2ZD9A

Structure of a bacterial cyclic-nucleotide regulated ion channel
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
APLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQLVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mll3241 protein
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
total genus 59
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zd9A02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 2zd9A01
3E8FA 4G27B 1R3LC 5B3SC 5EBMC 4UUJC 4F4LA 2ATKC 2K1EA 3K06A 4KFMA 3SYAA 4MVMA 4JTDB 2AHYA 2WLIB 3R65A 3ASOC 3F7VC 3E86A 3ABMC 4MVSA 4LBEC 3E8BA 5IY5C 3IFXA 2IH3C 2ITDC 3EFFK 1OCCC 1QLEC 4X8AA 1XL6A 2Q67A 2IH1C 1XL4A 3T2MA 4PA6A 3LDDA 1OCZC 3FB7C 4P30A 4GX5A 4RUEA 3HPLC 4MVUA 5CBFA 4LP8A 3T4DA 3VOUA 4MSWC 4JTAB 2A0LA 2AHZA 3AG4C 4P9PA 2DWDC 2X6AA 3TCUA 2DWEC 4H37A 4R6ZA 1R3JC 4RUFA 4MTFA 2Q6AA 3BEHA 3E83A 4MTGA 2Q68A 3WG7C 2QTOA 4EKWA 1OCRC 4P2ZA 4PA4A 3SYQA 5B1BC 2YEVA 2HVJC 2EINC 4WFEA 2X6BA 2HJFC 3RVYA 3STZC 1R3IC 3K04A 3ASNC 3PJSK 4H33A 3SPJA 2HG5C 3AG3C 4MS2A 4P9OA 1KKDA 3OR6C 4XDKA 1K4CC 5EBLC 4BW5A 3FB8C 4JTCB 4MW8A 3E89A 3SPHA 1JVMA 3KG2A 3ZRSA 4HZ3A 5B1AC 3T4ZA 1M56C 4X88A 2ZXWC 4PDLA 1R3KC 1LNQA 4DXWA 2WLJA 2EILC 4MTOA 2EIJC 4MVOA 3LNMB 3OR7C 4XDLA 5KUMA 3RW0A 3SYPA 3F7YC 1OCOC 2DYSC 2ZD9A 4PA3A 4PDMA 2BOBC 3GB7C 4GX2A 5EC2C 4GX0A 2H8PC 4R50A 2NLJC 4WFFA 4RO2A 3E8GA 4R8CA 1V55C 3OGCC 3K03A 2WLKA 5EBWC 2Q69A 4MVRA 5CBHA 2X6CA 3FB6C 1K4DC 4PA7A 4I9WA 2WLNA 3ZJZA 4TWKA 4QE9A 4PDRA 4PA9A 2OCCC 2W0FC 2WLLA 2WLHA 2QKSA 3ABLC 1BL8A 4ZBMA 2HVKC 1G4YB 2EIKC 3AG2C 2HFEC 2DYRC 4R7CA 1J95A 1M57C 3RBZA 3X2QC 2KB1A 3IGAC 2EIMC 4LCUC 3SPIA 3JYCA 3SYOA 3UKMA 3TETA 4XDJA 5E1AC 3T1CA 5J9PC 2R9RB 3AG1C 4CBCA 3OUSA 4J9ZB 4QE7A 3RVZA 2ITCC 4RAIA 3SPGA 3UM7A 4QNHB 1V54C 3F5WC 2P7TC 4WFHA 3K0GA 4MW3A 3LUTB 3LDCA 2WLLB 5EK0A 5EC1C 3SPCA 3ABKC 2Y69C 5BZBA 5CBGA 4OXSA 2BOCC 2WLMA 2WLIA 1ORQC 3K0DA 2JK5C 4HYOA 3OUFA 3K08A 3SJQC 3STLC 2A9HA 3E8HA 4PDVA 4G28B 5KUKA 3SYCA 4J9YB 4GX1A 4WFGA 1P7BA 3FB5C 1ZWIC 4MVZA 2A79B 3LDEA 4MVQA 4X89A 1S5HC
chains in the Genus database with same CATH superfamily
5BY1A 3EGXA 2QKCA 4YY3B 1FJGO 3PCVA 2Q0AA 1S3JA 1SZTA 4IGGA 3JRMO 1OHHG 1VQKV 1ZHTA 3N2ZB 5FNVA 1EN4A 2CGOA 3W7TA 1XL6A 3JALA 1VQNV 1Q90D 3JATB 3GM1A 3B0VC 4CZZA 3K1IA 4WGZA 4MVUA 3ML0A 1FFHA 1BQZA 1N34O 2J0XA 2N05A 1VEWA 1JFFA 1SQGA 3RYFB 1GN3A 4BJ5C 1M9NA 1ZLZA 3R66A 3GANA 3QF7A 2ZPAA 4DVZA 2H7OA 1TAEA 5FPRA 2J7PD 1ZAUA 5LYJA 2BTQB 3R2PA 2FTKA 1TUBB 4LF4O 5DECA 4L87A 1K97A 1FJGB 4WGYA 5B1AC 2R7QA 4PDLA 3HNKA 3G6BA 2EILC 4DUYB 2LFRA 5KUMA 3HR0A 1XHZA 1IBLB 2W4BA 4FLZA 4H13B 1N33B 3M4CA 2V4DA 4NR1A 1S5JA 2EBOA 1K73W 2X6CA 4RBNA 4X1KA 5GTIZ 4U5DE 3RYLA 3OEEG 4QE9A 4FVMA 3S27A 1ROPA 3P3PA 4FX5A 3K79A 4QDLA 1XOUA 5L0CA 4JGSA 1BL8A 1SS3A 1P7GA 1Q0MA 3LEVA 3IPMO 2DYRC 4DRXB 3A9CA 1VF5B 4DOZA 4ZHQB 1XHXA 4CSAC 1ZHYA 3ZRVA 4JCHA 4GT1A 2YIAA 3SR2C 1Z5WA 3OMAB 2I8BA 4QNHB 2ZXWB 4JI2O 3SPGA 4AHCA 3NDBB 3A8TA 1CPQA 4U7NA 1HW7A 4XBFA 4IWBA 1Q8IA 1N32B 2PX0A 1Q3EA 1IBMB 4J11A 4C3EA 2JDIG 5KA5A 1PV3A 3AOUA 4JI5B 2VQEO 2YS8A 1L7CA 3JSEO 1YDIA 1NQTA 4XPYA 1QCEA 2JD3A 4K1OA 2Q4FA 2AXTZ 1XMQO 3NRHA 1G4WR 1S5HC 4TUYB 4NXNB 1H2SB 4I50B 3M99B 4FLUA 2UXDB 3I5DA 3EH1A 1I5XA 3UMIA 5BR8B 1Z63A 1B04A 4XEVA 4O4JB 1AJNA 2Q7HA 1J5EO 4UB6Z 4UCVA 2QDOA 5JS5A 1JCHA 3GM3A 1CGME 3DXJF 1TWCA 1Z2GA 2ZINA 4F6EA 2B0HA 3N2KA 2XAHA 2HLDG 4CDYA 5IDJA 5KYXA 3FYEB 5L3GA 1G8XA 2Q9CA 4JAAA 2XSEA 1B06A 2UU9O 1OCRC 3L0IA 4U9EA 2XNDG 3KZIZ 1BMFG 2H7BA 2XLWA 1WP8A 4MQ9F 1L0NH 3WB1A 1XMQB 1UFBA 3SZRA 5H6QA 3SPJA 4I0XB 2A6EF 3DE9A 2XM0A 2LP4A 4EFBA 3FB8C 4JTCB 3IHUA 4ZLCA 1HW2A 4IAOA 3CSXA 2D5RB 5LP6B 1VQ8V 1EM1A 2YXLA 1KUQA 3DI5A 3ZWIA 3RW0A 3OW2U 5E79Z 2DYSC 1J5EB 3JASB 4JI4O 1MSDA 5KYUA 4W4KA 4QPKA 4DR1B 4JI7O 3MHSC 4NCQA 4JF3A 1K8AW 2OYQA 3OGCC 1MMDA 3UMKA 3T1YO 5CBHA 1LR1A 2ADPA 2WLNA 5JSLA 3UNGC 4O2BB 1Q0GA 4L8JA 2Y39A 4U9DA 3DC6A 3QW1A 5HSWA 5B1OA 4U5FE 4EFEA 3CWBH 2JVDA 3E2EA 3TK0A 2KB1A 4LCUC 5A6JA 1QQCA 1VK5A 3CRCA 2C2AA 4IRUA 2HSQA 4P9TA 2A69F 2FMLA 2PUSA 2RMKB 3O55A 1M56B 2XASA 3A2FA 1VB5A 3DWWA 1M2VB 2EIJB 4WFHA 4DR4O 1IXMA 3LUTB 3D36A 3LDCA 5DQZA 1NS1A 3PDMP 3S3WA 4K8ZA 3JARA 4R32A 3ZHSA 1KKCA 1Y4CA 2UUIA 4CBEA 1I5YA 3K08A 4JI4B 1V55B 4W8PA 3EZHA 3SJQC 1RSOA 2ZE8A 3VBBA 3IEEA 3CB2A 3SYCA 5LOVA 3VM6A 1MZEA 1C03A 4X89A 3RWRD 2OCCB 1VIBA 4I4TB 1R6KA 2WAMA 2ZDIC 4X20A 4TV9A 1TR2A 4CC5A 2J8WA 4KXRA 4BJ1A 2CE4A 2WPDG 3RYCA 3UO2A 1Y6XA 3RYHA 4FLWA 1MABG 4MTXA 1U89A 2L9JA 2HP8A 3CCRV 3B77A 4BW9A 4GKKB 4JPRA 3OWTA 2YL1A 4JRZA 2RSEB 2IJHA 5GONA 4CSAA 5BQIA 2OEXA 3MBGA 3CS5A 2JEXA 4K3AA 3I4UA 4UCOA 4JEBA 2YLDA 3NG1A 2JPUA 3B0PA 3JCUQ 5L3CA 4QI2A 3L71H 4NTXA 1H38A 4LF7O 3ZVRA 1QBZA 1CGOA 3JSNA 2V26A 3OEHG 3TGUH 1FFTB 3NMJA 2Q68A 3H1HH 3TD7A 3HKEA 1GGQA 4PJNA 4K7BA 1B68A 2O9XA 5KAFZ 2HG5C 1W2BU 1QQ3A 1ZSPA 2V7QG 2R02A 1RKCA 3JD3A 3C62A 1IZ3A 1RPOA 1E85A 1R3KC 3TULA 1Q6HA 1KD1W 1CEZA 4LWSB 1IXBA 5EC2C 3G4ZA 5LA6B 1PL0A 2Y4UA 4WFFA 4HNAB 3FYIB 1S72V 4FLTA 2X0LA 2KC3A 4KC9A 5JVDA 4DV7O 4PA9A 5A6BD 1NU1H 3CJHB 4LF7B 2NUPB 3HNIA 2W6JG 3T4RA 5CA0A 4JZGA 3RBZA 2P7VA 4ZI7B 3L9DA 2CDYA 2QA4V 1FYJA 3U0CA 1E83A 1PP9H 3AG1C 4LLCA 4J9ZB 4ZOLB 4F6RB 3PMRA 2DGJA 1QPUA 5EYPB 1I08A 1MNGA 1VF6A 5FZTA 3ZTMA 4DR3O 3ZN1A 3VF0A 4X1IB 2YLIA 1NH2B 5F28E 4HYOA 4NKGB 1Y74B 2OKUA 3ZSUA 3W7XA 1LUVA 4I5SA 4JEAA 1KU9A 5DS4A 3U2LA 1O3UA 2XS1A 2F22A 4O4IB 4KFMA 1EI7A 1ZTEA 2AHYA 3ZX6A 3RQGA 1NTZH 3HNLA 3ZIAG 1N36O 3CC7V 3EFFK 2BCCH 1C02A 3W2WA 5GW7A 1YLMA 3I56V 1EN5A 4Z9HA 2BTOA 1OW6A 1VLSA 4O2AB 2C04A 2ADQB 4CIHA 1GAXA 3KL4A 2L7AA 1AJQA 1GKFA 4LP8A 3THOA 3MDSA 3FDQA 5L3VA 4DR3B 1LI5A 1FXVA 4AL1A 2JGDB 3L70H 2KSDA 2X6AA 1PD3A 1WPXA 4H37A 4ULVA 4D4XA 2Q73A 4JASA 1I5NA 3E83A 3UMHA 3H2VA 2BE3A 2MHRA 5COGA 3FAPB 3GORA 4BW5A 1VQ5V 4J10A 1Q5OA 4DV1B 1YEWA 3T4ZA 3RT3C 4ZIBA 5JCOC 5CA1B 2LQTA 4GYCB 2ZD9A 3ZQVA 2QWRB 3OT7A 2BOBC 2XTAA 1FR0A 1AR5A 3OFNG 1AVMA 4YL0A 3ETQA 5B1NA 4ZKIA 1HNZO 3FOPA 1E2XA 4UCUA 2PI4A 3IJ4A 2R7RA 4IYHA 2KGOA 5B3IA 2Z3YA 1U6HA 3ABLC 4PV1B 1HNWO 1XQ8A 4R7CA 4DK1A 1FAPB 4JI0O 4KUMA 5JRAA 4XDJA 5DLJA 3AG3B 4C7OA 5E1AC 5JH7B 1N4CA 3MLGA 1K5SA 2CUGA 4Q7CA 2B1GA 5H5NA 2ZR2A 2JX0A 3IQ6A 2R9IA 4AE4A 1WGWA 4U3JA 1DOVA 1PD0A 3ZN0A 1TVKA 1KECA 4OXSA 1JAFA 1BS3A 3JAMN 1ORQC 3K9SA 4EEQA 2JK5C 3ETGA 4GCZA 3C8GA 3L1MA 3SNHA 2VC9A 1MMMA 4D7TA 1ZWIC 1ZHWA 2QR4A 1AI7A 3C3SA 1HNZB 2Q9LA 1F4MA 2XLOA 4OIPF 1RJ9A 1FKAO 2KQXA 4UVCA 1VQLV 4NTWA 3K1IC 3DC5A 1E84A 2IM8A 3EFOA 4DV4O 4MVMA 5KHHA 3H1LH 3X2QB 1VQ9V 2Z15A 1GM7A 4N21A 3QG5A 2NUTB 5JLIA 3E8BA 3L74H 4B7EA 3HKBB 1BBHA 3NYMA 2JGUA 4U3FH 2RN9A 2PX3A 5H2FZ 2OIGA 3EG9B 2CDQA 4Z1VA 1X59A 4PA6A 4M63A 4OINF 1AILA 4RWUA 1MZFA 5CBFA 1FMVA 3E70C 4YL1A 2P22C 1VQ7V 3TK1A 1BQ0A 1MMGA 3U2MA 3CCLV 1ZVZA 3SJBC 1VQ6V 4JV5B 1P84F 2HJ3A 2YZSA 2GHYA 3U0ZA 3ZMVA 4DYLA 3IQ5A 1WB8A 3FAVB 4LR3A 4DUZO 1XWJA 5H9CA 1O87A 1HE1A 2EINC 3SXZA 4E4EA 1HMDA 1DF5A 1QVGU 3K04A 2KG7B 3MYFA 3TJ6A 1RM1B 5LXTB 1K4CC 4FMTA 1BZKA 4DV4B 2QLAA 2WVOA 1QKRA 3A0HZ 2VQFO 1VF7A 2XLVA 4PA3A 1SQVH 4LFCO 2EJRA 1NVPD 5J2TA 3EZIA 1OXKA 1LI7A 3BA9A 1NSGB 3LAYA 2UUCO 2BSKB 1XZPA 4RQFA 5L0IA 2CK3G 3DMDA 1YIJV 3AG4B 4PA7A 4I9WA 3ZJZA 4LF5B 2GSMB 5ITZB 1LPEA 1UPGA 1A0BA 1RKEB 2NSGA 1VMGA 2YQYA 4GKJO 1M4UA 3FOOA 1JA8A 4GZRB 3WU2Z 3AK2A 2W0XA 4I55A 1AR1B 2GDCA 3QMKA 1G6UA 4CS9A 2KK1A 4A4AA 1Y76A 4DUZB 4TV8B 2H3OA 3FVYA 2HHHO 1F4NA 4JVSA 4RAIA 4UDVA 3CCEV 3EHNA 3K5MA 4OD5A 2KNHA 4BJ6A 4JW1A 4LFBO 3L72H 5AC5A 2MYSA 4F4BA 4IYIA 1GS9A 3SXKA 1XREA 5JQGB 2YXYA 2CTRA 3JTLO 5C93A 4A5UB 4ONSA 4P9FA 4PDVA 5CI8A 1Q43A 2EZOA 2Q8VA 1NFNA 4DR2B 4DR5O 3JATA 3POVA 3UGPA 5JJEB 1Z5VA 4JYCA 4G27B 2J46A 1KYOF 1XUQA 1NFOA 1NU7D 2XL4A 4HE8D 2L81A 2ZXPA 3M8AA 2XLEA 5A9GA 2IXNA 3JAWB 3RYFA 3AJMA 1B6QA 3ABMC 1K5QA 3K5LA 2HZ8A 1QZXA 5IY5C 4LNUB 5T3WA 3DAFA 1NKDA 2ZIMA 2QSAA 5IJ0B 2EPOA 4ASUG 4JZ2A 3CC4V 4JYAO 3DXRB 3Q4HB 2BTQA 1N0JA 3ABKB 1TUBA 1D1BA 4ZLDA 1YZBA 3VQXA 3H1IH 4LFBB 1LS4A 3B40A 1D5AA 4AK9A 3ZMZA 3DTUB 3JAKB 4B08A 2DWEC 4JCZA 4NVPA 4UCSA 4CDAA 2QTOA 5JUAA 3T6JA 4JAVA 4EHPA 5E2QA 3MAQA 4O4HB 1IDSA 4C7UA 1DK1A 3D3IA 5EBLC 3KKBA 3GEEA 4IHJB 4G7OF 5K1PA 2UXBO 4DXWA 4HEAJ 3U9JA 4N06A 5B5EZ 1NU9C 2UUHA 4DRXA 4UCTA 3W7UA 3QVYA 3CE2A 4QIWF 4ICGA 4ZHQA 3DJNB 1U0BB 2YEVB 1LE4A 3SDLA 3HTKC 2L35A 4JYAB 2N74A 1YTFD 4PJMA 1K4DC 1RFYA 4TWKA 3DKAA 3AGUA 3M79A 1VQMV 2Q7RA 2ZNJA 3B09A 1Y66A 4DRHB 2W0FC 5LHGA 1W2WA 3D8CA 1M1KW 1FPOA 3D36C 1G4YB 1YJWV 3EHBB 1ZU5A 4GEHA 1L1FA 1J95A 1Q82W 4UV8A 3CXCU 5L0DA 1RMVA 1Y4MA 1GO3F 1FAFA 2R9RB 2OEVA 1HR0O 3U11A 1T9KA 3JCUZ 3TJTA 3ZIBA 5LMUO 4TUYA 1YCIA 2P6VA 3TOMA 3UM7A 4PACA 4I50A 4JYBA 3JT1A 4DRIB 1SF9A 3WODF 3EH2A 1NI8A 2ZR3A 2WLLB 4IIJB 3SPCA 3OEOA 1M2OA 4DO2A 2UXBB 2M7WA 2L6HA 4O4JA 5CBGA 2BOCC 2KKWA 1N34B 1JMWA 5L0JA 4LF9O 3E9VA 1ZW2A 1KU2A 1TQGA 3U8VA 3PN1A 4U5HA 3H9VA 1R3LC 1I7FA 5B3SC 4CDVA 4CH4A 4YJWA 2ATKC 1D2DA 4I1MA 1P4RA 5BMVA 1FS0G 2EIKB 4EWCA 5A6AA 1ZHXA 1M57B 4DV5O 4W4LA 4LF4B 1W59A 3EGDB 1PM9A 2HJDA 1SMYF 3F47A 3R7CA 4J7TA 1YF2A 1KQSU 3AK1A 4K35A 2VCAA 3KYIA 1WAZA 3OTOO 4HFFB 4YXWG 4XWJA 5IJ9B 3ZDLA 4A2NB 1QLEC 2IBZH 5GPGB 2GUZB 4K0KO 2IH1C 2E74B 1SA0B 1HR0B 4XPWA 5LHHA 1OCZC 2FAPB 4X1YB 4I0XA 1YA7O 3LESA 2AHZA 4OIOF 2DWDC 2DW4A 3LSQA 2QM7A 5LP6A 3C8ZA 2ZNIA 1ZYRF 1WB7A 1OZ0A 2W45A 3BHPA 2F93B 2Q6AA 3JASA 2XOKG 2XAFA 2OU6A 2L6GA 3DZAA 4LF9B 3SYQA 2CNWA 1BGYH 1YZAA 2OCHA 1K3EA 3RVYA 4WABA 4NC3A 1WPBA 4P9OA 1CXZB 4O2BA 2OQMA 3RYIA 5E3CA 3KG2A 3OD4A 4JI2B 1SQPH 4MTOA 1OCOC 3SXYA 1S77D 2F95B 4R50A 4RO2A 3S28A 4R8CA 4CX9A 1FTSA 3K03A 2VQEB 1WWPA 2J0WA 1Z3IX 2NR5A 2PBEA 1DF4A 4DV6O 1M2VA 2PF4E 3Q6NA 2QWNB 1QLNA 1VF6C 3WG7B 1SZXA 3C7JA 1EA8A 2YIBA 3GEIA 5LHIA 3V5ZA 2UUAO 1MNEA 2PP4A 2PTMA 2C03A 1JPNA 2ETNA 3K59A 1M6TA 1AROP 3ICXA 4YJ3B 3S29A 3RQFA 3NXSA 1BHBA 2ZXRA 1K34A 4J80A 2HSBA 1NR1A 1H2GA 4I4TA 4U5CE 3F5WC 4NTYA 3ETEA 4MW3A 5IYZB 3K58A 3U9MA 5BUOA 2WA4A 2Y69C 3A0RA 4AILC 2R05A 1DLBA 1AB3A 3OUFA 1Q7YW 3CC2V 4GYTA 1FXHA 3STLC 2A9HA 2OWOA 5KUKA 2QJ1A 5IT9N 2OTJV 1NZEA 3KMIA 1O9HA 3U8PA 4GX1A 4U7OA 4YIOA 1P7BA 4RD9A 2A79B 2YI9A 3QVZA 2UU9B 3SJCC 3E8FA 1H2MA 3H01A 4DV6B 1YVIA 1G1XB 4I9QA 3AG2B 3B9QA 3CRAA 2EIMB 1FXKB 3JD4A 3ASOC 2LO1A 2UUAB 4MVSA 1C17M 5DS6A 2IH3C 2ITDC 1QNMA 2IJKA 4X62O 1V54B 3QW0A 1Q6UA 3FB7C 4RUEA 4CH3A 3LNNA 4JI7B 4KHPO 2A06H 3T1YB 2A0LA 1E86A 1YDXA 4FM1A 1YAUO 3RKOF 3HB3B 2P0NA 4TQFA 2XHBA 1R3JC 5KA6A 5B66Z 1PPJH 4LWSA 3O39A 3ZHRA 4HNAA 4I1OB 2DI3A 1E79G 3PJSK 1VP7A 5LBQA 3CSKA 4B3RO 4DK0A 1GN6A 1G4US 4EB6B 3SXMA 5JWPA 1F7YA 4E17A 5KYUB 5KX5B 1P49A 3CJHA 1EN6A 3K5OA 2NUPA 2K9PA 3LNMB 1THZA 2P61A 3QZCA 4DR4B 2HKOA 3G6EV 4PDMA 2LGQA 4EIYA 4AI8A 5C8YB 1GH6A 4GX0A 2ASRA 3HLZA 4LC1A 4CIPA 1MA1A 3MHHC 2Q5ZA 2WLKA 4X9QA 4JJFA 1KC8W 2Q69A 3FB6C 1JPJA 2ARHA 1GN2A 4ZOLA 5EYPA 1QR8A 2KW3C 2V3CC 1HNXO 4KHPB 2QE9A 1KTMA 1F23A 3KPHA 2Y48A 3WB2A 3ZRWB 5COMA 3P30A 1T6QA 2H94A 4X1IA 2VASA 1BT8A 1A41A 3CP1A 1JR8A 4PI0A 1GM8A 1QU7A 4OIQF 1EZVH 3AG7A 1Y74A 1ZL8B 1PD1A 2HV6A 2KYHA 3K57A 2J45A 2ZE5A 2PNOA 5CB4A 4JE9A 2JJ2G 3T1CA 2Z5UA 4AQYO 3B29A 5B1AB 2R25A 2YI8A 3JARB 2FB5A 5IWAO 2A0UA 2EILB 2Q3TA 3K0GA 4TSFG 2DJVA 4UB8Z 4LH6A 1NT2B 3UT5A 1S7ZA 4OIRF 5BZBA 3LS0A 2Y3DA 2WLMA 3CAXA 4Z1MG 1UFIA 1GM5A 3G80A 2MWQA 5LMNO 5CI9A 3VQVA 2BC5A 3E8HA 2BE5F 2X0CA 1O5HA 2M6YA 4X20B 4LACB 5D91A 3RQEA 1S05A 3LDEA 4BIOA 4W8KA 1Q0DA 2CGEA 2B1IA 1BR2A 4O2AA 4QGPA 5L3DA 4BIZA 1HNXB 3ZBHA 1NLXA 4DJ9A 3SYAA 2DYRB 5F2VO 4DW1A 2ZT9B 2JGDA 2XLMA 2WLIB 1H2KA 2WA3A 2UXNA 2XXAB 3K9AA 4LBEC 1W0JG 4LDKA 1L0LH 1OCCC 1YITV 2P6JA 2VS0A 3FX7A 3ZC4A 4FWVA 1XL4A 3ZMUA 4O6MA 2QE7G 5IE9A 2DB4A 1J8MF 5DVWA 4BEJA 4U5BE 5IWAB 3US6A 3T4DA 2D4UA 4HBNA 3DSQA 4WCEV 5CA1A 1G5ZA 4DV7B 2R7VA 2FYUH 1D1AA 3HNJA 5LMNB 1AEPA 2FFHA 4JC7A 2RNBA 1UG7A 4D6TH 2P4KA 1SC5B 5B1BC 1D0ZA 2HVJC 4WFEA 1ORJA 4JJGA 1XNRO 3C8GD 1VQOV 1YHQV 1R3IC 3ASNC 4X66O 4MS2A 2IBFA 1KKDA 5J2UB 4Q4ZF 1AVOB 1K04A 1GQAA 1M5IA 1IBKO 4FAPB 1BE3H 5F5FA 1PL4A 1YZCA 5TJ5E 2ZKOA 5CIVA 1MOFA 2IU0A 1SQBH 3K7DA 1TGOA 4UFZA 4J7ZA 2D2CB 2JS3A 3E8GA 2F4VO 1JPXA 5JH7A 4J7JA 1GK9A 3FMSA 4CS9C 3H1JH 2VWKA 2YHSA 2LSEA 3HJCA 4BJ6C 4FZ0A 1OCRB 1T6UA 3T6GB 1WJZA 2HV7A 5FLXN 4JI1O 1OQCA 1XZQA 1Z5ZA 2RD9A 1RPRA 3JYCA 4NY3A 1XI1A 2P5OA 3SYNA 3FXHA 4CBCA 1BCCH 3ATPA 1YSCA 1N36B 3Q7LA 3N2GB 3KKYA 5LL6Y 1OW8A 4X66B 4E7ZA 3HKDB 3VRCA 3W8HA 2AWYA 3ETDA 1TA8A 4Q6GA 2UUBO 2DYSB 3QTCA 1BR4A 3IC9A 2W6IG 1IBKB 5L0HA 2AP3A 4NQFA 4DW0A 2GTAA 4FLVA 4G78A 1AUEA 2NUTA 1OJHA 1JQ0A 4C3BA 3HKBA 1MMNA 4ER9A 4FM0A 5L0GA 2VWJA 1JX9A 4O4LB 4J9YB 2F4VB 1ORYA 3CMEV 3EG9A 4XPXA 3ZQYA 2J9UA 1WA8B 5T1DB 2V1DA 1O9GA 4UUJC 5HFMA 4OPAA 3ZHVA 2PFDA 2K1EA 1PNKA 2GAQA 3P3NA 3VYWA 5DEDA 4JTDB 3CMAV 3B8NA 3F7VC 4JI1B 1U97A 3JYHA 3ZEDA 2XL8A 3ZMSA 1XNQO 4DVYP 1SRYA 1M90W 3FAVA 2CH7B 5BXZA 2R7TA 1K33A 3ASOB 3T2MA 3L75H 4Q5SF 2R7OA 2KG7A 1QVXA 4C3DA 3HPLC 1FFXB 4P6IC 5LGUA 5LXTA 5EHHA 4Z9JA 2NNUA 3VOUA 1VQ4V 1ENVA 2J9BA 2UUBB 4X64O 1HMOA 2UXCO 2I15A 3W8IA 3V5XA 1PNMA 5IYCO 3VQYA 4RUFA 2XAQA 4UXNA 2CTQA 2QY9A 2LGWA 2WL8A 2J9VA 2XRHA 2ETSA 1HNWB 4IL6Z 3BPZA 2BSKA 1Q81W 3CZ6A 4K8XA 3GEHA 4CS3A 4JI0B 3D3QA 3C3TA 3QNEA 4FFBA 1BR1A 1F1MA 5ITZA 5KHIA 2QTVA 3SPHA 4E18A 3FD9A 4YT4A 2LW1A 2ZXWC 1K40A 1HW1A 4J30B 4ABMA 4XDLA 4FM2A 1DTOA 3T1HO 4LFAO 2ZM6O 2FGYA 2JRIA 5D92A 1HY5A 1TWGA 4UCRA 4CC6A 4TV8A 2ZE6A 2F1MA 1KB9F 1YXBA 3GWNA 3DM5A 1S76D 2DQ0A 1US6A 3LSUA 1T5OA 2RCVA 1VLTA 2R7SA 3MD0A 4X64B 4KI2A 5JQGA 2HFEC 1TUEB 1OKKA 3W7WA 1GN4A 1KP2A 2FKXA 2IW5A 3F5TA 1LE2A 3IGAC 5DQTA 3P32A 4CS8A 3AEIA 3EQLF 2L6LA 2Y3HA 4CH6A 1R73A 3CRMA 2YUAA 3KCXA 1R5ID 3FKSG 3B8MA 2XUMA 1TKNA 2YRFA 4YN0B 4YJ2B 2Q9BA 3QO5A 1LKXA 2HMZA 2P1AA 1A7DA 3T1HB 3KCYA 3J80N 4LFAB 1BHAA 3JAWA 3T6BA 5L3FA 4LNUA 1RJ9B 5IJ0A 1OV9A 3FB5C 4MVQA 1JOYA 2VCBA 1GMGA 3Q4HA 5K1XA 4U5GA 4TOIA 3ABUA 2IXPA 2QWPB 3ZMTA 3C63A 1SQFA 2WZLA 4NXMO 2ILMA 3RF3A 2ODMA 2A7WA 4N6HA 2GDSA 2WSSG 1Z23A 1LUWA 1NBBA 3LNRA 3ZG1A 5KMGB 2YIDA 2WVQA 3EVKA 1WP7A 3UO3A 3JAKA 1Q6IA 3R65A 1JJ2U 1Y6DA 5LP6C 3AG1B 4Q20A 2E75B 2VQFB 3UR3C 3QVNA 2ZQMA 4O4HA 4LFCB 5KYYB 2HUJA 1URFA 5KYNA 3OTFA 4EBJA 2YL3A 2UUCB 2G3VA 4IHJA 2IJIA 5A2QN 1ZW3A 2YLGA 4WJ0A 4YT2A 2QUPA 3BEHA 1SERA 1H6GA 5KYWB 1I0HA 4GKJB 3S84A 4PA4A 3ZRXA 3ECSA 2YEVA 4JI3O 4D7SA 3CCSV 3O65A 3IAYA 4PJ0Z 3E89A 4AL0A 1JVMA 1QR9A 2VH3A 1PKXA 1BZ4A 1M56C 2HHHB 3S90A 1FMWA 1T5EA 4BIUA 1LS1A 2EIJC 1Q0FA 2GFHA 1D0XA 2IJJA 3HKCB 3JSLA 4EBBA 3NKDA 3NMIA 4GX2A 4IJJA 2H8PC 1VYIA 1V55C 5EBWC 1W0KG 4BPMA 3DGEA 4WFAV 3CX5F 4I55B 1N8RW 4XEFA 4DR5B 1AP5A 2OCCC 2WLLA 4IIJA 2WLHA 3T9OA 1AI5A 2VCCA 2LFDA 5FL7G 3VQWA 4O6NA 1IW7F 2LIGA 5J9PC 4KBLA 4JI3B 2XLHA 3NYLA 3OA1A 2RQ6A 2YC0A 3C18A 1AP6A 2QKAA 2PZSA 4DUYO 2NG1A 3AQBA 1CPRA 2P7TC 1IBLO 3K66A 1H8EG 1N33O 2CNWD 4WBNB 4NYKA 3W2VA 2B9ZA 3EGDA 3EPVA 2FL4A 5L3QA 1WN0A 2MW2B 5IJ9A 2OJED 4FFKA 4G0HA 3CEXA 2GUZA 4WFGA 1FFTC 2OJQA 2VB6A 1SA0A 1FD9A 3FAJA 1NG1A 4X1YA 4B7KA 1OW7A 4F4LA 4BG0A 3ABLB 1NBMG 2JIZG 3N24A 4N6CA 5EZYB 3S0XA 4UV9A 5CMUA 5L3EA 1EBOA 5DS5A 3E22B 5FCLA 3EHMA 4XLPF 2IU3A 2OOCA 2HJMA 2RDCA 2P67A 3QO7A 2GBOA 2Y4TA 3BY6A 3UCSC 2EPNA 2WB7A 1X4TA 2DMXA 1N32O 2A0BA 2YIBD 1YVWA 2ZIOA 1IBMO 2PGGA 3EGXB 2M64A 2KSFA 1NVPB 4PD4F 4JI5O 1BSMA 2JEUA 1XDCA 4XQ1A 4DR6O 2Y3GA 1HWYA 5FNVB 3CXHF 1SYQA 4H0LB 4NXNO 1TFKB 3BAAA 2EPKX 2AZ2A 3C90A 3JALB 1PCXA 5LGNA 2UXDO 4WF9V 4LDQA 1I94O 2HJFC 2YWAA 5BR8O 4H33A 3JD0A 5LGTA 4JURI 3OR6C 4YT5A 1YYXA 4DRJB 3CYOA 1GRJA 1MSWD 3TJ5A 1VARA 3M4BA 3ZCCA 1JFFB 5LMUB 3SGIA 4PFPA 2WLJA 2R7WA 1EZJA 2Q7EA 4CH5A 1OXBA 4GQHA 3VAYA 2R70A 1K7DA 2YL7A 4YJ3A 1Z7Qc 3CD6V 1QVFU 5LYJB 4J7KA 5DM6V 2B0JA 3BCCH 3X1OA 4DBRA 1R4TA 4IT5A 2YICA 1H2LA 3L8IA 4N23A 3AQCA 3S3XA 1F51A 1LIHA 3KYJA 2A1DD 4JIOA 1HE9A 2Y3BA 5IYZA 4CS4A 2HR3A 1KP3A 4UVAA 4DR6B 2EINB 1EFRG 4JKVA 4DV5B 3ZTZA 1MMAA 4Z9IA 3OUSA 4FESA 3OTOB 1I94B 1H9TA 4LH7A 4MNDA 4X1KB 3K5NA 1DOWA 2PYJA 1WTYA 2O57A 4X65O 4K0KB 3M15A 1VOMA 4DBQA 4PK4A 4PFOA 3UQ8A 5EC1C 1RCPA 2L6FA 4EUKB 3DJUB 2AGAA 3GVMA 1V4AA 2J7PA 4PJJA 2ZE7A 1FXKA 4DR1O 2CW0F 2NN4A 2YDEA 3G71V 1AI4A 3O10A 5HFLA 4G28B 1VMAA 3JYYA 5BMVB 1JR9A 1N0NA 2YXHA 1APCA 2XAJA 1WOLA 5GTHZ 2DN9A 1GTOA 2YL0A 1XMOO 2IXMA 1BDJB 3ZHUA 3K06A 2OIEA 2ZCEA 2CTPA 4JYYA 1N1CA 1Q0KA 5JVEA 4QPJA 2J9WA 1JRAA 3N27A 4LLEA 2GA0A 4YIPA 2LQGA 1ZHZA 1NH2D 3LDDA 2NSFA 4GX5A 3CEIA 1TWAA 3G50A 2E5LO 1CP9A 3ZHTA 3LEOA 1KBHA 2OG2A 3W4YA 4X65B 4EB6A 4MSWC 3K1HA 4JTAB 3OMNB 3BFRA 5KX5A 1YTFB 4R6ZA 3JD2A 4CS2A 4MTGA 3NKEA 4YWQA 4P2ZA 5C8YA 4O6YA 4AX2A 1IX9A 3RYIB 3TQOA 2VRZA 1U96A 3STZC 3OM3B 3AG3C 2AVKA 3W7SA 3J06A 2LFFA 1XMOB 2AZ0A 4BR6A 3N2KB 2PY5A 1JJOA 3RFYA 3SP1A 3G67A 3ABMB 2ICWG 3LSSA 3ZRWA 5KYXB 5IY5B 4GKKO 4BJ5A 1CPYA 3OR7C 1SQQH 1ZL8A 4RDAA 4FIPC 2KQ9A 3I55V 1COWG 2QWOB 3V7OA 5LA6A 1XBLA 2E5LB 2QM4A 2D3OW 3RN4A 5CA3A 2CTWA 4LERA 1KMIZ 3G4SV 4O79A 4JAUA 3Q7GA 3CCUV 3NR7A 4IAQA 4ANJA 4G7ZF 2HVKC 4K0DA 4NTAA 3CPWU 1Z6AA 4XTKA 3X2QC 2EX3A 3SPIA 3UGOA 1ST6A 4IB4A 1QHTA 2HFIA 5F5HA 4J42A 2HS5A 3G4XA 4QI0A 1S5LZ 4LF8O 5EGYA 4B3SO 4ZI7A 3WAQA 3CCQV 3B2EE 2Q4PA 4X62B 4KL1A 1HP8A 4F6RA 4GLXA 2P90A 2OT5A 2WLIA 2XXAA 4FJCC 3IQTA 1AJPA 2PI5A 1R6NA 3BA8A 3I5QA 3WHNA 4MVZA 2YKZA 4TQDA 1YJ9V 4D4NA 2QWQB 5EBMC 2EPLX 4PJLA 3GODA 2G38A 256BA 1RM1C 4H54A 3CQZA 5EIBC 4TT3G 4B3RB 3JRTA 2BL2A 3U5SA 4E0IA 3E86A 4O4IA 4DV2O 5JJNB 4FPPA 4FLYA 1VTMP 4JZAA 1RSOB 3JSZA 5LOVB 3LLKA 3JZ0A 2HMQA 3U10A 4LF8B 4P30A 4NTFA 1Y67A 4B3SB 2CCYA 2Q00A 5J2UA 1MQVA 4TV9B 1J8YF 2LD6A 4OD4A 3AG4C 1V9PA 3SJAC 4H4KC 1XILA 1TWHA 3RYCB 1T01A 1M93A 3RYHB 5E33A 3J81N 4LDRA 3H1KH 5GONB 5B3SB 2H7VC 2G3KA 2Q9AA 3Q6MA 5KHJA 2OTLV 3ZS8C 4DV0O 1XEQA 3NYJA 4AQYB 5L3BA 2WVNA 4CS7A 2XT9A 1ORSC 3B71A 4OGQB 1LNQA 3MX3A 5AG2A 1D1CA 5A6KA 3PHF2 1QLEB 3A11A 2X7RB 4DV2B 3BVOA 1NJIW 3HKEB 4FLXA 3APQA 1OCZB 1MG1A 1RXQA 2DQ3A 1ZUQA 4CS8C 2EULA 1R6TA 2W9YA 4G7HF 3N2GA 2Z0AA 1V74B 1K05A 2DE0X 3HKDA 3IQCA 2GV9A 5AC4A 5KAIZ 4PDRA 1OR2A 3EJNA 3O6XA 3A0BZ 5CB4B 5CN0A 3CCVV 4RQEA 1K9MW 2YVKA 1NTMH 5EIBD 2XL6A 4XEKA 2HKVA 4PI2A 4KNVA 2R72A 5BQHA 2LFSA 1PV0A 1SQXH 3FFQA 3GM2A 4O4LA 2IOQA 4DV1O 5KHKA 3UT5B 5JVDB 4QE7A 3DAGA 3CCJV 1WA8A 3L34A 1KNYA 4DV0B 1H2NA 2A3QA 4OX9O 1OCOB 2PYLA 2G62A 3ABKC 1ZZPA 4EBKA 3L8JA 2YSUB 1JMKC 2JJ1G 5CA0B 2GWWA 1JOGA 2E87A 4QJFB 1YA9A 1I4YA 2AW9A 3H65A 4J7YA 2Y0PA 2MK3A 5H6RA 2CH7A 1VQPV 1H9GA 4X0RA 3CRRA 4E2LA 3TOLA 1WNSA 3V5YA 3CHXA 2QEXV 1FFXA 3BRCA 2CGNA 1MNDA 1E1RG 1XNRB 3SEOA 3WB0A 4CJOA 1DGSA 3QTHA 2QGNA 4HAMA 2HEPA 1NR7A 1ZX3A 1SETA 2UXXA 4X8AA 1WASA 3M1CB 4KNWA 5A6BA 2ZDIA 1LVKA 2AU5A 3TXSA 1OKKD 2P06A 4KP4A 2Y69B 1I4ZA 4OPHA 4Z2WA 1PNLA 3RGBA 4OX9B 1HDJA 2LP7A 3EXAA 3MYIA 4YT8A 3K33A 2JS5A 1YI2V 3LJBA 3TCUA 2QM8A 3K3WA 5T3TA 2NPUA 2LK4A 4H44B 4YK5A 2H8AA 1Q86W 1EQ1A 3FHDA 4E0HA 5COFA 2XS8A 1A7VA 1QSPA 2Q7GA 3ZRSA 1EKYA 1AR4A 4CJGA 3AK3A 3CRQA 5KHGA 1LM3B 4MVOA 2Q0OC 5BQGA 1IVSA 1IURA 5TISZ 2XAGA 4G2KA 4PHZA 1H7IA 2EJ7A 4I44A 4DR7O 2R9AA 2KJGA 3RH3A 5IYDO 3ABTA 1YARO 3M7MX 3DM9B 5E3AA 4PR9A 3O9OA 5AGFA 3QO8A 4JV5O 1D5NA 3APOA 4YJ2A 2DOSA 4UVBA 1WN7A 1GM9A 1RKEA 4ZBMA 2EIKC 3OE7G 4FK5C 4BAYA 1M57C 3L73H 1FNTc 2XLDA 5K0IA 2XM4A 3CCMV 5KLVH 2F23A 4E7SA 4MT8A 2CAZC 3RVZA 1XNQB 3GWKC 1ZU4A 5DN6G 1OR3A 3MFNA 2LCHA 2WZFA 1CGNA 4JI6O 5KMGA 3LS1A 4IARA 3N0TA 3OGIB 3K6BA 4B3MO 5FPOA 2UXCB 4B3TO 1B3QA 3IC7A 4C7OB 1E1QG 4LF5O 4J41A 4DR7B 4L6RA 1SZIA 4I7ZB 1YYJA 5A69A 5KYYA 1SESA 2Y0IA 2E3CA 5JP7A 4ULWA 4HFKB 4AE4B 4BJTA 4U3JB 2B5UA 3B0UX 3OMIB 1TVKB 5D5QA 1UJWB 2IXOA 3C8GB 2N04A 3B4SA 1WATA 3JD1A 3TXQA 5KYWA 1YJGA 3IFXA 4DV3O 4JI8O 5HV9A 4GUNA 2Q67A 3F46A 2TMVP 2ZM6B 4LF6O 2IYLD 3DE8A 3U3BA 2A6HF 1IZMA 2F43G 3GWOA 3DXRA 2CYDA 1WLEA 3EFOB 4P9PA 4WFBV 3KH2A 2LW7A 4JI6B 1G8MA 4NTBA 3WFVA 2WWWA 2ZXOA 3HKCA 4MTFA 4DR2O 1SKVA 3WG7C 4EKWA 4B3MB 3RIPA 4B3TB 1R1BA 1TFOB 4FFBB 4BWAA 5IYBO 4BEMJ 1RP3B 2X6BA 4YHHO 4XDKA 4MW8A 3E35A 4I3MA 4HZ3A 4XLNF 4X88A 4U5EE 1NZ6A 3JCZA 2QTSA 3HKKA 4J32B 3ZHQA 1OCCB 1SF8A 3SYPA 1H8HG 2EZPA 3F7YC 1VYKA 2X51A 2IM9A 2F66C 3GB7C 4DV3B 4JI8B 2NLJC 3NMKA 3DD7A 2E76B 2EPMX 5JT4A 2W4MA 4MVRA 3BABA 3ITFA 4LF6B 3U3FA 5JCOA 4YY3O 4WBNA 1YJNV 3RFRA 4PELA 2QKSA 2QNLA 3S9OA 4NXMB 3H2UA 3AG2C 4B6IA 1S0VA 2R03A 5B1BB 3BRJA 3TETA 3SYOA 5J2TB 2EIMC 1FXKC 1D0YA 3UKMA 3GWLA 3ASNB 3J7AU 2LJ2A 1L8DA 2A68F 2M4EA 4O7GA 5D5PA 2WZGA 2R7UA 4YHHB 2ITCC 1V54C 3OAAG 3LLIA 2R7XA 5EZYA 5JJJB 1A32A 5EK0A 3AGTA 5L0FA 1AI6A 3E22A 2P4VA 1SR2A 3K0DA 2AWCA 1A7EA 2RJZA 3I5PA 2GTSA 4NB5A 1Y76B 4N4WA 4FZ1A 1K92A 1T6IA 4YL3A 1L3PA 1NTKH
chains in the Genus database with same CATH topology
5L3DA 1F4MA 1GTOA 4BIZA 4UVCA 1VQLV 3K06A 3SYAA 2DYRB 1S3JA 1SZTA 4MVMA 3X2QB 1VQ9V 2WLIB 1OHHG 1VQKV 2UXNA 1GM7A 3K9AA 4N21A 4LBEC 1W0JG 4QPJA 3E8BA 3W7TA 1OCCC 1YITV 1XL6A 2P6JA 1VQNV 1XL4A 3ZMUA 4PA6A 3LDDA 1NH2D 4GX5A 2QE7G 4CZZA 1CP9A 4MVUA 3ML0A 5CBFA 3T4DA 4MSWC 4JTAB 1VQ7V 3TK1A 3OMNB 3CCLV 4WCEV 1VQ6V 1YTFB 4R6ZA 3JD2A 4MTGA 4P2ZA 1M9NA 2GHYA 3ZMVA 5H9CA 5B1BC 2HVJC 2EINC 4WFEA 1VQOV 1DF5A 1R3IC 3K04A 3ASNC 3OM3B 3STZC 2FTKA 3AG3C 1YHQV 3W7SA 1RM1B 4MS2A 1KKDA 1K4CC 4L87A 1K97A 5B1AC 3ABMB 4FMTA 4PDLA 3LSSA 3ZRWA 5IY5B 2EILC 2LFRA 1CPYA 3OR7C 5KUMA 4PA3A 1MOFA 2EJRA 2IU0A 1NVPD 4FIPC 2EBOA 3E8GA 1JPXA 3I55V 1COWG 1GK9A 1K73W 4RQFA 2CK3G 2X6CA 1YIJV 3AG4B 4PA7A 4I9WA 3ZJZA 2GSMB 3OEEG 4QE9A 2D3OW 1ROPA 5CA3A 3K79A 3G4SV 1OCRB 4JAUA 3CCUV 4JGSA 1BL8A 2HVKC 1AR1B 2DYRC 3CPWU 3X2QC 1RPRA 3SPIA 3JYCA 3ZRVA 4CBCA 4GT1A 1YSCA 3OMAB 4QNHB 1F4NA 2ZXWB 4RAIA 3SPGA 3CCEV 3CCQV 4U7NA 3ETDA 4XBFA 2DYSB 2W6IG 2JDIG 2P90A 5KA5A 2OT5A 2WLIA 4FJCC 5C93A 1AJPA 1JQ0A 1NQTA 2PI5A 4PDVA 1QCEA 2EZOA 1R6NA 1JX9A 4J9YB 3CMEV 4MVZA 1S5HC 1YJ9V 4JYCA 4G27B 2V1DA 3M99B 5EBMC 4UUJC 5HFMA 1I5XA 2K1EA 1PNKA 1RM1C 4JTDB 3CMAV 4TT3G 1AJNA 3B8NA 3F7VC 3E86A 1B6QA 3ABMC 1K5QA 4FPPA 5IY5C 3ZMSA 1NKDA 1JCHA 1SRYA 1M90W 1K33A 4ASUG 3CC4V 3ASOB 3T2MA 4P30A 3HPLC 3ABKB 5LGUA 2B1IA 2NNUA 2XAHA 3VOUA 1ENVA 1VQ4V 2HLDG 3AG4C 3ZMZA 3DTUB 5IDJA 3FYEB 5L3GA 2DWEC 1PNMA 5IYCO 4RUFA 2XAQA 4UXNA 2QTOA 1OCRC 4JAVA 2XNDG 1BMFG 5B3SB 1Q81W 5H6QA 3SPJA 3QNEA 2OTLV 3D3IA 5EBLC 3FB8C 4JTCB 3SPHA 5L3BA 2ZXWC 1VQ8V 1LNQA 4DXWA 4XDLA 3RW0A 1DTOA 1QLEB 3OW2U 2DYSC 2X7RB 3W7UA 1NJIW 4QIWF 1OCZB 4QPKA 3MHSC 1MG1A 2YEVB 4JF3A 1K8AW 3OGCC 2DQ3A 1YTFD 5CBHA 1K4DC 2WLNA 4TWKA 1S76D 2DQ0A 4PDRA 1VQMV 3MD0A 1Y66A 2W0FC 5B1OA 5LHGA 5CN0A 3CCVV 1M1KW 4RQEA 1G4YB 1YJWV 2HFEC 3EHBB 1TUEB 1L1FA 1K9MW 1J95A 3W7WA 4UV8A 1KP2A 2IW5A 1Q82W 3E2EA 2KB1A 3IGAC 4LCUC 3P32A 3CXCU 1Y4MA 2LFSA 3AEIA 1GO3F 2C2AA 2R9RB 1R73A 1M56B 2XASA 4QE7A 3FKSG 3B8MA 3UM7A 3CCJV 4JYBA 2EIJB 4WFHA 1IXMA 3LUTB 3D36A 1OCOB 3LDCA 2ZR3A 2WLLB 3QO5A 3SPCA 3ABKC 4DO2A 2M7WA 5CBGA 2BOCC 2YSUB 1BHAA 2JJ1G 1I5YA 3K08A 1V55B 4QJFB 5L3FA 3SJQC 3VBBA 3SYCA 2MK3A 5H6RA 3FB5C 4MVQA 1VQPV 1JOYA 4E2LA 1GMGA 4X89A 2QEXV 2OCCB 3ABUA 1R3LC 1R6KA 3ZMTA 5B3SC 2WAMA 1E1RG 2ZDIC 2ATKC 1P4RA 1FS0G 2EIKB 2WSSG 1M57B 2WPDG 3R65A 1JJ2U 4HAMA 1KQSU 1MABG 3AG1B 4MTXA 4Q20A 4YXWG 3CCRV 3B77A 4JPRA 1QLEC 1NR7A 4X8AA 1SETA 2UXXA 2IH1C 2IJHA 2ZQMA 2ZDIA 5LHHA 1OCZC 2JEXA 4KP4A 2Y69B 1PNLA 2AHZA 2IJIA 5L3CA 2LP7A 2DWDC 2DW4A 3LSQA 2QM7A 1YI2V 1QBZA 1H38A 3TCUA 2QM8A 3K3WA 3OEHG 1OZ0A 2Q6AA 3BEHA 1FFTB 1SERA 2Q68A 2XOKG 2XAFA 1Q86W 4PA4A 3ZRXA 3SYQA 2YEVA 3RVYA 1K3EA 3CCSV 2HG5C 1W2BU 4P9OA 2V7QG 3E89A 1JVMA 3JD3A 3KG2A 1QR9A 3ZRSA 1PKXA 1RPOA 1M56C 1R3KC 4BIUA 4MTOA 2EIJC 4MVOA 2IJJA 1OCOC 1KD1W 1S77D 1CEZA 5EC2C 4GX2A 2XAGA 4G2KA 2H8PC 4R50A 1PL0A 4WFFA 1S72V 3FYIB 4RO2A 4R8CA 2X0LA 1V55C 3K03A 5EBWC 5IYDO 3ABTA 1QVGU 1W0KG 1DF4A 3DGEA 4WFAV 1N8RW 3QO8A 4PA9A 1QLNA 4UVBA 2OCCC 2WLLA 3WG7B 2WLHA 1AI5A 2W6JG 1GM9A 4ZBMA 5LHIA 2EIKC 3OE7G 4FK5C 4BAYA 5FL7G 1M57C 3RBZA 2QA4V 1AROP 3CCMV 5J9PC 3AG1C 3NXSA 1BHBA 1K34A 4MT8A 4J9ZB 1NR1A 1H2GA 3RVZA 3F5WC 2P7TC 3ETEA 5DN6G 4MW3A 3ZN1A 1H8EG 2Y69C 3A0RA 1DLBA 1NH2B 4HYOA 3OUFA 1Q7YW 3CC2V 1FXHA 3STLC 2A9HA 3IC7A 5KUKA 1E1QG 2OTJV 3W7XA 4GX1A 4U7OA 4WFGA 1P7BA 2A79B 4I5SA 1SESA 3E8FA 3H01A 4F4LA 3ABLB 1NBMG 2JIZG 3AG2B 4KFMA 4UV9A 5CMUA 5L3EA 1EBOA 2B5UA 3OMIB 1UJWB 2AHYA 2EIMB 1FXKB 3JD4A 3ASOC 3JD1A 2IU3A 4MVSA 3ZIAG 2P67A 3IFXA 3QO7A 2IH3C 2ITDC 3BY6A 3EFFK 3CC7V 5GW7A 2Q67A 3I56V 2IJKA 1V54B 3FB7C 4RUEA 1AJQA 2F43G 1GKFA 4LP8A 1NVPB 3GWOA 2A0LA 1FXVA 1WLEA 2JEUA 4P9PA 4WFBV 2X6AA 3HB3B 1PD3A 1G8MA 1WPXA 4H37A 3WFVA 2WWWA 1HWYA 4JASA 1R3JC 4MTFA 5KA6A 3E83A 3WG7C 4EKWA 5IYBO 5LGNA 4WF9V 2X6BA 2HJFC 1E79G 4H33A 3PJSK 3JD0A 5LBQA 5LGTA 3OR6C 4XDKA 4BW5A 1VQ5V 4MW8A 3CYOA 3E35A 4HZ3A 1MSWD 3T4ZA 4X88A 3ZCCA 3JCZA 2WLJA 1EZJA 3LNMB 1THZA 1OCCB 3SYPA 1H8HG 2EZPA 2HKOA 3F7YC 2ZD9A 3G6EV 4PDMA 2BOBC 3GB7C 4GX0A 3OFNG 2NLJC 1K7DA 4LC1A 3MHHC 3CD6V 2WLKA 1QVFU 1KC8W 2Q69A 4MVRA 5B1NA 3FB6C 5DM6V 4ZKIA 1QR8A 4N23A 2PI4A 1F51A 1F23A 2Y48A 3ZRWB 2HR3A 1KP3A 2Z3YA 3P30A 2H94A 4PELA 4UVAA 2QKSA 1YJNV 3ABLC 3AG2C 3CP1A 1S0VA 1GM8A 4R7CA 5B1BB 2EINB 1EFRG 3TETA 3SYOA 2EIMC 1FXKC 4KUMA 3UKMA 3ASNB 4XDJA 3AG3B 2JJ2G 5E1AC 3T1CA 2Z5UA 1K5SA 3OUSA 5B1AB 2B1GA 2ITCC 2ZR2A 1V54C 2EILB 3OAAG 2R9IA 3K0GA 4TSFG 5EK0A 5EC1C 3ZN0A 1KECA 5BZBA 4OXSA 1AI6A 1FXKA 2WLMA 1ORQC 3K0DA 2JK5C 3ETGA 4GCZA 4Z1MG 3G71V 1AI4A 5HFLA 3E8HA 4G28B 1K92A 1ZWIC 3LDEA 1AI7A 2XAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8F A;  4G27 B;  1R3L C;  5B3S C;  5EBM C;  4UUJ C;  4F4L A;  2ATK C;  2K1E A;  3K06 A;  4KFM A;  3SYA A;  4MVM A;  4JTD B;  2AHY A;  2WLI B;  3R65 A;  3ASO C;  3F7V C;  3E86 A;  3ABM C;  4MVS A;  4LBE C;  3E8B A;  5IY5 C;  3IFX A;  2IH3 C;  2ITD C;  3EFF K;  1OCC C;  1QLE C;  4X8A A;  1XL6 A;  2Q67 A;  2IH1 C;  1XL4 A;  3T2M A;  4PA6 A;  3LDD A;  1OCZ C;  3FB7 C;  4P30 A;  4GX5 A;  4RUE A;  3HPL C;  4MVU A;  5CBF A;  4LP8 A;  3T4D A;  3VOU A;  4MSW C;  4JTA B;  2A0L A;  2AHZ A;  3AG4 C;  4P9P A;  2DWD C;  2X6A A;  3TCU A;  2DWE C;  4H37 A;  4R6Z A;  1R3J C;  4RUF A;  4MTF A;  2Q6A A;  3BEH A;  3E83 A;  4MTG A;  2Q68 A;  3WG7 C;  2QTO A;  4EKW A;  1OCR C;  4P2Z A;  4PA4 A;  3SYQ A;  5B1B C;  2YEV A;  2HVJ C;  2EIN C;  4WFE A;  2X6B A;  2HJF C;  3RVY A;  3STZ C;  1R3I C;  3K04 A;  3ASN C;  3PJS K;  4H33 A;  3SPJ A;  2HG5 C;  3AG3 C;  4MS2 A;  4P9O A;  1KKD A;  3OR6 C;  4XDK A;  1K4C C;  5EBL C;  4BW5 A;  3FB8 C;  4JTC B;  4MW8 A;  3E89 A;  3SPH A;  1JVM A;  3KG2 A;  3ZRS A;  4HZ3 A;  5B1A C;  3T4Z A;  1M56 C;  4X88 A;  2ZXW C;  4PDL A;  1R3K C;  1LNQ A;  4DXW A;  2WLJ A;  2EIL C;  4MTO A;  2EIJ C;  4MVO A;  3LNM B;  3OR7 C;  4XDL A;  5KUM A;  3RW0 A;  3SYP A;  3F7Y C;  1OCO C;  2DYS C;  2ZD9 A;  4PA3 A;  4PDM A;  2BOB C;  3GB7 C;  4GX2 A;  5EC2 C;  4GX0 A;  2H8P C;  4R50 A;  2NLJ C;  4WFF A;  4RO2 A;  3E8G A;  4R8C A;  1V55 C;  3OGC C;  3K03 A;  2WLK A;  5EBW C;  2Q69 A;  4MVR A;  5CBH A;  2X6C A;  3FB6 C;  1K4D C;  4PA7 A;  4I9W A;  2WLN A;  3ZJZ A;  4TWK A;  4QE9 A;  4PDR A;  4PA9 A;  2OCC C;  2W0F C;  2WLL A;  2WLH A;  2QKS A;  3ABL C;  1BL8 A;  4ZBM A;  2HVK C;  1G4Y B;  2EIK C;  3AG2 C;  2HFE C;  2DYR C;  4R7C A;  1J95 A;  1M57 C;  3RBZ A;  3X2Q C;  2KB1 A;  3IGA C;  2EIM C;  4LCU C;  3SPI A;  3JYC A;  3SYO A;  3UKM A;  3TET A;  4XDJ A;  5E1A C;  3T1C A;  5J9P C;  2R9R B;  3AG1 C;  4CBC A;  3OUS A;  4J9Z B;  4QE7 A;  3RVZ A;  2ITC C;  4RAI A;  3SPG A;  3UM7 A;  4QNH B;  1V54 C;  3F5W C;  2P7T C;  4WFH A;  3K0G A;  4MW3 A;  3LUT B;  3LDC A;  2WLL B;  5EK0 A;  5EC1 C;  3SPC A;  3ABK C;  2Y69 C;  5BZB A;  5CBG A;  4OXS A;  2BOC C;  2WLM A;  2WLI A;  1ORQ C;  3K0D A;  2JK5 C;  4HYO A;  3OUF A;  3K08 A;  3SJQ C;  3STL C;  2A9H A;  3E8H A;  4PDV A;  4G28 B;  5KUK A;  3SYC A;  4J9Y B;  4GX1 A;  4WFG A;  1P7B A;  3FB5 C;  1ZWI C;  4MVZ A;  2A79 B;  3LDE A;  4MVQ A;  4X89 A;  1S5H C; 
#chains in the Genus database with same CATH topology
 5BY1 A;  3EGX A;  2QKC A;  4YY3 B;  1FJG O;  3PCV A;  2Q0A A;  1S3J A;  1SZT A;  4IGG A;  3JRM O;  1OHH G;  1VQK V;  1ZHT A;  3N2Z B;  5FNV A;  1EN4 A;  2CGO A;  3W7T A;  1XL6 A;  3JAL A;  1VQN V;  1Q90 D;  3JAT B;  3GM1 A;  3B0V C;  4CZZ A;  3K1I A;  4WGZ A;  4MVU A;  3ML0 A;  1FFH A;  1BQZ A;  1N34 O;  2J0X A;  2N05 A;  1VEW A;  1JFF A;  1SQG A;  3RYF B;  1GN3 A;  4BJ5 C;  1M9N A;  1ZLZ A;  3R66 A;  3GAN A;  3QF7 A;  2ZPA A;  4DVZ A;  2H7O A;  1TAE A;  5FPR A;  2J7P D;  1ZAU A;  5LYJ A;  2BTQ B;  3R2P A;  2FTK A;  1TUB B;  4LF4 O;  5DEC A;  4L87 A;  1K97 A;  1FJG B;  4WGY A;  5B1A C;  2R7Q A;  4PDL A;  3HNK A;  3G6B A;  2EIL C;  4DUY B;  2LFR A;  5KUM A;  3HR0 A;  1XHZ A;  1IBL B;  2W4B A;  4FLZ A;  4H13 B;  1N33 B;  3M4C A;  2V4D A;  4NR1 A;  1S5J A;  2EBO A;  1K73 W;  2X6C A;  4RBN A;  4X1K A;  5GTI Z;  4U5D E;  3RYL A;  3OEE G;  4QE9 A;  4FVM A;  3S27 A;  1ROP A;  3P3P A;  4FX5 A;  3K79 A;  4QDL A;  1XOU A;  5L0C A;  4JGS A;  1BL8 A;  1SS3 A;  1P7G A;  1Q0M A;  3LEV A;  3IPM O;  2DYR C;  4DRX B;  3A9C A;  1VF5 B;  4DOZ A;  4ZHQ B;  1XHX A;  4CSA C;  1ZHY A;  3ZRV A;  4JCH A;  4GT1 A;  2YIA A;  3SR2 C;  1Z5W A;  3OMA B;  2I8B A;  4QNH B;  2ZXW B;  4JI2 O;  3SPG A;  4AHC A;  3NDB B;  3A8T A;  1CPQ A;  4U7N A;  1HW7 A;  4XBF A;  4IWB A;  1Q8I A;  1N32 B;  2PX0 A;  1Q3E A;  1IBM B;  4J11 A;  4C3E A;  2JDI G;  5KA5 A;  1PV3 A;  3AOU A;  4JI5 B;  2VQE O;  2YS8 A;  1L7C A;  3JSE O;  1YDI A;  1NQT A;  4XPY A;  1QCE A;  2JD3 A;  4K1O A;  2Q4F A;  2AXT Z;  1XMQ O;  3NRH A;  1G4W R;  1S5H C;  4TUY B;  4NXN B;  1H2S B;  4I50 B;  3M99 B;  4FLU A;  2UXD B;  3I5D A;  3EH1 A;  1I5X A;  3UMI A;  5BR8 B;  1Z63 A;  1B04 A;  4XEV A;  4O4J B;  1AJN A;  2Q7H A;  1J5E O;  4UB6 Z;  4UCV A;  2QDO A;  5JS5 A;  1JCH A;  3GM3 A;  1CGM E;  3DXJ F;  1TWC A;  1Z2G A;  2ZIN A;  4F6E A;  2B0H A;  3N2K A;  2XAH A;  2HLD G;  4CDY A;  5IDJ A;  5KYX A;  3FYE B;  5L3G A;  1G8X A;  2Q9C A;  4JAA A;  2XSE A;  1B06 A;  2UU9 O;  1OCR C;  3L0I A;  4U9E A;  2XND G;  3KZI Z;  1BMF G;  2H7B A;  2XLW A;  1WP8 A;  4MQ9 F;  1L0N H;  3WB1 A;  1XMQ B;  1UFB A;  3SZR A;  5H6Q A;  3SPJ A;  4I0X B;  2A6E F;  3DE9 A;  2XM0 A;  2LP4 A;  4EFB A;  3FB8 C;  4JTC B;  3IHU A;  4ZLC A;  1HW2 A;  4IAO A;  3CSX A;  2D5R B;  5LP6 B;  1VQ8 V;  1EM1 A;  2YXL A;  1KUQ A;  3DI5 A;  3ZWI A;  3RW0 A;  3OW2 U;  5E79 Z;  2DYS C;  1J5E B;  3JAS B;  4JI4 O;  1MSD A;  5KYU A;  4W4K A;  4QPK A;  4DR1 B;  4JI7 O;  3MHS C;  4NCQ A;  4JF3 A;  1K8A W;  2OYQ A;  3OGC C;  1MMD A;  3UMK A;  3T1Y O;  5CBH A;  1LR1 A;  2ADP A;  2WLN A;  5JSL A;  3UNG C;  4O2B B;  1Q0G A;  4L8J A;  2Y39 A;  4U9D A;  3DC6 A;  3QW1 A;  5HSW A;  5B1O A;  4U5F E;  4EFE A;  3CWB H;  2JVD A;  3E2E A;  3TK0 A;  2KB1 A;  4LCU C;  5A6J A;  1QQC A;  1VK5 A;  3CRC A;  2C2A A;  4IRU A;  2HSQ A;  4P9T A;  2A69 F;  2FML A;  2PUS A;  2RMK B;  3O55 A;  1M56 B;  2XAS A;  3A2F A;  1VB5 A;  3DWW A;  1M2V B;  2EIJ B;  4WFH A;  4DR4 O;  1IXM A;  3LUT B;  3D36 A;  3LDC A;  5DQZ A;  1NS1 A;  3PDM P;  3S3W A;  4K8Z A;  3JAR A;  4R32 A;  3ZHS A;  1KKC A;  1Y4C A;  2UUI A;  4CBE A;  1I5Y A;  3K08 A;  4JI4 B;  1V55 B;  4W8P A;  3EZH A;  3SJQ C;  1RSO A;  2ZE8 A;  3VBB A;  3IEE A;  3CB2 A;  3SYC A;  5LOV A;  3VM6 A;  1MZE A;  1C03 A;  4X89 A;  3RWR D;  2OCC B;  1VIB A;  4I4T B;  1R6K A;  2WAM A;  2ZDI C;  4X20 A;  4TV9 A;  1TR2 A;  4CC5 A;  2J8W A;  4KXR A;  4BJ1 A;  2CE4 A;  2WPD G;  3RYC A;  3UO2 A;  1Y6X A;  3RYH A;  4FLW A;  1MAB G;  4MTX A;  1U89 A;  2L9J A;  2HP8 A;  3CCR V;  3B77 A;  4BW9 A;  4GKK B;  4JPR A;  3OWT A;  2YL1 A;  4JRZ A;  2RSE B;  2IJH A;  5GON A;  4CSA A;  5BQI A;  2OEX A;  3MBG A;  3CS5 A;  2JEX A;  4K3A A;  3I4U A;  4UCO A;  4JEB A;  2YLD A;  3NG1 A;  2JPU A;  3B0P A;  3JCU Q;  5L3C A;  4QI2 A;  3L71 H;  4NTX A;  1H38 A;  4LF7 O;  3ZVR A;  1QBZ A;  1CGO A;  3JSN A;  2V26 A;  3OEH G;  3TGU H;  1FFT B;  3NMJ A;  2Q68 A;  3H1H H;  3TD7 A;  3HKE A;  1GGQ A;  4PJN A;  4K7B A;  1B68 A;  2O9X A;  5KAF Z;  2HG5 C;  1W2B U;  1QQ3 A;  1ZSP A;  2V7Q G;  2R02 A;  1RKC A;  3JD3 A;  3C62 A;  1IZ3 A;  1RPO A;  1E85 A;  1R3K C;  3TUL A;  1Q6H A;  1KD1 W;  1CEZ A;  4LWS B;  1IXB A;  5EC2 C;  3G4Z A;  5LA6 B;  1PL0 A;  2Y4U A;  4WFF A;  4HNA B;  3FYI B;  1S72 V;  4FLT A;  2X0L A;  2KC3 A;  4KC9 A;  5JVD A;  4DV7 O;  4PA9 A;  5A6B D;  1NU1 H;  3CJH B;  4LF7 B;  2NUP B;  3HNI A;  2W6J G;  3T4R A;  5CA0 A;  4JZG A;  3RBZ A;  2P7V A;  4ZI7 B;  3L9D A;  2CDY A;  2QA4 V;  1FYJ A;  3U0C A;  1E83 A;  1PP9 H;  3AG1 C;  4LLC A;  4J9Z B;  4ZOL B;  4F6R B;  3PMR A;  2DGJ A;  1QPU A;  5EYP B;  1I08 A;  1MNG A;  1VF6 A;  5FZT A;  3ZTM A;  4DR3 O;  3ZN1 A;  3VF0 A;  4X1I B;  2YLI A;  1NH2 B;  5F28 E;  4HYO A;  4NKG B;  1Y74 B;  2OKU A;  3ZSU A;  3W7X A;  1LUV A;  4I5S A;  4JEA A;  1KU9 A;  5DS4 A;  3U2L A;  1O3U A;  2XS1 A;  2F22 A;  4O4I B;  4KFM A;  1EI7 A;  1ZTE A;  2AHY A;  3ZX6 A;  3RQG A;  1NTZ H;  3HNL A;  3ZIA G;  1N36 O;  3CC7 V;  3EFF K;  2BCC H;  1C02 A;  3W2W A;  5GW7 A;  1YLM A;  3I56 V;  1EN5 A;  4Z9H A;  2BTO A;  1OW6 A;  1VLS A;  4O2A B;  2C04 A;  2ADQ B;  4CIH A;  1GAX A;  3KL4 A;  2L7A A;  1AJQ A;  1GKF A;  4LP8 A;  3THO A;  3MDS A;  3FDQ A;  5L3V A;  4DR3 B;  1LI5 A;  1FXV A;  4AL1 A;  2JGD B;  3L70 H;  2KSD A;  2X6A A;  1PD3 A;  1WPX A;  4H37 A;  4ULV A;  4D4X A;  2Q73 A;  4JAS A;  1I5N A;  3E83 A;  3UMH A;  3H2V A;  2BE3 A;  2MHR A;  5COG A;  3FAP B;  3GOR A;  4BW5 A;  1VQ5 V;  4J10 A;  1Q5O A;  4DV1 B;  1YEW A;  3T4Z A;  3RT3 C;  4ZIB A;  5JCO C;  5CA1 B;  2LQT A;  4GYC B;  2ZD9 A;  3ZQV A;  2QWR B;  3OT7 A;  2BOB C;  2XTA A;  1FR0 A;  1AR5 A;  3OFN G;  1AVM A;  4YL0 A;  3ETQ A;  5B1N A;  4ZKI A;  1HNZ O;  3FOP A;  1E2X A;  4UCU A;  2PI4 A;  3IJ4 A;  2R7R A;  4IYH A;  2KGO A;  5B3I A;  2Z3Y A;  1U6H A;  3ABL C;  4PV1 B;  1HNW O;  1XQ8 A;  4R7C A;  4DK1 A;  1FAP B;  4JI0 O;  4KUM A;  5JRA A;  4XDJ A;  5DLJ A;  3AG3 B;  4C7O A;  5E1A C;  5JH7 B;  1N4C A;  3MLG A;  1K5S A;  2CUG A;  4Q7C A;  2B1G A;  5H5N A;  2ZR2 A;  2JX0 A;  3IQ6 A;  2R9I A;  4AE4 A;  1WGW A;  4U3J A;  1DOV A;  1PD0 A;  3ZN0 A;  1TVK A;  1KEC A;  4OXS A;  1JAF A;  1BS3 A;  3JAM N;  1ORQ C;  3K9S A;  4EEQ A;  2JK5 C;  3ETG A;  4GCZ A;  3C8G A;  3L1M A;  3SNH A;  2VC9 A;  1MMM A;  4D7T A;  1ZWI C;  1ZHW A;  2QR4 A;  1AI7 A;  3C3S A;  1HNZ B;  2Q9L A;  1F4M A;  2XLO A;  4OIP F;  1RJ9 A;  1FKA O;  2KQX A;  4UVC A;  1VQL V;  4NTW A;  3K1I C;  3DC5 A;  1E84 A;  2IM8 A;  3EFO A;  4DV4 O;  4MVM A;  5KHH A;  3H1L H;  3X2Q B;  1VQ9 V;  2Z15 A;  1GM7 A;  4N21 A;  3QG5 A;  2NUT B;  5JLI A;  3E8B A;  3L74 H;  4B7E A;  3HKB B;  1BBH A;  3NYM A;  2JGU A;  4U3F H;  2RN9 A;  2PX3 A;  5H2F Z;  2OIG A;  3EG9 B;  2CDQ A;  4Z1V A;  1X59 A;  4PA6 A;  4M63 A;  4OIN F;  1AIL A;  4RWU A;  1MZF A;  5CBF A;  1FMV A;  3E70 C;  4YL1 A;  2P22 C;  1VQ7 V;  3TK1 A;  1BQ0 A;  1MMG A;  3U2M A;  3CCL V;  1ZVZ A;  3SJB C;  1VQ6 V;  4JV5 B;  1P84 F;  2HJ3 A;  2YZS A;  2GHY A;  3U0Z A;  3ZMV A;  4DYL A;  3IQ5 A;  1WB8 A;  3FAV B;  4LR3 A;  4DUZ O;  1XWJ A;  5H9C A;  1O87 A;  1HE1 A;  2EIN C;  3SXZ A;  4E4E A;  1HMD A;  1DF5 A;  1QVG U;  3K04 A;  2KG7 B;  3MYF A;  3TJ6 A;  1RM1 B;  5LXT B;  1K4C C;  4FMT A;  1BZK A;  4DV4 B;  2QLA A;  2WVO A;  1QKR A;  3A0H Z;  2VQF O;  1VF7 A;  2XLV A;  4PA3 A;  1SQV H;  4LFC O;  2EJR A;  1NVP D;  5J2T A;  3EZI A;  1OXK A;  1LI7 A;  3BA9 A;  1NSG B;  3LAY A;  2UUC O;  2BSK B;  1XZP A;  4RQF A;  5L0I A;  2CK3 G;  3DMD A;  1YIJ V;  3AG4 B;  4PA7 A;  4I9W A;  3ZJZ A;  4LF5 B;  2GSM B;  5ITZ B;  1LPE A;  1UPG A;  1A0B A;  1RKE B;  2NSG A;  1VMG A;  2YQY A;  4GKJ O;  1M4U A;  3FOO A;  1JA8 A;  4GZR B;  3WU2 Z;  3AK2 A;  2W0X A;  4I55 A;  1AR1 B;  2GDC A;  3QMK A;  1G6U A;  4CS9 A;  2KK1 A;  4A4A A;  1Y76 A;  4DUZ B;  4TV8 B;  2H3O A;  3FVY A;  2HHH O;  1F4N A;  4JVS A;  4RAI A;  4UDV A;  3CCE V;  3EHN A;  3K5M A;  4OD5 A;  2KNH A;  4BJ6 A;  4JW1 A;  4LFB O;  3L72 H;  5AC5 A;  2MYS A;  4F4B A;  4IYI A;  1GS9 A;  3SXK A;  1XRE A;  5JQG B;  2YXY A;  2CTR A;  3JTL O;  5C93 A;  4A5U B;  4ONS A;  4P9F A;  4PDV A;  5CI8 A;  1Q43 A;  2EZO A;  2Q8V A;  1NFN A;  4DR2 B;  4DR5 O;  3JAT A;  3POV A;  3UGP A;  5JJE B;  1Z5V A;  4JYC A;  4G27 B;  2J46 A;  1KYO F;  1XUQ A;  1NFO A;  1NU7 D;  2XL4 A;  4HE8 D;  2L81 A;  2ZXP A;  3M8A A;  2XLE A;  5A9G A;  2IXN A;  3JAW B;  3RYF A;  3AJM A;  1B6Q A;  3ABM C;  1K5Q A;  3K5L A;  2HZ8 A;  1QZX A;  5IY5 C;  4LNU B;  5T3W A;  3DAF A;  1NKD A;  2ZIM A;  2QSA A;  5IJ0 B;  2EPO A;  4ASU G;  4JZ2 A;  3CC4 V;  4JYA O;  3DXR B;  3Q4H B;  2BTQ A;  1N0J A;  3ABK B;  1TUB A;  1D1B A;  4ZLD A;  1YZB A;  3VQX A;  3H1I H;  4LFB B;  1LS4 A;  3B40 A;  1D5A A;  4AK9 A;  3ZMZ A;  3DTU B;  3JAK B;  4B08 A;  2DWE C;  4JCZ A;  4NVP A;  4UCS A;  4CDA A;  2QTO A;  5JUA A;  3T6J A;  4JAV A;  4EHP A;  5E2Q A;  3MAQ A;  4O4H B;  1IDS A;  4C7U A;  1DK1 A;  3D3I A;  5EBL C;  3KKB A;  3GEE A;  4IHJ B;  4G7O F;  5K1P A;  2UXB O;  4DXW A;  4HEA J;  3U9J A;  4N06 A;  5B5E Z;  1NU9 C;  2UUH A;  4DRX A;  4UCT A;  3W7U A;  3QVY A;  3CE2 A;  4QIW F;  4ICG A;  4ZHQ A;  3DJN B;  1U0B B;  2YEV B;  1LE4 A;  3SDL A;  3HTK C;  2L35 A;  4JYA B;  2N74 A;  1YTF D;  4PJM A;  1K4D C;  1RFY A;  4TWK A;  3DKA A;  3AGU A;  3M79 A;  1VQM V;  2Q7R A;  2ZNJ A;  3B09 A;  1Y66 A;  4DRH B;  2W0F C;  5LHG A;  1W2W A;  3D8C A;  1M1K W;  1FPO A;  3D36 C;  1G4Y B;  1YJW V;  3EHB B;  1ZU5 A;  4GEH A;  1L1F A;  1J95 A;  1Q82 W;  4UV8 A;  3CXC U;  5L0D A;  1RMV A;  1Y4M A;  1GO3 F;  1FAF A;  2R9R B;  2OEV A;  1HR0 O;  3U11 A;  1T9K A;  3JCU Z;  3TJT A;  3ZIB A;  5LMU O;  4TUY A;  1YCI A;  2P6V A;  3TOM A;  3UM7 A;  4PAC A;  4I50 A;  4JYB A;  3JT1 A;  4DRI B;  1SF9 A;  3WOD F;  3EH2 A;  1NI8 A;  2ZR3 A;  2WLL B;  4IIJ B;  3SPC A;  3OEO A;  1M2O A;  4DO2 A;  2UXB B;  2M7W A;  2L6H A;  4O4J A;  5CBG A;  2BOC C;  2KKW A;  1N34 B;  1JMW A;  5L0J A;  4LF9 O;  3E9V A;  1ZW2 A;  1KU2 A;  1TQG A;  3U8V A;  3PN1 A;  4U5H A;  3H9V A;  1R3L C;  1I7F A;  5B3S C;  4CDV A;  4CH4 A;  4YJW A;  2ATK C;  1D2D A;  4I1M A;  1P4R A;  5BMV A;  1FS0 G;  2EIK B;  4EWC A;  5A6A A;  1ZHX A;  1M57 B;  4DV5 O;  4W4L A;  4LF4 B;  1W59 A;  3EGD B;  1PM9 A;  2HJD A;  1SMY F;  3F47 A;  3R7C A;  4J7T A;  1YF2 A;  1KQS U;  3AK1 A;  4K35 A;  2VCA A;  3KYI A;  1WAZ A;  3OTO O;  4HFF B;  4YXW G;  4XWJ A;  5IJ9 B;  3ZDL A;  4A2N B;  1QLE C;  2IBZ H;  5GPG B;  2GUZ B;  4K0K O;  2IH1 C;  2E74 B;  1SA0 B;  1HR0 B;  4XPW A;  5LHH A;  1OCZ C;  2FAP B;  4X1Y B;  4I0X A;  1YA7 O;  3LES A;  2AHZ A;  4OIO F;  2DWD C;  2DW4 A;  3LSQ A;  2QM7 A;  5LP6 A;  3C8Z A;  2ZNI A;  1ZYR F;  1WB7 A;  1OZ0 A;  2W45 A;  3BHP A;  2F93 B;  2Q6A A;  3JAS A;  2XOK G;  2XAF A;  2OU6 A;  2L6G A;  3DZA A;  4LF9 B;  3SYQ A;  2CNW A;  1BGY H;  1YZA A;  2OCH A;  1K3E A;  3RVY A;  4WAB A;  4NC3 A;  1WPB A;  4P9O A;  1CXZ B;  4O2B A;  2OQM A;  3RYI A;  5E3C A;  3KG2 A;  3OD4 A;  4JI2 B;  1SQP H;  4MTO A;  1OCO C;  3SXY A;  1S77 D;  2F95 B;  4R50 A;  4RO2 A;  3S28 A;  4R8C A;  4CX9 A;  1FTS A;  3K03 A;  2VQE B;  1WWP A;  2J0W A;  1Z3I X;  2NR5 A;  2PBE A;  1DF4 A;  4DV6 O;  1M2V A;  2PF4 E;  3Q6N A;  2QWN B;  1QLN A;  1VF6 C;  3WG7 B;  1SZX A;  3C7J A;  1EA8 A;  2YIB A;  3GEI A;  5LHI A;  3V5Z A;  2UUA O;  1MNE A;  2PP4 A;  2PTM A;  2C03 A;  1JPN A;  2ETN A;  3K59 A;  1M6T A;  1ARO P;  3ICX A;  4YJ3 B;  3S29 A;  3RQF A;  3NXS A;  1BHB A;  2ZXR A;  1K34 A;  4J80 A;  2HSB A;  1NR1 A;  1H2G A;  4I4T A;  4U5C E;  3F5W C;  4NTY A;  3ETE A;  4MW3 A;  5IYZ B;  3K58 A;  3U9M A;  5BUO A;  2WA4 A;  2Y69 C;  3A0R A;  4AIL C;  2R05 A;  1DLB A;  1AB3 A;  3OUF A;  1Q7Y W;  3CC2 V;  4GYT A;  1FXH A;  3STL C;  2A9H A;  2OWO A;  5KUK A;  2QJ1 A;  5IT9 N;  2OTJ V;  1NZE A;  3KMI A;  1O9H A;  3U8P A;  4GX1 A;  4U7O A;  4YIO A;  1P7B A;  4RD9 A;  2A79 B;  2YI9 A;  3QVZ A;  2UU9 B;  3SJC C;  3E8F A;  1H2M A;  3H01 A;  4DV6 B;  1YVI A;  1G1X B;  4I9Q A;  3AG2 B;  3B9Q A;  3CRA A;  2EIM B;  1FXK B;  3JD4 A;  3ASO C;  2LO1 A;  2UUA B;  4MVS A;  1C17 M;  5DS6 A;  2IH3 C;  2ITD C;  1QNM A;  2IJK A;  4X62 O;  1V54 B;  3QW0 A;  1Q6U A;  3FB7 C;  4RUE A;  4CH3 A;  3LNN A;  4JI7 B;  4KHP O;  2A06 H;  3T1Y B;  2A0L A;  1E86 A;  1YDX A;  4FM1 A;  1YAU O;  3RKO F;  3HB3 B;  2P0N A;  4TQF A;  2XHB A;  1R3J C;  5KA6 A;  5B66 Z;  1PPJ H;  4LWS A;  3O39 A;  3ZHR A;  4HNA A;  4I1O B;  2DI3 A;  1E79 G;  3PJS K;  1VP7 A;  5LBQ A;  3CSK A;  4B3R O;  4DK0 A;  1GN6 A;  1G4U S;  4EB6 B;  3SXM A;  5JWP A;  1F7Y A;  4E17 A;  5KYU B;  5KX5 B;  1P49 A;  3CJH A;  1EN6 A;  3K5O A;  2NUP A;  2K9P A;  3LNM B;  1THZ A;  2P61 A;  3QZC A;  4DR4 B;  2HKO A;  3G6E V;  4PDM A;  2LGQ A;  4EIY A;  4AI8 A;  5C8Y B;  1GH6 A;  4GX0 A;  2ASR A;  3HLZ A;  4LC1 A;  4CIP A;  1MA1 A;  3MHH C;  2Q5Z A;  2WLK A;  4X9Q A;  4JJF A;  1KC8 W;  2Q69 A;  3FB6 C;  1JPJ A;  2ARH A;  1GN2 A;  4ZOL A;  5EYP A;  1QR8 A;  2KW3 C;  2V3C C;  1HNX O;  4KHP B;  2QE9 A;  1KTM A;  1F23 A;  3KPH A;  2Y48 A;  3WB2 A;  3ZRW B;  5COM A;  3P30 A;  1T6Q A;  2H94 A;  4X1I A;  2VAS A;  1BT8 A;  1A41 A;  3CP1 A;  1JR8 A;  4PI0 A;  1GM8 A;  1QU7 A;  4OIQ F;  1EZV H;  3AG7 A;  1Y74 A;  1ZL8 B;  1PD1 A;  2HV6 A;  2KYH A;  3K57 A;  2J45 A;  2ZE5 A;  2PNO A;  5CB4 A;  4JE9 A;  2JJ2 G;  3T1C A;  2Z5U A;  4AQY O;  3B29 A;  5B1A B;  2R25 A;  2YI8 A;  3JAR B;  2FB5 A;  5IWA O;  2A0U A;  2EIL B;  2Q3T A;  3K0G A;  4TSF G;  2DJV A;  4UB8 Z;  4LH6 A;  1NT2 B;  3UT5 A;  1S7Z A;  4OIR F;  5BZB A;  3LS0 A;  2Y3D A;  2WLM A;  3CAX A;  4Z1M G;  1UFI A;  1GM5 A;  3G80 A;  2MWQ A;  5LMN O;  5CI9 A;  3VQV A;  2BC5 A;  3E8H A;  2BE5 F;  2X0C A;  1O5H A;  2M6Y A;  4X20 B;  4LAC B;  5D91 A;  3RQE A;  1S05 A;  3LDE A;  4BIO A;  4W8K A;  1Q0D A;  2CGE A;  2B1I A;  1BR2 A;  4O2A A;  4QGP A;  5L3D A;  4BIZ A;  1HNX B;  3ZBH A;  1NLX A;  4DJ9 A;  3SYA A;  2DYR B;  5F2V O;  4DW1 A;  2ZT9 B;  2JGD A;  2XLM A;  2WLI B;  1H2K A;  2WA3 A;  2UXN A;  2XXA B;  3K9A A;  4LBE C;  1W0J G;  4LDK A;  1L0L H;  1OCC C;  1YIT V;  2P6J A;  2VS0 A;  3FX7 A;  3ZC4 A;  4FWV A;  1XL4 A;  3ZMU A;  4O6M A;  2QE7 G;  5IE9 A;  2DB4 A;  1J8M F;  5DVW A;  4BEJ A;  4U5B E;  5IWA B;  3US6 A;  3T4D A;  2D4U A;  4HBN A;  3DSQ A;  4WCE V;  5CA1 A;  1G5Z A;  4DV7 B;  2R7V A;  2FYU H;  1D1A A;  3HNJ A;  5LMN B;  1AEP A;  2FFH A;  4JC7 A;  2RNB A;  1UG7 A;  4D6T H;  2P4K A;  1SC5 B;  5B1B C;  1D0Z A;  2HVJ C;  4WFE A;  1ORJ A;  4JJG A;  1XNR O;  3C8G D;  1VQO V;  1YHQ V;  1R3I C;  3ASN C;  4X66 O;  4MS2 A;  2IBF A;  1KKD A;  5J2U B;  4Q4Z F;  1AVO B;  1K04 A;  1GQA A;  1M5I A;  1IBK O;  4FAP B;  1BE3 H;  5F5F A;  1PL4 A;  1YZC A;  5TJ5 E;  2ZKO A;  5CIV A;  1MOF A;  2IU0 A;  1SQB H;  3K7D A;  1TGO A;  4UFZ A;  4J7Z A;  2D2C B;  2JS3 A;  3E8G A;  2F4V O;  1JPX A;  5JH7 A;  4J7J A;  1GK9 A;  3FMS A;  4CS9 C;  3H1J H;  2VWK A;  2YHS A;  2LSE A;  3HJC A;  4BJ6 C;  4FZ0 A;  1OCR B;  1T6U A;  3T6G B;  1WJZ A;  2HV7 A;  5FLX N;  4JI1 O;  1OQC A;  1XZQ A;  1Z5Z A;  2RD9 A;  1RPR A;  3JYC A;  4NY3 A;  1XI1 A;  2P5O A;  3SYN A;  3FXH A;  4CBC A;  1BCC H;  3ATP A;  1YSC A;  1N36 B;  3Q7L A;  3N2G B;  3KKY A;  5LL6 Y;  1OW8 A;  4X66 B;  4E7Z A;  3HKD B;  3VRC A;  3W8H A;  2AWY A;  3ETD A;  1TA8 A;  4Q6G A;  2UUB O;  2DYS B;  3QTC A;  1BR4 A;  3IC9 A;  2W6I G;  1IBK B;  5L0H A;  2AP3 A;  4NQF A;  4DW0 A;  2GTA A;  4FLV A;  4G78 A;  1AUE A;  2NUT A;  1OJH A;  1JQ0 A;  4C3B A;  3HKB A;  1MMN A;  4ER9 A;  4FM0 A;  5L0G A;  2VWJ A;  1JX9 A;  4O4L B;  4J9Y B;  2F4V B;  1ORY A;  3CME V;  3EG9 A;  4XPX A;  3ZQY A;  2J9U A;  1WA8 B;  5T1D B;  2V1D A;  1O9G A;  4UUJ C;  5HFM A;  4OPA A;  3ZHV A;  2PFD A;  2K1E A;  1PNK A;  2GAQ A;  3P3N A;  3VYW A;  5DED A;  4JTD B;  3CMA V;  3B8N A;  3F7V C;  4JI1 B;  1U97 A;  3JYH A;  3ZED A;  2XL8 A;  3ZMS A;  1XNQ O;  4DVY P;  1SRY A;  1M90 W;  3FAV A;  2CH7 B;  5BXZ A;  2R7T A;  1K33 A;  3ASO B;  3T2M A;  3L75 H;  4Q5S F;  2R7O A;  2KG7 A;  1QVX A;  4C3D A;  3HPL C;  1FFX B;  4P6I C;  5LGU A;  5LXT A;  5EHH A;  4Z9J A;  2NNU A;  3VOU A;  1VQ4 V;  1ENV A;  2J9B A;  2UUB B;  4X64 O;  1HMO A;  2UXC O;  2I15 A;  3W8I A;  3V5X A;  1PNM A;  5IYC O;  3VQY A;  4RUF A;  2XAQ A;  4UXN A;  2CTQ A;  2QY9 A;  2LGW A;  2WL8 A;  2J9V A;  2XRH A;  2ETS A;  1HNW B;  4IL6 Z;  3BPZ A;  2BSK A;  1Q81 W;  3CZ6 A;  4K8X A;  3GEH A;  4CS3 A;  4JI0 B;  3D3Q A;  3C3T A;  3QNE A;  4FFB A;  1BR1 A;  1F1M A;  5ITZ A;  5KHI A;  2QTV A;  3SPH A;  4E18 A;  3FD9 A;  4YT4 A;  2LW1 A;  2ZXW C;  1K40 A;  1HW1 A;  4J30 B;  4ABM A;  4XDL A;  4FM2 A;  1DTO A;  3T1H O;  4LFA O;  2ZM6 O;  2FGY A;  2JRI A;  5D92 A;  1HY5 A;  1TWG A;  4UCR A;  4CC6 A;  4TV8 A;  2ZE6 A;  2F1M A;  1KB9 F;  1YXB A;  3GWN A;  3DM5 A;  1S76 D;  2DQ0 A;  1US6 A;  3LSU A;  1T5O A;  2RCV A;  1VLT A;  2R7S A;  3MD0 A;  4X64 B;  4KI2 A;  5JQG A;  2HFE C;  1TUE B;  1OKK A;  3W7W A;  1GN4 A;  1KP2 A;  2FKX A;  2IW5 A;  3F5T A;  1LE2 A;  3IGA C;  5DQT A;  3P32 A;  4CS8 A;  3AEI A;  3EQL F;  2L6L A;  2Y3H A;  4CH6 A;  1R73 A;  3CRM A;  2YUA A;  3KCX A;  1R5I D;  3FKS G;  3B8M A;  2XUM A;  1TKN A;  2YRF A;  4YN0 B;  4YJ2 B;  2Q9B A;  3QO5 A;  1LKX A;  2HMZ A;  2P1A A;  1A7D A;  3T1H B;  3KCY A;  3J80 N;  4LFA B;  1BHA A;  3JAW A;  3T6B A;  5L3F A;  4LNU A;  1RJ9 B;  5IJ0 A;  1OV9 A;  3FB5 C;  4MVQ A;  1JOY A;  2VCB A;  1GMG A;  3Q4H A;  5K1X A;  4U5G A;  4TOI A;  3ABU A;  2IXP A;  2QWP B;  3ZMT A;  3C63 A;  1SQF A;  2WZL A;  4NXM O;  2ILM A;  3RF3 A;  2ODM A;  2A7W A;  4N6H A;  2GDS A;  2WSS G;  1Z23 A;  1LUW A;  1NBB A;  3LNR A;  3ZG1 A;  5KMG B;  2YID A;  2WVQ A;  3EVK A;  1WP7 A;  3UO3 A;  3JAK A;  1Q6I A;  3R65 A;  1JJ2 U;  1Y6D A;  5LP6 C;  3AG1 B;  4Q20 A;  2E75 B;  2VQF B;  3UR3 C;  3QVN A;  2ZQM A;  4O4H A;  4LFC B;  5KYY B;  2HUJ A;  1URF A;  5KYN A;  3OTF A;  4EBJ A;  2YL3 A;  2UUC B;  2G3V A;  4IHJ A;  2IJI A;  5A2Q N;  1ZW3 A;  2YLG A;  4WJ0 A;  4YT2 A;  2QUP A;  3BEH A;  1SER A;  1H6G A;  5KYW B;  1I0H A;  4GKJ B;  3S84 A;  4PA4 A;  3ZRX A;  3ECS A;  2YEV A;  4JI3 O;  4D7S A;  3CCS V;  3O65 A;  3IAY A;  4PJ0 Z;  3E89 A;  4AL0 A;  1JVM A;  1QR9 A;  2VH3 A;  1PKX A;  1BZ4 A;  1M56 C;  2HHH B;  3S90 A;  1FMW A;  1T5E A;  4BIU A;  1LS1 A;  2EIJ C;  1Q0F A;  2GFH A;  1D0X A;  2IJJ A;  3HKC B;  3JSL A;  4EBB A;  3NKD A;  3NMI A;  4GX2 A;  4IJJ A;  2H8P C;  1VYI A;  1V55 C;  5EBW C;  1W0K G;  4BPM A;  3DGE A;  4WFA V;  3CX5 F;  4I55 B;  1N8R W;  4XEF A;  4DR5 B;  1AP5 A;  2OCC C;  2WLL A;  4IIJ A;  2WLH A;  3T9O A;  1AI5 A;  2VCC A;  2LFD A;  5FL7 G;  3VQW A;  4O6N A;  1IW7 F;  2LIG A;  5J9P C;  4KBL A;  4JI3 B;  2XLH A;  3NYL A;  3OA1 A;  2RQ6 A;  2YC0 A;  3C18 A;  1AP6 A;  2QKA A;  2PZS A;  4DUY O;  2NG1 A;  3AQB A;  1CPR A;  2P7T C;  1IBL O;  3K66 A;  1H8E G;  1N33 O;  2CNW D;  4WBN B;  4NYK A;  3W2V A;  2B9Z A;  3EGD A;  3EPV A;  2FL4 A;  5L3Q A;  1WN0 A;  2MW2 B;  5IJ9 A;  2OJE D;  4FFK A;  4G0H A;  3CEX A;  2GUZ A;  4WFG A;  1FFT C;  2OJQ A;  2VB6 A;  1SA0 A;  1FD9 A;  3FAJ A;  1NG1 A;  4X1Y A;  4B7K A;  1OW7 A;  4F4L A;  4BG0 A;  3ABL B;  1NBM G;  2JIZ G;  3N24 A;  4N6C A;  5EZY B;  3S0X A;  4UV9 A;  5CMU A;  5L3E A;  1EBO A;  5DS5 A;  3E22 B;  5FCL A;  3EHM A;  4XLP F;  2IU3 A;  2OOC A;  2HJM A;  2RDC A;  2P67 A;  3QO7 A;  2GBO A;  2Y4T A;  3BY6 A;  3UCS C;  2EPN A;  2WB7 A;  1X4T A;  2DMX A;  1N32 O;  2A0B A;  2YIB D;  1YVW A;  2ZIO A;  1IBM O;  2PGG A;  3EGX B;  2M64 A;  2KSF A;  1NVP B;  4PD4 F;  4JI5 O;  1BSM A;  2JEU A;  1XDC A;  4XQ1 A;  4DR6 O;  2Y3G A;  1HWY A;  5FNV B;  3CXH F;  1SYQ A;  4H0L B;  4NXN O;  1TFK B;  3BAA A;  2EPK X;  2AZ2 A;  3C90 A;  3JAL B;  1PCX A;  5LGN A;  2UXD O;  4WF9 V;  4LDQ A;  1I94 O;  2HJF C;  2YWA A;  5BR8 O;  4H33 A;  3JD0 A;  5LGT A;  4JUR I;  3OR6 C;  4YT5 A;  1YYX A;  4DRJ B;  3CYO A;  1GRJ A;  1MSW D;  3TJ5 A;  1VAR A;  3M4B A;  3ZCC A;  1JFF B;  5LMU B;  3SGI A;  4PFP A;  2WLJ A;  2R7W A;  1EZJ A;  2Q7E A;  4CH5 A;  1OXB A;  4GQH A;  3VAY A;  2R70 A;  1K7D A;  2YL7 A;  4YJ3 A;  1Z7Q c;  3CD6 V;  1QVF U;  5LYJ B;  4J7K A;  5DM6 V;  2B0J A;  3BCC H;  3X1O A;  4DBR A;  1R4T A;  4IT5 A;  2YIC A;  1H2L A;  3L8I A;  4N23 A;  3AQC A;  3S3X A;  1F51 A;  1LIH A;  3KYJ A;  2A1D D;  4JIO A;  1HE9 A;  2Y3B A;  5IYZ A;  4CS4 A;  2HR3 A;  1KP3 A;  4UVA A;  4DR6 B;  2EIN B;  1EFR G;  4JKV A;  4DV5 B;  3ZTZ A;  1MMA A;  4Z9I A;  3OUS A;  4FES A;  3OTO B;  1I94 B;  1H9T A;  4LH7 A;  4MND A;  4X1K B;  3K5N A;  1DOW A;  2PYJ A;  1WTY A;  2O57 A;  4X65 O;  4K0K B;  3M15 A;  1VOM A;  4DBQ A;  4PK4 A;  4PFO A;  3UQ8 A;  5EC1 C;  1RCP A;  2L6F A;  4EUK B;  3DJU B;  2AGA A;  3GVM A;  1V4A A;  2J7P A;  4PJJ A;  2ZE7 A;  1FXK A;  4DR1 O;  2CW0 F;  2NN4 A;  2YDE A;  3G71 V;  1AI4 A;  3O10 A;  5HFL A;  4G28 B;  1VMA A;  3JYY A;  5BMV B;  1JR9 A;  1N0N A;  2YXH A;  1APC A;  2XAJ A;  1WOL A;  5GTH Z;  2DN9 A;  1GTO A;  2YL0 A;  1XMO O;  2IXM A;  1BDJ B;  3ZHU A;  3K06 A;  2OIE A;  2ZCE A;  2CTP A;  4JYY A;  1N1C A;  1Q0K A;  5JVE A;  4QPJ A;  2J9W A;  1JRA A;  3N27 A;  4LLE A;  2GA0 A;  4YIP A;  2LQG A;  1ZHZ A;  1NH2 D;  3LDD A;  2NSF A;  4GX5 A;  3CEI A;  1TWA A;  3G50 A;  2E5L O;  1CP9 A;  3ZHT A;  3LEO A;  1KBH A;  2OG2 A;  3W4Y A;  4X65 B;  4EB6 A;  4MSW C;  3K1H A;  4JTA B;  3OMN B;  3BFR A;  5KX5 A;  1YTF B;  4R6Z A;  3JD2 A;  4CS2 A;  4MTG A;  3NKE A;  4YWQ A;  4P2Z A;  5C8Y A;  4O6Y A;  4AX2 A;  1IX9 A;  3RYI B;  3TQO A;  2VRZ A;  1U96 A;  3STZ C;  3OM3 B;  3AG3 C;  2AVK A;  3W7S A;  3J06 A;  2LFF A;  1XMO B;  2AZ0 A;  4BR6 A;  3N2K B;  2PY5 A;  1JJO A;  3RFY A;  3SP1 A;  3G67 A;  3ABM B;  2ICW G;  3LSS A;  3ZRW A;  5KYX B;  5IY5 B;  4GKK O;  4BJ5 A;  1CPY A;  3OR7 C;  1SQQ H;  1ZL8 A;  4RDA A;  4FIP C;  2KQ9 A;  3I55 V;  1COW G;  2QWO B;  3V7O A;  5LA6 A;  1XBL A;  2E5L B;  2QM4 A;  2D3O W;  3RN4 A;  5CA3 A;  2CTW A;  4LER A;  1KMI Z;  3G4S V;  4O79 A;  4JAU A;  3Q7G A;  3CCU V;  3NR7 A;  4IAQ A;  4ANJ A;  4G7Z F;  2HVK C;  4K0D A;  4NTA A;  3CPW U;  1Z6A A;  4XTK A;  3X2Q C;  2EX3 A;  3SPI A;  3UGO A;  1ST6 A;  4IB4 A;  1QHT A;  2HFI A;  5F5H A;  4J42 A;  2HS5 A;  3G4X A;  4QI0 A;  1S5L Z;  4LF8 O;  5EGY A;  4B3S O;  4ZI7 A;  3WAQ A;  3CCQ V;  3B2E E;  2Q4P A;  4X62 B;  4KL1 A;  1HP8 A;  4F6R A;  4GLX A;  2P90 A;  2OT5 A;  2WLI A;  2XXA A;  4FJC C;  3IQT A;  1AJP A;  2PI5 A;  1R6N A;  3BA8 A;  3I5Q A;  3WHN A;  4MVZ A;  2YKZ A;  4TQD A;  1YJ9 V;  4D4N A;  2QWQ B;  5EBM C;  2EPL X;  4PJL A;  3GOD A;  2G38 A;  256B A;  1RM1 C;  4H54 A;  3CQZ A;  5EIB C;  4TT3 G;  4B3R B;  3JRT A;  2BL2 A;  3U5S A;  4E0I A;  3E86 A;  4O4I A;  4DV2 O;  5JJN B;  4FPP A;  4FLY A;  1VTM P;  4JZA A;  1RSO B;  3JSZ A;  5LOV B;  3LLK A;  3JZ0 A;  2HMQ A;  3U10 A;  4LF8 B;  4P30 A;  4NTF A;  1Y67 A;  4B3S B;  2CCY A;  2Q00 A;  5J2U A;  1MQV A;  4TV9 B;  1J8Y F;  2LD6 A;  4OD4 A;  3AG4 C;  1V9P A;  3SJA C;  4H4K C;  1XIL A;  1TWH A;  3RYC B;  1T01 A;  1M93 A;  3RYH B;  5E33 A;  3J81 N;  4LDR A;  3H1K H;  5GON B;  5B3S B;  2H7V C;  2G3K A;  2Q9A A;  3Q6M A;  5KHJ A;  2OTL V;  3ZS8 C;  4DV0 O;  1XEQ A;  3NYJ A;  4AQY B;  5L3B A;  2WVN A;  4CS7 A;  2XT9 A;  1ORS C;  3B71 A;  4OGQ B;  1LNQ A;  3MX3 A;  5AG2 A;  1D1C A;  5A6K A;  3PHF 2;  1QLE B;  3A11 A;  2X7R B;  4DV2 B;  3BVO A;  1NJI W;  3HKE B;  4FLX A;  3APQ A;  1OCZ B;  1MG1 A;  1RXQ A;  2DQ3 A;  1ZUQ A;  4CS8 C;  2EUL A;  1R6T A;  2W9Y A;  4G7H F;  3N2G A;  2Z0A A;  1V74 B;  1K05 A;  2DE0 X;  3HKD A;  3IQC A;  2GV9 A;  5AC4 A;  5KAI Z;  4PDR A;  1OR2 A;  3EJN A;  3O6X A;  3A0B Z;  5CB4 B;  5CN0 A;  3CCV V;  4RQE A;  1K9M W;  2YVK A;  1NTM H;  5EIB D;  2XL6 A;  4XEK A;  2HKV A;  4PI2 A;  4KNV A;  2R72 A;  5BQH A;  2LFS A;  1PV0 A;  1SQX H;  3FFQ A;  3GM2 A;  4O4L A;  2IOQ A;  4DV1 O;  5KHK A;  3UT5 B;  5JVD B;  4QE7 A;  3DAG A;  3CCJ V;  1WA8 A;  3L34 A;  1KNY A;  4DV0 B;  1H2N A;  2A3Q A;  4OX9 O;  1OCO B;  2PYL A;  2G62 A;  3ABK C;  1ZZP A;  4EBK A;  3L8J A;  2YSU B;  1JMK C;  2JJ1 G;  5CA0 B;  2GWW A;  1JOG A;  2E87 A;  4QJF B;  1YA9 A;  1I4Y A;  2AW9 A;  3H65 A;  4J7Y A;  2Y0P A;  2MK3 A;  5H6R A;  2CH7 A;  1VQP V;  1H9G A;  4X0R A;  3CRR A;  4E2L A;  3TOL A;  1WNS A;  3V5Y A;  3CHX A;  2QEX V;  1FFX A;  3BRC A;  2CGN A;  1MND A;  1E1R G;  1XNR B;  3SEO A;  3WB0 A;  4CJO A;  1DGS A;  3QTH A;  2QGN A;  4HAM A;  2HEP A;  1NR7 A;  1ZX3 A;  1SET A;  2UXX A;  4X8A A;  1WAS A;  3M1C B;  4KNW A;  5A6B A;  2ZDI A;  1LVK A;  2AU5 A;  3TXS A;  1OKK D;  2P06 A;  4KP4 A;  2Y69 B;  1I4Z A;  4OPH A;  4Z2W A;  1PNL A;  3RGB A;  4OX9 B;  1HDJ A;  2LP7 A;  3EXA A;  3MYI A;  4YT8 A;  3K33 A;  2JS5 A;  1YI2 V;  3LJB A;  3TCU A;  2QM8 A;  3K3W A;  5T3T A;  2NPU A;  2LK4 A;  4H44 B;  4YK5 A;  2H8A A;  1Q86 W;  1EQ1 A;  3FHD A;  4E0H A;  5COF A;  2XS8 A;  1A7V A;  1QSP A;  2Q7G A;  3ZRS A;  1EKY A;  1AR4 A;  4CJG A;  3AK3 A;  3CRQ A;  5KHG A;  1LM3 B;  4MVO A;  2Q0O C;  5BQG A;  1IVS A;  1IUR A;  5TIS Z;  2XAG A;  4G2K A;  4PHZ A;  1H7I A;  2EJ7 A;  4I44 A;  4DR7 O;  2R9A A;  2KJG A;  3RH3 A;  5IYD O;  3ABT A;  1YAR O;  3M7M X;  3DM9 B;  5E3A A;  4PR9 A;  3O9O A;  5AGF A;  3QO8 A;  4JV5 O;  1D5N A;  3APO A;  4YJ2 A;  2DOS A;  4UVB A;  1WN7 A;  1GM9 A;  1RKE A;  4ZBM A;  2EIK C;  3OE7 G;  4FK5 C;  4BAY A;  1M57 C;  3L73 H;  1FNT c;  2XLD A;  5K0I A;  2XM4 A;  3CCM V;  5KLV H;  2F23 A;  4E7S A;  4MT8 A;  2CAZ C;  3RVZ A;  1XNQ B;  3GWK C;  1ZU4 A;  5DN6 G;  1OR3 A;  3MFN A;  2LCH A;  2WZF A;  1CGN A;  4JI6 O;  5KMG A;  3LS1 A;  4IAR A;  3N0T A;  3OGI B;  3K6B A;  4B3M O;  5FPO A;  2UXC B;  4B3T O;  1B3Q A;  3IC7 A;  4C7O B;  1E1Q G;  4LF5 O;  4J41 A;  4DR7 B;  4L6R A;  1SZI A;  4I7Z B;  1YYJ A;  5A69 A;  5KYY A;  1SES A;  2Y0I A;  2E3C A;  5JP7 A;  4ULW A;  4HFK B;  4AE4 B;  4BJT A;  4U3J B;  2B5U A;  3B0U X;  3OMI B;  1TVK B;  5D5Q A;  1UJW B;  2IXO A;  3C8G B;  2N04 A;  3B4S A;  1WAT A;  3JD1 A;  3TXQ A;  5KYW A;  1YJG A;  3IFX A;  4DV3 O;  4JI8 O;  5HV9 A;  4GUN A;  2Q67 A;  3F46 A;  2TMV P;  2ZM6 B;  4LF6 O;  2IYL D;  3DE8 A;  3U3B A;  2A6H F;  1IZM A;  2F43 G;  3GWO A;  3DXR A;  2CYD A;  1WLE A;  3EFO B;  4P9P A;  4WFB V;  3KH2 A;  2LW7 A;  4JI6 B;  1G8M A;  4NTB A;  3WFV A;  2WWW A;  2ZXO A;  3HKC A;  4MTF A;  4DR2 O;  1SKV A;  3WG7 C;  4EKW A;  4B3M B;  3RIP A;  4B3T B;  1R1B A;  1TFO B;  4FFB B;  4BWA A;  5IYB O;  4BEM J;  1RP3 B;  2X6B A;  4YHH O;  4XDK A;  4MW8 A;  3E35 A;  4I3M A;  4HZ3 A;  4XLN F;  4X88 A;  4U5E E;  1NZ6 A;  3JCZ A;  2QTS A;  3HKK A;  4J32 B;  3ZHQ A;  1OCC B;  1SF8 A;  3SYP A;  1H8H G;  2EZP A;  3F7Y C;  1VYK A;  2X51 A;  2IM9 A;  2F66 C;  3GB7 C;  4DV3 B;  4JI8 B;  2NLJ C;  3NMK A;  3DD7 A;  2E76 B;  2EPM X;  5JT4 A;  2W4M A;  4MVR A;  3BAB A;  3ITF A;  4LF6 B;  3U3F A;  5JCO A;  4YY3 O;  4WBN A;  1YJN V;  3RFR A;  4PEL A;  2QKS A;  2QNL A;  3S9O A;  4NXM B;  3H2U A;  3AG2 C;  4B6I A;  1S0V A;  2R03 A;  5B1B B;  3BRJ A;  3TET A;  3SYO A;  5J2T B;  2EIM C;  1FXK C;  1D0Y A;  3UKM A;  3GWL A;  3ASN B;  3J7A U;  2LJ2 A;  1L8D A;  2A68 F;  2M4E A;  4O7G A;  5D5P A;  2WZG A;  2R7U A;  4YHH B;  2ITC C;  1V54 C;  3OAA G;  3LLI A;  2R7X A;  5EZY A;  5JJJ B;  1A32 A;  5EK0 A;  3AGT A;  5L0F A;  1AI6 A;  3E22 A;  2P4V A;  1SR2 A;  3K0D A;  2AWC A;  1A7E A;  2RJZ A;  3I5P A;  2GTS A;  4NB5 A;  1Y76 B;  4N4W A;  4FZ1 A;  1K92 A;  1T6I A;  4YL3 A;  1L3P A;  1NTK H; 
#chains in the Genus database with same CATH homology
 5L3D A;  1F4M A;  1GTO A;  4BIZ A;  4UVC A;  1VQL V;  3K06 A;  3SYA A;  2DYR B;  1S3J A;  1SZT A;  4MVM A;  3X2Q B;  1VQ9 V;  2WLI B;  1OHH G;  1VQK V;  2UXN A;  1GM7 A;  3K9A A;  4N21 A;  4LBE C;  1W0J G;  4QPJ A;  3E8B A;  3W7T A;  1OCC C;  1YIT V;  1XL6 A;  2P6J A;  1VQN V;  1XL4 A;  3ZMU A;  4PA6 A;  3LDD A;  1NH2 D;  4GX5 A;  2QE7 G;  4CZZ A;  1CP9 A;  4MVU A;  3ML0 A;  5CBF A;  3T4D A;  4MSW C;  4JTA B;  1VQ7 V;  3TK1 A;  3OMN B;  3CCL V;  4WCE V;  1VQ6 V;  1YTF B;  4R6Z A;  3JD2 A;  4MTG A;  4P2Z A;  1M9N A;  2GHY A;  3ZMV A;  5H9C A;  5B1B C;  2HVJ C;  2EIN C;  4WFE A;  1VQO V;  1DF5 A;  1R3I C;  3K04 A;  3ASN C;  3OM3 B;  3STZ C;  2FTK A;  3AG3 C;  1YHQ V;  3W7S A;  1RM1 B;  4MS2 A;  1KKD A;  1K4C C;  4L87 A;  1K97 A;  5B1A C;  3ABM B;  4FMT A;  4PDL A;  3LSS A;  3ZRW A;  5IY5 B;  2EIL C;  2LFR A;  1CPY A;  3OR7 C;  5KUM A;  4PA3 A;  1MOF A;  2EJR A;  2IU0 A;  1NVP D;  4FIP C;  2EBO A;  3E8G A;  1JPX A;  3I55 V;  1COW G;  1GK9 A;  1K73 W;  4RQF A;  2CK3 G;  2X6C A;  1YIJ V;  3AG4 B;  4PA7 A;  4I9W A;  3ZJZ A;  2GSM B;  3OEE G;  4QE9 A;  2D3O W;  1ROP A;  5CA3 A;  3K79 A;  3G4S V;  1OCR B;  4JAU A;  3CCU V;  4JGS A;  1BL8 A;  2HVK C;  1AR1 B;  2DYR C;  3CPW U;  3X2Q C;  1RPR A;  3SPI A;  3JYC A;  3ZRV A;  4CBC A;  4GT1 A;  1YSC A;  3OMA B;  4QNH B;  1F4N A;  2ZXW B;  4RAI A;  3SPG A;  3CCE V;  3CCQ V;  4U7N A;  3ETD A;  4XBF A;  2DYS B;  2W6I G;  2JDI G;  2P90 A;  5KA5 A;  2OT5 A;  2WLI A;  4FJC C;  5C93 A;  1AJP A;  1JQ0 A;  1NQT A;  2PI5 A;  4PDV A;  1QCE A;  2EZO A;  1R6N A;  1JX9 A;  4J9Y B;  3CME V;  4MVZ A;  1S5H C;  1YJ9 V;  4JYC A;  4G27 B;  2V1D A;  3M99 B;  5EBM C;  4UUJ C;  5HFM A;  1I5X A;  2K1E A;  1PNK A;  1RM1 C;  4JTD B;  3CMA V;  4TT3 G;  1AJN A;  3B8N A;  3F7V C;  3E86 A;  1B6Q A;  3ABM C;  1K5Q A;  4FPP A;  5IY5 C;  3ZMS A;  1NKD A;  1JCH A;  1SRY A;  1M90 W;  1K33 A;  4ASU G;  3CC4 V;  3ASO B;  3T2M A;  4P30 A;  3HPL C;  3ABK B;  5LGU A;  2B1I A;  2NNU A;  2XAH A;  3VOU A;  1ENV A;  1VQ4 V;  2HLD G;  3AG4 C;  3ZMZ A;  3DTU B;  5IDJ A;  3FYE B;  5L3G A;  2DWE C;  1PNM A;  5IYC O;  4RUF A;  2XAQ A;  4UXN A;  2QTO A;  1OCR C;  4JAV A;  2XND G;  1BMF G;  5B3S B;  1Q81 W;  5H6Q A;  3SPJ A;  3QNE A;  2OTL V;  3D3I A;  5EBL C;  3FB8 C;  4JTC B;  3SPH A;  5L3B A;  2ZXW C;  1VQ8 V;  1LNQ A;  4DXW A;  4XDL A;  3RW0 A;  1DTO A;  1QLE B;  3OW2 U;  2DYS C;  2X7R B;  3W7U A;  1NJI W;  4QIW F;  1OCZ B;  4QPK A;  3MHS C;  1MG1 A;  2YEV B;  4JF3 A;  1K8A W;  3OGC C;  2DQ3 A;  1YTF D;  5CBH A;  1K4D C;  2WLN A;  4TWK A;  1S76 D;  2DQ0 A;  4PDR A;  1VQM V;  3MD0 A;  1Y66 A;  2W0F C;  5B1O A;  5LHG A;  5CN0 A;  3CCV V;  1M1K W;  4RQE A;  1G4Y B;  1YJW V;  2HFE C;  3EHB B;  1TUE B;  1L1F A;  1K9M W;  1J95 A;  3W7W A;  4UV8 A;  1KP2 A;  2IW5 A;  1Q82 W;  3E2E A;  2KB1 A;  3IGA C;  4LCU C;  3P32 A;  3CXC U;  1Y4M A;  2LFS A;  3AEI A;  1GO3 F;  2C2A A;  2R9R B;  1R73 A;  1M56 B;  2XAS A;  4QE7 A;  3FKS G;  3B8M A;  3UM7 A;  3CCJ V;  4JYB A;  2EIJ B;  4WFH A;  1IXM A;  3LUT B;  3D36 A;  1OCO B;  3LDC A;  2ZR3 A;  2WLL B;  3QO5 A;  3SPC A;  3ABK C;  4DO2 A;  2M7W A;  5CBG A;  2BOC C;  2YSU B;  1BHA A;  2JJ1 G;  1I5Y A;  3K08 A;  1V55 B;  4QJF B;  5L3F A;  3SJQ C;  3VBB A;  3SYC A;  2MK3 A;  5H6R A;  3FB5 C;  4MVQ A;  1VQP V;  1JOY A;  4E2L A;  1GMG A;  4X89 A;  2QEX V;  2OCC B;  3ABU A;  1R3L C;  1R6K A;  3ZMT A;  5B3S C;  2WAM A;  1E1R G;  2ZDI C;  2ATK C;  1P4R A;  1FS0 G;  2EIK B;  2WSS G;  1M57 B;  2WPD G;  3R65 A;  1JJ2 U;  4HAM A;  1KQS U;  1MAB G;  3AG1 B;  4MTX A;  4Q20 A;  4YXW G;  3CCR V;  3B77 A;  4JPR A;  1QLE C;  1NR7 A;  4X8A A;  1SET A;  2UXX A;  2IH1 C;  2IJH A;  2ZQM A;  2ZDI A;  5LHH A;  1OCZ C;  2JEX A;  4KP4 A;  2Y69 B;  1PNL A;  2AHZ A;  2IJI A;  5L3C A;  2LP7 A;  2DWD C;  2DW4 A;  3LSQ A;  2QM7 A;  1YI2 V;  1QBZ A;  1H38 A;  3TCU A;  2QM8 A;  3K3W A;  3OEH G;  1OZ0 A;  2Q6A A;  3BEH A;  1FFT B;  1SER A;  2Q68 A;  2XOK G;  2XAF A;  1Q86 W;  4PA4 A;  3ZRX A;  3SYQ A;  2YEV A;  3RVY A;  1K3E A;  3CCS V;  2HG5 C;  1W2B U;  4P9O A;  2V7Q G;  3E89 A;  1JVM A;  3JD3 A;  3KG2 A;  1QR9 A;  3ZRS A;  1PKX A;  1RPO A;  1M56 C;  1R3K C;  4BIU A;  4MTO A;  2EIJ C;  4MVO A;  2IJJ A;  1OCO C;  1KD1 W;  1S77 D;  1CEZ A;  5EC2 C;  4GX2 A;  2XAG A;  4G2K A;  2H8P C;  4R50 A;  1PL0 A;  4WFF A;  1S72 V;  3FYI B;  4RO2 A;  4R8C A;  2X0L A;  1V55 C;  3K03 A;  5EBW C;  5IYD O;  3ABT A;  1QVG U;  1W0K G;  1DF4 A;  3DGE A;  4WFA V;  1N8R W;  3QO8 A;  4PA9 A;  1QLN A;  4UVB A;  2OCC C;  2WLL A;  3WG7 B;  2WLH A;  1AI5 A;  2W6J G;  1GM9 A;  4ZBM A;  5LHI A;  2EIK C;  3OE7 G;  4FK5 C;  4BAY A;  5FL7 G;  1M57 C;  3RBZ A;  2QA4 V;  1ARO P;  3CCM V;  5J9P C;  3AG1 C;  3NXS A;  1BHB A;  1K34 A;  4MT8 A;  4J9Z B;  1NR1 A;  1H2G A;  3RVZ A;  3F5W C;  2P7T C;  3ETE A;  5DN6 G;  4MW3 A;  3ZN1 A;  1H8E G;  2Y69 C;  3A0R A;  1DLB A;  1NH2 B;  4HYO A;  3OUF A;  1Q7Y W;  3CC2 V;  1FXH A;  3STL C;  2A9H A;  3IC7 A;  5KUK A;  1E1Q G;  2OTJ V;  3W7X A;  4GX1 A;  4U7O A;  4WFG A;  1P7B A;  2A79 B;  4I5S A;  1SES A;  3E8F A;  3H01 A;  4F4L A;  3ABL B;  1NBM G;  2JIZ G;  3AG2 B;  4KFM A;  4UV9 A;  5CMU A;  5L3E A;  1EBO A;  2B5U A;  3OMI B;  1UJW B;  2AHY A;  2EIM B;  1FXK B;  3JD4 A;  3ASO C;  3JD1 A;  2IU3 A;  4MVS A;  3ZIA G;  2P67 A;  3IFX A;  3QO7 A;  2IH3 C;  2ITD C;  3BY6 A;  3EFF K;  3CC7 V;  5GW7 A;  2Q67 A;  3I56 V;  2IJK A;  1V54 B;  3FB7 C;  4RUE A;  1AJQ A;  2F43 G;  1GKF A;  4LP8 A;  1NVP B;  3GWO A;  2A0L A;  1FXV A;  1WLE A;  2JEU A;  4P9P A;  4WFB V;  2X6A A;  3HB3 B;  1PD3 A;  1G8M A;  1WPX A;  4H37 A;  3WFV A;  2WWW A;  1HWY A;  4JAS A;  1R3J C;  4MTF A;  5KA6 A;  3E83 A;  3WG7 C;  4EKW A;  5IYB O;  5LGN A;  4WF9 V;  2X6B A;  2HJF C;  1E79 G;  4H33 A;  3PJS K;  3JD0 A;  5LBQ A;  5LGT A;  3OR6 C;  4XDK A;  4BW5 A;  1VQ5 V;  4MW8 A;  3CYO A;  3E35 A;  4HZ3 A;  1MSW D;  3T4Z A;  4X88 A;  3ZCC A;  3JCZ A;  2WLJ A;  1EZJ A;  3LNM B;  1THZ A;  1OCC B;  3SYP A;  1H8H G;  2EZP A;  2HKO A;  3F7Y C;  2ZD9 A;  3G6E V;  4PDM A;  2BOB C;  3GB7 C;  4GX0 A;  3OFN G;  2NLJ C;  1K7D A;  4LC1 A;  3MHH C;  3CD6 V;  2WLK A;  1QVF U;  1KC8 W;  2Q69 A;  4MVR A;  5B1N A;  3FB6 C;  5DM6 V;  4ZKI A;  1QR8 A;  4N23 A;  2PI4 A;  1F51 A;  1F23 A;  2Y48 A;  3ZRW B;  2HR3 A;  1KP3 A;  2Z3Y A;  3P30 A;  2H94 A;  4PEL A;  4UVA A;  2QKS A;  1YJN V;  3ABL C;  3AG2 C;  3CP1 A;  1S0V A;  1GM8 A;  4R7C A;  5B1B B;  2EIN B;  1EFR G;  3TET A;  3SYO A;  2EIM C;  1FXK C;  4KUM A;  3UKM A;  3ASN B;  4XDJ A;  3AG3 B;  2JJ2 G;  5E1A C;  3T1C A;  2Z5U A;  1K5S A;  3OUS A;  5B1A B;  2B1G A;  2ITC C;  2ZR2 A;  1V54 C;  2EIL B;  3OAA G;  2R9I A;  3K0G A;  4TSF G;  5EK0 A;  5EC1 C;  3ZN0 A;  1KEC A;  5BZB A;  4OXS A;  1AI6 A;  1FXK A;  2WLM A;  1ORQ C;  3K0D A;  2JK5 C;  3ETG A;  4GCZ A;  4Z1M G;  3G71 V;  1AI4 A;  5HFL A;  3E8H A;  4G28 B;  1K92 A;  1ZWI C;  3LDE A;  1AI7 A;  2XAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...