2ZD9A

Structure of a bacterial cyclic-nucleotide regulated ion channel
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'APLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQLVAAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mll3241 protein
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
total genus 59
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zd9A02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 2zd9A01
4MW3A 4X8AA 4R7CA 2ZXWC 4MVUA 4R50A 2Y69C 1KKDA 3OR6C 4WFGA 2BOCC 1LNQA 3HPLC 4JTDB 2YEVA 5EBLC 2EINC 3ABLC 2WLKA 1V55C 3E86A 3TETA 4MSWC 4PA7A 4OXSA 2WLIB 3AG2C 1P7BA 2JK5C 3FB6C 4RUFA 2ITCC 3SYAA 3K04A 3FB8C 5B3SC 2AHZA 2EIMC 1OCOC 2NLJC 3OUSA 4WFHA 5E1AC 3STZC 4J9YB 3SPCA 3FB5C 5IY5C 2WLLB 3LUTB 3ASOC 3E8BA 3K0DA 4GX0A 4HYOA 1OCCC 1G4YB 4KFMA 4LCUC 3K0GA 2HVKC 1V54C 2ZD9A 2BOBC 3OUFA 1OCZC 3UKMA 1QLEC 3K03A 4DXWA 3E8FA 1OCRC 2W0FC 3BEHA 3GB7C 3LDEA 4MVRA 5KUKA 3AG3C 3E8HA 2QKSA 3K08A 4MTFA 4R8CA 3IFXA 3RVZA 4MVMA 1XL6A 3R65A 2K1EA 4X88A 4QE7A 4JTCB 2Q6AA 3SPJA 3PJSK 3F7YC 3SPIA 4P9OA 4PA4A 1M56C 1R3JC 3SYCA 4XDJA 5EBMC 3UM7A 5EBWC 3RW0A 4GX5A 5CBGA 4P2ZA 4RAIA 2WLIA 2IH3C 2H8PC 4G27B 5B1AC 4MTGA 3SPHA 1R3LC 3KG2A 3RVYA 3ABKC 3ZJZA 2WLJA 5J9PC 4XDLA 3OGCC 2HVJC 3SPGA 4MW8A 2EIJC 2WLLA 4QNHB 4PDRA 4QE9A 4P30A 2X6CA 3ABMC 3EFFK 2DWDC 1R3IC 2A9HA 4WFEA 5KUMA 2ATKC 3JYCA 3RBZA 3LDDA 1M57C 4WFFA 2EIKC 4RUEA 4MVSA 2KB1A 2X6BA 3WG7C 2EILC 1BL8A 2ITDC 3T4DA 3E89A 4RO2A 2WLNA 5EK0A 2QTOA 5CBHA 4I9WA 4PA9A 4MTOA 3T2MA 2HG5C 1JVMA 1K4DC 2Q68A 1J95A 2DYSC 3SYPA 4MVOA 4PA6A 4GX2A 2DYRC 1S5HC 3LDCA 4MVQA 1ZWIC 2DWEC 2AHYA 4LP8A 4H33A 5B1BC 3FB7C 4H37A 3ASNC 4R6ZA 4MVZA 3E83A 3T4ZA 4P9PA 4J9ZB 2OCCC 4LBEC 4PDMA 2Q67A 4UUJC 5EC1C 3SYQA 3VOUA 3X2QC 2R9RB 3F5WC 2HFEC 4CBCA 5CBFA 3ZRSA 4EKWA 4TWKA 2P7TC 4G28B 2X6AA 4MS2A 4ZBMA 4HZ3A 3AG4C 1R3KC 3STLC 3TCUA 4PDLA 3SJQC 4BW5A 4F4LA 4JTAB 4PA3A 3K06A 2Q69A 2WLMA 4X89A 5EC2C 3SYOA 4XDKA 1ORQC 4PDVA 1K4CC 2WLHA 4GX1A 3LNMB 3AG1C 2A0LA 3E8GA 3OR7C 3IGAC 2A79B 5BZBA 2IH1C 3T1CA 2HJFC 3F7VC 1XL4A
chains in the Genus database with same CATH superfamily
4R7CA 4N23A 1XMQO 2LP7A 4JW1A 2BOCC 4NTXA 1H2SB 4G7HF 2R7OA 2XLMA 1VOMA 4JI3O 4CBEA 3ZHSA 1M9NA 2YIBD 2ODMA 3EQLF 3K9SA 4EB6A 3EH2A 4U3FH 5E1AC 1QKRA 1PM9A 4J9YB 1Z23A 5IY5C 4PJMA 4HEAJ 2R7XA 1FXKA 3FOPA 3ETDA 1Z7Qc 1YDXA 1M1KW 2A6EF 3CCSV 3K03A 1QU7A 2OJED 4FPPA 2Q5ZA 4JKVA 1OCRC 3RN4A 1Q6UA 3JARB 5LMNO 4H0LB 4KNVA 4BWAA 1NBBA 2QUPA 4LLEA 2R7UA 2GTAA 1AI4A 1Y76B 5GONA 1SYQA 3H9VA 1VK5A 1YF2A 3QNEA 3CRAA 3ZWIA 2P6JA 4B3TB 1Q0GA 3ZSUA 1LI7A 3L9DA 3SJCC 2YHSA 2QWOB 1HNZB 1AR5A 4P2ZA 2Z15A 4O6NA 3BHPA 1Q86W 5J9PC 1I94O 4LDKA 2LO1A 1VQLV 2VCAA 3AQCA 4FMTA 5B66Z 3ZHQA 3DJUB 3E35A 2XAQA 1IXBA 1I5NA 3OGIB 4O4JA 1BT8A 2IJKA 4DR3O 3JT1A 1P7GA 4X65O 4X66B 3CEXA 4DV4B 4NTWA 3G50A 5JVEA 1AJPA 4EBKA 4D7TA 2KNHA 1YDIA 1ZZPA 2ZXWB 4XLPF 3P30A 4CDYA 2A06H 3IAYA 4OIQF 3L73H 4I1MA 3ZRWA 3ABTA 3VBBA 2CGNA 2UUBB 4DO2A 4YJ2A 2Q4FA 2YI9A 2KC3A 1K34A 1A7EA 2OTJV 3K66A 1RJ9A 1G4US 4XQ1A 1QR9A 3C7JA 2G3KA 2WA4A 3B77A 1QPUA 1IZ3A 3B8NA 3AG7A 3T4RA 3DXJF 4GKKB 1OKKA 3HKDB 4L6RA 2YLGA 4OD5A 4CJGA 3JYHA 4YT4A 2PFDA 5KHJA 2KG7B 3L75H 3M4BA 2XL4A 3AK3A 2QY9A 1NSGB 2VCBA 4NXNB 1FJGO 5AGFA 5EZYB 4FESA 4JYBA 3U9JA 3ZMSA 4FM2A 1HMDA 4DV6B 1N33B 3OR7C 2Y4UA 2LFDA 3NYJA 3K57A 3B9QA 3LJBA 1FAFA 3EG9B 4LR3A 3UR3C 4XPWA 4JTDB 5AC5A 3LEVA 1AR4A 2R7RA 5GW7A 4AK9A 1WA8A 5B3SC 3OWTA 3K7DA 4W4KA 5LP6A 2X0CA 1EA8A 3EXAA 1PL0A 4I44A 1YVIA 4N06A 1SETA 3NMIA 3D8CA 1VMAA 3UNGC 3JD1A 2R9IA 3C63A 4KFMA 2OG2A 5LOVA 3I55V 2LD6A 1TUEB 3ABMB 2XAGA 3OUFA 4I55A 2ETNA 2XL6A 4LF5O 1O9HA 1NFNA 4I4TA 1THZA 2D4UA 3LNRA 4EHPA 1BGYH 4R8CA 2CTPA 5L0JA 4LF4B 1QQ3A 3CQZA 1BBHA 1Q43A 2RD9A 4GLXA 5A69A 2YC0A 3D36A 3SPIA 1ZHYA 5KYXA 2GTSA 4O4LA 4XDJA 3CCRV 4U5FE 2IU0A 2ZXRA 1XZQA 3SEOA 1VQKV 3RYHB 2YXYA 3FXHA 4JRZA 3HTKC 5BY1A 2B1IA 2ADPA 5C93A 3VYWA 2Y39A 4RWUA 1L1FA 2HVJC 2WA3A 4LFAO 2WLLA 2P7VA 1R4TA 3ZN1A 2LQGA 3TK0A 3ZBHA 2F66C 3M8AA 3O9OA 3H2UA 4BJ6A 2CW0F 2GDCA 1HP8A 1H2MA 3POVA 4RUEA 1N1CA 2CH7A 3BRCA 1YAUO 4LF9B 4YT8A 4U3JA 3S84A 3ML0A 4J7TA 1HWYA 1PV3A 5JVDB 5K1PA 2Q68A 3THOA 3VAYA 3LLIA 4OIOF 2F93B 3AG2B 2PYLA 1ZL8A 4R32A 4EB6B 5L3EA 3PCVA 4NVPA 4H33A 4FLYA 4X1YA 4NC3A 1AR1B 1B6QA 4UVCA 1T6IA 3IPMO 5CI9A 3VOUA 1EKYA 3ZEDA 2JS5A 5DVWA 2ZT9B 1J5EO 4EIYA 5IJ9A 3DAFA 1R3KC 1KBHA 5CMUA 2DI3A 1D2DA 4KC9A 3S3XA 1NG1A 4CIPA 4X89A 4I9QA 2NUTA 2B9ZA 3AG3B 3G4SV 1M5IA 4JEBA 5LGTA 3LESA 4J80A 3HNIA 4XDLA 1I08A 2OEXA 1VF5B 4JI3B 1JOGA 2M6YA 4X8AA 3AGUA 3OM3B 1JPNA 4CSAC 3MDSA 5B3SB 4NXMB 5L3FA 2QWRB 3HPLC 3CE2A 2UUIA 4JI4B 3H1KH 4PFOA 2J7PA 2GUZA 3SYAA 2XLWA 2YL0A 4NTBA 3H1HH 3OA1A 2ZM6B 2GSMB 3T1HO 1IBKO 1IZMA 4LCUC 1NVPD 1BR2A 3JSZA 1VQNV 3J81N 4YIOA 1C17M 1Z5VA 1FMVA 3ZHUA 1OQCA 2RDCA 1HNXO 2KGOA 2A6HF 2KW3C 2VC9A 5KHKA 3K3WA 3HKEB 1XZPA 3A2FA 2W0FC 3LDEA 3GB7C 2J9VA 5L0HA 1SRYA 1T5EA 3DC6A 5B5EZ 4B3MB 4CH3A 1XL6A 2UU9O 3DAGA 1SQXH 1MMGA 4X88A 1E84A 4JI5B 4JTCB 3SPJA 5COGA 4YJ2B 1GM5A 2YL3A 2P67A 3RYCA 4YXWG 3FKSG 1YYJA 4CS4A 5JUAA 3FFQA 5EYPA 4JV5B 2WVQA 3ZJZA 2WLJA 4FZ0A 2HHHB 3BAAA 4K35A 1VF6C 4YHHO 2ZIMA 3CJHA 3OGCC 4JASA 2KQ9A 2IOQA 4DW0A 3IQTA 2P90A 3PDMP 4YT5A 2UXBO 3S3WA 3CXCU 2VWKA 3HNJA 4PHZA 4X1IA 3T6GB 3WG7C 2V7QG 2ITDC 4O4IA 5E2QA 2OU6A 4D4XA 1RXQA 1VYIA 4JZ2A 3TGUH 4TQDA 1DOWA 3DI5A 5LMUO 3APOA 3F5TA 1ORJA 3ZTZA 2N74A 3EHNA 4A5UB 3DXRB 1PNLA 3Q7LA 2OCCC 1ZHXA 5CBFA 3F5WC 1K5QA 3NDBB 4NQFA 3AK2A 5JCOA 2EBOA 3DM9B 4G28B 1LI5A 4ZBMA 3SJQC 2PP4A 4I0XB 3EGDA 1SKVA 2Q0AA 2WLHA 1JFFA 1XNRB 3KZIZ 1N36O 4PD4F 2MYSA 1R6KA 4X62B 1E1QG 1AILA 2Y48A 4ZLCA 1QCEA 3ZX6A 5IWAB 1O3UA 1XHZA 1DLBA 5KHGA 5KYXB 1XMOO 2XAJA 4JAAA 4UB8Z 4DV1O 3HLZA 4JI0B 1LM3B 3E22B 3OMAB 3FB6C 1ZU5A 2W4MA 4B3RB 3TJ6A 5DS6A 4FM1A 5BQGA 4TV8A 1SQQH 2NR5A 256BA 3FB5C 1HW1A 1BE3H 2WLLB 3CCJV 1RM1C 3UT5B 2YWAA 3K0GA 1EM1A 1YYXA 1ZU4A 1JX9A 2Y3BA 3WB0A 2JJ2G 4LF6O 4DR6B 1PPJH 2P22C 1U97A 4HNAB 5L3VA 1DGSA 1ZSPA 4BIOA 5KYYB 1GN2A 2F1MA 4U3JB 3E8HA 4N21A 1B68A 4YL3A 1DF4A 4E7ZA 2DW4A 1B3QA 1ZUQA 3C8GA 4OINF 2OQMA 1ZL8B 1OJHA 2HSQA 1JA8A 1TKNA 5A6AA 3ZG1A 3QO5A 4Z1MG 2CE4A 1YSCA 3BPZA 5KA5A 4KHPO 4FLZA 3NG1A 4RAIA 1Q81W 1OR3A 1SQBH 1BHAA 1YI2V 2J9WA 5A6BD 4LWSB 3JRTA 3SPHA 4P6IC 3B0UX 2FFHA 3DKAA 2P61A 2HUJA 5IJ9B 5COMA 1F51A 4JI1B 1WJZA 2ICWG 4AL1A 1FMWA 3KCXA 2XUMA 5T3WA 2MK3A 2DGJA 3B8MA 4LFBO 3FHDA 4MTXA 3L8JA 3AEIA 1RSOB 3JYCA 4G78A 2CTWA 1AJQA 1Q0KA 3V5XA 1BL8A 2NUPA 4DUZO 3M99B 1OHHG 2QGNA 1K33A 1ST6A 2RNBA 3P3PA 2WZLA 1E85A 1VQ7V 3R66A 2Q00A 3IQCA 4K0KB 4HFKB 4QPJA 3P3NA 1GK9A 1ZHWA 5LYJA 4KI2A 1FPOA 4HE8D 4J10A 2ZCEA 1D1CA 2KK1A 1OV9A 1Y4MA 3ZS8C 2O57A 3STLC 4PJJA 2QWPB 1KECA 1C03A 1S72V 4O6MA 3OEEG 4JYAO 3L72H 4JI8O 2RCVA 3L0IA 1ORQC 1D5AA 2MHRA 4O2BA 2Q4PA 3JD0A 1CPQA 1X59A 3F7VC 4YJ3A 1L3PA 3OR6C 2ZDIC 3ZMZA 1LKXA 2R25A 3KH2A 2WLKA 5BQIA 1P49A 4MSWC 5A6KA 3NYLA 3FAVA 2XL8A 5F28E 3U8VA 1TVKA 3V5YA 4IYHA 5BQHA 2AHZA 2A0BA 2V3CC 1T6QA 3ABKB 2XTAA 4E17A 1HW7A 1WP7A 3CJHB 3GWOA 3OT7A 5E3AA 1FS0G 4E7SA 4FFKA 3K59A 1GMGA 4JYCA 5K1XA 1OCCC 4B3SO 1QBZA 3OTOO 4KL1A 4DBQA 3CB2A 2Q7EA 3E2EA 4X0RA 5F5HA 2EPOA 3BY6A 2OJQA 5AC4A 1H8EG 1TFOB 3UO2A 2JEXA 4X1IB 1M57B 5CA0A 3UMIA 1MZEA 2XLDA 5KYWB 4IHJA 3W7XA 4O4IB 4JI6B 4YY3B 1JQ0A 3AK1A 1HR0B 1A0BA 2UXCB 3K1IA 2ZPAA 3RVZA 3WHNA 1WAZA 4CS9C 4ER9A 5HFLA 4KP4A 3KMIA 2FGYA 3H65A 1MZFA 2R70A 1NTMH 4P9OA 1BS3A 5CA1A 2Z0AA 2HV7A 4D6TH 4DV7B 1P84F 4JYYA 5B1BB 3KKYA 5BR8O 4CS3A 5LA6A 4G27B 5IYBO 3L1MA 1TUBA 3MFNA 5JJEB 2JGDA 4QJFB 2WWWA 3NYMA 3SPGA 5H5NA 1VLTA 3JSLA 3EGDB 4X20B 4LF8O 4JI2B 3LSSA 4Q5SF 2I15A 3MD0A 1Y6DA 4ZI7B 4UB6Z 3DMDA 5LMUB 3ATPA 2G38A 1YJ9V 1PV0A 4OX9O 1N32O 1Q5OA 5BMVA 1VQ4V 1K4DC 3D3IA 1MNGA 1SQPH 4GYTA 3WB1A 2I8BA 5KA6A 3FB7C 4TV8B 2RSEB 5HSWA 3T4ZA 4F6RA 3CMEV 2UUAB 3K1HA 2BE3A 4LNUB 1XREA 1MG1A 2F95B 3ZRSA 2AU5A 1JR8A 3SXKA 4K8ZA 4RQFA 1RP3B 5L0CA 1MMAA 1OW7A 2ZE8A 1SMYF 2DMXA 1RKEB 3W7TA 2OIGA 1VQOV 3RYIA 4DR4B 1AVMA 2D5RB 5FPRA 3FD9A 3HKCA 4I5SA 1M90W 1H8HG 2IU3A 4DR5O 5JH7A 1YTFD 4X9QA 1A41A 2ZXWC 1YXBA 1VQ6V 2YEVA 1XNQB 3NKEA 3JAMN 5KYUA 3JZ0A 4Q20A 2R7VA 3ZC4A 3SJAC 3FB8C 1EN5A 4WGZA 3LSUA 2HZ8A 1RPRA 1JCHA 1Y74B 4I1OB 1NFOA 5B3IA 3I5DA 3SR2C 3FMSA 1LE2A 3HKKA 1G4YB 4DR1B 4B7KA 1FFXA 2ZD9A 3ICXA 2Q7HA 4X64B 3RYFA 1QZXA 3U11A 2XLVA 1S05A 4QI2A 1Q6HA 3DJNB 3JALB 3BEHA 3K79A 1FFHA 4UCOA 5CB4A 1MSWD 2IW5A 1TWHA 4NTYA 3RFRA 3IHUA 4Q4ZF 2QWQB 1XBLA 5H6RA 3T1YO 1S0VA 2UXDO 3ZCCA 1COWG 3G4XA 3ASNB 5CBGA 1P4RA 3QO8A 1ZW2A 1UG7A 4NB5A 4CDVA 4OIPF 2QLAA 5LHIA 2HLDG 4MTGA 4E0HA 2QE9A 1BR4A 4DR7O 3WB2A 1WPBA 1E83A 1JJOA 2GBOA 4MW8A 4JI7O 2XOKG 5GTHZ 1G1XB 2A68F 2LIGA 4LFCB 4P30A 3IEEA 3ZHTA 3ABMC 2PY5A 3FX7A 1Z5ZA 3L8IA 2BSKA 4ZOLA 2WZGA 2EIKC 2IJHA 3NXSA 1JOYA 4U5BE 3QZCA 3C62A 4RO2A 5DN6G 5CBHA 4Z9JA 3ECSA 1R6NA 2B1GA 2Q7RA 1EN6A 1O87A 2L6HA 2YL1A 1XHXA 2EZOA 2E5LB 2XXAB 2QM4A 2X51A 4CC6A 2NSFA 3JYYA 1OCOB 5J2TA 4Z2WA 3K5NA 4J30B 4C3DA 1NU1H 4DV5O 1WGWA 2FMLA 3QVNA 4G7OF 1V54B 2VH3A 1Z2GA 4P9TA 3BCCH 3GM1A 2P4VA 4GQHA 5L0DA 4JTAB 4U9EA 3TJTA 3CCEV 1ZHZA 5EC2C 3U9MA 2YLIA 2H7BA 4RBNA 1M93A 1WNSA 4FJCC 4XBFA 3EGXB 1K73W 2HMZA 3ZMUA 2A0LA 1F1MA 5IYCO 4PACA 1XL4A 2MW2B 2UXXA 2LJ2A 5CA1B 4LLCA 4EFBA 2ETSA 3KYJA 1VF7A 2Y4TA 4AHCA 3M4CA 4DUYB 3AG2C 2JRIA 5D91A 3KYIA 1N34B 4BPMA 1NU9C 4QDLA 5CN0A 2DN9A 2QA4V 4WJ0A 1FXKC 4I50A 1HNWB 3GWNA 3L74H 1F7YA 2BCCH 2QM7A 2BOBC 3N27A 3OD4A 4GKJO 2R02A 4H54A 3FVYA 2A3QA 3EHMA 1OXKA 1G8MA 3U5SA 4ABMA 4D4NA 3QW1A 3A0HZ 3AG3C 2QJ1A 1B06A 3C3TA 5BMVB 3JCUZ 1R1BA 2QR4A 2F4VB 3U3FA 1GM8A 4PFPA 3W2WA 1MNEA 4IJJA 3QTCA 1YZAA 4F6RB 1K40A 2VQEB 1V74B 4NTAA 2QKAA 5KMGB 3P32A 3CRRA 4O6YA 1IBMO 2IYLD 1D0YA 5L0IA 3WODF 4TV9A 3CC7V 2EIKB 2H8AA 1UPGA 4DK1A 3RYIB 2XLOA 2Q0OC 2YZSA 1LIHA 1R3IC 3B0PA 3ZIAG 3ZMTA 3AG1B 3PN1A 2EPMX 1XEQA 5L3QA 3MAQA 1DOVA 2YSUB 4UCRA 2YXHA 5IE9A 5JLIA 3E9VA 2YEVB 3HNKA 3T2MA 4C3EA 2EINB 4IAQA 1M2VA 4MQ9F 3SP1A 1KD1W 2VASA 3LDCA 1Q82W 3DZAA 5A6BA 4Q7CA 3J7AU 1R73A 4CSAA 3E83A 5KHIA 4PDMA 2W0XA 4CS8A 1E1RG 2ILMA 2R9RB 4U7OA 4C3BA 3VQXA 1FFXB 1LR1A 2P7TC 3SXZA 3UO3A 3MBGA 5T1DB 3RFYA 3RGBA 4CDAA 1PNKA 4XDKA 4Z9HA 1K4CC 3ZHVA 4ANJA 4K3AA 3ZHRA 2M7WA 4JJFA 4YWQA 3T1CA 3T4DA 5LHHA 4DV0O 1O9GA 2ADQB 2NSGA 1NR1A 4W4LA 5J2UA 3HJCA 1LNQA 3A8TA 3CSXA 2HKVA 4FLTA 5EHHA 2A0UA 3SNHA 2V26A 5A2QN 1FXKB 3VRCA 2AXTZ 4EEQA 1RPOA 3APQA 2YVKA 3K6BA 2HP8A 2VQFB 4G0HA 3LUTB 4GX0A 2XHBA 3GANA 1XMQB 2XM4A 1ZTEA 3U3BA 2D3OW 1WB8A 2GDSA 5GONB 1Q3EA 4TT3G 2JIZG 1A7DA 4WGYA 1HE9A 4YL0A 4PJ0Z 3WFVA 1Y67A 3KCYA 4M63A 4IGGA 5L3GA 1CPRA 4DRJB 3D36C 4BEMJ 4AL0A 1BDJB 3SYCA 1S77D 5EBMC 5J2TB 1Z3IX 3I4UA 5A6JA 4O4JB 5LMNB 4DV2O 4WF9V 5IYZA 5B1AC 1OW8A 1KYOF 2Z3YA 3GM2A 4DV3O 1D0ZA 3ZRXA 2Q9AA 2NN4A 1MMNA 2X0LA 1WN0A 4N6HA 1I4ZA 4ZHQA 4BJ6C 1TGOA 1PL4A 4O4HA 3EJNA 1QSPA 4WFEA 2KSFA 3ZRWB 4BJTA 1OXBA 5JSLA 4OIRF 1ZAUA 2Q9CA 1I94B 3GEIA 3FYEB 3DC5A 2EPNA 4BIZA 1RJ9B 3OW2U 3UGOA 2HG5C 4U9DA 1JVMA 2Y0IA 4PA6A 1WLEA 4DR3B 1N8RW 4O2AA 4I7ZB 4X65B 5BUOA 2ZXPA 4RD9A 3R7CA 1QQCA 2J9UA 4J32B 1Q0FA 2HFEC 3K58A 2NG1A 4UVAA 2CGEA 4CS7A 1YITV 5E33A 2PNOA 2UUCO 1W59A 3U2MA 3TJ5A 4F4LA 3AG4C 3HKBA 1SERA 1J8MF 1EFRG 3QVZA 4LERA 2OKUA 5F5FA 3RIPA 3NR7A 2B0HA 1BR1A 2IH1C 2XASA 2HEPA 3N0TA 2XLHA 1JPXA 1WA8B 1C02A 3BFRA 1U0BB 5LP6B 2FAPB 1GS9A 4EBJA 1IBLO 4BJ5C 1L8DA 1V55C 3G4ZA 4JEAA 3NMKA 3ZVRA 1AI7A 2W6IG 5LOVB 1FJGB 3RT3C 2XM0A 4YJWA 4U7NA 4UCSA 1HW2A 2NLJC 3OUSA 3STZC 1XI1A 4I55B 3UGPA 2Q73A 4MT8A 4TV9B 4I4TB 5E3CA 4GT1A 1ORSC 3UQ8A 3JD4A 4LF7O 4TSFG 2L9JA 2M4EA 1WOLA 3QVYA 1YJNV 2ZXOA 3J80N 2ZQMA 2EX3A 5JP7A 2D2CB 4PJNA 1OKKD 3AGTA 4F6EA 4O4LB 4WFAV 4DR2O 4U5GA 3IFXA 1GM7A 1JAFA 3CRMA 2AWCA 5JQGA 1QNMA 3CWBH 1K5SA 5B1AB 3S90A 1M56C 1JMWA 4FK5C 4JC7A 4LF5B 4GX5A 3FAPB 3X2QB 4TUYA 4UDVA 2IH3C 5ITZA 1TWCA 4DRXA 3ABKC 4C7OA 4Q6GA 1A7VA 2PUSA 1H38A 2CH7B 3QO7A 4J7JA 4ULVA 5CIVA 2AVKA 2DWDC 2CTRA 1KTMA 5FL7G 1H6GA 5KUMA 2P6VA 1M57C 3KKBA 4WFFA 3B40A 1ENVA 3L71H 2EILC 5KX5A 3LNNA 2H3OA 4X1YB 2YIBA 1KKCA 4U5DE 4LFAB 2BTQA 2ZIOA 3C3SA 2C03A 1Q6IA 3I5PA 5DLJA 2YIDA 4HAMA 1G5ZA 5DQTA 4AQYO 2GWWA 2YL7A 5B1BC 1EI7A 2EIMB 2DB4A 2CK3G 2IXMA 4P9PA 4J9ZB 3AG4B 5EC1C 2Q67A 1D1BA 3DE8A 2NUTB 5JCOC 2LFRA 1TFKB 4EKWA 4CZZA 4L8JA 3WU2Z 3VF0A 2RMKB 4DBRA 1H7IA 1QLEB 1GAXA 3JAWA 3F47A 3HNLA 4BG0A 3E8GA 1V55B 2GUZB 2XS8A 4CH5A 4MW3A 1VARA 3CPWU 1ZVZA 1E79G 1J5EB 2AW9A 2BL2A 2V1DA 3LLKA 3Q4HA 1LPEA 3O55A 4PJLA 2OYQA 3TETA 4CS9A 4UXNA 2EJRA 1SF8A 3VQWA 1I5YA 5L3DA 1OW6A 5CI8A 4O7GA 4G2KA 2CUGA 3UCSC 4JAUA 4X1KA 4FLUA 2EIJB 3ZIBA 2QKCA 2CCYA 4B3TO 2EJ7A 1HNZO 3JASA 4BIUA 4JF3A 5D5PA 3EH1A 3QG5A 5LBQA 2PF4E 2CTQA 2WZFA 1FKAO 2E87A 2ARHA 3RYCB 3RF3A 1M56B 3FYIB 3CAXA 3B09A 3FOOA 3ETEA 3R65A 3Q6MA 3T1HB 1IBKB 3UMHA 1BQZA 1WTYA 1U89A 2R7WA 4WBNA 4I3MA 1LS1A 5EYPB 4HBNA 1NU7D 1CPYA 3A11A 3RWRD 1T5OA 3ZN0A 4O2AB 1MA1A 3W7UA 4H4KC 3CRCA 3OTFA 2M64A 3W8HA 1HNXB 4X66O 2OWOA 3GODA 3NMJA 1Y76A 4DV4O 3OMNB 1VQ9V 4U5CE 2E76B 2IJJA 3RVYA 3BA8A 2UU9B 3W7WA 3DD7A 4CX9A 2J7PD 1KU9A 3HKBB 4W8PA 3HR0A 1PP9H 4QNHB 1K04A 2HJ3A 2EILB 1NTKH 3BRJA 4B7EA 3R2PA 3V5ZA 2UUBO 4DRHB 5EGYA 2IBFA 3G71V 5DECA 2E74B 2WPDG 1AI6A 1T9KA 2C04A 2QEXV 3E89A 1MMDA 3LSQA 5C8YA 2Y69B 4YHHB 4GKKO 4XEKA 3L70H 4J42A 1FR0A 1AI5A 1J95A 2W4BA 1TQGA 3LEOA 4IRUA 1IW7F 2UXBB 4IT5A 4LH6A 1ZWIC 3OMIB 4LP8A 4H37A 2W6JG 3ASNC 4R6ZA 1Q8IA 3MLGA 3UMKA 4DV6O 1N33O 3EZIA 2Y3HA 3O39A 1G4WR 1BCCH 3T6BA 4K8XA 5JJNB 1JFFB 3MX3A 2QTVA 1Z5WA 3VQYA 2HSBA 1OCZB 2XSEA 2K9PA 2H7OA 1EQ1A 3K9AA 1Y66A 2WLMA 1CGOA 4JZGA 5AG2A 3TK1A 3U0ZA 1AP5A 3HKDA 2G62A 3DE9A 2ZNIA 2KG7A 3U10A 1KB9F 1WASA 2PI4A 3S0XA 4DW1A 4R50A 2YQYA 1HY5A 3M15A 1AEPA 3G6BA 2OCHA 4Z9IA 1PCXA 4D7SA 5ITZB 4DRXB 5FCLA 1SA0A 4C7OB 1OCOC 1N36B 4UCUA 4FLXA 4RQEA 4LF4O 4J41A 1VQMV 3M79A 4ULWA 2H94A 1GN3A 4FVMA 3ABUA 1V54C 1XDCA 1D5NA 1XMOB 2LSEA 4DV1B 2NNUA 1FFTB 2YLDA 1XOUA 5DS5A 3UKMA 3G80A 3G6EV 2QM8A 4IIJA 2KQXA 3C8GB 4LACB 1RMVA 2QWNB 1VLSA 1LVKA 3AQBA 5KX5B 1G6UA 1Q0MA 3K5MA 1K8AW 1G8XA 2XLEA 2BTQB 4MVMA 2TMVP 3B0VC 3BA9A 3GEEA 3ZQVA 3HB3B 2Y3GA 3TOMA 2N05A 2DYRB 4PA4A 4JPRA 4LF6B 3OAAG 2OEVA 3N2ZB 5TISZ 3RW0A 2L6GA 3GEHA 1PD0A 1R3LC 1QHTA 4E2LA 4LF9O 1JRAA 4DOZA 2JVDA 1T6UA 3RYLA 4C7UA 2CDYA 4PDRA 2NUPB 4QI0A 1U6HA 2R03A 2IBZH 3X1OA 1W0JG 2A9HA 4KHPB 4IB4A 1NTZH 1K97A 4J11A 1TA8A 1FAPB 2QTSA 1HMOA 3Q4HB 4NYKA 4BR6A 5LYJB 4NY3A 2ZINA 2HFIA 1NZ6A 4ICGA 2Q3TA 3RQEA 4A4AA 5KYNA 3US6A 3H01A 1GO3F 1RFYA 4GUNA 4LFBB 3GORA 3FAJA 4N6CA 1LS4A 3CCLV 1WATA 1A32A 3CSKA 3K5OA 3C8GD 4X1KB 5JVDA 1HDJA 1N4CA 4JE9A 1ZX3A 3ASOB 3CHXA 2XAFA 4E0IA 4DUZB 1CGME 4PR9A 4E18A 1S3JA 1R5ID 1F4NA 3MYIA 1EBOA 4XPXA 4O2BB 4NXMO 4MS2A 3TCUA 3SDLA 3JASB 1NH2B 4JI4O 2GFHA 4YJ3B 1GTOA 3CP1A 2DOSA 5BXZA 1SQVH 3JD3A 4GX1A 4PV1B 1NQTA 1S5LZ 2GV9A 3AG1C 4PI0A 2J0WA 2ZM6O 3H1IH 3ITFA 3FAVB 3PHF2 4WBNB 3U8PA 1TVKB 2LQTA 3SGIA 5TJ5E 1R6TA 2LGWA 3W8IA 2EINC 4DYLA 5HFMA 5IDJA 1EN4A 5FNVA 4PA7A 3N2GA 4OXSA 4YIPA 4JYAB 3IQ6A 2YXLA 3OE7G 4JI8B 1KP3A 2ITCC 1AP6A 2YDEA 4YT2A 1TWAA 4B3MO 2OOCA 2ZE7A 5CA0B 1SZTA 4QGPA 4IHJB 4CH6A 4JI5O 3O6XA 2HVKC 1H9GA 1APCA 2CDQA 2EPLX 2QNLA 2MWQA 3QW0A 2OT5A 1DTOA 3JATA 5COFA 1AUEA 3VQVA 4NCQA 2JGUA 1S76D 4NKGB 2JEUA 3K08A 4JV5O 5C8YB 1GQAA 3GWLA 4NTFA 2PZSA 2HHHO 1D0XA 4WFBV 1E2XA 5LA6B 1GRJA 4B3SB 3OTOB 1FYJA 4J7KA 3PJSK 1TUBB 3HKEA 2JGDB 1M4UA 1OZ0A 1NKDA 4B6IA 1R3JC 2HKOA 2FL4A 1HE1A 1NH2D 2P1AA 2VWJA 1Y4CA 2Y3DA 3CRQA 3KG2A 1BQ0A 3C90A 4DVZA 4KNWA 2L6LA 2L6FA 2WB7A 4YL1A 3K5LA 1SZIA 1ZLZA 2IJIA 2KSDA 2CYDA 2NPUA 5BR8B 3RBZA 1VQPV 3QF7A 1AJNA 3MYFA 4AILC 2LW7A 2WLNA 3DSQA 4I9WA 3MHSC 5B1OA 1V9PA 3F46A 1CGNA 2R7SA 1Z6AA 1DF5A 2CGOA 4LF8B 2AZ0A 1MQVA 1SA0B 4H44B 2VS0A 2PYJA 1T01A 3JSEO 4K1OA 3V7OA 1XNRO 5KHHA 3IJ4A 5IY5B 4OX9B 4X62O 1N32B 5IWAO 2R05A 3GM3A 3CMAV 1KP2A 2X6AA 3D3QA 3DXRA 3HKCB 5H6QA 4IARA 4IIJB 5JH7B 3JRMO 3EVKA 4JI0O 5L0FA 4CIHA 5GTIZ 1SS3A 4B3RO 1OCRB 5KYUB 2JS3A 2DJVA 3LNMB 1KNYA 1U96A 3EFOA 1S7ZA 2R7TA 2Q9BA 2HJDA 2HJFC 1W2WA 5FLXN 5A9GA 4WCEV 4I0XA 1KC8W 1BZ4A 1YJGA 2KJGA 4AX2A 3ABLC 4CC5A 1YIJV 5GPGB 3RKOF 4DR6O 2V4DA 2BC5A 2PX3A 4UVBA 3RQGA 1QR8A 1ZYRF 4JURI 3RYFB 1LUVA 4WFHA 2F22A 3SPCA 1NBMG 4DR5B 4CJOA 2XAHA 3E22A 1IVSA 3U2LA 1IX9A 4QPKA 3TD7A 2YUAA 2EZPA 5CB4B 1ZW3A 1N0NA 3W7SA 1F23A 1K92A 1XWJA 2H7VC 1VMGA 1PNMA 3G67A 3E8FA 2LFFA 2RQ6A 3UT5A 4MVRA 1URFA 4MTFA 5KUKA 2QKSA 4KXRA 2WL8A 3QTHA 4JI1O 4JJGA 2UUHA 4QE7A 2G3VA 4JCZA 1K9MW 2ZKOA 2YS8A 2B5UA 4HNAA 1VQ8V 5JRAA 5KYYA 5LP6C 4FLVA 1KU2A 3SZRA 2Y0PA 1NVPB 1QVXA 1K3EA 5LXTA 5JS5A 5EBWC 4KUMA 1EZJA 1KUQA 3NRHA 1I7FA 4ZKIA 1BSMA 2WLIA 1UFBA 3TOLA 2RJZA 1GN4A 3CCMV 1IXMA 3S29A 2HMQA 5D5QA 1L0LH 2BSKB 4ZOLB 1VF6A 4GZRB 2CNWD 3T1YB 1TR2A 5FZTA 2E3CA 2UXDB 4LWSA 1SR2A 4K0KO 3EFFK 3LDDA 4J7YA 2L35A 2DQ0A 2C2AA 1LE4A 2KYHA 4OD4A 1CEZA 1FTSA 4DR7B 5EK0A 2JX0A 1F4MA 4W8KA 3EPVA 4MTOA 4JI7B 5FNVB 1AROP 2IM9A 1RSOA 2QSAA 3N2GB 2YKZA 2ZR2A 2JDIG 3MHHC 4OPAA 1XQ8A 4UCVA 3DGEA 1H9TA 4FLWA 2XS1A 4FX5A 3OFNG 3ZRVA 4CS8C 3X2QC 4BJ5A 2FB5A 1SESA 3DWWA 1YA7O 3S27A 1NS1A 3CS5A 3JATB 4BW5A 2JD3A 2Q69A 1V4AA 5JT4A 2LGQA 3ABLB 1TAEA 3CYOA 3NKDA 1W2BU 4DV5B 2VB6A 2WAMA 3DM5A 1EZVH 1BMFG 5F2VO 2JJ1G 4LC1A 4WFGA 5EBLC 4A2NB 1L7CA 4O79A 5LL6Y 2R9AA 1YCIA 3SXMA 4I50B 1SF9A 3W4YA 2JK5C 4CS2A 2EPKX 2R7QA 4RDAA 1MABG 1B04A 2EIMC 4YY3O 4JI6O 1I5XA 1HR0O 2UXCO 1BZKA 3EZHA 4EUKB 4LDQA 2A7WA 5DS4A 4UV8A 4K0DA 2GA0A 2VRZA 1MSDA 1MOFA 4XEFA 2CAZC 1X4TA 4DV7O 4FWVA 1WN7A 4GYCB 1QLEC 1JMKC 1Q0DA 2J45A 1AVOB 3H1LH 1WB7A 4GCZA 1SQGA 4FM0A 1US6A 3H1JH 1GN6A 5KYWA 1YA9A 3F7YC 2LW1A 3SJBC 2HV6A 3UM7A 1NI8A 4JI2O 3LS1A 4EFEA 4GKJB 5T3TA 5IT9N 2LFSA 2ZR3A 2PBEA 1H2LA 3T6JA 3A0BZ 3B2EE 3TXQA 3SYNA 3IQ5A 1AB3A 1SC5B 5DEDA 3JAKA 3K33A 2KKWA 2HR3A 1I0HA 2EIJC 3VM6A 4YN0B 4QE9A 4ASUG 1H2GA 3AJMA 3IC7A 3U0CA 3EFOB 2ATKC 3C8ZA 1D1AA 1M2VB 4YK5A 3WAQA 4IWBA 2UUAO 1NJIW 2A69F 3M7MX 2Q8VA 4X20A 3TXSA 2QTOA 1IBMB 2OIEA 5JWPA 1ORYA 3ZDLA 4B08A 3B4SA 4ZI7A 2L81A 1ZHTA 1VYKA 1PD1A 2GAQA 4JAVA 3GVMA 2J8WA 3OEOA 1S5HC 2Z5UA 3CZ6A 1KMIZ 4DR4O 1VP7A 1VQ5V 1OR2A 4DK0A 3B29A 4LBEC 4FAPB 2BE5F 4FZ1A 4TWKA 1GKFA 1XNQO 4PDLA 2P0NA 4LNUA 3K06A 2X7RB 5J2UB 1DK1A 4XLNF 1JR9A 1JPJA 4AI8A 1ROPA 2ZNJA 5BZBA 5D92A 2AWYA 2WVOA 1GGQA 4PK4A 1RKEA 3M1CB 2GHYA 2R72A 4DR1O 4MVUA 3KL4A 2Y69C 5LXTB 1YJWV 5LGUA 3A9CA 5LHGA 4IYIA 4X64O 3QMKA 2ZDIA 5EIBC 2IXPA 3JSNA 4QIWF 5L3CA 2WLIB 4IL6Z 2HS5A 1P7BA 5IJ0A 1O5HA 3K04A 4AE4A 3EHBB 4BJ1A 3PMRA 2J46A 3E8BA 2W45A 4FFBA 4DV0B 4HYOA 4OGQB 2LK4A 3ETGA 4WABA 2F23A 4BEJA 5DQZA 5HV9A 1Y6XA 2O9XA 3AOUA 2FKXA 1OCZC 1Y74A 2IM8A 3LS0A 3N2KA 1VB5A 2F43G 3IC9A 2PI5A 1WPXA 5KAIZ 4FIPC 4IAOA 1H2KA 3A0RA 3WG7B 1GM9A 3ZMVA 4U5EE 4J7ZA 3T9OA 3RH3A 2YICA 1YZBA 5IYZB 2ASRA 3CEIA 3JALA 1WP8A 2DE0X 4LFCO 2N04A 1YEWA 3O10A 2ZE5A 4DJ9A 1J8YF 4ONSA 2OCCB 4ZHQB 4HFFB 1Q7YW 2DQ3A 4O4HB 5CA3A 4OPHA 3JCZA 4LH7A 4XEVA 4F4BA 3L34A 4EWCA 1NT2B 4U5HA 1YHQV 5H2FZ 2LCHA 2E5LO 1FXVA 3CX5F 4UCTA 5KAFZ 1FFTC 2AZ2A 2OTLV 1QVFU 3DTUB 4DV2B 3GWKC 3S28A 4MVSA 2KB1A 2X6BA 1RKCA 3JARA 2P5OA 1Q90D 4DV3B 3ETQA 4JVSA 3CXHF 2A1DD 4BW9A 4UFZA 3S9OA 2DYSC 3OEHG 3SYPA 3Q7GA 4GX2A 2DYRC 2FYUH 2P4KA 4JCHA 4MVQA 2QE7G 2DWEC 1FD9A 2PGGA 4ZIBA 1E86A 3SYQA 1SZXA 1QVGU 5L0GA 1KQSU 4CH4A 1RM1B 4JIOA 2XXAA 1YZCA 2Q7GA 3O65A 1N0JA 3W2VA 4L87A 4PA3A 1TWGA 4DUYO 3LAYA 2YI8A 1NZEA 1PKXA 4GEHA 4P9FA 3ZQYA 1N34O 3JCUQ 4MNDA 4PI2A 1FXHA 2WVNA 1BHBA 2P06A 4NXNO 1IURA 4XWJA 1HNWO 2UUCB 1KKDA 1QLNA 5K0IA 1VTMP 2XNDG 3EGXA 3FDQA 3E86A 1L0NH 4TOIA 5FPOA 4G7ZF 4RUFA 2HJMA 2IXNA 3JAKB 1M6TA 1MMMA 1CP9A 3CCQV 3ASOC 1SQFA 3K0DA 2F4VO 2ZE6A 4PELA 1K7DA 1WWPA 3B71A 1YTFB 5B1NA 1IBLB 4E4EA 2J0XA 1Z63A 2XT9A 2IXOA 4UV9A 3RQFA 4H13B 5JQGB 2PX0A 1IDSA 2FTKA 4DXWA 2VQEO 2JPUA 5EZYA 1RCPA 5JJJB 4XPYA 2WSSG 2K1EA 4TUYB 3JD2A 4ZLDA 3TULA 2Q6AA 2Q9LA 4LF7B 4N4WA 2L7AA 2BTOA 3BVOA 2XRHA 1W0KG 3EG9A 1VIBA 1H2NA 2LP4A 2J9BA 3Q6NA 1FNTc 1LUWA 5DM6V 4LDRA 5H9CA 2H8PC 3CC4V 1YARO 3I56V 4DR2B 1I4YA 3CD6V 2AGAA 3CCUV 1VEWA 1PD3A 1S5JA 2PTMA 1UJWB 5EIBD 2YRFA 1K05A 4JGSA 3K1IC 1XUQA 4KBLA 2X6CA 5KMGA 1JJ2U 1CXZB 3I5QA 5E79Z 2W9YA 3J06A 2DYSB 4EBBA 4DVYP 1GH6A 4K7BA 1YVWA 4TQFA 4PA9A 2B0JA 4NR1A 4BAYA 3ZTMA 1MNDA 1M2OA 3H2VA 4MVOA 3C18A 5IJ0B 4DRIB 4AE4B 2AHYA 4JZAA 2E75B 4Z1VA 3BABA 5KLVH 1NLXA 2AP3A 3N24A 4MVZA 2VCCA 4UUJC 3TQOA 1UFIA 4CBCA 4FFBB 3JAWB 1OCCB 3JTLO 1XILA 3RYHA 2CNWA 5IYDO 3E70C 1NR7A 4HZ3A 3N2KB 3SXYA 4XTKA 3KPHA 5LGNA 4AQYB 3SYOA 2QDOA 4PDVA 3CC2V 2UXNA 2YIAA 2EULA 3IGAC 2A79B 3CCVV 5L3BA 1YLMA 2VQFO 2RN9A
chains in the Genus database with same CATH topology
4WCEV 4R7CA 4N23A 1KC8W 2LP7A 3OR6C 2ZDIC 2BOCC 3ZMZA 3ABLC 2WLKA 1V55C 1YIJV 4MSWC 1AI7A 2W6IG 4UVBA 1M9NA 4U7NA 1QR8A 2AHZA 2NLJC 3OUSA 3STZC 4WFHA 3ABKB 5E1AC 4J9YB 1NBMG 3GWOA 3SPCA 5IY5C 4MT8A 1FS0G 1GMGA 4JYCA 2XAHA 1OCCC 4GT1A 1QBZA 1FXKA 3JD4A 4QPKA 2EZPA 4TSFG 3ETDA 1M1KW 3E2EA 3W7SA 3BY6A 1F23A 1K92A 1YJNV 1H8EG 3CCSV 2JEXA 2ZQMA 1M57B 3K03A 1PNMA 4FPPA 3E8FA 1OCRC 3W7XA 1JQ0A 4MVRA 4MTFA 5KUKA 2QKSA 4WFAV 3IFXA 1GM7A 3RVZA 5HFLA 1AI4A 4KP4A 4QE7A 1K9MW 2B5UA 1VQ8V 3QNEA 1K5SA 5B1AB 2P6JA 4P9OA 1NVPB 1K3EA 1M56C 4FK5C 5B1BB 5EBWC 4KUMA 1EZJA 4GX5A 4ZKIA 4P2ZA 3X2QB 2WLIA 2IH3C 4G27B 5IYBO 3CCMV 1IXMA 1Q86W 3ABKC 5J9PC 4QJFB 2WWWA 1VQLV 4FMTA 3SPGA 1H38A 3E35A 2XAQA 3QO7A 2IJKA 3EFFK 3LSSA 2DWDC 3F7VC 5FL7G 3MD0A 5KUMA 3LDDA 1M57C 4WFFA 2DQ0A 2C2AA 1YJ9V 1AJPA 1ENVA 2EILC 1CEZA 5EK0A 2ZXWB 3P30A 1F4MA 1VQ4V 4MTOA 1AROP 1K4DC 3ZRWA 3ABTA 2ZR2A 2JDIG 3D3IA 3MHHC 4HAMA 3VBBA 3DGEA 4DO2A 5KA6A 3OFNG 5B1BC 3FB7C 3ZRVA 1K34A 2EIMB 3T4ZA 2CK3G 4P9PA 4J9ZB 2OTJV 3X2QC 3AG4B 5EC1C 2Q67A 3CMEV 1SESA 1QR9A 1MG1A 3B77A 3ZRSA 2LFRA 4EKWA 3B8NA 4CZZA 4RQFA 4BW5A 1QLEB 3W7TA 2Q69A 1VQOV 4JYBA 3ZMSA 3E8GA 3ABLB 3CYOA 3OR7C 1V55B 1W2BU 4I5SA 1M90W 1H8HG 2WAMA 2IU3A 4MW3A 1YTFD 3CPWU 1BMFG 1E79G 2ZXWC 2V1DA 2JJ1G 1VQ6V 4LC1A 4WFGA 4JTDB 2YEVA 5EBLC 3TETA 4Q20A 5GW7A 4UXNA 2JK5C 2EJRA 3FB8C 1I5YA 5B3SC 1MABG 2EIMC 5L3DA 1I5XA 1RPRA 1JCHA 1PL0A 1SETA 4G2KA 4JAUA 3JD1A 2EIJB 2R9IA 1G4YB 4KFMA 2ZD9A 3I55V 4UV8A 1TUEB 1MOFA 3ABMB 2XAGA 3OUFA 1QLEC 4BIUA 4JF3A 5LBQA 1THZA 3BEHA 3K79A 4R8CA 1M56B 3FYIB 2IW5A 4GCZA 1MSWD 3ETEA 3R65A 5H6RA 1CPYA 3D36A 3F7YC 3SPIA 1S0VA 3ZN0A 3W7UA 3UM7A 4XDJA 1COWG 3ZCCA 3CCRV 2IU0A 3ASNB 5CBGA 1P4RA 3QO8A 3OMNB 1VQ9V 2LFSA 5LHIA 2HLDG 2ZR3A 1VQKV 4MTGA 2IJJA 3RVYA 3W7WA 2B1IA 5C93A 2HVJC 1L1FA 2HR3A 4MW8A 2EIJC 2WLLA 2XOKG 4QNHB 3ZN1A 4QE9A 4ASUG 1H2GA 2EILB 4P30A 3ABMC 3IC7A 2ATKC 3G71V 2WPDG 2EIKC 4RUEA 2IJHA 1AI6A 3NXSA 1NJIW 1JOYA 2QEXV 3E89A 4RO2A 5DN6G 2QTOA 3LSQA 5CBHA 2Y69B 1R6NA 3ML0A 2B1GA 1HWYA 2Q68A 1AI5A 1J95A 4JAVA 2EZOA 1S5HC 3AG2B 2Z5UA 1ZWIC 3OMIB 5L3EA 4LP8A 4H33A 1VQ5V 4H37A 2W6JG 3ASNC 1OCOB 4R6ZA 1B6QA 1AR1B 4UVCA 4LBEC 3VOUA 4TWKA 1V54B 1GKFA 1R3KC 4PDLA 5CMUA 1OCZB 4JTAB 3CCEV 3K06A 2X7RB 1Y66A 2WLMA 3K9AA 4X89A 5EC2C 4XBFA 4FJCC 3AG3B 3TK1A 3G4SV 1K73W 3ZMUA 2A0LA 1ROPA 5BZBA 5LGTA 5IYCO 4XDLA 1XL4A 2PI4A 2UXXA 4X8AA 3OM3B 2GHYA 4MVUA 4R50A 2Y69C 5B3SB 1YJWV 5L3FA 3HPLC 5LGUA 5LHGA 2ZDIA 4QIWF 5L3CA 2WLIB 3AG2C 1P7BA 3SYAA 3K04A 3EHBB 1OCOC 2GSMB 4RQEA 1VQMV 2H94A 5CN0A 3E8BA 2QA4V 4HYOA 1FXKC 3ABUA 3ETGA 4LCUC 1NVPD 1V54C 1VQNV 2QM7A 2BOBC 2NNUA 1FFTB 1OCZC 3UKMA 3G6EV 2QM8A 2F43G 2PI5A 1WPXA 3K3WA 1G8MA 4FIPC 3LDEA 2W0FC 3GB7C 1SRYA 3A0RA 3AG3C 1GM9A 3WG7B 3ZMVA 1K8AW 4MVMA 1XL6A 4X88A 1GM8A 4JTCB 3HB3B 3SPJA 2DYRB 4PA4A 4JPRA 2P67A 3OAAG 3RW0A 4YXWG 3FKSG 2OCCB 1R3LC 4E2LA 2DQ3A 5CA3A 3ZJZA 1Q7YW 2WLJA 3P32A 3JCZA 3OGCC 4JASA 3CC7V 2P90A 2EIKB 4PDRA 1YHQV 1FXVA 1W0JG 1R3IC 3CXCU 2A9HA 2OTLV 3ZIAG 3ZMTA 3AG1B 1K97A 1QVFU 3DTUB 4MVSA 2YSUB 2KB1A 2X6BA 3WG7C 2V7QG 2ITDC 2YEVB 3T2MA 2EINB 2DYSC 3OEHG 3SYPA 3H01A 1GO3F 4GX2A 1KD1W 2DYRC 3LDCA 1Q82W 4MVQA 2QE7G 2DWEC 1PNLA 3CCLV 1R73A 3E83A 2OCCC 4PDMA 5CBFA 3SYQA 1E1RG 4U7OA 2R9RB 3F5WC 3ASOB 1QVGU 2XAFA 1KQSU 1K5QA 1RM1B 2EBOA 2P7TC 1S3JA 4G28B 1F4NA 1EBOA 4MS2A 4ZBMA 3TCUA 1NH2B 3SJQC 4L87A 1GTOA 3CP1A 4PA3A 1PNKA 4XDKA 3JD3A 1K4CC 1PKXA 2WLHA 4GX1A 2M7WA 1NQTA 3AG1C 1R6KA 1FXHA 3T1CA 3T4DA 2Y48A 1E1QG 1BHBA 5LHHA 1QCEA 1NR1A 1KKDA 1DLBA 1QLNA 1LNQA 2XAJA 2XNDG 2EINC 5HFMA 3E86A 5IDJA 4PA7A 3OMAB 4OXSA 3OE7G 1FXKB 1KP3A 3FB6C 4RUFA 2ITCC 1RPOA 1CP9A 3FB5C 3CCQV 2WLLB 3LUTB 3ASOC 1SZTA 3K0DA 4GX0A 3CCJV 1RM1C 4PELA 1K7DA 3K0GA 2HVKC 1YTFB 5B1NA 1JX9A 2D3OW 2JJ2G 4UV9A 2OT5A 1DTOA 4TT3G 2FTKA 2JIZG 4DXWA 1S76D 3E8HA 2JEUA 3K08A 4N21A 3WFVA 1DF4A 4WFBV 2DW4A 2WSSG 2K1EA 5L3GA 3JD2A 2Q6AA 3PJSK 1OZ0A 1NKDA 1W0KG 3SYCA 1R3JC 2HKOA 3QO5A 5EBMC 4Z1MG 1S77D 1NH2D 1YSCA 5KA5A 4RAIA 5DM6V 1Q81W 1BHAA 5H9CA 1YI2V 2H8PC 3CC4V 4WF9V 5B1AC 3SPHA 3I56V 3KG2A 3CD6V 2Z3YA 1F51A 3CCUV 1PD3A 1UJWB 3ZRXA 2X0LA 2IJIA 4JGSA 2X6CA 2MK3A 1JJ2U 3B8MA 4MTXA 4WFEA 3AEIA 3JYCA 3ZRWB 3RBZA 1VQPV 1AJNA 2DYSB 1AJQA 1BL8A 3FYEB 2WLNA 3M99B 1OHHG 4I9WA 4BIZA 3MHSC 4PA9A 1K33A 5B1OA 3OW2U 2HG5C 4BAYA 1JVMA 1VQ7V 4MVOA 4PA6A 1WLEA 1DF5A 1N8RW 4QPJA 2AHYA 1GK9A 4MVZA 4UUJC 4CBCA 5IY5B 2HFEC 4UVAA 1OCCB 1YITV 5IYDO 1Y4MA 3CMAV 1KP2A 2X6AA 1NR7A 5H6QA 4HZ3A 3AG4C 4F4LA 3STLC 1SERA 1KECA 1S72V 3OEEG 5LGNA 1EFRG 3SYOA 1ORQC 1OCRB 4PDVA 3CC2V 3LNMB 2UXNA 3IGAC 2A79B 3CCVV 5L3BA 2IH1C 2XASA 3JD0A 2HJFC 1JPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW3 A;  4X8A A;  4R7C A;  2ZXW C;  4MVU A;  4R50 A;  2Y69 C;  1KKD A;  3OR6 C;  4WFG A;  2BOC C;  1LNQ A;  3HPL C;  4JTD B;  2YEV A;  5EBL C;  2EIN C;  3ABL C;  2WLK A;  1V55 C;  3E86 A;  3TET A;  4MSW C;  4PA7 A;  4OXS A;  2WLI B;  3AG2 C;  1P7B A;  2JK5 C;  3FB6 C;  4RUF A;  2ITC C;  3SYA A;  3K04 A;  3FB8 C;  5B3S C;  2AHZ A;  2EIM C;  1OCO C;  2NLJ C;  3OUS A;  4WFH A;  5E1A C;  3STZ C;  4J9Y B;  3SPC A;  3FB5 C;  5IY5 C;  2WLL B;  3LUT B;  3ASO C;  3E8B A;  3K0D A;  4GX0 A;  4HYO A;  1OCC C;  1G4Y B;  4KFM A;  4LCU C;  3K0G A;  2HVK C;  1V54 C;  2ZD9 A;  2BOB C;  3OUF A;  1OCZ C;  3UKM A;  1QLE C;  3K03 A;  4DXW A;  3E8F A;  1OCR C;  2W0F C;  3BEH A;  3GB7 C;  3LDE A;  4MVR A;  5KUK A;  3AG3 C;  3E8H A;  2QKS A;  3K08 A;  4MTF A;  4R8C A;  3IFX A;  3RVZ A;  4MVM A;  1XL6 A;  3R65 A;  2K1E A;  4X88 A;  4QE7 A;  4JTC B;  2Q6A A;  3SPJ A;  3PJS K;  3F7Y C;  3SPI A;  4P9O A;  4PA4 A;  1M56 C;  1R3J C;  3SYC A;  4XDJ A;  5EBM C;  3UM7 A;  5EBW C;  3RW0 A;  4GX5 A;  5CBG A;  4P2Z A;  4RAI A;  2WLI A;  2IH3 C;  2H8P C;  4G27 B;  5B1A C;  4MTG A;  3SPH A;  1R3L C;  3KG2 A;  3RVY A;  3ABK C;  3ZJZ A;  2WLJ A;  5J9P C;  4XDL A;  3OGC C;  2HVJ C;  3SPG A;  4MW8 A;  2EIJ C;  2WLL A;  4QNH B;  4PDR A;  4QE9 A;  4P30 A;  2X6C A;  3ABM C;  3EFF K;  2DWD C;  1R3I C;  2A9H A;  4WFE A;  5KUM A;  2ATK C;  3JYC A;  3RBZ A;  3LDD A;  1M57 C;  4WFF A;  2EIK C;  4RUE A;  4MVS A;  2KB1 A;  2X6B A;  3WG7 C;  2EIL C;  1BL8 A;  2ITD C;  3T4D A;  3E89 A;  4RO2 A;  2WLN A;  5EK0 A;  2QTO A;  5CBH A;  4I9W A;  4PA9 A;  4MTO A;  3T2M A;  2HG5 C;  1JVM A;  1K4D C;  2Q68 A;  1J95 A;  2DYS C;  3SYP A;  4MVO A;  4PA6 A;  4GX2 A;  2DYR C;  1S5H C;  3LDC A;  4MVQ A;  1ZWI C;  2DWE C;  2AHY A;  4LP8 A;  4H33 A;  5B1B C;  3FB7 C;  4H37 A;  3ASN C;  4R6Z A;  4MVZ A;  3E83 A;  3T4Z A;  4P9P A;  4J9Z B;  2OCC C;  4LBE C;  4PDM A;  2Q67 A;  4UUJ C;  5EC1 C;  3SYQ A;  3VOU A;  3X2Q C;  2R9R B;  3F5W C;  2HFE C;  4CBC A;  5CBF A;  3ZRS A;  4EKW A;  4TWK A;  2P7T C;  4G28 B;  2X6A A;  4MS2 A;  4ZBM A;  4HZ3 A;  3AG4 C;  1R3K C;  3STL C;  3TCU A;  4PDL A;  3SJQ C;  4BW5 A;  4F4L A;  4JTA B;  4PA3 A;  3K06 A;  2Q69 A;  2WLM A;  4X89 A;  5EC2 C;  3SYO A;  4XDK A;  1ORQ C;  4PDV A;  1K4C C;  2WLH A;  4GX1 A;  3LNM B;  3AG1 C;  2A0L A;  3E8G A;  3OR7 C;  3IGA C;  2A79 B;  5BZB A;  2IH1 C;  3T1C A;  2HJF C;  3F7V C;  1XL4 A; 
#chains in the Genus database with same CATH topology
 4R7C A;  4N23 A;  1XMQ O;  2LP7 A;  4JW1 A;  2BOC C;  4NTX A;  1H2S B;  4G7H F;  2R7O A;  2XLM A;  1VOM A;  4JI3 O;  4CBE A;  3ZHS A;  1M9N A;  2YIB D;  2ODM A;  3EQL F;  3K9S A;  4EB6 A;  3EH2 A;  4U3F H;  5E1A C;  1QKR A;  1PM9 A;  4J9Y B;  1Z23 A;  5IY5 C;  4PJM A;  4HEA J;  2R7X A;  1FXK A;  3FOP A;  3ETD A;  1Z7Q c;  1YDX A;  1M1K W;  2A6E F;  3CCS V;  3K03 A;  1QU7 A;  2OJE D;  4FPP A;  2Q5Z A;  4JKV A;  1OCR C;  3RN4 A;  1Q6U A;  3JAR B;  5LMN O;  4H0L B;  4KNV A;  4BWA A;  1NBB A;  2QUP A;  4LLE A;  2R7U A;  2GTA A;  1AI4 A;  1Y76 B;  5GON A;  1SYQ A;  3H9V A;  1VK5 A;  1YF2 A;  3QNE A;  3CRA A;  3ZWI A;  2P6J A;  4B3T B;  1Q0G A;  3ZSU A;  1LI7 A;  3L9D A;  3SJC C;  2YHS A;  2QWO B;  1HNZ B;  1AR5 A;  4P2Z A;  2Z15 A;  4O6N A;  3BHP A;  1Q86 W;  5J9P C;  1I94 O;  4LDK A;  2LO1 A;  1VQL V;  2VCA A;  3AQC A;  4FMT A;  5B66 Z;  3ZHQ A;  3DJU B;  3E35 A;  2XAQ A;  1IXB A;  1I5N A;  3OGI B;  4O4J A;  1BT8 A;  2IJK A;  4DR3 O;  3JT1 A;  1P7G A;  4X65 O;  4X66 B;  3CEX A;  4DV4 B;  4NTW A;  3G50 A;  5JVE A;  1AJP A;  4EBK A;  4D7T A;  2KNH A;  1YDI A;  1ZZP A;  2ZXW B;  4XLP F;  3P30 A;  4CDY A;  2A06 H;  3IAY A;  4OIQ F;  3L73 H;  4I1M A;  3ZRW A;  3ABT A;  3VBB A;  2CGN A;  2UUB B;  4DO2 A;  4YJ2 A;  2Q4F A;  2YI9 A;  2KC3 A;  1K34 A;  1A7E A;  2OTJ V;  3K66 A;  1RJ9 A;  1G4U S;  4XQ1 A;  1QR9 A;  3C7J A;  2G3K A;  2WA4 A;  3B77 A;  1QPU A;  1IZ3 A;  3B8N A;  3AG7 A;  3T4R A;  3DXJ F;  4GKK B;  1OKK A;  3HKD B;  4L6R A;  2YLG A;  4OD5 A;  4CJG A;  3JYH A;  4YT4 A;  2PFD A;  5KHJ A;  2KG7 B;  3L75 H;  3M4B A;  2XL4 A;  3AK3 A;  2QY9 A;  1NSG B;  2VCB A;  4NXN B;  1FJG O;  5AGF A;  5EZY B;  4FES A;  4JYB A;  3U9J A;  3ZMS A;  4FM2 A;  1HMD A;  4DV6 B;  1N33 B;  3OR7 C;  2Y4U A;  2LFD A;  3NYJ A;  3K57 A;  3B9Q A;  3LJB A;  1FAF A;  3EG9 B;  4LR3 A;  3UR3 C;  4XPW A;  4JTD B;  5AC5 A;  3LEV A;  1AR4 A;  2R7R A;  5GW7 A;  4AK9 A;  1WA8 A;  5B3S C;  3OWT A;  3K7D A;  4W4K A;  5LP6 A;  2X0C A;  1EA8 A;  3EXA A;  1PL0 A;  4I44 A;  1YVI A;  4N06 A;  1SET A;  3NMI A;  3D8C A;  1VMA A;  3UNG C;  3JD1 A;  2R9I A;  3C63 A;  4KFM A;  2OG2 A;  5LOV A;  3I55 V;  2LD6 A;  1TUE B;  3ABM B;  2XAG A;  3OUF A;  4I55 A;  2ETN A;  2XL6 A;  4LF5 O;  1O9H A;  1NFN A;  4I4T A;  1THZ A;  2D4U A;  3LNR A;  4EHP A;  1BGY H;  4R8C A;  2CTP A;  5L0J A;  4LF4 B;  1QQ3 A;  3CQZ A;  1BBH A;  1Q43 A;  2RD9 A;  4GLX A;  5A69 A;  2YC0 A;  3D36 A;  3SPI A;  1ZHY A;  5KYX A;  2GTS A;  4O4L A;  4XDJ A;  3CCR V;  4U5F E;  2IU0 A;  2ZXR A;  1XZQ A;  3SEO A;  1VQK V;  3RYH B;  2YXY A;  3FXH A;  4JRZ A;  3HTK C;  5BY1 A;  2B1I A;  2ADP A;  5C93 A;  3VYW A;  2Y39 A;  4RWU A;  1L1F A;  2HVJ C;  2WA3 A;  4LFA O;  2WLL A;  2P7V A;  1R4T A;  3ZN1 A;  2LQG A;  3TK0 A;  3ZBH A;  2F66 C;  3M8A A;  3O9O A;  3H2U A;  4BJ6 A;  2CW0 F;  2GDC A;  1HP8 A;  1H2M A;  3POV A;  4RUE A;  1N1C A;  2CH7 A;  3BRC A;  1YAU O;  4LF9 B;  4YT8 A;  4U3J A;  3S84 A;  3ML0 A;  4J7T A;  1HWY A;  1PV3 A;  5JVD B;  5K1P A;  2Q68 A;  3THO A;  3VAY A;  3LLI A;  4OIO F;  2F93 B;  3AG2 B;  2PYL A;  1ZL8 A;  4R32 A;  4EB6 B;  5L3E A;  3PCV A;  4NVP A;  4H33 A;  4FLY A;  4X1Y A;  4NC3 A;  1AR1 B;  1B6Q A;  4UVC A;  1T6I A;  3IPM O;  5CI9 A;  3VOU A;  1EKY A;  3ZED A;  2JS5 A;  5DVW A;  2ZT9 B;  1J5E O;  4EIY A;  5IJ9 A;  3DAF A;  1R3K C;  1KBH A;  5CMU A;  2DI3 A;  1D2D A;  4KC9 A;  3S3X A;  1NG1 A;  4CIP A;  4X89 A;  4I9Q A;  2NUT A;  2B9Z A;  3AG3 B;  3G4S V;  1M5I A;  4JEB A;  5LGT A;  3LES A;  4J80 A;  3HNI A;  4XDL A;  1I08 A;  2OEX A;  1VF5 B;  4JI3 B;  1JOG A;  2M6Y A;  4X8A A;  3AGU A;  3OM3 B;  1JPN A;  4CSA C;  3MDS A;  5B3S B;  4NXM B;  5L3F A;  2QWR B;  3HPL C;  3CE2 A;  2UUI A;  4JI4 B;  3H1K H;  4PFO A;  2J7P A;  2GUZ A;  3SYA A;  2XLW A;  2YL0 A;  4NTB A;  3H1H H;  3OA1 A;  2ZM6 B;  2GSM B;  3T1H O;  1IBK O;  1IZM A;  4LCU C;  1NVP D;  1BR2 A;  3JSZ A;  1VQN V;  3J81 N;  4YIO A;  1C17 M;  1Z5V A;  1FMV A;  3ZHU A;  1OQC A;  2RDC A;  1HNX O;  2KGO A;  2A6H F;  2KW3 C;  2VC9 A;  5KHK A;  3K3W A;  3HKE B;  1XZP A;  3A2F A;  2W0F C;  3LDE A;  3GB7 C;  2J9V A;  5L0H A;  1SRY A;  1T5E A;  3DC6 A;  5B5E Z;  4B3M B;  4CH3 A;  1XL6 A;  2UU9 O;  3DAG A;  1SQX H;  1MMG A;  4X88 A;  1E84 A;  4JI5 B;  4JTC B;  3SPJ A;  5COG A;  4YJ2 B;  1GM5 A;  2YL3 A;  2P67 A;  3RYC A;  4YXW G;  3FKS G;  1YYJ A;  4CS4 A;  5JUA A;  3FFQ A;  5EYP A;  4JV5 B;  2WVQ A;  3ZJZ A;  2WLJ A;  4FZ0 A;  2HHH B;  3BAA A;  4K35 A;  1VF6 C;  4YHH O;  2ZIM A;  3CJH A;  3OGC C;  4JAS A;  2KQ9 A;  2IOQ A;  4DW0 A;  3IQT A;  2P90 A;  3PDM P;  4YT5 A;  2UXB O;  3S3W A;  3CXC U;  2VWK A;  3HNJ A;  4PHZ A;  4X1I A;  3T6G B;  3WG7 C;  2V7Q G;  2ITD C;  4O4I A;  5E2Q A;  2OU6 A;  4D4X A;  1RXQ A;  1VYI A;  4JZ2 A;  3TGU H;  4TQD A;  1DOW A;  3DI5 A;  5LMU O;  3APO A;  3F5T A;  1ORJ A;  3ZTZ A;  2N74 A;  3EHN A;  4A5U B;  3DXR B;  1PNL A;  3Q7L A;  2OCC C;  1ZHX A;  5CBF A;  3F5W C;  1K5Q A;  3NDB B;  4NQF A;  3AK2 A;  5JCO A;  2EBO A;  3DM9 B;  4G28 B;  1LI5 A;  4ZBM A;  3SJQ C;  2PP4 A;  4I0X B;  3EGD A;  1SKV A;  2Q0A A;  2WLH A;  1JFF A;  1XNR B;  3KZI Z;  1N36 O;  4PD4 F;  2MYS A;  1R6K A;  4X62 B;  1E1Q G;  1AIL A;  2Y48 A;  4ZLC A;  1QCE A;  3ZX6 A;  5IWA B;  1O3U A;  1XHZ A;  1DLB A;  5KHG A;  5KYX B;  1XMO O;  2XAJ A;  4JAA A;  4UB8 Z;  4DV1 O;  3HLZ A;  4JI0 B;  1LM3 B;  3E22 B;  3OMA B;  3FB6 C;  1ZU5 A;  2W4M A;  4B3R B;  3TJ6 A;  5DS6 A;  4FM1 A;  5BQG A;  4TV8 A;  1SQQ H;  2NR5 A;  256B A;  3FB5 C;  1HW1 A;  1BE3 H;  2WLL B;  3CCJ V;  1RM1 C;  3UT5 B;  2YWA A;  3K0G A;  1EM1 A;  1YYX A;  1ZU4 A;  1JX9 A;  2Y3B A;  3WB0 A;  2JJ2 G;  4LF6 O;  4DR6 B;  1PPJ H;  2P22 C;  1U97 A;  4HNA B;  5L3V A;  1DGS A;  1ZSP A;  4BIO A;  5KYY B;  1GN2 A;  2F1M A;  4U3J B;  3E8H A;  4N21 A;  1B68 A;  4YL3 A;  1DF4 A;  4E7Z A;  2DW4 A;  1B3Q A;  1ZUQ A;  3C8G A;  4OIN F;  2OQM A;  1ZL8 B;  1OJH A;  2HSQ A;  1JA8 A;  1TKN A;  5A6A A;  3ZG1 A;  3QO5 A;  4Z1M G;  2CE4 A;  1YSC A;  3BPZ A;  5KA5 A;  4KHP O;  4FLZ A;  3NG1 A;  4RAI A;  1Q81 W;  1OR3 A;  1SQB H;  1BHA A;  1YI2 V;  2J9W A;  5A6B D;  4LWS B;  3JRT A;  3SPH A;  4P6I C;  3B0U X;  2FFH A;  3DKA A;  2P61 A;  2HUJ A;  5IJ9 B;  5COM A;  1F51 A;  4JI1 B;  1WJZ A;  2ICW G;  4AL1 A;  1FMW A;  3KCX A;  2XUM A;  5T3W A;  2MK3 A;  2DGJ A;  3B8M A;  4LFB O;  3FHD A;  4MTX A;  3L8J A;  3AEI A;  1RSO B;  3JYC A;  4G78 A;  2CTW A;  1AJQ A;  1Q0K A;  3V5X A;  1BL8 A;  2NUP A;  4DUZ O;  3M99 B;  1OHH G;  2QGN A;  1K33 A;  1ST6 A;  2RNB A;  3P3P A;  2WZL A;  1E85 A;  1VQ7 V;  3R66 A;  2Q00 A;  3IQC A;  4K0K B;  4HFK B;  4QPJ A;  3P3N A;  1GK9 A;  1ZHW A;  5LYJ A;  4KI2 A;  1FPO A;  4HE8 D;  4J10 A;  2ZCE A;  1D1C A;  2KK1 A;  1OV9 A;  1Y4M A;  3ZS8 C;  2O57 A;  3STL C;  4PJJ A;  2QWP B;  1KEC A;  1C03 A;  1S72 V;  4O6M A;  3OEE G;  4JYA O;  3L72 H;  4JI8 O;  2RCV A;  3L0I A;  1ORQ C;  1D5A A;  2MHR A;  4O2B A;  2Q4P A;  3JD0 A;  1CPQ A;  1X59 A;  3F7V C;  4YJ3 A;  1L3P A;  3OR6 C;  2ZDI C;  3ZMZ A;  1LKX A;  2R25 A;  3KH2 A;  2WLK A;  5BQI A;  1P49 A;  4MSW C;  5A6K A;  3NYL A;  3FAV A;  2XL8 A;  5F28 E;  3U8V A;  1TVK A;  3V5Y A;  4IYH A;  5BQH A;  2AHZ A;  2A0B A;  2V3C C;  1T6Q A;  3ABK B;  2XTA A;  4E17 A;  1HW7 A;  1WP7 A;  3CJH B;  3GWO A;  3OT7 A;  5E3A A;  1FS0 G;  4E7S A;  4FFK A;  3K59 A;  1GMG A;  4JYC A;  5K1X A;  1OCC C;  4B3S O;  1QBZ A;  3OTO O;  4KL1 A;  4DBQ A;  3CB2 A;  2Q7E A;  3E2E A;  4X0R A;  5F5H A;  2EPO A;  3BY6 A;  2OJQ A;  5AC4 A;  1H8E G;  1TFO B;  3UO2 A;  2JEX A;  4X1I B;  1M57 B;  5CA0 A;  3UMI A;  1MZE A;  2XLD A;  5KYW B;  4IHJ A;  3W7X A;  4O4I B;  4JI6 B;  4YY3 B;  1JQ0 A;  3AK1 A;  1HR0 B;  1A0B A;  2UXC B;  3K1I A;  2ZPA A;  3RVZ A;  3WHN A;  1WAZ A;  4CS9 C;  4ER9 A;  5HFL A;  4KP4 A;  3KMI A;  2FGY A;  3H65 A;  1MZF A;  2R70 A;  1NTM H;  4P9O A;  1BS3 A;  5CA1 A;  2Z0A A;  2HV7 A;  4D6T H;  4DV7 B;  1P84 F;  4JYY A;  5B1B B;  3KKY A;  5BR8 O;  4CS3 A;  5LA6 A;  4G27 B;  5IYB O;  3L1M A;  1TUB A;  3MFN A;  5JJE B;  2JGD A;  4QJF B;  2WWW A;  3NYM A;  3SPG A;  5H5N A;  1VLT A;  3JSL A;  3EGD B;  4X20 B;  4LF8 O;  4JI2 B;  3LSS A;  4Q5S F;  2I15 A;  3MD0 A;  1Y6D A;  4ZI7 B;  4UB6 Z;  3DMD A;  5LMU B;  3ATP A;  2G38 A;  1YJ9 V;  1PV0 A;  4OX9 O;  1N32 O;  1Q5O A;  5BMV A;  1VQ4 V;  1K4D C;  3D3I A;  1MNG A;  1SQP H;  4GYT A;  3WB1 A;  2I8B A;  5KA6 A;  3FB7 C;  4TV8 B;  2RSE B;  5HSW A;  3T4Z A;  4F6R A;  3CME V;  2UUA B;  3K1H A;  2BE3 A;  4LNU B;  1XRE A;  1MG1 A;  2F95 B;  3ZRS A;  2AU5 A;  1JR8 A;  3SXK A;  4K8Z A;  4RQF A;  1RP3 B;  5L0C A;  1MMA A;  1OW7 A;  2ZE8 A;  1SMY F;  2DMX A;  1RKE B;  3W7T A;  2OIG A;  1VQO V;  3RYI A;  4DR4 B;  1AVM A;  2D5R B;  5FPR A;  3FD9 A;  3HKC A;  4I5S A;  1M90 W;  1H8H G;  2IU3 A;  4DR5 O;  5JH7 A;  1YTF D;  4X9Q A;  1A41 A;  2ZXW C;  1YXB A;  1VQ6 V;  2YEV A;  1XNQ B;  3NKE A;  3JAM N;  5KYU A;  3JZ0 A;  4Q20 A;  2R7V A;  3ZC4 A;  3SJA C;  3FB8 C;  1EN5 A;  4WGZ A;  3LSU A;  2HZ8 A;  1RPR A;  1JCH A;  1Y74 B;  4I1O B;  1NFO A;  5B3I A;  3I5D A;  3SR2 C;  3FMS A;  1LE2 A;  3HKK A;  1G4Y B;  4DR1 B;  4B7K A;  1FFX A;  2ZD9 A;  3ICX A;  2Q7H A;  4X64 B;  3RYF A;  1QZX A;  3U11 A;  2XLV A;  1S05 A;  4QI2 A;  1Q6H A;  3DJN B;  3JAL B;  3BEH A;  3K79 A;  1FFH A;  4UCO A;  5CB4 A;  1MSW D;  2IW5 A;  1TWH A;  4NTY A;  3RFR A;  3IHU A;  4Q4Z F;  2QWQ B;  1XBL A;  5H6R A;  3T1Y O;  1S0V A;  2UXD O;  3ZCC A;  1COW G;  3G4X A;  3ASN B;  5CBG A;  1P4R A;  3QO8 A;  1ZW2 A;  1UG7 A;  4NB5 A;  4CDV A;  4OIP F;  2QLA A;  5LHI A;  2HLD G;  4MTG A;  4E0H A;  2QE9 A;  1BR4 A;  4DR7 O;  3WB2 A;  1WPB A;  1E83 A;  1JJO A;  2GBO A;  4MW8 A;  4JI7 O;  2XOK G;  5GTH Z;  1G1X B;  2A68 F;  2LIG A;  4LFC B;  4P30 A;  3IEE A;  3ZHT A;  3ABM C;  2PY5 A;  3FX7 A;  1Z5Z A;  3L8I A;  2BSK A;  4ZOL A;  2WZG A;  2EIK C;  2IJH A;  3NXS A;  1JOY A;  4U5B E;  3QZC A;  3C62 A;  4RO2 A;  5DN6 G;  5CBH A;  4Z9J A;  3ECS A;  1R6N A;  2B1G A;  2Q7R A;  1EN6 A;  1O87 A;  2L6H A;  2YL1 A;  1XHX A;  2EZO A;  2E5L B;  2XXA B;  2QM4 A;  2X51 A;  4CC6 A;  2NSF A;  3JYY A;  1OCO B;  5J2T A;  4Z2W A;  3K5N A;  4J30 B;  4C3D A;  1NU1 H;  4DV5 O;  1WGW A;  2FML A;  3QVN A;  4G7O F;  1V54 B;  2VH3 A;  1Z2G A;  4P9T A;  3BCC H;  3GM1 A;  2P4V A;  4GQH A;  5L0D A;  4JTA B;  4U9E A;  3TJT A;  3CCE V;  1ZHZ A;  5EC2 C;  3U9M A;  2YLI A;  2H7B A;  4RBN A;  1M93 A;  1WNS A;  4FJC C;  4XBF A;  3EGX B;  1K73 W;  2HMZ A;  3ZMU A;  2A0L A;  1F1M A;  5IYC O;  4PAC A;  1XL4 A;  2MW2 B;  2UXX A;  2LJ2 A;  5CA1 B;  4LLC A;  4EFB A;  2ETS A;  3KYJ A;  1VF7 A;  2Y4T A;  4AHC A;  3M4C A;  4DUY B;  3AG2 C;  2JRI A;  5D91 A;  3KYI A;  1N34 B;  4BPM A;  1NU9 C;  4QDL A;  5CN0 A;  2DN9 A;  2QA4 V;  4WJ0 A;  1FXK C;  4I50 A;  1HNW B;  3GWN A;  3L74 H;  1F7Y A;  2BCC H;  2QM7 A;  2BOB C;  3N27 A;  3OD4 A;  4GKJ O;  2R02 A;  4H54 A;  3FVY A;  2A3Q A;  3EHM A;  1OXK A;  1G8M A;  3U5S A;  4ABM A;  4D4N A;  3QW1 A;  3A0H Z;  3AG3 C;  2QJ1 A;  1B06 A;  3C3T A;  5BMV B;  3JCU Z;  1R1B A;  2QR4 A;  2F4V B;  3U3F A;  1GM8 A;  4PFP A;  3W2W A;  1MNE A;  4IJJ A;  3QTC A;  1YZA A;  4F6R B;  1K40 A;  2VQE B;  1V74 B;  4NTA A;  2QKA A;  5KMG B;  3P32 A;  3CRR A;  4O6Y A;  1IBM O;  2IYL D;  1D0Y A;  5L0I A;  3WOD F;  4TV9 A;  3CC7 V;  2EIK B;  2H8A A;  1UPG A;  4DK1 A;  3RYI B;  2XLO A;  2Q0O C;  2YZS A;  1LIH A;  1R3I C;  3B0P A;  3ZIA G;  3ZMT A;  3AG1 B;  3PN1 A;  2EPM X;  1XEQ A;  5L3Q A;  3MAQ A;  1DOV A;  2YSU B;  4UCR A;  2YXH A;  5IE9 A;  5JLI A;  3E9V A;  2YEV B;  3HNK A;  3T2M A;  4C3E A;  2EIN B;  4IAQ A;  1M2V A;  4MQ9 F;  3SP1 A;  1KD1 W;  2VAS A;  3LDC A;  1Q82 W;  3DZA A;  5A6B A;  4Q7C A;  3J7A U;  1R73 A;  4CSA A;  3E83 A;  5KHI A;  4PDM A;  2W0X A;  4CS8 A;  1E1R G;  2ILM A;  2R9R B;  4U7O A;  4C3B A;  3VQX A;  1FFX B;  1LR1 A;  2P7T C;  3SXZ A;  3UO3 A;  3MBG A;  5T1D B;  3RFY A;  3RGB A;  4CDA A;  1PNK A;  4XDK A;  4Z9H A;  1K4C C;  3ZHV A;  4ANJ A;  4K3A A;  3ZHR A;  2M7W A;  4JJF A;  4YWQ A;  3T1C A;  3T4D A;  5LHH A;  4DV0 O;  1O9G A;  2ADQ B;  2NSG A;  1NR1 A;  4W4L A;  5J2U A;  3HJC A;  1LNQ A;  3A8T A;  3CSX A;  2HKV A;  4FLT A;  5EHH A;  2A0U A;  3SNH A;  2V26 A;  5A2Q N;  1FXK B;  3VRC A;  2AXT Z;  4EEQ A;  1RPO A;  3APQ A;  2YVK A;  3K6B A;  2HP8 A;  2VQF B;  4G0H A;  3LUT B;  4GX0 A;  2XHB A;  3GAN A;  1XMQ B;  2XM4 A;  1ZTE A;  3U3B A;  2D3O W;  1WB8 A;  2GDS A;  5GON B;  1Q3E A;  4TT3 G;  2JIZ G;  1A7D A;  4WGY A;  1HE9 A;  4YL0 A;  4PJ0 Z;  3WFV A;  1Y67 A;  3KCY A;  4M63 A;  4IGG A;  5L3G A;  1CPR A;  4DRJ B;  3D36 C;  4BEM J;  4AL0 A;  1BDJ B;  3SYC A;  1S77 D;  5EBM C;  5J2T B;  1Z3I X;  3I4U A;  5A6J A;  4O4J B;  5LMN B;  4DV2 O;  4WF9 V;  5IYZ A;  5B1A C;  1OW8 A;  1KYO F;  2Z3Y A;  3GM2 A;  4DV3 O;  1D0Z A;  3ZRX A;  2Q9A A;  2NN4 A;  1MMN A;  2X0L A;  1WN0 A;  4N6H A;  1I4Z A;  4ZHQ A;  4BJ6 C;  1TGO A;  1PL4 A;  4O4H A;  3EJN A;  1QSP A;  4WFE A;  2KSF A;  3ZRW B;  4BJT A;  1OXB A;  5JSL A;  4OIR F;  1ZAU A;  2Q9C A;  1I94 B;  3GEI A;  3FYE B;  3DC5 A;  2EPN A;  4BIZ A;  1RJ9 B;  3OW2 U;  3UGO A;  2HG5 C;  4U9D A;  1JVM A;  2Y0I A;  4PA6 A;  1WLE A;  4DR3 B;  1N8R W;  4O2A A;  4I7Z B;  4X65 B;  5BUO A;  2ZXP A;  4RD9 A;  3R7C A;  1QQC A;  2J9U A;  4J32 B;  1Q0F A;  2HFE C;  3K58 A;  2NG1 A;  4UVA A;  2CGE A;  4CS7 A;  1YIT V;  5E33 A;  2PNO A;  2UUC O;  1W59 A;  3U2M A;  3TJ5 A;  4F4L A;  3AG4 C;  3HKB A;  1SER A;  1J8M F;  1EFR G;  3QVZ A;  4LER A;  2OKU A;  5F5F A;  3RIP A;  3NR7 A;  2B0H A;  1BR1 A;  2IH1 C;  2XAS A;  2HEP A;  3N0T A;  2XLH A;  1JPX A;  1WA8 B;  1C02 A;  3BFR A;  1U0B B;  5LP6 B;  2FAP B;  1GS9 A;  4EBJ A;  1IBL O;  4BJ5 C;  1L8D A;  1V55 C;  3G4Z A;  4JEA A;  3NMK A;  3ZVR A;  1AI7 A;  2W6I G;  5LOV B;  1FJG B;  3RT3 C;  2XM0 A;  4YJW A;  4U7N A;  4UCS A;  1HW2 A;  2NLJ C;  3OUS A;  3STZ C;  1XI1 A;  4I55 B;  3UGP A;  2Q73 A;  4MT8 A;  4TV9 B;  4I4T B;  5E3C A;  4GT1 A;  1ORS C;  3UQ8 A;  3JD4 A;  4LF7 O;  4TSF G;  2L9J A;  2M4E A;  1WOL A;  3QVY A;  1YJN V;  2ZXO A;  3J80 N;  2ZQM A;  2EX3 A;  5JP7 A;  2D2C B;  4PJN A;  1OKK D;  3AGT A;  4F6E A;  4O4L B;  4WFA V;  4DR2 O;  4U5G A;  3IFX A;  1GM7 A;  1JAF A;  3CRM A;  2AWC A;  5JQG A;  1QNM A;  3CWB H;  1K5S A;  5B1A B;  3S90 A;  1M56 C;  1JMW A;  4FK5 C;  4JC7 A;  4LF5 B;  4GX5 A;  3FAP B;  3X2Q B;  4TUY A;  4UDV A;  2IH3 C;  5ITZ A;  1TWC A;  4DRX A;  3ABK C;  4C7O A;  4Q6G A;  1A7V A;  2PUS A;  1H38 A;  2CH7 B;  3QO7 A;  4J7J A;  4ULV A;  5CIV A;  2AVK A;  2DWD C;  2CTR A;  1KTM A;  5FL7 G;  1H6G A;  5KUM A;  2P6V A;  1M57 C;  3KKB A;  4WFF A;  3B40 A;  1ENV A;  3L71 H;  2EIL C;  5KX5 A;  3LNN A;  2H3O A;  4X1Y B;  2YIB A;  1KKC A;  4U5D E;  4LFA B;  2BTQ A;  2ZIO A;  3C3S A;  2C03 A;  1Q6I A;  3I5P A;  5DLJ A;  2YID A;  4HAM A;  1G5Z A;  5DQT A;  4AQY O;  2GWW A;  2YL7 A;  5B1B C;  1EI7 A;  2EIM B;  2DB4 A;  2CK3 G;  2IXM A;  4P9P A;  4J9Z B;  3AG4 B;  5EC1 C;  2Q67 A;  1D1B A;  3DE8 A;  2NUT B;  5JCO C;  2LFR A;  1TFK B;  4EKW A;  4CZZ A;  4L8J A;  3WU2 Z;  3VF0 A;  2RMK B;  4DBR A;  1H7I A;  1QLE B;  1GAX A;  3JAW A;  3F47 A;  3HNL A;  4BG0 A;  3E8G A;  1V55 B;  2GUZ B;  2XS8 A;  4CH5 A;  4MW3 A;  1VAR A;  3CPW U;  1ZVZ A;  1E79 G;  1J5E B;  2AW9 A;  2BL2 A;  2V1D A;  3LLK A;  3Q4H A;  1LPE A;  3O55 A;  4PJL A;  2OYQ A;  3TET A;  4CS9 A;  4UXN A;  2EJR A;  1SF8 A;  3VQW A;  1I5Y A;  5L3D A;  1OW6 A;  5CI8 A;  4O7G A;  4G2K A;  2CUG A;  3UCS C;  4JAU A;  4X1K A;  4FLU A;  2EIJ B;  3ZIB A;  2QKC A;  2CCY A;  4B3T O;  2EJ7 A;  1HNZ O;  3JAS A;  4BIU A;  4JF3 A;  5D5P A;  3EH1 A;  3QG5 A;  5LBQ A;  2PF4 E;  2CTQ A;  2WZF A;  1FKA O;  2E87 A;  2ARH A;  3RYC B;  3RF3 A;  1M56 B;  3FYI B;  3CAX A;  3B09 A;  3FOO A;  3ETE A;  3R65 A;  3Q6M A;  3T1H B;  1IBK B;  3UMH A;  1BQZ A;  1WTY A;  1U89 A;  2R7W A;  4WBN A;  4I3M A;  1LS1 A;  5EYP B;  4HBN A;  1NU7 D;  1CPY A;  3A11 A;  3RWR D;  1T5O A;  3ZN0 A;  4O2A B;  1MA1 A;  3W7U A;  4H4K C;  3CRC A;  3OTF A;  2M64 A;  3W8H A;  1HNX B;  4X66 O;  2OWO A;  3GOD A;  3NMJ A;  1Y76 A;  4DV4 O;  3OMN B;  1VQ9 V;  4U5C E;  2E76 B;  2IJJ A;  3RVY A;  3BA8 A;  2UU9 B;  3W7W A;  3DD7 A;  4CX9 A;  2J7P D;  1KU9 A;  3HKB B;  4W8P A;  3HR0 A;  1PP9 H;  4QNH B;  1K04 A;  2HJ3 A;  2EIL B;  1NTK H;  3BRJ A;  4B7E A;  3R2P A;  3V5Z A;  2UUB O;  4DRH B;  5EGY A;  2IBF A;  3G71 V;  5DEC A;  2E74 B;  2WPD G;  1AI6 A;  1T9K A;  2C04 A;  2QEX V;  3E89 A;  1MMD A;  3LSQ A;  5C8Y A;  2Y69 B;  4YHH B;  4GKK O;  4XEK A;  3L70 H;  4J42 A;  1FR0 A;  1AI5 A;  1J95 A;  2W4B A;  1TQG A;  3LEO A;  4IRU A;  1IW7 F;  2UXB B;  4IT5 A;  4LH6 A;  1ZWI C;  3OMI B;  4LP8 A;  4H37 A;  2W6J G;  3ASN C;  4R6Z A;  1Q8I A;  3MLG A;  3UMK A;  4DV6 O;  1N33 O;  3EZI A;  2Y3H A;  3O39 A;  1G4W R;  1BCC H;  3T6B A;  4K8X A;  5JJN B;  1JFF B;  3MX3 A;  2QTV A;  1Z5W A;  3VQY A;  2HSB A;  1OCZ B;  2XSE A;  2K9P A;  2H7O A;  1EQ1 A;  3K9A A;  1Y66 A;  2WLM A;  1CGO A;  4JZG A;  5AG2 A;  3TK1 A;  3U0Z A;  1AP5 A;  3HKD A;  2G62 A;  3DE9 A;  2ZNI A;  2KG7 A;  3U10 A;  1KB9 F;  1WAS A;  2PI4 A;  3S0X A;  4DW1 A;  4R50 A;  2YQY A;  1HY5 A;  3M15 A;  1AEP A;  3G6B A;  2OCH A;  4Z9I A;  1PCX A;  4D7S A;  5ITZ B;  4DRX B;  5FCL A;  1SA0 A;  4C7O B;  1OCO C;  1N36 B;  4UCU A;  4FLX A;  4RQE A;  4LF4 O;  4J41 A;  1VQM V;  3M79 A;  4ULW A;  2H94 A;  1GN3 A;  4FVM A;  3ABU A;  1V54 C;  1XDC A;  1D5N A;  1XMO B;  2LSE A;  4DV1 B;  2NNU A;  1FFT B;  2YLD A;  1XOU A;  5DS5 A;  3UKM A;  3G80 A;  3G6E V;  2QM8 A;  4IIJ A;  2KQX A;  3C8G B;  4LAC B;  1RMV A;  2QWN B;  1VLS A;  1LVK A;  3AQB A;  5KX5 B;  1G6U A;  1Q0M A;  3K5M A;  1K8A W;  1G8X A;  2XLE A;  2BTQ B;  4MVM A;  2TMV P;  3B0V C;  3BA9 A;  3GEE A;  3ZQV A;  3HB3 B;  2Y3G A;  3TOM A;  2N05 A;  2DYR B;  4PA4 A;  4JPR A;  4LF6 B;  3OAA G;  2OEV A;  3N2Z B;  5TIS Z;  3RW0 A;  2L6G A;  3GEH A;  1PD0 A;  1R3L C;  1QHT A;  4E2L A;  4LF9 O;  1JRA A;  4DOZ A;  2JVD A;  1T6U A;  3RYL A;  4C7U A;  2CDY A;  4PDR A;  2NUP B;  4QI0 A;  1U6H A;  2R03 A;  2IBZ H;  3X1O A;  1W0J G;  2A9H A;  4KHP B;  4IB4 A;  1NTZ H;  1K97 A;  4J11 A;  1TA8 A;  1FAP B;  2QTS A;  1HMO A;  3Q4H B;  4NYK A;  4BR6 A;  5LYJ B;  4NY3 A;  2ZIN A;  2HFI A;  1NZ6 A;  4ICG A;  2Q3T A;  3RQE A;  4A4A A;  5KYN A;  3US6 A;  3H01 A;  1GO3 F;  1RFY A;  4GUN A;  4LFB B;  3GOR A;  3FAJ A;  4N6C A;  1LS4 A;  3CCL V;  1WAT A;  1A32 A;  3CSK A;  3K5O A;  3C8G D;  4X1K B;  5JVD A;  1HDJ A;  1N4C A;  4JE9 A;  1ZX3 A;  3ASO B;  3CHX A;  2XAF A;  4E0I A;  4DUZ B;  1CGM E;  4PR9 A;  4E18 A;  1S3J A;  1R5I D;  1F4N A;  3MYI A;  1EBO A;  4XPX A;  4O2B B;  4NXM O;  4MS2 A;  3TCU A;  3SDL A;  3JAS B;  1NH2 B;  4JI4 O;  2GFH A;  4YJ3 B;  1GTO A;  3CP1 A;  2DOS A;  5BXZ A;  1SQV H;  3JD3 A;  4GX1 A;  4PV1 B;  1NQT A;  1S5L Z;  2GV9 A;  3AG1 C;  4PI0 A;  2J0W A;  2ZM6 O;  3H1I H;  3ITF A;  3FAV B;  3PHF 2;  4WBN B;  3U8P A;  1TVK B;  2LQT A;  3SGI A;  5TJ5 E;  1R6T A;  2LGW A;  3W8I A;  2EIN C;  4DYL A;  5HFM A;  5IDJ A;  1EN4 A;  5FNV A;  4PA7 A;  3N2G A;  4OXS A;  4YIP A;  4JYA B;  3IQ6 A;  2YXL A;  3OE7 G;  4JI8 B;  1KP3 A;  2ITC C;  1AP6 A;  2YDE A;  4YT2 A;  1TWA A;  4B3M O;  2OOC A;  2ZE7 A;  5CA0 B;  1SZT A;  4QGP A;  4IHJ B;  4CH6 A;  4JI5 O;  3O6X A;  2HVK C;  1H9G A;  1APC A;  2CDQ A;  2EPL X;  2QNL A;  2MWQ A;  3QW0 A;  2OT5 A;  1DTO A;  3JAT A;  5COF A;  1AUE A;  3VQV A;  4NCQ A;  2JGU A;  1S76 D;  4NKG B;  2JEU A;  3K08 A;  4JV5 O;  5C8Y B;  1GQA A;  3GWL A;  4NTF A;  2PZS A;  2HHH O;  1D0X A;  4WFB V;  1E2X A;  5LA6 B;  1GRJ A;  4B3S B;  3OTO B;  1FYJ A;  4J7K A;  3PJS K;  1TUB B;  3HKE A;  2JGD B;  1M4U A;  1OZ0 A;  1NKD A;  4B6I A;  1R3J C;  2HKO A;  2FL4 A;  1HE1 A;  1NH2 D;  2P1A A;  2VWJ A;  1Y4C A;  2Y3D A;  3CRQ A;  3KG2 A;  1BQ0 A;  3C90 A;  4DVZ A;  4KNW A;  2L6L A;  2L6F A;  2WB7 A;  4YL1 A;  3K5L A;  1SZI A;  1ZLZ A;  2IJI A;  2KSD A;  2CYD A;  2NPU A;  5BR8 B;  3RBZ A;  1VQP V;  3QF7 A;  1AJN A;  3MYF A;  4AIL C;  2LW7 A;  2WLN A;  3DSQ A;  4I9W A;  3MHS C;  5B1O A;  1V9P A;  3F46 A;  1CGN A;  2R7S A;  1Z6A A;  1DF5 A;  2CGO A;  4LF8 B;  2AZ0 A;  1MQV A;  1SA0 B;  4H44 B;  2VS0 A;  2PYJ A;  1T01 A;  3JSE O;  4K1O A;  3V7O A;  1XNR O;  5KHH A;  3IJ4 A;  5IY5 B;  4OX9 B;  4X62 O;  1N32 B;  5IWA O;  2R05 A;  3GM3 A;  3CMA V;  1KP2 A;  2X6A A;  3D3Q A;  3DXR A;  3HKC B;  5H6Q A;  4IAR A;  4IIJ B;  5JH7 B;  3JRM O;  3EVK A;  4JI0 O;  5L0F A;  4CIH A;  5GTI Z;  1SS3 A;  4B3R O;  1OCR B;  5KYU B;  2JS3 A;  2DJV A;  3LNM B;  1KNY A;  1U96 A;  3EFO A;  1S7Z A;  2R7T A;  2Q9B A;  2HJD A;  2HJF C;  1W2W A;  5FLX N;  5A9G A;  4WCE V;  4I0X A;  1KC8 W;  1BZ4 A;  1YJG A;  2KJG A;  4AX2 A;  3ABL C;  4CC5 A;  1YIJ V;  5GPG B;  3RKO F;  4DR6 O;  2V4D A;  2BC5 A;  2PX3 A;  4UVB A;  3RQG A;  1QR8 A;  1ZYR F;  4JUR I;  3RYF B;  1LUV A;  4WFH A;  2F22 A;  3SPC A;  1NBM G;  4DR5 B;  4CJO A;  2XAH A;  3E22 A;  1IVS A;  3U2L A;  1IX9 A;  4QPK A;  3TD7 A;  2YUA A;  2EZP A;  5CB4 B;  1ZW3 A;  1N0N A;  3W7S A;  1F23 A;  1K92 A;  1XWJ A;  2H7V C;  1VMG A;  1PNM A;  3G67 A;  3E8F A;  2LFF A;  2RQ6 A;  3UT5 A;  4MVR A;  1URF A;  4MTF A;  5KUK A;  2QKS A;  4KXR A;  2WL8 A;  3QTH A;  4JI1 O;  4JJG A;  2UUH A;  4QE7 A;  2G3V A;  4JCZ A;  1K9M W;  2ZKO A;  2YS8 A;  2B5U A;  4HNA A;  1VQ8 V;  5JRA A;  5KYY A;  5LP6 C;  4FLV A;  1KU2 A;  3SZR A;  2Y0P A;  1NVP B;  1QVX A;  1K3E A;  5LXT A;  5JS5 A;  5EBW C;  4KUM A;  1EZJ A;  1KUQ A;  3NRH A;  1I7F A;  4ZKI A;  1BSM A;  2WLI A;  1UFB A;  3TOL A;  2RJZ A;  1GN4 A;  3CCM V;  1IXM A;  3S29 A;  2HMQ A;  5D5Q A;  1L0L H;  2BSK B;  4ZOL B;  1VF6 A;  4GZR B;  2CNW D;  3T1Y B;  1TR2 A;  5FZT A;  2E3C A;  2UXD B;  4LWS A;  1SR2 A;  4K0K O;  3EFF K;  3LDD A;  4J7Y A;  2L35 A;  2DQ0 A;  2C2A A;  1LE4 A;  2KYH A;  4OD4 A;  1CEZ A;  1FTS A;  4DR7 B;  5EK0 A;  2JX0 A;  1F4M A;  4W8K A;  3EPV A;  4MTO A;  4JI7 B;  5FNV B;  1ARO P;  2IM9 A;  1RSO A;  2QSA A;  3N2G B;  2YKZ A;  2ZR2 A;  2JDI G;  3MHH C;  4OPA A;  1XQ8 A;  4UCV A;  3DGE A;  1H9T A;  4FLW A;  2XS1 A;  4FX5 A;  3OFN G;  3ZRV A;  4CS8 C;  3X2Q C;  4BJ5 A;  2FB5 A;  1SES A;  3DWW A;  1YA7 O;  3S27 A;  1NS1 A;  3CS5 A;  3JAT B;  4BW5 A;  2JD3 A;  2Q69 A;  1V4A A;  5JT4 A;  2LGQ A;  3ABL B;  1TAE A;  3CYO A;  3NKD A;  1W2B U;  4DV5 B;  2VB6 A;  2WAM A;  3DM5 A;  1EZV H;  1BMF G;  5F2V O;  2JJ1 G;  4LC1 A;  4WFG A;  5EBL C;  4A2N B;  1L7C A;  4O79 A;  5LL6 Y;  2R9A A;  1YCI A;  3SXM A;  4I50 B;  1SF9 A;  3W4Y A;  2JK5 C;  4CS2 A;  2EPK X;  2R7Q A;  4RDA A;  1MAB G;  1B04 A;  2EIM C;  4YY3 O;  4JI6 O;  1I5X A;  1HR0 O;  2UXC O;  1BZK A;  3EZH A;  4EUK B;  4LDQ A;  2A7W A;  5DS4 A;  4UV8 A;  4K0D A;  2GA0 A;  2VRZ A;  1MSD A;  1MOF A;  4XEF A;  2CAZ C;  1X4T A;  4DV7 O;  4FWV A;  1WN7 A;  4GYC B;  1QLE C;  1JMK C;  1Q0D A;  2J45 A;  1AVO B;  3H1L H;  1WB7 A;  4GCZ A;  1SQG A;  4FM0 A;  1US6 A;  3H1J H;  1GN6 A;  5KYW A;  1YA9 A;  3F7Y C;  2LW1 A;  3SJB C;  2HV6 A;  3UM7 A;  1NI8 A;  4JI2 O;  3LS1 A;  4EFE A;  4GKJ B;  5T3T A;  5IT9 N;  2LFS A;  2ZR3 A;  2PBE A;  1H2L A;  3T6J A;  3A0B Z;  3B2E E;  3TXQ A;  3SYN A;  3IQ5 A;  1AB3 A;  1SC5 B;  5DED A;  3JAK A;  3K33 A;  2KKW A;  2HR3 A;  1I0H A;  2EIJ C;  3VM6 A;  4YN0 B;  4QE9 A;  4ASU G;  1H2G A;  3AJM A;  3IC7 A;  3U0C A;  3EFO B;  2ATK C;  3C8Z A;  1D1A A;  1M2V B;  4YK5 A;  3WAQ A;  4IWB A;  2UUA O;  1NJI W;  2A69 F;  3M7M X;  2Q8V A;  4X20 A;  3TXS A;  2QTO A;  1IBM B;  2OIE A;  5JWP A;  1ORY A;  3ZDL A;  4B08 A;  3B4S A;  4ZI7 A;  2L81 A;  1ZHT A;  1VYK A;  1PD1 A;  2GAQ A;  4JAV A;  3GVM A;  2J8W A;  3OEO A;  1S5H C;  2Z5U A;  3CZ6 A;  1KMI Z;  4DR4 O;  1VP7 A;  1VQ5 V;  1OR2 A;  4DK0 A;  3B29 A;  4LBE C;  4FAP B;  2BE5 F;  4FZ1 A;  4TWK A;  1GKF A;  1XNQ O;  4PDL A;  2P0N A;  4LNU A;  3K06 A;  2X7R B;  5J2U B;  1DK1 A;  4XLN F;  1JR9 A;  1JPJ A;  4AI8 A;  1ROP A;  2ZNJ A;  5BZB A;  5D92 A;  2AWY A;  2WVO A;  1GGQ A;  4PK4 A;  1RKE A;  3M1C B;  2GHY A;  2R72 A;  4DR1 O;  4MVU A;  3KL4 A;  2Y69 C;  5LXT B;  1YJW V;  5LGU A;  3A9C A;  5LHG A;  4IYI A;  4X64 O;  3QMK A;  2ZDI A;  5EIB C;  2IXP A;  3JSN A;  4QIW F;  5L3C A;  2WLI B;  4IL6 Z;  2HS5 A;  1P7B A;  5IJ0 A;  1O5H A;  3K04 A;  4AE4 A;  3EHB B;  4BJ1 A;  3PMR A;  2J46 A;  3E8B A;  2W45 A;  4FFB A;  4DV0 B;  4HYO A;  4OGQ B;  2LK4 A;  3ETG A;  4WAB A;  2F23 A;  4BEJ A;  5DQZ A;  5HV9 A;  1Y6X A;  2O9X A;  3AOU A;  2FKX A;  1OCZ C;  1Y74 A;  2IM8 A;  3LS0 A;  3N2K A;  1VB5 A;  2F43 G;  3IC9 A;  2PI5 A;  1WPX A;  5KAI Z;  4FIP C;  4IAO A;  1H2K A;  3A0R A;  3WG7 B;  1GM9 A;  3ZMV A;  4U5E E;  4J7Z A;  3T9O A;  3RH3 A;  2YIC A;  1YZB A;  5IYZ B;  2ASR A;  3CEI A;  3JAL A;  1WP8 A;  2DE0 X;  4LFC O;  2N04 A;  1YEW A;  3O10 A;  2ZE5 A;  4DJ9 A;  1J8Y F;  4ONS A;  2OCC B;  4ZHQ B;  4HFF B;  1Q7Y W;  2DQ3 A;  4O4H B;  5CA3 A;  4OPH A;  3JCZ A;  4LH7 A;  4XEV A;  4F4B A;  3L34 A;  4EWC A;  1NT2 B;  4U5H A;  1YHQ V;  5H2F Z;  2LCH A;  2E5L O;  1FXV A;  3CX5 F;  4UCT A;  5KAF Z;  1FFT C;  2AZ2 A;  2OTL V;  1QVF U;  3DTU B;  4DV2 B;  3GWK C;  3S28 A;  4MVS A;  2KB1 A;  2X6B A;  1RKC A;  3JAR A;  2P5O A;  1Q90 D;  4DV3 B;  3ETQ A;  4JVS A;  3CXH F;  2A1D D;  4BW9 A;  4UFZ A;  3S9O A;  2DYS C;  3OEH G;  3SYP A;  3Q7G A;  4GX2 A;  2DYR C;  2FYU H;  2P4K A;  4JCH A;  4MVQ A;  2QE7 G;  2DWE C;  1FD9 A;  2PGG A;  4ZIB A;  1E86 A;  3SYQ A;  1SZX A;  1QVG U;  5L0G A;  1KQS U;  4CH4 A;  1RM1 B;  4JIO A;  2XXA A;  1YZC A;  2Q7G A;  3O65 A;  1N0J A;  3W2V A;  4L87 A;  4PA3 A;  1TWG A;  4DUY O;  3LAY A;  2YI8 A;  1NZE A;  1PKX A;  4GEH A;  4P9F A;  3ZQY A;  1N34 O;  3JCU Q;  4MND A;  4PI2 A;  1FXH A;  2WVN A;  1BHB A;  2P06 A;  4NXN O;  1IUR A;  4XWJ A;  1HNW O;  2UUC B;  1KKD A;  1QLN A;  5K0I A;  1VTM P;  2XND G;  3EGX A;  3FDQ A;  3E86 A;  1L0N H;  4TOI A;  5FPO A;  4G7Z F;  4RUF A;  2HJM A;  2IXN A;  3JAK B;  1M6T A;  1MMM A;  1CP9 A;  3CCQ V;  3ASO C;  1SQF A;  3K0D A;  2F4V O;  2ZE6 A;  4PEL A;  1K7D A;  1WWP A;  3B71 A;  1YTF B;  5B1N A;  1IBL B;  4E4E A;  2J0X A;  1Z63 A;  2XT9 A;  2IXO A;  4UV9 A;  3RQF A;  4H13 B;  5JQG B;  2PX0 A;  1IDS A;  2FTK A;  4DXW A;  2VQE O;  2JPU A;  5EZY A;  1RCP A;  5JJJ B;  4XPY A;  2WSS G;  2K1E A;  4TUY B;  3JD2 A;  4ZLD A;  3TUL A;  2Q6A A;  2Q9L A;  4LF7 B;  4N4W A;  2L7A A;  2BTO A;  3BVO A;  2XRH A;  1W0K G;  3EG9 A;  1VIB A;  1H2N A;  2LP4 A;  2J9B A;  3Q6N A;  1FNT c;  1LUW A;  5DM6 V;  4LDR A;  5H9C A;  2H8P C;  3CC4 V;  1YAR O;  3I56 V;  4DR2 B;  1I4Y A;  3CD6 V;  2AGA A;  3CCU V;  1VEW A;  1PD3 A;  1S5J A;  2PTM A;  1UJW B;  5EIB D;  2YRF A;  1K05 A;  4JGS A;  3K1I C;  1XUQ A;  4KBL A;  2X6C A;  5KMG A;  1JJ2 U;  1CXZ B;  3I5Q A;  5E79 Z;  2W9Y A;  3J06 A;  2DYS B;  4EBB A;  4DVY P;  1GH6 A;  4K7B A;  1YVW A;  4TQF A;  4PA9 A;  2B0J A;  4NR1 A;  4BAY A;  3ZTM A;  1MND A;  1M2O A;  3H2V A;  4MVO A;  3C18 A;  5IJ0 B;  4DRI B;  4AE4 B;  2AHY A;  4JZA A;  2E75 B;  4Z1V A;  3BAB A;  5KLV H;  1NLX A;  2AP3 A;  3N24 A;  4MVZ A;  2VCC A;  4UUJ C;  3TQO A;  1UFI A;  4CBC A;  4FFB B;  3JAW B;  1OCC B;  3JTL O;  1XIL A;  3RYH A;  2CNW A;  5IYD O;  3E70 C;  1NR7 A;  4HZ3 A;  3N2K B;  3SXY A;  4XTK A;  3KPH A;  5LGN A;  4AQY B;  3SYO A;  2QDO A;  4PDV A;  3CC2 V;  2UXN A;  2YIA A;  2EUL A;  3IGA C;  2A79 B;  3CCV V;  5L3B A;  1YLM A;  2VQF O;  2RN9 A; 
#chains in the Genus database with same CATH homology
 4WCE V;  4R7C A;  4N23 A;  1KC8 W;  2LP7 A;  3OR6 C;  2ZDI C;  2BOC C;  3ZMZ A;  3ABL C;  2WLK A;  1V55 C;  1YIJ V;  4MSW C;  1AI7 A;  2W6I G;  4UVB A;  1M9N A;  4U7N A;  1QR8 A;  2AHZ A;  2NLJ C;  3OUS A;  3STZ C;  4WFH A;  3ABK B;  5E1A C;  4J9Y B;  1NBM G;  3GWO A;  3SPC A;  5IY5 C;  4MT8 A;  1FS0 G;  1GMG A;  4JYC A;  2XAH A;  1OCC C;  4GT1 A;  1QBZ A;  1FXK A;  3JD4 A;  4QPK A;  2EZP A;  4TSF G;  3ETD A;  1M1K W;  3E2E A;  3W7S A;  3BY6 A;  1F23 A;  1K92 A;  1YJN V;  1H8E G;  3CCS V;  2JEX A;  2ZQM A;  1M57 B;  3K03 A;  1PNM A;  4FPP A;  3E8F A;  1OCR C;  3W7X A;  1JQ0 A;  4MVR A;  4MTF A;  5KUK A;  2QKS A;  4WFA V;  3IFX A;  1GM7 A;  3RVZ A;  5HFL A;  1AI4 A;  4KP4 A;  4QE7 A;  1K9M W;  2B5U A;  1VQ8 V;  3QNE A;  1K5S A;  5B1A B;  2P6J A;  4P9O A;  1NVP B;  1K3E A;  1M56 C;  4FK5 C;  5B1B B;  5EBW C;  4KUM A;  1EZJ A;  4GX5 A;  4ZKI A;  4P2Z A;  3X2Q B;  2WLI A;  2IH3 C;  4G27 B;  5IYB O;  3CCM V;  1IXM A;  1Q86 W;  3ABK C;  5J9P C;  4QJF B;  2WWW A;  1VQL V;  4FMT A;  3SPG A;  1H38 A;  3E35 A;  2XAQ A;  3QO7 A;  2IJK A;  3EFF K;  3LSS A;  2DWD C;  3F7V C;  5FL7 G;  3MD0 A;  5KUM A;  3LDD A;  1M57 C;  4WFF A;  2DQ0 A;  2C2A A;  1YJ9 V;  1AJP A;  1ENV A;  2EIL C;  1CEZ A;  5EK0 A;  2ZXW B;  3P30 A;  1F4M A;  1VQ4 V;  4MTO A;  1ARO P;  1K4D C;  3ZRW A;  3ABT A;  2ZR2 A;  2JDI G;  3D3I A;  3MHH C;  4HAM A;  3VBB A;  3DGE A;  4DO2 A;  5KA6 A;  3OFN G;  5B1B C;  3FB7 C;  3ZRV A;  1K34 A;  2EIM B;  3T4Z A;  2CK3 G;  4P9P A;  4J9Z B;  2OTJ V;  3X2Q C;  3AG4 B;  5EC1 C;  2Q67 A;  3CME V;  1SES A;  1QR9 A;  1MG1 A;  3B77 A;  3ZRS A;  2LFR A;  4EKW A;  3B8N A;  4CZZ A;  4RQF A;  4BW5 A;  1QLE B;  3W7T A;  2Q69 A;  1VQO V;  4JYB A;  3ZMS A;  3E8G A;  3ABL B;  3CYO A;  3OR7 C;  1V55 B;  1W2B U;  4I5S A;  1M90 W;  1H8H G;  2WAM A;  2IU3 A;  4MW3 A;  1YTF D;  3CPW U;  1BMF G;  1E79 G;  2ZXW C;  2V1D A;  2JJ1 G;  1VQ6 V;  4LC1 A;  4WFG A;  4JTD B;  2YEV A;  5EBL C;  3TET A;  4Q20 A;  5GW7 A;  4UXN A;  2JK5 C;  2EJR A;  3FB8 C;  1I5Y A;  5B3S C;  1MAB G;  2EIM C;  5L3D A;  1I5X A;  1RPR A;  1JCH A;  1PL0 A;  1SET A;  4G2K A;  4JAU A;  3JD1 A;  2EIJ B;  2R9I A;  1G4Y B;  4KFM A;  2ZD9 A;  3I55 V;  4UV8 A;  1TUE B;  1MOF A;  3ABM B;  2XAG A;  3OUF A;  1QLE C;  4BIU A;  4JF3 A;  5LBQ A;  1THZ A;  3BEH A;  3K79 A;  4R8C A;  1M56 B;  3FYI B;  2IW5 A;  4GCZ A;  1MSW D;  3ETE A;  3R65 A;  5H6R A;  1CPY A;  3D36 A;  3F7Y C;  3SPI A;  1S0V A;  3ZN0 A;  3W7U A;  3UM7 A;  4XDJ A;  1COW G;  3ZCC A;  3CCR V;  2IU0 A;  3ASN B;  5CBG A;  1P4R A;  3QO8 A;  3OMN B;  1VQ9 V;  2LFS A;  5LHI A;  2HLD G;  2ZR3 A;  1VQK V;  4MTG A;  2IJJ A;  3RVY A;  3W7W A;  2B1I A;  5C93 A;  2HVJ C;  1L1F A;  2HR3 A;  4MW8 A;  2EIJ C;  2WLL A;  2XOK G;  4QNH B;  3ZN1 A;  4QE9 A;  4ASU G;  1H2G A;  2EIL B;  4P30 A;  3ABM C;  3IC7 A;  2ATK C;  3G71 V;  2WPD G;  2EIK C;  4RUE A;  2IJH A;  1AI6 A;  3NXS A;  1NJI W;  1JOY A;  2QEX V;  3E89 A;  4RO2 A;  5DN6 G;  2QTO A;  3LSQ A;  5CBH A;  2Y69 B;  1R6N A;  3ML0 A;  2B1G A;  1HWY A;  2Q68 A;  1AI5 A;  1J95 A;  4JAV A;  2EZO A;  1S5H C;  3AG2 B;  2Z5U A;  1ZWI C;  3OMI B;  5L3E A;  4LP8 A;  4H33 A;  1VQ5 V;  4H37 A;  2W6J G;  3ASN C;  1OCO B;  4R6Z A;  1B6Q A;  1AR1 B;  4UVC A;  4LBE C;  3VOU A;  4TWK A;  1V54 B;  1GKF A;  1R3K C;  4PDL A;  5CMU A;  1OCZ B;  4JTA B;  3CCE V;  3K06 A;  2X7R B;  1Y66 A;  2WLM A;  3K9A A;  4X89 A;  5EC2 C;  4XBF A;  4FJC C;  3AG3 B;  3TK1 A;  3G4S V;  1K73 W;  3ZMU A;  2A0L A;  1ROP A;  5BZB A;  5LGT A;  5IYC O;  4XDL A;  1XL4 A;  2PI4 A;  2UXX A;  4X8A A;  3OM3 B;  2GHY A;  4MVU A;  4R50 A;  2Y69 C;  5B3S B;  1YJW V;  5L3F A;  3HPL C;  5LGU A;  5LHG A;  2ZDI A;  4QIW F;  5L3C A;  2WLI B;  3AG2 C;  1P7B A;  3SYA A;  3K04 A;  3EHB B;  1OCO C;  2GSM B;  4RQE A;  1VQM V;  2H94 A;  5CN0 A;  3E8B A;  2QA4 V;  4HYO A;  1FXK C;  3ABU A;  3ETG A;  4LCU C;  1NVP D;  1V54 C;  1VQN V;  2QM7 A;  2BOB C;  2NNU A;  1FFT B;  1OCZ C;  3UKM A;  3G6E V;  2QM8 A;  2F43 G;  2PI5 A;  1WPX A;  3K3W A;  1G8M A;  4FIP C;  3LDE A;  2W0F C;  3GB7 C;  1SRY A;  3A0R A;  3AG3 C;  1GM9 A;  3WG7 B;  3ZMV A;  1K8A W;  4MVM A;  1XL6 A;  4X88 A;  1GM8 A;  4JTC B;  3HB3 B;  3SPJ A;  2DYR B;  4PA4 A;  4JPR A;  2P67 A;  3OAA G;  3RW0 A;  4YXW G;  3FKS G;  2OCC B;  1R3L C;  4E2L A;  2DQ3 A;  5CA3 A;  3ZJZ A;  1Q7Y W;  2WLJ A;  3P32 A;  3JCZ A;  3OGC C;  4JAS A;  3CC7 V;  2P90 A;  2EIK B;  4PDR A;  1YHQ V;  1FXV A;  1W0J G;  1R3I C;  3CXC U;  2A9H A;  2OTL V;  3ZIA G;  3ZMT A;  3AG1 B;  1K97 A;  1QVF U;  3DTU B;  4MVS A;  2YSU B;  2KB1 A;  2X6B A;  3WG7 C;  2V7Q G;  2ITD C;  2YEV B;  3T2M A;  2EIN B;  2DYS C;  3OEH G;  3SYP A;  3H01 A;  1GO3 F;  4GX2 A;  1KD1 W;  2DYR C;  3LDC A;  1Q82 W;  4MVQ A;  2QE7 G;  2DWE C;  1PNL A;  3CCL V;  1R73 A;  3E83 A;  2OCC C;  4PDM A;  5CBF A;  3SYQ A;  1E1R G;  4U7O A;  2R9R B;  3F5W C;  3ASO B;  1QVG U;  2XAF A;  1KQS U;  1K5Q A;  1RM1 B;  2EBO A;  2P7T C;  1S3J A;  4G28 B;  1F4N A;  1EBO A;  4MS2 A;  4ZBM A;  3TCU A;  1NH2 B;  3SJQ C;  4L87 A;  1GTO A;  3CP1 A;  4PA3 A;  1PNK A;  4XDK A;  3JD3 A;  1K4C C;  1PKX A;  2WLH A;  4GX1 A;  2M7W A;  1NQT A;  3AG1 C;  1R6K A;  1FXH A;  3T1C A;  3T4D A;  2Y48 A;  1E1Q G;  1BHB A;  5LHH A;  1QCE A;  1NR1 A;  1KKD A;  1DLB A;  1QLN A;  1LNQ A;  2XAJ A;  2XND G;  2EIN C;  5HFM A;  3E86 A;  5IDJ A;  4PA7 A;  3OMA B;  4OXS A;  3OE7 G;  1FXK B;  1KP3 A;  3FB6 C;  4RUF A;  2ITC C;  1RPO A;  1CP9 A;  3FB5 C;  3CCQ V;  2WLL B;  3LUT B;  3ASO C;  1SZT A;  3K0D A;  4GX0 A;  3CCJ V;  1RM1 C;  4PEL A;  1K7D A;  3K0G A;  2HVK C;  1YTF B;  5B1N A;  1JX9 A;  2D3O W;  2JJ2 G;  4UV9 A;  2OT5 A;  1DTO A;  4TT3 G;  2FTK A;  2JIZ G;  4DXW A;  1S76 D;  3E8H A;  2JEU A;  3K08 A;  4N21 A;  3WFV A;  1DF4 A;  4WFB V;  2DW4 A;  2WSS G;  2K1E A;  5L3G A;  3JD2 A;  2Q6A A;  3PJS K;  1OZ0 A;  1NKD A;  1W0K G;  3SYC A;  1R3J C;  2HKO A;  3QO5 A;  5EBM C;  4Z1M G;  1S77 D;  1NH2 D;  1YSC A;  5KA5 A;  4RAI A;  5DM6 V;  1Q81 W;  1BHA A;  5H9C A;  1YI2 V;  2H8P C;  3CC4 V;  4WF9 V;  5B1A C;  3SPH A;  3I56 V;  3KG2 A;  3CD6 V;  2Z3Y A;  1F51 A;  3CCU V;  1PD3 A;  1UJW B;  3ZRX A;  2X0L A;  2IJI A;  4JGS A;  2X6C A;  2MK3 A;  1JJ2 U;  3B8M A;  4MTX A;  4WFE A;  3AEI A;  3JYC A;  3ZRW B;  3RBZ A;  1VQP V;  1AJN A;  2DYS B;  1AJQ A;  1BL8 A;  3FYE B;  2WLN A;  3M99 B;  1OHH G;  4I9W A;  4BIZ A;  3MHS C;  4PA9 A;  1K33 A;  5B1O A;  3OW2 U;  2HG5 C;  4BAY A;  1JVM A;  1VQ7 V;  4MVO A;  4PA6 A;  1WLE A;  1DF5 A;  1N8R W;  4QPJ A;  2AHY A;  1GK9 A;  4MVZ A;  4UUJ C;  4CBC A;  5IY5 B;  2HFE C;  4UVA A;  1OCC B;  1YIT V;  5IYD O;  1Y4M A;  3CMA V;  1KP2 A;  2X6A A;  1NR7 A;  5H6Q A;  4HZ3 A;  3AG4 C;  4F4L A;  3STL C;  1SER A;  1KEC A;  1S72 V;  3OEE G;  5LGN A;  1EFR G;  3SYO A;  1ORQ C;  1OCR B;  4PDV A;  3CC2 V;  3LNM B;  2UXN A;  3IGA C;  2A79 B;  3CCV V;  5L3B A;  2IH1 C;  2XAS A;  3JD0 A;  2HJF C;  1JPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...