF5 B;  5KMG B;  1SQV H;  1IDS A;  1OJH A;  1R3I C;  4O7G A;  2CE4 A;  3E86 A;  3THO A;  1YYX A;  4O4I A;  3O9O A;  4CH5 A;  4YL0 A;  4ANJ A;  3EZI A;  4C7O B;  3AGU A;  5DS6 A;  2XLW A;  5JSL A;  2GA0 A;  3T4Z A;  4JTC B;  3T1H O;  4Q4Z F;  3N24 A;  3PHF 2;  1W2W A;  1KNY A;  1N33 O;  4B7K A;  2CGE A;  4NYK A;  4QPK A;  1GTO A;  4G28 B;  5LXT B;  5IYC O;  1LUV A;  3SP1 A;  5EBW C;  2ZD9 A;  3IQC A;  2LFF A;  2YL0 A;  4J7J A;  3HKK A;  4JYY A;  1DOV A;  1M57 C;  3E8F A;  5E79 Z;  3WHN A;  3HKD B;  3H1H H;  2Q7G A;  3RYI B;  2ZIM A;  3OUF A;  4LF4 O;  3E22 A;  2Z0A A;  1AI5 A;  3X2Q C;  2OJE D;  4HFF B;  3DMD A;  5D5Q A;  2V4D A;  1XNQ B;  1VQ4 V;  1YZC A;  3D36 C;  4DW0 A;  2DYR B;  4G0H A;  1AR5 A;  3W8H A;  4DV7 O;  3EGD A;  1F1M A;  2J9B A;  4M63 A;  5L0J A;  2HFE C;  3SJC C;  1NU1 H;  3OUS A;  3V5X A;  1YSC A;  4UCU A;  3CQZ A;  4ZI7 A;  2NSF A;  5J2U B;  4RDA A;  3E35 A;  5H2F Z;  3ZHV A;  4PA4 A;  2DYS C;  2UXC O;  4P2Z A;  4RBN A;  1GN3 A;  5EIB D;  2OTJ V;  4FPP A;  3LNR A;  4JI1 O;  1DGS A;  4DRX B;  1FS0 G;  1LS4 A;  5L0I A;  3TOM A;  1SF9 A;  3I5P A;  4C3D A;  3CXH F;  4K8Z A;  1MMG A;  2BL2 A;  3I56 V;  4RO2 A;  3SGI A;  4ULV A;  3J81 N;  1T6U A;  5CB4 A;  2H7B A;  2Q4F A;  5LA6 B;  1AJP A;  2Y4T A;  5KHI A;  2ODM A;  1XUQ A;  4TWK A;  1FFT C;  4DW1 A;  2Q6A A;  1L3P A;  4IYH A;  2WVQ A;  2KK1 A;  1Q6U A;  3GM1 A;  2PTM A;  4JYA O;  2ZKO A;  3LDE A;  1Y4M A;  2NUT A;  1N32 O;  3U9M A;  4EWC A;  2V3C C;  4B7E A;  1G5Z A;  1Q8I A;  2YWA A;  1VQM V;  4LLE A;  3CSK A;  1CGN A;  3MBG A;  4PFP A;  2ZXW C;  2ZIN A;  2IM8 A;  1FKA O;  2CGO A;  5A6J A;  1VF6 C;  4O2B B;  1VF5 B;  1JOG A;  5A6A A;  1K8A W;  2CTR A;  1N34 O;  1RJ9 B;  2H7O A;  2LIG A;  4IAR A;  3J06 A;  2PYJ A;  3KG2 A;  1RKC A;  2YID A;  3O6X A;  1RKE B;  3I5D A;  2GWW A;  1J95 A;  4KNW A;  1YLM A;  1H9G A;  1FAP B;  4HNA A;  3LSS A;  4ZLD A;  4YJ3 B;  1L8D A;  1T9K A;  1AR1 B;  1NTZ H;  3DXR A;  2F4V O;  3LS1 A;  1IXM A;  2XAQ A;  1D0Y A;  2YI8 A;  4BJT A;  2J0X A;  5COF A;  1RSO B;  5A6B D;  3JAK A;  4BW9 A;  2KYH A;  1VQL V;  2LQG A;  3QVZ A;  3JD1 A;  4D7T A;  4I9Q A;  4MW8 A;  2W0F C;  3K08 A;  1ORY A;  2ASR A;  1H2M A;  4J7Z A;  3N2G A;  5AGF A;  4IAO A;  2HMQ A;  1MZF A;  1FTS A;  4W8P A;  2NUP B;  3O65 A;  2DWD C;  2ZE5 A;  3FMS A;  3B8M A;  1EZV H;  3W8I A;  1T5E A;  2Q5Z A;  3W7U A;  5KUK A;  1YIT V;  4B3S O;  5JH7 B;  3T4R A;  3AK2 A;  2IU3 A;  2KW3 C;  2Q68 A;  5EZY B;  1V55 C;  1K97 A;  1XMO O;  2ZNI A;  2R7Q A;  1S5J A;  1G4U S;  1WB7 A;  4IB4 A;  2ZR3 A;  2PGG A;  4DVY P;  4K0K B;  1N0N A;  4QPJ A;  1KKD A;  4FAP B;  2QWP B;  2X51 A;  3EH1 A;  2FL4 A;  4O6N A;  4XDJ A;  3TOL A;  3IFX A;  1TWG A;  3JD3 A;  2QWQ B;  3OEH G;  2JGD B;  3J80 N;  1WOL A;  3B0U X;  2DI3 A;  1AP5 A;  5B66 Z;  3CCJ V;  4KNV A;  2LW7 A;  1D1C A;  1MQV A;  5BQI A;  4NTX A;  5B3S C;  2YVK A;  2O9X A;  3I5Q A;  4JAU A;  3FB8 C;  4BIU A;  3TK0 A;  2N05 A;  1ZX3 A;  3U11 A;  3NKD A;  2B9Z A;  3JAT A;  4W4K A;  4JRZ A;  2ETS A;  3CXC U;  2YKZ A;  2WZF A;  3SPJ A;  1SMY F;  3DM5 A;  4HZ3 A;  1TAE A;  2Q9L A;  4MVR A;  4DR4 O;  4ZLC A;  3SYC A;  5JT4 A;  4FZ0 A;  1YVW A;  1JA8 A;  2Y3D A;  4GLX A;  1L1F A;  3CC2 V;  3SPC A;  2HZ8 A;  1S5L Z;  1SR2 A;  3FOP A;  3LNM B;  3L34 A;  3RKO F;  1QPU A;  2YQY A;  5KYN A;  4XDK A;  2HKO A;  4RQE A;  1XMQ O;  4EEQ A;  4JVS A;  4KXR A;  4I50 B;  3WU2 Z;  3A9C A;  5GTI Z;  4DVZ A;  2I8B A;  1Y67 A;  3LDC A;  4PA3 A;  2R72 A;  1GM8 A;  4CC6 A;  4JI6 B;  4JI5 B;  4JJF A;  3EGX A;  3DC6 A;  4LWS A;  1VQK V;  3RT3 C;  1OCR C;  2H7V C;  1E83 A;  4LFB O;  4FJC C;  2Y0P A;  2BOB C;  1LM3 B;  3JD2 A;  3C18 A;  3FOO A;  3EVK A;  2ZXR A;  1JRA A;  4LFC B;  2P1A A;  3BFR A;  3SXK A;  1SZT A;  5CN0 A;  2IYL D;  2ARH A;  1DK1 A;  4JZG A;  4K8X A;  2QKS A;  1BHB A;  4ASU G;  3GB7 C;  5E33 A;  1B04 A;  4Q6G A;  4BPM A;  5L0D A;  5KA5 A;  3UT5 A;  3B40 A;  3WG7 C;  3K1I A;  1VMG A;  1PP9 H;  3NMK A;  5LGT A;  4I4T A;  1M56 C;  2PP4 A;  2FKX A;  2Y69 C;  3T4D A;  5KMG A;  3J7A U;  4X65 O;  4UDV A;  2XLD A;  1Z3I X;  4ZKI A;  2ADP A;  2M7W A;  4LDK A;  3FAJ A;  3E2E A;  1KBH A;  4LR3 A;  4O4I B;  1YJ9 V;  3EPV A;  4AX2 A;  2A6H F;  5L3E A;  4CDA A;  4AI8 A;  3BCC H;  4O4J B;  4DBR A;  3KYJ A;  1TQG A;  1NQT A;  4ULW A;  2PX3 A;  1YDI A;  4LF8 O;  1EKY A;  2ZXP A;  1PL0 A;  2B5U A;  5DLJ A;  1RP3 B;  4DUZ B;  3RWR D;  4EBJ A;  3VYW A;  2EIK C;  2PYL A;  4N21 A;  1YA7 O;  5B5E Z;  1K5Q A;  5LXT A;  2KGO A;  1S05 A;  4JCH A;  4KI2 A;  4FFB A;  1K05 A;  2XLE A;  3RYF A;  2DE0 X;  1FR0 A;  5KYW B;  2A68 F;  1VYI A;  4P9T A;  5JVD B;  3RYI A;  4DO2 A;  1XL6 A;  3TUL A;  2VWJ A;  3AG2 B;  2QSA A;  4HFK B;  3ZTZ A;  3ABU A;  1E1Q G;  3TCU A;  2YLD A;  5LOV B;  1OR2 A;  2PF4 E;  1H38 A;  4FVM A;  1JCH A;  3LAY A;  1H6G A;  3QTH A;  4UUJ C;  2EIJ B;  1FFT B;  2YI9 A;  3EGD B;  2G3V A;  2QTV A;  3BA8 A;  2HSQ A;  3DI5 A;  3ZSU A;  2JX0 A;  1PD3 A;  5B1B C;  4O4H B;  2WLH A;  5J2U A;  1QHT A;  2EIK B;  3JAR B;  4AIL C;  2QNL A;  2IH1 C;  3K5L A;  2R03 A;  4JZA A;  3SYN A;  4D6T H;  1PNK A;  1JFF B;  4MVQ A;  1KQS U;  3H2V A;  4N4W A;  1I4Y A;  4X1I B;  2O57 A;  1Q82 W;  3K0G A;  1R3L C;  3AG3 C;  2HFI A;  1H2N A;  1A32 A;  1B3Q A;  1SQF A;  4GKK B;  4LDR A;  4U5F E;  2R7X A;  4PI2 A;  1I5Y A;  5CB4 B;  5L3B A;  1XWJ A;  1BSM A;  3L74 H;  4J10 A;  1Z5W A;  2CTW A;  1NKD A;  1SA0 B;  2R7V A;  1TGO A;  1WP7 A;  2XOK G;  2E5L O;  1J8Y F;  2B0J A;  3AGT A;  4DR2 O;  2AP3 A;  3T9O A;  2CAZ C;  2EJ7 A;  4C3E A;  4P30 A;  4GQH A;  4WFG A;  5B1B B;  2YZS A;  3TJ5 A;  3A0R A;  1NH2 B;  3GOD A;  4A2N B;  2UUA O;  4R8C A;  2L9J A;  2HUJ A;  5JRA A;  5IYD O;  4GZR B;  5LHG A;  1IZM A;  4KC9 A;  4WGY A;  5CIV A;  4OIO F;  2ITD C;  2UXD O;  3VRC A;  1Q86 W;  5H6Q A;  1VOM A;  3CRR A;  1QU7 A;  2W6I G;  2QJ1 A;  1LIH A;  1E79 G;  5ITZ A;  1R3J C;  1RJ9 A;  2R7S A;  2UUB B;  1C03 A;  1BT8 A;  4JI3 B;  4YT4 A;  1PD0 A;  1OR3 A;  2KNH A;  4OIP F;  3C63 A;  1WNS A;  3OAA G;  1MSW D;  3OR6 C;  2X0C A;  2HEP A;  1FXV A;  1Z5V A;  4CDV A;  4U5D E;  3DXR B;  4ONS A;  2XLM A;  1NBB A;  1RSO A;  2FFH A;  2YUA A;  4JUR I;  1PD1 A;  3EJN A;  1O5H A;  3AK1 A;  2LO1 A;  1R6T A;  1WAS A;  2F93 B;  3C62 A;  2R7T A;  4TV9 A;  1KP3 A;  4JAS A;  2X6C A;  1ORS C;  3GAN A;  4JAV A;  1P7G A;  2HP8 A;  3ASO B;  2NUP A;  3MD0 A;  2GHY A;  5KX5 B;  3K5M A;  2CNW A;  3HLZ A;  3JSE O;  1M2O A;  1QCE A;  2Q7R A;  1G6U A;  1ZHW A;  3CME V;  1H9T A;  4B3M O;  4UCR A;  2EIM B;  2KSD A;  3PDM P;  1CPY A;  4X89 A;  5L3C A;  2RQ6 A;  3KZI Z;  1S76 D;  2AHY A;  3MDS A;  1Q0G A;  2Y3H A;  3HKC B;  3L70 H;  1HNX B;  1TUB B;  3H1J H;  2IXP A;  2BE3 A;  3ZBH A;  4BEM J;  4JZ2 A;  3L71 H;  2M64 A;  1L0L H;  4J7Y A;  3H01 A;  4TV8 B;  5CA0 B;  1OV9 A;  1I94 O;  2ZR2 A;  4LH6 A;  2YLG A;  4QIW F;  2AVK A;  1EBO A;  5AG2 A;  1GQA A;  4H4K C;  5A6K A;  1NT2 B;  4UVB A;  3UR3 C;  5KLV H;  4P9P A;  3UNG C;  1QR8 A;  2A7W A;  4WFA V;  2P6J A;  2VB6 A;  2Z5U A;  4JAA A;  1NZE A;  1R6N A;  1K40 A;  2PX0 A;  3JAT B;  2BE5 F;  3K9S A;  2E87 A;  1OCR B;  5TIS Z;  4OGQ B;  1S72 V;  3UKM A;  4EFB A;  1BR2 A;  2YL1 A;  1XHZ A;  5D92 A;  3L0I A;  3S3W A;  5CBH A;  5KYY A;  2VCA A;  4EKW A;  1YF2 A;  4BJ6 C;  5JUA A;  1M93 A;  3HKB A;  4X9Q A;  1VP7 A;  1XQ8 A;  1E1R G;  2MWQ A;  4NTY A;  4U3J A;  3ZN0 A;  5E3A A;  3ZRV A;  1SQQ H;  3DM9 B;  3VBB A;  1MAB G;  3M4B A;  4OD5 A;  1BCC H;  4XDL A;  4GYC B;  3NMI A;  4FM0 A;  4MVU A;  3CC4 V;  4DV1 B;  2G62 A;  2LGQ A;  4X64 B;  5IJ0 B;  1ZHT A;  4R7C A;  2ZE6 A;  3CRQ A;  1NR7 A;  4YN0 B;  4UFZ A;  1K7D A;  4LNU B;  4DR3 O;  5JQG B;  2BTO A;  2UUC B;  1H2S B;  4U5E E;  1QKR A;  4LFA O;  1GGQ A;  3GM3 A;  1IZ3 A;  2BOC C;  4IHJ A;  1MMM A;  3UO3 A;  2DW4 A;  5DQT A;  5L3G A;  3W7X A;  1GM9 A;  5KHK A;  3M99 B;  4FLW A;  2R7W A;  4J32 B;  2EUL A;  2R7R A;  4JI6 O;  1ZL8 B;  5LBQ A;  1VQ7 V;  5CA1 A;  1G1X B;  2D5R B;  2GV9 A;  4F6E A;  3MLG A;  4DV1 O;  2KKW A;  2ITC C;  2EZO A;  3WB0 A;  1BDJ B;  1GO3 F;  2GTA A;  5H6R A;  4J30 B;  1OZ0 A;  3DGE A;  1XNR B;  3ZMZ A;  4DRI B;  1VLS A;  2L6G A;  3BRC A;  1DTO A;  1XIL A;  3QG5 A;  3EH2 A;  5EC2 C;  2GBO A;  4KHP O;  1AI4 A;  1NJI W;  3MYF A;  1B06 A;  1D2D A;  3CCL V;  3ZQV A;  2G38 A;  4I55 B;  2IH3 C;  1THZ A;  2C04 A;  1AI7 A;  2AGA A;  1T01 A;  2F23 A;  4NXN B;  1E85 A;  2QLA A;  3HB3 B;  1MND A;  2YSU B;  3D36 A;  3IJ4 A;  3F7Y C;  3DAG A;  4O4J A;  3CB2 A;  2JD3 A;  1X59 A;  3L75 H;  2Q9A A;  4DV4 O;  3CWB H;  1D1A A;  3CC7 V;  3DSQ A;  1DF5 A;  3MAQ A;  3SYP A;  4MVO A;  1CXZ B;  1GMG A;  4DR5 B;  1OQC A;  2OCH A;  1WN0 A;  3N2Z B;  5F5H A;  2PY5 A;  2RJZ A;  2Y4U A;  1OHH G;  1K4D C;  4Z2W A;  4YK5 A;  1YZB A;  3DTU B;  4JW1 A;  4OX9 O;  2ETN A;  1SQP H;  4FFB B;  3DAF A;  2OYQ A;  3LES A;  2V1D A;  3IAY A;  1PM9 A;  1N33 B;  1WJZ A;  3B29 A;  1FFX A;  2ZXW B;  3SJQ C;  4NXM O;  1BZ4 A;  3VAY A;  3CAX A;  4DBQ A;  4RAI A;  5LP6 C;  5K1P A;  5B3I A;  4L8J A;  1YJG A;  2PUS A;  2CNW D;  1FXK A;  3CSX A;  1ZUQ A;  3FAP B;  5KAI Z;  4Z9H A;  4OPA A;  3TET A;  3EFO B;  3CYO A;  5B1O A;  3S29 A;  4U5G A;  3AG1 C;  4MND A;  2JS5 A;  5L0C A;  4UVC A;  2ZM6 O;  1WB8 A;  3GWO A;  3U3F A;  4KHP B;  1AI6 A;  3JAR A;  5JJN B;  3JAL B;  3SYA A;  4LF9 B;  3ZED A;  2WVO A;  1JFF A;  1Y6X A;  4R50 A;  2Q0O C;  5IYB O;  1K73 W;  4X1I A;  3BAB A;  1IBK O;  1P84 F;  3JSL A;  3GOR A;  4X20 B;  2W9Y A;  3M7M X;  1JAF A;  3OTO B;  2VCC A;  1XBL A;  1BR4 A;  2NLJ C;  3VOU A;  3MFN A;  2WA3 A;  1KTM A;  2EBO A;  1SA0 A;  1AB3 A;  3CMA V;  1LPE A;  2AU5 A;  4GUN A;  3SJB C;  1MMN A;  3QZC A;  3ZQY A;  1RPR A;  1K92 A;  2Y39 A;  2IM9 A;  5L0H A;  1SET A;  4PJ0 Z;  3E22 B;  2J8W A;  3QO8 A;  5EC1 C;  3SYO A;  2ICW G;  3U9J A;  3AEI A;  1NTK H;  3FB7 C;  4BJ5 A;  1OKK A;  3JRT A;  3POV A;  3AG4 B;  4B3M B;  3I55 V;  3ZIB A;  2L7A A;  1I5X A;  2JPU A;  2JRI A;  3OMI B;  1VMA A;  2A6E F;  5JLI A;  3LDD A;  3RBZ A;  4WBN A;  5LP6 A;  3EFF K;  2FGY A;  5COM A;  3LEV A;  4ZI7 B;  1AEP A;  4PAC A;  3UMI A;  4YIO A;  3QF7 A;  4AL0 A;  5E1A C;  1SZI A;  4N6C A;  2VQF B;  2W4M A;  1VTM P;  3KL4 A;  4PDV A;  3SDL A;  2OOC A;  3H9V A;  2XAF A;  3FXH A;  2F1M A;  4CS3 A;  5H5N A;  2EIL C;  4JI4 O;  3C3S A;  4E0I A;  2MYS A;  1PNM A;  2QKC A;  4K7B A;  2QM7 A;  4LER A;  1SZX A;  4UB8 Z;  2VQF O;  2OU6 A;  5BY1 A;  3DC5 A;  4DR7 O;  2YRF A;  4H33 A;  4PK4 A;  2CW0 F;  1VAR A;  2BTQ B;  4UV8 A;  2OWO A;  4LF5 O;  1YTF B;  2WB7 A;  2ZCE A;  3T2M A;  4TV9 B;  3AG4 C;  1HW7 A;  5IJ9 B;  4WAB A;  3N0T A;  1K34 A;  4DV5 B;  1FMV A;  1AVM A;  1M2V A;  1Q0K A;  2PI4 A;  4NTF A;  2Q69 A;  1FPO A;  3LLK A;  3LS0 A;  3K0D A;  4HAM A;  4O2A A;  3TD7 A;  5KX5 A;  2KG7 B;  4UVA A;  2IJJ A;  3HR0 A;  5F2V O;  3NRH A;  4OIR F;  3OD4 A;  3O39 A;  3ZIA G;  2A0B A;  2DYS B;  3EHB B;  2YS8 A;  2CDY A;  2LSE A;  4RWU A;  1M57 B;  2QA4 V;  5EHH A;  2PZS A;  1TWC A;  1TUB A;  3JT1 A;  3AG2 C;  2KJG A;  4DR5 O;  1SRY A;  2RDC A;  1WPX A;  3JCU Z;  2B1G A;  4JTD B;  2AW9 A;  2WL8 A;  1RKE A;  3Q6N A;  4JI5 O;  3MYI A;  3IQ5 A;  4KFM A;  2EPO A;  2A0L A;  3TJ6 A;  4HNA B;  2LW1 A;  2Y48 A;  4H0L B;  2OKU A;  3STL C;  4CC5 A;  1M9N A;  4DR7 B;  3JYY A;  2YIB D;  4YT8 A;  1QLE C;  3DE8 A;  3FKS G;  1AJQ A;  1A7V A;  2VQE B;  3H1I H;  5H9C A;  4LH7 A;  2RSE B;  5IT9 N;  4U7N A;  1R4T A;  4X66 B;  2GAQ A;  3N2K A;  5CBG A;  3K9A A;  3K7D A;  2Y0I A;  5LGU A;  3N2G B;  1KU2 A;  3SXM A;  2B1I A;  4XLP F;  2CH7 B;  3IC9 A;  4IAQ A;  3K58 A;  2LFR A;  1ORQ C;  1AIL A;  2AWC A;  1NZ6 A;  5KYY B;  1D0X A;  1HE1 A;  1OCO C;  4CZZ A;  2QWR B;  3NMJ A;  3A8T A;  4FX5 A;  2UUB O;  5KYX A;  2XT9 A;  3FD9 A;  4CS7 A;  1E86 A;  2QM4 A;  1WAZ A;  4ICG A;  1ZW2 A;  4J7K A;  3JTL O;  4EBB A;  4GX0 A;  1V54 B;  5TJ5 E;  5DED A;  2YXY A;  2H8P C;  4FLU A;  3K03 A;  3ZHQ A;  4NCQ A;  1NTM H;  5IJ0 A;  4L87 A;  3ZMS A;  2N04 A;  3X1O A;  4PD4 F;  1O3U A;  1SQG A;  1QLE B;  1FMW A;  3IC7 A;  4LNU A;  1W2B U;  2RMK B;  2P6V A;  1WAT A;  1O9G A;  2OCC C;  5JQG A;  1PPJ H;  1BBH A;  3U8V A;  4B3R B;  2ZPA A;  5E2Q A;  2EPN A;  3ZRW A;  4PJM A;  4DUZ O;  4HE8 D;  5B1A B;  4EB6 B;  4IIJ B;  4O6M A;  3K5N A;  1CPQ A;  4MVS A;  1NU9 C;  1JQ0 A;  3OMA B;  5CA1 B;  4DV0 O;  3ZCC A;  4F6R A;  5E3C A;  1R3K C;  1VQ9 V;  1PV0 A;  3C8G B;  1K5S A;  4ZOL B;  3CCQ V;  3QO5 A;  3GWL A;  3IEE A;  3A11 A;  5JJJ B;  2ZM6 B;  5BQH A;  4P9O A;  2LFD A;  2I15 A;  1N36 B;  1K4C C;  4HBN A;  2JDI G;  2DB4 A;  3WOD F;  3ABT A;  2LK4 A;  2UU9 B;  3T6G B;  2ZIO A;  2EIN C;  2R9I A;  1F4M A;  4I50 A;  1G8M A;  5L3D A;  1OXB A;  3DJU B;  5IY5 B;  5B3S B;  4DR6 O;  1O87 A;  3DD7 A;  4XQ1 A;  3OTF A;  3NR7 A;  1XI1 A;  4XTK A;  2XS8 A;  4UCV A;  1BGY H;  2ZXO A;  3AG1 B;  2JIZ G;  4N23 A;  1HDJ A;  2HJM A;  3EGX B;  1D5A A;  3TJT A;  4LFC O;  4P9F A;  4F4L A;  3G4S V;  3W7W A;  1BS3 A;  4FK5 C;  1YAU O;  1MSD A;  4LFB B;  4YY3 B;  4K0D A;  5J9P C;  2CGN A;  1U0B B;  4W8K A;  2XTA A;  4O79 A;  1IBM O;  2BSK B;  3T1C A;  1J8M F;  2R25 A;  2YEV B;  1RCP A;  3CS5 A;  4WCE V;  3PCV A;  1A7E A;  1OCC B;  2L81 A;  4U9E A;  4QI2 A;  1OCZ C;  2EJR A;  4JTA B;  3RYH A;  4DR1 B;  1JR9 A;  1OXK A;  4JEB A;  5IWA O;  2QDO A;  1E84 A;  2YL7 A;  3GVM A;  4TQF A;  1P7B A;  1HW1 A;  5IY5 C;  1HW2 A;  3B9Q A;  2CK3 G;  1Z6A A;  1HNZ B;  3U0C A;  5FNV A;  1EA8 A;  1U97 A;  4JI0 O;  2WWW A;  4RUE A;  4JC7 A;  2RCV A;  3H65 A;  3IQT A;  3EFO A;  3CRM A;  1V74 B;  2LD6 A;  2EIL B;  4CDY A;  5LL6 Y;  1HMD A;  2UUI A;  1SYQ A;  2LJ2 A;  4DXW A;  3X2Q B;  4JF3 A;  1H8E G;  5FPR A;  1I4Z A;  1N36 O;  4CS8 A;  4K3A A;  2ILM A;  1SQX H;  4B6I A;  2YHS A;  4JGS A;  4W4L A;  2EPK X;  1I0H A;  5LMU O;  3VQY A;  3BA9 A;  3K1H A;  1IXB A;  4ZIB A;  4WGZ A;  4UCS A;  1VIB A;  4XPW A;  4X20 A;  1IBM B;  4GX5 A;  2HS5 A;  1LE4 A;  1H2K A;  4A5U B;  1I94 B;  5EGY A;  1IVS A;  5DS4 A;  1N34 B;  3KYI A;  3WG7 B;  5LHH A;  1HNX O;  5DS5 A;  3NYM A;  1H8H G;  3RYF B;  1SES A;  1NFN A;  3F5W C;  3FHD A;  2EX3 A;  1LKX A;  3VM6 A;  1QNM A;  1BQZ A;  2W4B A;  2V26 A;  3G4Z A;  5LOV A;  5A69 A;  3CCS V;  3A0B Z;  2P5O A;  3ZRX A;  4X1K B;  1NG1 A;  2MK3 A;  3U8P A;  2FTK A;  1TVK B;  1JVM A;  4AHC A;  5HV9 A;  1F4N A;  3B4S A;  2QUP A;  3MHH C;  2J45 A;  4XEV A;  5IYZ B;  1M90 W;  4WBN B;  4C3B A;  2DGJ A;  3JAM N;  1K3E A;  2LQT A;  3K5O A;  3V7O A;  5BR8 O;  1ARO P;  1UFI A;  1QZX A;  3R2P A;  3CCE V;  5T3T A;  5KHH A;  1NS1 A;  3ZJZ A;  1HR0 B;  1G8X A;  3B0V C;  5JWP A;  2HJF C;  1N4C A;  4XEF A;  1VF6 A;  1GN2 A;  3KPH A;  4DRH B;  4NR1 A;  2NSG A;  4H37 A;  4NY3 A;  1B6Q A;  4EFE A;  3APQ A;  3SZR A;  2UXC B;  4PHZ A;  1WTY A;  3WAQ A;  3FYI B;  1RM1 C;  1M6T A;  4J9Y B;  3ZN1 A;  4XEK A;  3TXS A;  5BMV A;  1DF4 A;  4QDL A;  4FM1 A;  3R7C A;  5LYJ B;  3DJN B;  1TR2 A;  3D3I A;  2H94 A;  3B0P A;  4E7Z A;  4X1Y A;  4CH3 A;  1ORJ A;  1VQ5 V;  4UCT A;  3RVY A;  2KG7 A;  4H44 B;  5FPO A;  4GCZ A;  3CEX A;  3A2F A;  5A9G A;  3IQ6 A;  4MQ9 F;  1OKK D;  3WB2 A;  1MNG A;  4PI0 A;  4I0X A;  5HFM A;  1XEQ A;  1YDX A;  2HV7 A;  2IBF A;  2PI5 A;  3ZMV A;  3HTK C;  4FLX A;  3T1H B;  2DJV A;  3EHM A;  1C17 M;  1KD1 W;  5FZT A;  1Y4C A;  1H7I A;  1TFO B;  4MTO A;  5B1A C;  5GON B;  2XS1 A;  2HVK C;  3U3B A;  3ABL C;  2L6F A;  2D4U A;  2IJH A;  2BCC H;  1F7Y A;  3GEH A;  1US6 A;  4MVM A;  4X8A A;  2IBZ H;  3RW0 A;  2X7R B;  2CCY A;  1FJG O;  1GM7 A;  1KUQ A;  4LBE C;  1ZTE A;  3G50 A;  3M4C A;  2JJ2 G;  2XL4 A;  3G71 V;  1Y74 B;  1S7Z A;  4GYT A;  2EZP A;  3H1K H;  3KKB A;  2M6Y A;  3RVZ A;  3S27 A;  2WLJ A;  3FAV A;  4GT1 A;  3Q4H A;  4J9Z B;  1P49 A;  2R70 A;  4E2L A;  2A79 B;  4CBE A;  5FL7 G;  1VQN V;  3N2K B;  1D0Z A;  1QVF U;  3C90 A;  2XXA B;  2CH7 A;  3CP1 A;  1GK9 A;  2HLD G;  1Q6H A;  4GEH A;  4I3M A;  4KBL A;  1GM5 A;  4XWJ A;  3EG9 A;  2IJK A;  4FMT A;  5LMN B;  1KB9 F;  3EXA A;  3D8C A;  5KYX B;  2QY9 A;  4JEA A;  3JD0 A;  3VQX A;  3CZ6 A;  2P4K A;  3OMN B;  4CH6 A;  1MOF A;  1ZWI C;  3KCX A;  1ZLZ A;  2R7U A;  3ZS8 C;  3QMK A;  3JAS A;  2XLO A;  2XSE A;  2UUA B;  1ZHX A;  2X0L A;  1LE2 A;  1HNW O;  3OW2 U;  1R5I D;  1FFH A;  1HNW B;  3DE9 A;  2XLV A;  3K79 A;  2UXD B;  3BY6 A;  5K1X A;  1BR1 A;  3C7J A;  1Z63 A;  1HWY A;  1OCC C;  4U7O A;  4WFH A;  3GWN A;  3L8I A;  1HP8 A;  4EBK A;  1YIJ V;  2W0X A;  1WA8 B;  5JVE A;  1Z5Z A;  2AZ0 A;  4IIJ A;  3ASN B;  3GWK C;  3M15 A;  3ETG A;  2KSF A;  5C93 A;  4JI2 O;  1WN7 A;  1A41 A;  1R73 A;  2WAM A;  4QE7 A;  1U89 A;  4F6R B;  4TOI A;  3CHX A;  5C8Y B;  2P67 A;  3AK3 A;  3C8G A;  3W2V A;  3U2L A;  4ZOL A;  3B2E E;  1Q43 A;  3JAW B;  4GKK O;  4DRJ B;  1UFB A;  4U5C E;  3OEO A;  2VAS A;  1HR0 O;  1ZHY A;  3DKA A;  2XM4 A;  4DV2 B;  1Q0F A;  4QGP A;  4DUY O;  1KMI Z;  2QGN A;  2P90 A;  1S5H C;  4U3J B;  5BR8 B;  3DZA A;  1MA1 A;  2VH3 A;  1KC8 W;  1QSP A;  1D5N A;  2ATK C;  5L3Q A;  3FB5 C;  3OM3 B;  2A0U A;  1NR1 A;  1SQB H;  4A4A A;  3ETE A;  3ABK B;  2Y3B A;  3ZHR A;  1T5O A;  1SER A;  4AK9 A;  4G27 B;  2DQ3 A;  1CPR A;  1FXK C;  3CX5 F;  1EZJ A;  5B1N A;  1L0N H;  3OGC C;  3S90 A;  4I9W A;  3OGI B;  4IHJ B;  1LS1 A;  1YVI A;  2Y69 B;  4KP4 A;  3T6B A;  4GX1 A;  3E89 A;  2CTQ A;  2WLI A;  1TWH A;  1H2G A;  2OTL V;  1MZE A;  3SXZ A;  4J11 A;  4DV3 O;  1XDC A;  1Q0D A;  3BPZ A;  4GKJ B;  1F23 A;  1ZSP A;  1ZL8 A;  1Q6I A;  2YEV A;  4OPH A;  2GSM B;  1IBK B;  2OIG A;  1NSG B;  1NBM G;  2DMX A;  4G78 A;  3LJB A;  3JYC A;  1Q7Y W;  2K9P A;  4CS2 A;  2NPU A;  4TT3 G;  5FCL A;  3HKE A;  1W59 A;  3DWW A;  4G7H F;  1RMV A;  4LF9 O;  3OTO O;  5CI9 A;  2HVJ C;  2XM0 A;  4Z1M G;  4G7Z F;  4LP8 A;  1F51 A;  1X4T A;  2IJI A;  3AG7 A;  5LMU B;  4JV5 O;  1L7C A;  3OT7 A;  3EQL F;  2GDS A;  3O55 A;  1WGW A;  4PJJ A;  2LGW A;  5FNV B;  3G80 A;  2P61 A;  1Y76 B;  2AZ2 A;  1HE9 A;  3F5T A;  4L6R A;  1WPB A;  4O4L A;  2JEX A;  2WLN A;  4ZHQ B;  4DR4 B;  1LVK A;  2HR3 A;  4K35 A;  2NG1 A;  3ABM B;  5JCO C;  4X65 B;  3M1C B;  2R02 A;  3U2M A;  1FJG B;  2QTO A;  2UUH A;  4JI0 B;  3SJA C;  1JPJ A;  3VF0 A;  3CJH B;  2AXT Z;  2EIJ C;  2JGU A;  3OWT A;  2ZQM A;  1LI5 A;  1COW G;  2ADQ B;  3IPM O;  5KUM A;  1PCX A;  4NXM B;  4JE9 A;  3S28 A;  4U3F H;  2L6H A;  1ZAU A;  4LF6 O;  2MW2 B;  3AQB A;  1G4Y B;  1Z23 A;  1N0J A;  2Q4P A;  2A69 F;  4CS4 A;  1FFX B;  3F47 A;  3LEO A;  3FFQ A;  2HJ3 A;  3E8B A;  1ENV A;  5IE9 A;  4X88 A;  3DXJ F;  2HV6 A;  4JI8 B;  3OEE G;  4LF7 B;  4NXN O;  1IUR A;  1PNL A;  1ZYR F;  2QR4 A;  4CSA C;  2KQX A;  4X1K A;  4QE9 A;  4B08 A;  5DM6 V;  4EHP A;  1UJW B;  5AC5 A;  3ZHT A;  4O6Y A;  4YL3 A;  2XRH A;  3SXY A;  1GH6 A;  1TFK B;  2XUM A;  4HYO A;  4J41 A;  1ZZP A;  3K66 A;  1MMA A;  5GW7 A;  1I7F A;  2XHB A;  3FYE B;  1H2L A;  3PJS K;  1IBL B;  1LI7 A;  1BMF G;  5EBM C;  4NB5 A;  3ZMT A;  3W4Y A;  1VQP V;  3JAL A;  1XZP A;  4R6Z A;  3QTC A;  3IGA C;  4KUM A;  4NKG B;  1XNR O;  4ER9 A;  4Q5S F;  2OQM A;  4AE4 B;  5EYP B;  4F4B A;  2YIC A;  3VQW A;  3H1L H;  4IYI A;  4BW5 A;  1C02 A;  5JCO A;  5A6B A;  4LAC B;  3JZ0 A;  1QVX A;  2NR5 A;  4YXW G;  3CCM V;  2R05 A;  3QVY A;  3HNI A;  2HHH B;  2QWO B;  5BMV B;  4DV0 B;  1CGM E;  5LA6 A;  1KYO F;  4UV9 A;  1T6Q A;  3K06 A;  2PBE A;  1J5E O;  1HMO A;  1NVP B;  2IXN A;  4PA7 A;  1WP8 A;  4RUF A;  5D5P A;  3CPW U;  1ZU5 A;  3HJC A;  4MS2 A;  1CP9 A;  2P4V A;  2NUT B;  3HPL C;  4LFA B;  1S77 D;  3LNN A;  2HJD A;  2FYU H;  4I0X B;  1R6K A;  1OCZ B;  1OW7 A;  4JYA B;  3CCU V;  3V5Z A;  3AJM A;  5LP6 B;  2C03 A;  4O2B A;  3AG3 B;  2DQ0 A;  3JSZ A;  5GON A;  5L3F A;  2LFS A;  2Q73 A;  3E70 C;  4DR6 B;  1YZA A;  1D1B A;  1M5I A;  4CSA A;  4WF9 V;  4H13 B;  3G6E V;  1GRJ A;  2E3C A;  2UXX A;  3K1I C;  3S0X A;  4NVP A;  4FLV A;  2WPD G;  4FWV A;  4YJ3 A;  2B0H A;  1GS9 A;  3JSN A;  1FXH A;  1TA8 A;  4FM2 A;  1Y74 A;  2QE7 G;  5J2T A;  2CDQ A;  4CS9 A;  1BL8 A;  1TUE B;  2XAJ A;  1ST6 A;  3BAA A;  2J46 A;  2R7O A;  4YHH B;  3FAV B;  1EFR G;  3MHS C;  4JV5 B;  1GN4 A;  5T3W A;  2BTQ A;  5BUO A;  4BWA A;  4UCO A;  4IWB A;  3OA1 A;  5IJ9 A;  5KHG A;  3L1M A;  3N27 A;  3VQV A;  1M2V B;  5F5F A;  4DK1 A;  4MVZ A;  1KU9 A;  1XZQ A;  4WFE A;  5CA3 A;  4O2A B;  2YL3 A;  5IWA B;  3LUT B;  1JMW A;  2Q7H A;  3ABK C;  4EUK B;  3BEH A;  4PV1 B;  4BIZ A;  3U5S A;  1VYK A;  1EN4 A;  4AQY B;  1IW7 F;  1XNQ O;  4XBF A;  5EZY A;  1N1C A;  2XLH A;  4YY3 O;  4YJ2 A;  2GUZ B;  2WA4 A;  3P32 A;  2Q9C A;  2J7P D;  3K59 A;  4K1O A;  2PNO A;  1YJN V;  3TXQ A;  3JAS B;  2HMZ A;  2XAS A;  2QKA A;  3RQE A;  2X6A A;  2WZG A;  2P7T C;  5K0I A;  5L0G A;  1GKF A;  3GM2 A;  3V5Y A;  3U0Z A;  2R9R B;  1Y6D A;  3L73 H;  3JYH A;  5A2Q N;  5EIB C;  1N32 B;  4I1M A;  1XHX A;  3SPH A;  3BRJ A;  2Y3G A;  2UU9 O;  4E4E A;  3G4X A;  3D3Q A;  3ASO C;  2YXH A;  1YJW V; 
#chains in the Genus database with same CATH homology
 1QR8 A;  4GX5 A;  3ZMU A;  1QR9 A;  1KEC A;  2V7Q G;  1ROP A;  3JD4 A;  4QPK A;  2P6J A;  1GTO A;  4WFA V;  4G28 B;  2Z5U A;  5IYC O;  1R6N A;  5EBW C;  2W6J G;  3WG7 B;  2ZD9 A;  5LHH A;  2EIM C;  1H8H G;  1OCR B;  1SES A;  3F7V C;  1S72 V;  1M57 C;  3E8F A;  3F5W C;  3UKM A;  1W0J G;  5CBH A;  1W0K G;  3OUF A;  1AI5 A;  3X2Q C;  2QEX V;  4EKW A;  4QNH B;  3B77 A;  1QVG U;  1VQ4 V;  4MTX A;  1E1R G;  4PDR A;  3CCS V;  2DYR B;  4PDM A;  3ZRX A;  2MK3 A;  3ZN0 A;  4BAY A;  2FTK A;  3ZRV A;  3NXS A;  1JVM A;  2HFE C;  3VBB A;  1MAB G;  3K04 A;  1F4N A;  1YHQ V;  3MHH C;  4XDL A;  3OUS A;  1M90 W;  4MVU A;  3CC4 V;  1YSC A;  1S3J A;  1Y66 A;  1K3E A;  4R7C A;  2C2A A;  1NR7 A;  3E35 A;  2D3O W;  1K7D A;  3QNE A;  4Q20 A;  1ARO P;  4PA4 A;  2DYS C;  4P2Z A;  3CCE V;  5KA6 A;  2OTJ V;  3E8G A;  1M56 B;  3ZJZ A;  4FPP A;  2BOC C;  2HJF C;  1FS0 G;  2DW4 A;  2IU0 A;  3ZRW B;  5L3G A;  3W7X A;  1GM9 A;  4H37 A;  3I56 V;  3M99 B;  4RO2 A;  4PDL A;  1B6Q A;  3SPG A;  4CBC A;  3FYI B;  1RM1 C;  4J9Y B;  3ZN1 A;  5LBQ A;  1OCO B;  1VQ7 V;  1DF4 A;  5BZB A;  1AJP A;  3D3I A;  2H94 A;  2EZO A;  2ITC C;  4LC1 A;  4TWK A;  2WLL B;  2Q6A A;  1GO3 F;  4MTG A;  5H6R A;  1OZ0 A;  1V54 C;  3DGE A;  1VQ5 V;  3ZMZ A;  3RVY A;  3LDE A;  1Y4M A;  1DTO A;  4GCZ A;  4MSW C;  5EC2 C;  5HFM A;  1AI4 A;  1NJI W;  1VQM V;  2PI5 A;  2OCC B;  3ZMV A;  3CCL V;  3OR7 C;  2IH3 C;  1KD1 W;  1THZ A;  2ZXW C;  1AI7 A;  3LSQ A;  4MT8 A;  3R65 A;  1K8A W;  4MTO A;  5B1A C;  2HVK C;  3HB3 B;  3KG2 A;  3ABL C;  2YSU B;  3D36 A;  3F7Y C;  3QO7 A;  1V55 B;  2IJH A;  1J95 A;  4X8A A;  4MVM A;  3RW0 A;  3CC7 V;  2X7R B;  1DF5 A;  1GM7 A;  3LSS A;  3SYP A;  4MVO A;  4LBE C;  1GMG A;  1AR1 B;  1IXM A;  2JJ2 G;  2XAQ A;  3G71 V;  2EZP A;  1K33 A;  1NH2 D;  2JJ1 G;  3RVZ A;  1VQL V;  2WLJ A;  4GT1 A;  1OHH G;  1K4D C;  4J9Z B;  3DTU B;  4E2L A;  3JD1 A;  2A79 B;  4MW8 A;  2W0F C;  3K08 A;  5FL7 G;  1VQN V;  2V1D A;  1QVF U;  2A9H A;  2ZXW B;  3SJQ C;  3CD6 V;  3CP1 A;  1GK9 A;  2DWD C;  2HLD G;  4RAI A;  3B8M A;  2EIN B;  3W7U A;  2UXN A;  2IJK A;  4FMT A;  5KUK A;  1YIT V;  3E8H A;  1FXK A;  2IU3 A;  3SPI A;  2Q68 A;  3JD0 A;  1V55 C;  1KP2 A;  3TET A;  3CYO A;  1K97 A;  5B1O A;  3AG1 C;  3OMN B;  1MOF A;  1ZWI C;  2ZR3 A;  4UVC A;  2Z3Y A;  4WFB V;  4QPJ A;  1KKD A;  2X0L A;  3GWO A;  3OW2 U;  1AI6 A;  1S0V A;  4XDJ A;  3SYA A;  3IFX A;  3K79 A;  3BY6 A;  3JD3 A;  1N8R W;  3OEH G;  1HWY A;  2WLM A;  4R50 A;  5IYB O;  1OCC C;  4U7O A;  1K73 W;  4WFH A;  1M1K W;  3CCJ V;  1YIJ V;  2WSS G;  5B3S C;  2X6B A;  3ASN B;  2XND G;  1WLE A;  3ETG A;  4JAU A;  3FB8 C;  4BIU A;  5C93 A;  5IDJ A;  1R73 A;  2WAM A;  2NLJ C;  3VOU A;  4QE7 A;  4FIP C;  2EBO A;  3CXC U;  3CMA V;  2P67 A;  1XL4 A;  3SPJ A;  2JK5 C;  4HZ3 A;  1RPR A;  1K92 A;  4MVR A;  3CCV V;  1SET A;  1JPX A;  3SYC A;  3QO8 A;  5EC1 C;  3SYO A;  1L1F A;  3CC2 V;  3SPC A;  3AEI A;  2P90 A;  3FB7 C;  1S5H C;  3AG4 B;  3LNM B;  5CBF A;  3I55 V;  1KC8 W;  1I5X A;  4XDK A;  2ATK C;  2HKO A;  4RQE A;  3OMI B;  3FB5 C;  3OM3 B;  3LDD A;  3RBZ A;  3EFF K;  1NR1 A;  2K1E A;  3ETE A;  3ABK B;  1SER A;  2ZDI A;  5E1A C;  3ASN C;  4G27 B;  2DQ3 A;  1PKX A;  3LDC A;  1FXK C;  1EZJ A;  4PA3 A;  4PDV A;  3ZRS A;  1GM8 A;  5B1N A;  3OGC C;  2XAF A;  4I9W A;  2EIL C;  1K9M W;  1CEZ A;  1VQK V;  1Q81 W;  2Y69 B;  1OCR C;  3ABM C;  3B8N A;  4FJC C;  4KP4 A;  1PNM A;  4GX1 A;  2BOB C;  3W7T A;  3E89 A;  2WLI A;  3JD2 A;  1H2G A;  2QM7 A;  2OTL V;  4PA6 A;  3ETD A;  1F23 A;  4JYC A;  4H33 A;  2YEV A;  2AHZ A;  2GSM B;  4UV8 A;  1YTF B;  3OFN G;  1VQ6 V;  1NBM G;  3T2M A;  1SZT A;  3JYC A;  3AG4 C;  5CN0 A;  1Q7Y W;  1VQO V;  1VQ8 V;  1K34 A;  4TT3 G;  2PI4 A;  2Q69 A;  2QKS A;  3K0D A;  1BHB A;  4HAM A;  2HVJ C;  4ASU G;  3GB7 C;  4UVA A;  4Z1M G;  1MG1 A;  2IJJ A;  4LP8 A;  1F51 A;  2IJI A;  2F43 G;  3CCR V;  3ZIA G;  2DYS B;  3EHB B;  3UM7 A;  5KA5 A;  3WG7 C;  5LGT A;  2JEX A;  1M56 C;  1LNQ A;  1M57 B;  2WLN A;  2QA4 V;  2HR3 A;  2Y69 C;  3T4D A;  3ABM B;  1BHA A;  3AG2 C;  4WFF A;  1NVP D;  4ZKI A;  1SRY A;  2M7W A;  2QTO A;  3FB6 C;  2QM8 A;  3E2E A;  1WPX A;  1RM1 B;  1YJ9 V;  2B1G A;  4JTD B;  2XAG A;  5L3E A;  2DYR C;  2EIJ C;  2ZQM A;  1NQT A;  4KFM A;  1COW G;  2A0L A;  4ZBM A;  1PL0 A;  2Y48 A;  2B5U A;  4UXN A;  3STL C;  1RPO A;  5KUM A;  1M9N A;  2EIK C;  2ZDI C;  4G2K A;  1QLE C;  4N21 A;  3FKS G;  3W7S A;  1JX9 A;  1AJQ A;  3TK1 A;  5H9C A;  1K5Q A;  4U7N A;  1G4Y B;  3K9A A;  3SYQ A;  5CBG A;  5LGU A;  2B1I A;  1AJN A;  3STZ C;  2KB1 A;  2LFR A;  1ORQ C;  3E8B A;  1ENV A;  4JYB A;  4X88 A;  2HG5 C;  4DO2 A;  1DLB A;  1XL6 A;  3AG2 B;  3OEE G;  3ABU A;  4I5S A;  1E1Q G;  3TCU A;  1OCO C;  4CZZ A;  1H38 A;  1PNL A;  1JCH A;  4UUJ C;  2EIJ B;  1FFT B;  4QE9 A;  5DM6 V;  1UJW B;  4GX0 A;  1V54 B;  2NNU A;  1QLN A;  2JEU A;  2H8P C;  4HYO A;  3K03 A;  1PD3 A;  5GW7 A;  5B1B C;  1JOY A;  4L87 A;  3FYE B;  2WLH A;  3PJS K;  1QBZ A;  3ZMS A;  1BMF G;  5EBM C;  2EIK B;  3ZMT A;  1QLE B;  1VQP V;  2IH1 C;  3IC7 A;  1W2B U;  4R6Z A;  1PNK A;  3IGA C;  4KUM A;  2OCC C;  4MVQ A;  1KQS U;  2DWE C;  1Q82 W;  4BW5 A;  3K0G A;  3ZRW A;  1R3L C;  4MW3 A;  3AG3 C;  4PEL A;  5LHI A;  4MTF A;  5B1A B;  1YI2 V;  4MVS A;  4YXW G;  3CCM V;  1I5Y A;  1JQ0 A;  1YTF D;  3ABL B;  5L3B A;  3OMA B;  1P4R A;  3K3W A;  2IW5 A;  4UV9 A;  3K06 A;  3ZCC A;  1NKD A;  1R3K C;  1VQ9 V;  2WLL A;  1NVP B;  3JCZ A;  1K5S A;  2XOK G;  4PA7 A;  2XAH A;  3CCQ V;  4RUF A;  3QO5 A;  3CPW U;  4P30 A;  4WFG A;  4MS2 A;  1CP9 A;  5B1B B;  3A0R A;  1NH2 B;  1JJ2 U;  4R8C A;  3HPL C;  1S77 D;  5IYD O;  4P9O A;  5LHG A;  1R6K A;  4TSF G;  1OCZ B;  1K4C C;  2ITD C;  1Q86 W;  2JDI G;  5H6Q A;  3P30 A;  3CCU V;  3ABT A;  5EBL C;  3ML0 A;  2W6I G;  5CMU A;  2EIN C;  3AG3 B;  1E79 G;  1F4M A;  2R9I A;  5LGN A;  1R3J C;  1G8M A;  2DQ0 A;  5L3D A;  5IY5 B;  5B3S B;  5L3F A;  2LFS A;  4WF9 V;  3G6E V;  2UXX A;  4GX2 A;  3OAA G;  3AG1 B;  2JIZ G;  4N23 A;  2WPD G;  1MSW D;  3OR6 C;  4F4L A;  3G4S V;  1FXV A;  5HFL A;  3W7W A;  4FK5 C;  1FXH A;  2WLI B;  2QE7 G;  5J9P C;  1BL8 A;  1TUE B;  2XAJ A;  4QJF B;  3T1C A;  5DN6 G;  2WLK A;  4OXS A;  1EFR G;  2YEV B;  3MHS C;  4WCE V;  1OCC B;  1OCZ C;  2EJR A;  1KP3 A;  4JAS A;  2X6C A;  2Q67 A;  3OE7 G;  4RQF A;  4JTA B;  4PA9 A;  4JAV A;  4LCU C;  4MVZ A;  2OT5 A;  3ASO B;  4WFE A;  3MD0 A;  5CA3 A;  2GHY A;  3LUT B;  4JPR A;  1P7B A;  3ABK C;  5IY5 C;  3BEH A;  4BIZ A;  2LP7 A;  1QCE A;  2CK3 G;  3CME V;  1FXK B;  4XBF A;  2WWW A;  4RUE A;  5EK0 A;  3E83 A;  3WFV A;  2EIM B;  1CPY A;  2EIL B;  3P32 A;  4X89 A;  5L3C A;  1S76 D;  2AHY A;  1YJN V;  4DXW A;  2XAS A;  3X2Q B;  1R3I C;  4JF3 A;  1H8E G;  3E86 A;  2X6A A;  2P7T C;  1GKF A;  2R9R B;  3H01 A;  4JGS A;  2ZR2 A;  4QIW F;  3SPH A;  1EBO A;  4UVB A;  3ASO C;  3T4Z A;  4JTC B;  4P9P A;  1YJW V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...