2ZD9A

Structure of a bacterial cyclic-nucleotide regulated ion channel
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
APLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQLVAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
molecule keywords Mll3241 protein
total genus 59
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zd9A02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 2zd9A01
4H33A 1V55C 2DWDC 5EC2C 3E8GA 3SYOA 3T4ZA 3ASNC 3RVZA 2AHZA 4RAIA 5E1AC 3AG3C 3AG4C 3KG2A 3ABKC 2WLHA 3T1CA 4MVUA 1M56C 3FB6C 4QE7A 3LDDA 4R50A 3SPGA 3SYAA 2IH1C 5EC1C 5B1BC 3IGAC 5CBFA 4R6ZA 4GX1A 2EIMC 4LCUC 4RUFA 2BOCC 3JYCA 4PA7A 2HVJC 4MS2A 3FB8C 2NLJC 1P7BA 3K08A 2WLIA 3E86A 3K06A 4MW3A 3RW0A 2ATKC 2WLLA 3TCUA 4CBCA 3HPLC 4I9WA 5EBLC 2EILC 4PDMA 3LNMB 3E8FA 4WFHA 5EK0A 4GX2A 3VOUA 2QKSA 2WLKA 1K4CC 1OCOC 2DYRC 3E8BA 4JTAB 4MVRA 2K1EA 3ABLC 4MVOA 3SJQC 3X2QC 3EFFK 2H8PC 3ZJZA 3SPJA 4H37A 4HZ3A 3UM7A 4QNHB 4J9ZB 4LBEC 3RBZA 4WFFA 5BZBA 4MVQA 2A9HA 1XL6A 2ZD9A 2X6CA 3LDEA 4TWKA 3K03A 3AG2C 3E83A 4P30A 1R3LC 1M57C 3ZRSA 1R3JC 3IFXA 2EINC 2P7TC 4MVMA 4PDLA 5KUMA 1K4DC 3GB7C 2WLLB 4QE9A 2HFEC 2YEVA 3F7VC 4F4LA 5B3SC 4EKWA 3K0DA 2Y69C 3LUTB 2X6BA 3E89A 4OXSA 1OCZC 2Q69A 2WLJA 4PA6A 3FB7C 2ITDC 3STZC 2HVKC 1G4YB 4R7CA 1XL4A 4MTGA 2EIJC 4HYOA 3PJSK 2WLIB 2Q68A 4PDVA 1R3IC 4PA9A 2BOBC 4BW5A 2IH3C 1ORQC 3SYCA 4P9PA 3LDCA 2ZXWC 2HG5C 3FB5C 3ASOC 1ZWIC 5B1AC 3OUSA 4GX5A 4PA4A 3SYQA 2R9RB 5EBWC 5IY5C 1JVMA 5EBMC 4MTOA 4P2ZA 2OCCC 4JTCB 1V54C 1QLEC 3ABMC 4RUEA 2QTOA 4MTFA 4UUJC 2A0LA 5KUKA 2ITCC 2EIKC 4WFEA 3TETA 2X6AA 4DXWA 2DYSC 4X89A 2KB1A 3RVYA 4KFMA 3AG1C 5CBHA 1KKDA 4PDRA 1OCCC 3SPHA 4JTDB 4XDLA 4J9YB 4LP8A 5CBGA 3SPCA 3SPIA 3BEHA 4MVZA 3WG7C 5J9PC 4X88A 3T2MA 3OGCC 4MSWC 4R8CA 2WLNA 1BL8A 4MVSA 2W0FC 3SYPA 3UKMA 1R3KC 2HJFC 2WLMA 4RO2A 4G28B 1LNQA 3K04A 3OR7C 1OCRC 1S5HC 2AHYA 3F5WC 4X8AA 2DWEC 2JK5C 2Q67A 3STLC 1J95A 3R65A 3OR6C 3F7YC 2A79B 4ZBMA 4G27B 4MW8A 3OUFA 4PA3A 3E8HA 4GX0A 4WFGA 4P9OA 4XDKA 3K0GA 3T4DA 2Q6AA 4XDJA
chains in the Genus database with same CATH superfamily
2A0UA 1V55C 2P61A 4FM2A 2AWCA 1KUQA 3EGDA 4GEHA 4DRJB 5B1BB 2L35A 2ADQB 3IJ4A 3CCVV 1M56C 2G62A 3QTHA 4LF5O 4ZHQB 3OT7A 1GM9A 4JPRA 3U5SA 3ZWIA 4GX1A 1YVWA 4UCRA 4HFKB 2NR5A 2R7XA 2KW3C 3FB8C 1V9PA 3DXJF 3W8HA 2WLIA 1YLMA 5LXTA 2UXDO 1YYJA 3L34A 3E8FA 3GVMA 3CXHF 3ZHQA 1WNSA 5AGFA 3ZMSA 1RJ9B 2K1EA 2OCCB 1SZTA 4GT1A 4FLZA 2UUIA 4J30B 3SPJA 4H37A 2KSDA 5H5NA 1ZZPA 1JQ0A 4JYYA 2A9HA 3S28A 2AWYA 3JAWB 3CEIA 1LUWA 1G8MA 2JGUA 3UR3C 4J41A 4WBNB 4E0IA 4QGPA 4DV7B 2AGAA 2YXYA 1OCCB 1XOUA 4MVMA 4U3JA 3C8GD 1YA9A 4ZI7B 1M2VA 3ZIAG 3NKDA 1NQTA 1G1XB 3LESA 4EB6B 2YEVA 3AEIA 4EKWA 3GM3A 2XLEA 4JCHA 4AILC 5HFMA 1RJ9A 3FHDA 3CCQV 2JS3A 2QGNA 3RT3C 3PMRA 1AJPA 5KHGA 3I5QA 3K66A 4B7KA 4JI3O 5DLJA 1PD1A 1YJGA 5BMVB 3IAYA 3VYWA 4P9PA 3ZEDA 1H7IA 3ZG1A 5GTIZ 2J9WA 3PDMP 2YVKA 2WZFA 4E7SA 1KC8W 4I3MA 2RQ6A 1GRJA 2R9IA 3C3SA 3K5MA 4DV0O 1YF2A 3DGEA 5FL7G 2YUAA 2IYLD 4H4KC 1WA8A 4DXWA 1JAFA 3RVYA 4RD9A 4BEMJ 3SDLA 1QPUA 3MYIA 4PDRA 2J46A 3MDSA 4LLCA 3U0CA 2QKAA 4X9QA 3I4UA 2Q4PA 3HKCB 2YQYA 4R8CA 2F93B 1SQGA 1BL8A 5DM6V 1VLTA 2IXMA 5EZYA 4KXRA 4D7SA 3B29A 3ZMUA 1S5HC 2F43G 1TWCA 5IY5B 3RQFA 4ZLDA 1EN6A 1A7VA 4GKKB 1GKFA 1SQPH 1BZKA 1QVGU 4DRXA 5L0DA 4LWSB 2DI3A 3RFYA 3WU2Z 4TOIA 2OQMA 3ZRWB 4LF9O 1U0BB 3CE2A 3M99B 1LI7A 3ZHVA 2N74A 3AG3C 5C8YB 1X59A 3SPGA 2UXBO 4NC3A 3HKCA 4JRZA 4O4LA 4LFCB 1Y4CA 2EJRA 3JYCA 2ETSA 5BR8B 5B5EZ 4G7ZF 4P9TA 2ZR2A 2OOCA 4IARA 1EM1A 1QSPA 1F4MA 2UXNA 4GX2A 4X65O 4GLXA 1AVMA 1HE1A 4DV2O 3WB1A 1KKDA 5LP6A 3S9OA 1AB3A 1GN2A 4BEJA 3JD1A 1SQXH 1B6QA 3SXMA 1PM9A 1U96A 2ZINA 4J7TA 3RGBA 4LACB 1TUBA 4JZ2A 1XMOO 2K9PA 2F1MA 1BS3A 4YN0B 4O4LB 2Q5ZA 2GDCA 3HNIA 1XNQO 2DOSA 5LXTB 1JOGA 3CXCU 1VQMV 4JYCA 3UCSC 3JATB 2HFEC 5LGTA 4RDAA 3JD4A 4DK0A 2UUCB 3JYHA 3RH3A 4U9DA 1K34A 2HVKC 2LGQA 1ZHTA 5ITZB 2YICA 3CRAA 1PL0A 2ODMA 1N34B 3LSQA 1AILA 5LHIA 3T6GB 5LMUB 5FLXN 5LMUO 1VF6A 4U5BE 3P3NA 3US6A 4GQHA 3DC6A 2GAQA 4CH6A 3OE7G 3IQ5A 4E18A 3BA8A 1GM5A 4JYBA 3ZS8C 2PNOA 2WSSG 2YEVB 3N2KB 4FLYA 3BA9A 1NFOA 2OIEA 1D0XA 4AE4A 4E7ZA 4MNDA 2R7WA 1OQCA 2B5UA 3C8GB 4J10A 3K33A 1Z63A 1DOWA 2F23A 2PUSA 4B3TB 5J9PC 3AK2A 4GZRB 3MFNA 5BMVA 1ZW3A 2KQXA 2VQEO 4MSWC 2HLDG 3LEOA 4LF7O 1CGNA 3MLGA 4JC7A 3WB2A 2DN9A 3JRTA 1COWG 3NXSA 1OCRC 1K5QA 1UPGA 4BIOA 5K1PA 2JK5C 4LR3A 4FZ1A 3EH2A 4EBKA 4D6TH 3OAAG 2GUZA 3C90A 4B3RO 4PJJA 2XLMA 1ORJA 2LQTA 1A0BA 1KYOF 4U5EE 1NS1A 1AUEA 2AW9A 2XL6A 5F5HA 4C7OB 3V5YA 5A2QN 1PPJH 1PD3A 2KG7B 1FFTB 2A6EF 3HNKA 5GPGB 3ZHSA 1F51A 2HV7A 4PA7A 3FAJA 3HJCA 2CTPA 2BCCH 2Y0PA 5KYXB 2XUMA 2P06A 5IE9A 1RM1C 3Q6NA 3VOUA 1Z6AA 1HWYA 3X2QC 3E8BA 3B0PA 1ZSPA 2C2AA 3G50A 1UFBA 4QI0A 2ZD9A 3P30A 1JPJA 3LDEA 2B1IA 1VQOV 3AQCA 1RMVA 1IX9A 1K40A 2ETNA 2Y3DA 4JEAA 4CIPA 1N1CA 4WGZA 2UUHA 2HKOA 2M6YA 4LFCO 1XNRO 2EINC 2A3QA 5KYWB 4FM1A 2RCVA 4GKJO 3FAVB 4RQEA 1HNWB 3FX7A 1WATA 3U0ZA 1SETA 3K7DA 2X6BA 5LP6B 1VP7A 1WN7A 3DTUB 3FB7C 2Y3HA 4X1KA 4LFBO 3WHNA 1XL4A 2XXAB 2IBZH 1TWAA 2PF4E 4DVZA 1M93A 4PDVA 4K0KO 4XEVA 4G7OF 1AJQA 1OKKA 2E3CA 2CGNA 1YZCA 4JI3B 2YHSA 4IAQA 2UXDB 4K3AA 2YL3A 3CCMV 4BJ5C 2R9RB 3VBBA 2UUBO 5DVWA 2ICWG 2P5OA 2R7QA 5DEDA 4M63A 2QR4A 3M7MX 3B2EE 1VF6C 3KCYA 1RCPA 5J2TA 1XZPA 1MZFA 3B4SA 4DR7B 3SPHA 1LVKA 2HP8A 4CH4A 3LJBA 1VQ6V 1L3PA 3FOOA 4DV7O 1SKVA 5LHHA 1PL4A 3CQZA 4B6IA 1RKEB 2WVOA 5CI9A 3JCUZ 2B9ZA 2HKVA 4NY3A 5CMUA 3Q7LA 1SS3A 2AHYA 4XWJA 1ZHYA 2R7RA 4K1OA 4XDKA 3DJNB 2X0LA 2B0JA 4CS3A 4AE4B 2QWQB 3TJ6A 4UCOA 3JAKA 4I50B 5EC2C 2Z5UA 2FMLA 1TGOA 3QG5A 1NJIW 4I1MA 4U5HA 1Q81W 4R50A 2H7VC 2IH1C 5GTHZ 1IBKB 1IBKO 1RKEA 4NB5A 2CK3G 5CBFA 3EZHA 3O39A 4O2BA 4R6ZA 4UVBA 4C3BA 3FD9A 3A0BZ 5LA6B 2LFFA 5KHKA 1IW7F 1G8XA 3HPLC 1AROP 5EBLC 2ZR3A 4HNAA 3LNMB 1YIJV 3KKBA 4FLXA 1WWPA 3ZDLA 5HV9A 2DYRC 4E17A 4JI7O 3H1KH 2QDOA 4I50A 4A5UB 1Z3IX 3VQXA 3K03A 5F5FA 2Z15A 4AL0A 4X62O 3AG3B 4DW0A 3DI5A 2EILB 2KGOA 4KBLA 2JDIG 2P6JA 2CTQA 5EHHA 4Z1MG 1OW8A 3JD0A 4PDLA 4JI8B 3CRCA 3LAYA 4QPKA 1DK1A 1ZHZA 3LSUA 4IB4A 3ZMZA 1NBMG 5L3VA 3I55V 3E89A 3UMKA 4B3TO 2WPDG 1T6QA 4EIYA 4G0HA 2ADPA 3BVOA 4FFKA 2OWOA 2HUJA 2WLIB 2WVNA 4OIQF 1CEZA 2XAHA 2KC3A 4FLWA 4JV5B 1ORQC 4JYAO 4JYAB 3KCXA 2A0BA 4JI8O 4LLEA 4XPYA 1APCA 1QZXA 3TOMA 4O4HB 3BY6A 1FFXA 1TVKA 3CC7V 1JR9A 1LR1A 1Q6HA 3HR0A 1GN6A 4DV2B 3KYIA 2B1GA 4RUEA 2EPKX 3AQBA 4DUYB 3CWBH 4A2NB 2VRZA 4DV3B 1SR2A 4X1KB 2CW0F 3WG7C 4JJFA 1HW7A 3TK1A 4X88A 4EB6A 3TXSA 5JQGA 5GONA 2UXBB 3BHPA 1HNWO 2FB5A 3VQWA 2Y4TA 4OPAA 2M4EA 2VCCA 2HJFC 2N05A 2PYLA 3JTLO 4XBFA 4NXMO 1TFKB 3U3FA 4LF6B 4CJOA 5B1AB 2PX3A 2VWKA 1H9GA 4K0KB 4LERA 2YIBD 1QNMA 4BJ6C 3K0GA 1NLXA 3JD3A 3ETGA 2YIAA 1D1AA 3C18A 3GWLA 4JI6O 4XEKA 2CAZC 2FGYA 4X0RA 2NNUA 3VRCA 5CI8A 1O5HA 1KP2A 2P22C 5EIBC 2WAMA 4YJWA 3K5NA 2OJED 2YWAA 2BE3A 5A69A 3BFRA 5EC1C 1GN3A 4OD5A 3IGAC 1M6TA 5JH7A 3CCUV 3CYOA 2EPMX 2YL0A 3CRRA 1W2WA 2GA0A 3PCVA 5JS5A 1GTOA 3O6XA 1LS1A 2EPLX 4JURI 3TK0A 4DR2O 2AVKA 1AP6A 2EIJB 4MVOA 3UT5B 4BG0A 4DV1B 1P49A 3UM7A 2VASA 1M9NA 5KYYB 3U9JA 2XRHA 1BR2A 2OCHA 3T4RA 4LFAO 4DR6B 1LPEA 5JH7B 2JEXA 1SQQH 1DOVA 4ZOLB 3B09A 2W6IG 1H2KA 5E3CA 4LF7B 5B66Z 1K4DC 1Q6IA 4LF8O 4DW1A 3T1YO 1EBOA 3HTKC 2Y69C 4FX5A 2ARHA 5IT9N 2F22A 2UXCB 2IJHA 2ITDC 3PJSK 4DR6O 2PI5A 4OX9O 2CNWA 4Q7CA 1IVSA 1B04A 4I5SA 1URFA 1M57B 3WG7B 4WGYA 3OTFA 2XS8A 2G3VA 3N2GB 1KU9A 3POVA 1G5ZA 4CX9A 3JT1A 4ZOLA 3ZQVA 5J2UA 2LCHA 3IQTA 2R70A 1E83A 3CX5F 1YCIA 4KNVA 4X62B 1ROPA 1TUEB 4BPMA 4DOZA 4RBNA 2YS8A 2DYSC 1GH6A 4JF3A 2PGGA 2Q4FA 1JMWA 4NXNO 5E79Z 3BEHA 1ST6A 4OD4A 3T2MA 3JALA 3H9VA 3QW1A 3SYPA 2EPNA 1R3KC 2IJKA 1WN0A 4JE9A 4GKKO 3D3QA 3DD7A 2LQGA 5LMNB 2DWEC 1E86A 4BW9A 3ZN1A 1TVKB 3AGUA 4BIZA 4PA3A 4CS2A 4WFGA 4ZHQA 1GGQA 3S29A 4X66O 3OMAB 1F4NA 2IJIA 2Y39A 2Y3GA 1E1QG 2L6FA 4GCZA 4J42A 1XQ8A 5B1NA 1AJNA 1ZX3A 1T01A 3O55A 5L3CA 3CRMA 3AK3A 5E1AC 2Y48A 3EHNA 4W8KA 2P90A 1TAEA 4JZAA 1KB9F 5H6QA 1E84A 1NR1A 4UFZA 3JALB 3JYYA 3ZTZA 3J7AU 1LE4A 1FXHA 1R6KA 4R32A 1VQLV 2NLJC 3APQA 1U89A 3JAWA 3UO3A 1GM7A 5LGUA 1AI7A 4WBNA 3K58A 3M79A 1YEWA 3EHMA 4DV6B 1V54B 2QWNB 3EFOB 3EFFK 2H8PC 4DUZB 4JI6B 3ZVRA 4FFBB 2I8BA 4AL1A 1K7DA 1WPBA 2XLVA 2X6CA 2QKCA 4TWKA 1AR4A 1OHHG 4UCTA 3CZ6A 3FVYA 3AG2C 4YT4A 4LNUA 3ZRSA 1R6NA 3T1HB 1JPXA 1WB7A 4JI1O 1S3JA 3KMIA 4YT2A 2PBEA 3SR2C 1QR8A 2J8WA 3AG1B 4PR9A 4YL3A 3R7CA 5L0HA 3D36C 3GB7C 3B8MA 4I0XB 4TV8A 1FTSA 4PFOA 2HJDA 1XMOB 1VB5A 2KG7A 4XEFA 1K05A 1HNZO 1XEQA 4JCZA 2ZE5A 5IJ9A 2QUPA 4HYOA 2BTQB 3EGXB 4QJFB 5BY1A 2Q73A 5TISZ 2E5LB 3SXYA 3ETQA 3GWKC 1WA8B 1GMGA 1Q0DA 1P4RA 2KYHA 4F4BA 1ZYRF 1YXBA 3QMKA 3L1MA 5KYUA 1HW2A 2XOKG 4DV5B 5EBWC 5IY5C 5BR8O 5IWAO 4MTOA 5L3GA 3ICXA 1HNZB 1F1MA 1NTZH 1IBLB 3ABKB 2GTAA 1XMQB 4TV8B 1Y76B 4N23A 3TETA 4BJTA 2G3KA 1SF9A 1GAXA 1ZW2A 4IAOA 1OCCC 4CC5A 5IJ0B 4QI2A 4UV9A 3EPVA 2H3OA 3VAYA 3FAVA 5L0CA 3ZN0A 3RF3A 1H38A 1GO3F 4NQFA 4TV9B 4GUNA 3FOPA 3GANA 4BJ1A 4DRXB 1QLEB 5IWAB 1Q3EA 1SMYF 1OXBA 2HMZA 2JX0A 2O57A 4N4WA 1J8MF 5KYUB 4X8AA 3STLC 5IYBO 1Q0KA 5COMA 1BGYH 3E22A 1YZBA 2P0NA 3U11A 2KSFA 1L0NH 4PJ0Z 2DE0X 2OTJV 1LM3B 1C02A 1YYXA 5CA0B 1N8RW 1CPQA 4KUMA 1WPXA 5L3EA 1SERA 2DWDC 2ZCEA 3JSZA 4KHPO 3SYOA 3SGIA 1Z5VA 3V5ZA 1LI5A 3KG2A 4Q20A 1TFOB 2OJQA 3CCJV 3CAXA 1B06A 1EZVH 2X51A 4LDRA 3IEEA 3EH1A 4N21A 5DS5A 5LYJA 2E87A 1YAUO 4Z9HA 4CJGA 1K73W 3G6EV 5KA6A 2DYSB 1TUBB 2YL7A 3L9DA 4X66B 1TA8A 3TJ5A 1JRAA 2XL8A 3SXZA 5BZBA 1S76D 5LMNO 3UO2A 3VQYA 3ZC4A 1VF5B 4IGGA 4J7ZA 4E2LA 4JV5O 1A7EA 2W9YA 1C03A 2J9VA 3JAKB 1EFRG 1BHAA 4PJNA 5IYDO 4JAVA 4U9EA 4FJCC 1SYQA 1MOFA 3ML0A 4F4LA 2IXNA 5TJ5E 5JVDB 4PI2A 2C03A 3EFOA 1XHZA 2CE4A 2Q69A 4H13B 4XQ1A 3K59A 4FFBA 1Q82W 2QTSA 4NTYA 2BOBC 2QY9A 5T1DB 3N2KA 4BW5A 1YZAA 2CUGA 1MNDA 1D5AA 3BABA 2OTLV 5FPRA 3GODA 2FFHA 3FB5C 2P7VA 4QDLA 5IYZA 1WP7A 5HFLA 1G4US 4FM0A 1DTOA 2Y4UA 4FMTA 1N36O 5EBMC 4Q5SF 3IHUA 1PNKA 1MABG 3ZHUA 4NYKA 5COFA 3M8AA 4EEQA 1K5SA 1QQCA 4MTFA 2L7AA 2VC9A 4CS9C 1BMFG 3QW0A 2QJ1A 5CBHA 4FPPA 4JTDB 2ZXPA 1NU1H 3U2MA 3SPCA 3SPIA 4O4IA 3HKBB 4MVZA 2XSEA 2XLDA 3OGCC 2E5LO 5JLIA 3LS0A 2ZIMA 3A0RA 4YJ2A 1IZMA 3OFNG 1FMVA 3AJMA 1ZU5A 2PTMA 1SQFA 4C7OA 4P9OA 4DR2B 1Y76A 2NN4A 3ZMVA 4EFBA 3EJNA 1NFNA 2NUPB 4DR4O 1CGME 3N24A 2YSUB 4K35A 4B08A 3UQ8A 1KKCA 2QWOB 2WLHA 4YL0A 3LDDA 5A9GA 2J7PA 2W4BA 1XREA 4DR4B 4O2AB 4BWAA 4K0DA 2EINB 2YLDA 1JMKC 1XUQA 1HP8A 5GONB 4P6IC 1KBHA 1IBLO 4WFHA 1OJHA 2F4VB 1OW7A 1OW6A 3A11A 5CA0A 2XLWA 3DE8A 3V7OA 2A6HF 4H54A 1E85A 3PN1A 1YJWV 3RYCB 1YTFD 3QO8A 2L6GA 2QTVA 1Q0FA 1Y4MA 3KH2A 1ZHXA 4LF5B 1O87A 2DGJA 1M5IA 3NYLA 4Z1VA 4E0HA 2Q7GA 1KQSU 3OWTA 2XXAA 1PNMA 4X20A 5LYJB 2PFDA 3UMIA 3B40A 4DUYO 4EBJA 4B3MO 1FJGB 4ONSA 1OCZB 2WA3A 1AEPA 5B3SC 3K0DA 1OCZC 4PA6A 4OPHA 1P7GA 3STZC 4CDAA 1L8DA 2V4DA 3J81N 1TQGA 3RYLA 3NDBB 1DLBA 3JARA 3CMEV 3QF7A 1DGSA 3CCRV 4FAPB 1HW1A 2YDEA 3H65A 5KAIZ 3SYCA 2DQ0A 3DAFA 1FJGO 3OUSA 2W45A 3QO5A 4O6MA 3ZIBA 4X20B 1TWHA 2MW2B 4UB8Z 2XS1A 3A8TA 4FZ0A 4BJ5A 4DV6O 4DJ9A 3ABMC 1IZ3A 4JEBA 2NG1A 5IYCO 4JI0B 2ZDIA 5EIBD 1FKAO 2JEUA 3IC7A 2YZSA 1QHTA 2XTAA 4KFMA 5DQTA 2QEXV 1GN4A 3B0VC 3CD6V 1I5YA 3JCUQ 3JARB 2JGDA 2EIMB 4LP8A 4O7GA 2YXHA 3TXQA 1BT8A 3AG2B 3KKYA 4MTXA 5JJEB 4YHHO 1RKCA 2R03A 1XHXA 2M7WA 4OGQB 2AZ0A 4IYIA 2YLIA 3GEEA 5LBQA 2XLOA 2WVQA 3JCZA 4ZIBA 2HR3A 3ASOB 2CDQA 1UJWB 2D5RB 4HFFB 3L73H 2JIZG 1CXZB 3NG1A 1QKRA 1AR1B 1FXKB 1NZ6A 1Q8IA 2YIDA 4JZGA 2E75B 3U9MA 5J2UB 4ABMA 2JGDB 1YI2V 3HKBA 3F47A 1Q7YW 3SYAA 3K79A 3W7UA 4DR3O 5IDJA 4DR1B 1NVPD 3JD2A 3BCCH 1KMIZ 2XAQA 2QWPB 3GEHA 2WL8A 5CA3A 2R7TA 2XAJA 4YJ2B 3ASNB 4N06A 4BIUA 2ZNIA 4E4EA 1R1BA 3C8ZA 4MS2A 3NKEA 3JSEO 2CGEA 4CBCA 3RW0A 1V4AA 3TCUA 1RFYA 1SZXA 1FAFA 3AG7A 2VB6A 3ABUA 3K5LA 2HHHB 2P6VA 3FDQA 1R6TA 3OTOO 1UG7A 1HY5A 3ZJZA 1YARO 5BQIA 1SA0A 1XDCA 5BUOA 5LP6C 2H8AA 1T5OA 5A6JA 2XAGA 1VIBA 2L81A 2VS0A 1M56B 2LIGA 3TQOA 4IHJA 4PD4F 3H1HH 1VQ7V 1MMAA 3M1CB 3Q7GA 2LO1A 1T9KA 2LJ2A 2GHYA 4O2AA 2P4KA 5GW7A 5JWPA 3W7TA 1JA8A 3D8CA 3L71H 3ZMTA 5H6RA 2IM9A 3RFRA 5T3WA 4H0LB 4OXSA 3B77A 4PV1B 1XWJA 3RYCA 1OCOB 1QBZA 3B71A 5L3FA 3CS5A 2QM8A 2ZDIC 4W4KA 2UUAB 1MMNA 4CIHA 2F95B 1YVIA 5KA5A 4EBBA 3HKEB 4YT5A 4DRHB 1JR8A 2W6JG 3J80N 1NR7A 3AOUA 3DXRB 4RQFA 2XASA 5JQGB 2Q7HA 2V7QG 1NU7D 3NYJA 3S0XA 4Q4ZF 4K8XA 1ENVA 4O79A 1O9GA 4BR6A 1B68A 2LD6A 1QLNA 1K92A 2IBFA 1XZQA 4U3FH 4NTAA 4I0XA 2QWRB 1Y74A 5L0GA 2WLNA 5LOVA 4MVSA 1Q6UA 1W59A 4CBEA 3DSQA 3K04A 2ZT9B 4X1YB 3BRJA 1KP3A 4J7JA 3T1HO 1YTFB 3G4ZA 2R9AA 3F7YC 3JSNA 3RQEA 5B1OA 1AI4A 4IT5A 3FYEB 1H8EG 3SJBC 2MYSA 4C3DA 4FIPC 2LK4A 3G4SV 1PV3A 4JW1A 4X64B 4DYLA 3T6BA 3J06A 1HNXB 3C62A 3WB0A 3ASNC 3RVZA 1ZU4A 4DV1O 3S90A 3ABKC 1O9HA 3U10A 2VCBA 3ZHRA 1Y74B 3K3WA 5K0IA 3UT5A 2J7PD 4TT3G 4J11A 4EUKB 3H2VA 4JI2B 1QR9A 5IJ0A 5BQHA 2HVJC 4B3SB 3ETDA 2ATKC 5AG2A 4C7UA 1EN5A 4MVRA 2OIGA 3QZCA 3G67A 1N4CA 4LBEC 2XT9A 1BBHA 2ZE8A 3OMIB 3OA1A 2ILMA 3MBGA 1K3EA 1W0JG 4B3SO 2CGOA 4OX9B 4UVAA 3W7XA 3ZHTA 3ZSUA 4XTKA 1S5LZ 1YA7O 2YL1A 3K1IC 5FNVA 3TJTA 2QM7A 1H2SB 4D4NA 4DV0B 4UCSA 1VYIA 3HKKA 4UB6Z 4P9FA 3DM5A 2D4UA 4HEAJ 5H2FZ 4U7OA 4I7ZB 4GYTA 1GS9A 2EZOA 2MHRA 4LFAB 4LF4O 2Q9AA 1YITV 3CMAV 2XM4A 5DS4A 3OD4A 2XM0A 1HDJA 3K9AA 1YDIA 3RYIA 1VEWA 2P4VA 4YY3O 1K97A 3X1OA 3SYQA 2HS5A 4OIPF 1XNRB 3DMDA 5F28E 4P2ZA 2X7RB 1Q43A 1AR5A 1JJOA 2KJGA 4AK9A 5LHGA 2DYRB 2A0LA 2KQ9A 4WFEA 1BZ4A 4X89A 1WASA 2KB1A 3TD7A 2R7VA 3SP1A 4F6EA 2IJJA 2XAFA 4DO2A 1NSGB 1Q90D 3JASA 1XBLA 5JJNB 3OEEG 1VMGA 4NCQA 3MAQA 1WJZA 1E79G 3HKEA 3N0TA 2L6LA 1NU9C 5JJJB 3ABTA 3K5OA 4QPJA 1J95A 3DXRA 1FD9A 5D5QA 3SNHA 1EQ1A 1CGOA 2DMXA 4ZBMA 1NTMH 3E8HA 4GX0A 4UXNA 4MQ9F 4X65B 2KNHA 3T4DA 3P3PA 5IYZB 1E1RG 3ZX6A 1Q0GA 3RYHA 4HBNA 2GTSA 2H94A 4RAIA 3EG9A 2UU9O 2YXLA 3T1CA 4F6RA 1OV9A 2RNBA 3D3IA 2QA4V 3LLKA 1D1CA 3O65A 5KAFZ 4PFPA 2OYQA 3A0HZ 1BR1A 1RSOB 1QQ3A 4UDVA 1L7CA 3ECSA 3E35A 3TOLA 4LDKA 4DR7O 2B0HA 2FL4A 2BOCC 1Z2GA 3JAMN 3W2VA 4YT8A 1SESA 1ZLZA 1JPNA 3C7JA 4Q6GA 4LNUB 2LW1A 3ITFA 3ZRXA 1SQBH 1I5XA 4G2KA 1DF4A 3CPWU 3P32A 3RYHB 1FFTC 2PX0A 1R73A 2CYDA 4D7TA 1LKXA 1US6A 3RIPA 1WTYA 1T6UA 1NI8A 4GYCB 1M90W 3QVZA 2NUPA 2GWWA 4UCVA 1MQVA 1N32O 3DE9A 5IJ9B 4X64O 3FXHA 2BTQA 2PY5A 3EGXA 4XPXA 5JUAA 1VQKV 4YHHB 4JI4O 1ORSC 2FTKA 4QE9A 1K04A 2Q9BA 1BR4A 2NPUA 1AP5A 5F2VO 1D2DA 1VQ9V 3G6BA 1R5ID 3L0IA 1THZA 1PNLA 5L3DA 3VQVA 3QTCA 2CNWD 3E2EA 2OT5A 3CC2V 4TUYA 3T1YB 2GV9A 2Q00A 1NKDA 5A6BA 4GX5A 3CJHA 2O9XA 1S72V 1JVMA 3OEHG 1CPRA 1L1FA 1O3UA 5KX5B 4JTCB 5T3TA 4CC6A 5FNVB 4TV9A 3BPZA 5B3SB 3C3TA 3FYIB 5KMGA 4XLNF 2Q7EA 1NT2B 2H7OA 1S7ZA 2Q0AA 1LIHA 3CSKA 2IW5A 1C17M 4J9YB 1IDSA 5CBGA 2EBOA 3E22B 5KYNA 1J8YF 1GK9A 1LE2A 3H2UA 3K1IA 4W4LA 4RO2A 3OR7C 2ZKOA 3CJHB 1HE9A 5KLVH 2Y3BA 5LGNA 2BTOA 1H6GA 4ULVA 2CCYA 3OR6C 1G4WR 4QIWF 1FXKC 3OUFA 1EN4A 4CH3A 4KI2A 2HHHO 3CHXA 4UCUA 2D2CB 4XDJA 4QNHB 1KD1W 2OU6A 1J5EO 3E8GA 1FFHA 2E74B 2GSMB 1MNEA 1H2MA 4J7KA 2CH7B 1NH2B 2A68F 4MVUA 5EGYA 4YJ3A 1U6HA 2NUTB 5CN0A 2WZLA 3NR7A 1ZL8A 2R72A 2EIMC 4RUFA 1PCXA 1ZVZA 2Z0AA 1FMWA 3TULA 2LFRA 5KHIA 1P7BA 3K08A 3E86A 2IM8A 3ETEA 2EILC 2HSQA 3ZBHA 5L0IA 2V3CC 3L8JA 5H9CA 1R4TA 2QKSA 2AU5A 2WLKA 3AGTA 3SJQC 4JTAB 2QNLA 3MHHC 5D92A 3JZ0A 2FAPB 3RN4A 2UXXA 3L72H 4WFFA 3R66A 2YRFA 3B8NA 3EG9B 3ABLB 4I55B 3MX3A 3S84A 3ATPA 2CH7A 3RYFA 1BDJB 2IXPA 4IL6Z 2BL2A 5JVDA 2V1DA 3LLIA 4XPWA 3HB3B 1MG1A 5KHJA 1ZL8B 3CCSV 3W7WA 1RPOA 2P7TC 4JAAA 2Q9CA 4G78A 2G38A 4U5FE 3SZRA 2Y0IA 2OKUA 4DV4B 4K8ZA 3IPMO 2V26A 2RN9A 1XI1A 4CS8A 2Z3YA 2YC0A 4WABA 2HSBA 1HR0O 1VQPV 4JI4B 4J7YA 3U3BA 4LDQA 1OXKA 4OINF 4J80A 3JRMO 3A2FA 2LFDA 3EXAA 4I55A 4PA9A 1WP8A 4BJ6A 2DW4A 1VQNV 1ORYA 1XMQO 1HR0B 4CS8C 1JX9A 3BAAA 4NXMB 1EA8A 2ZXWC 1S05A 4DV4O 1MA1A 1NTKH 1OCRB 3APOA 1VOMA 3HKDB 3EQLF 4O4IB 1K33A 1V54C 3OM3B 4B7EA 4NVPA 2LSEA 4UUJC 5KUKA 2ITCC 4ICGA 1TKNA 4ER9A 4JAUA 1EI7A 4I4TB 3AG1C 5LL6Y 1JOYA 4JI2O 2EJ7A 4KP4A 2VWJA 5FCLA 3M4BA 3N27A 5L3BA 3O9OA 3SYNA 1Q5OA 1BQ0A 1SC5B 2OEXA 2CDYA 1I08A 5JCOA 1IBMO 2ZPAA 4NR1A 3UKMA 5E2QA 1LNQA 1N32B 2AXTZ 4RWUA 3U8VA 3G71V 5KX5A 1RXQA 4YWQA 2QE7G 3DC5A 2HJ3A 5FZTA 2WA4A 2IU3A 2Q6AA 2VQEB 3CSXA 5A6BD 4I4TA 2LP7A 4DVYP 1H2NA 1M1KW 4BAYA 1WB8A 4JASA 4IWBA 1S5JA 5HSWA 3GWOA 2HMQA 3DAGA 2DJVA 1Y6XA 1VQ8V 3E9VA 3L70H 3ZRWA 4IIJB 4JI7B 2WLLA 5C8YA 2I15A 4FWVA 3IQCA 1A32A 2ZE6A 4CDVA 3HNJA 1N0JA 3EVKA 3SJCC 1FPOA 5LOVB 3I56V 1MSDA 1YSCA 3L74H 3F5TA 3KL4A 3UGOA 1CPYA 4J9ZB 4X1YA 3RBZA 4WCEV 1NZEA 4WJ0A 3M4CA 1NG1A 2VCAA 4DV3O 1IURA 5AC5A 2NUTA 3H1JH 3E83A 2LGWA 3W7SA 4L6RA 3NRHA 2M64A 1XILA 1SRYA 1EZJA 3MHSC 2QE9A 4FK5C 1OKKD 2ZNJA 2L6HA 2JS5A 1AVOB 4O6YA 2RMKB 5KUMA 2WLLB 2HZ8A 1I4ZA 3ZQYA 2PZSA 2UUBB 1IXMA 1I7FA 3H1IH 4WF9V 3L75H 3AG4B 2ZXOA 1ZTEA 3X2QB 3SJAC 3FFQA 4O4JA 2EPOA 1SZIA 3UMHA 4KL1A 2IH3C 2Q0OC 1ZHWA 2C04A 1BHBA 3KYJA 4TQFA 1YJNV 1HMOA 2R7OA 2J9BA 3FKSG 2GDSA 3F46A 5B1AC 4J32B 2R7UA 2F66C 1I4YA 1FYJA 2ZM6O 3QO7A 1NH2D 1S0VA 3N2ZB 5A6KA 4IRUA 1VLSA 1V55B 1N36B 3OGIB 3QVNA 5EYPB 4YXWG 3FMSA 4G7HF 4O4JB 4XLPF 1T5EA 2AP3A 1YDXA 3JSLA 2MK3A 1FXKA 3Q6MA 4JIOA 2WZGA 2WLMA 3E70C 4PELA 3DJUB 3U2LA 1FS0G 3R65A 4A4AA 4DUZO 2A79B 4NTFA 4MW8A 3KZIZ 3U8PA 1X4TA 4JGSA 1D1BA 3RYIB 4CDYA 2LW7A 5E3AA 5E33A 4C3EA 4JI5O 5C93A 1PV0A 5AC4A 5KHHA 4N6HA 5BXZA 3TGUH 3K1HA 3OTOB 2R02A 1H2LA 5DS6A 2A69F 4PJLA 4U7NA 2GUZB 3K9SA 1A7DA 3MD0A 2JPUA 2HV6A 4NTBA 5B1BC 2R05A 1E2XA 1SA0B 4DBRA 2HFIA 3JASB 1HNXO 1B3QA 1Z23A 4DR5O 5DQZA 4I9WA 4ZKIA 4IHJB 5EK0A 4FLVA 3T6JA 4ASUG 1F7YA 1BE3H 2L9JA 3OEOA 4LF4B 5D91A 1N0NA 5JT4A 2JVDA 4U5CE 3VF0A 1KNYA 1FR0A 3OW2U 3O10A 3AK1A 1FXVA 4KC9A 4KNWA 5KYXA 1R3LC 1Y66A 2W4MA 3R2PA 2PP4A 2LFSA 4LH7A 4LF8B 1KTMA 4KHPB 2FYUH 3LEVA 4OIRF 1MSWD 3H1LH 1I94B 1I94O 4F6RB 2NSGA 1W2BU 1WOLA 5JP7A 4B3RB 1KU2A 1Z5ZA 1YHQV 1S77D 1RSOA 4LF9B 2J0WA 4PHZA 2WLJA 4AQYB 2XLHA 1G4YB 4R7CA 4MTGA 1EKYA 3K6BA 5KYWA 1K8AW 3NMKA 1YJ9V 3C63A 4CS9A 4YY3B 4JI0O 1N34O 1SF8A 4AX2A 3CRQA 3ASOC 5K1XA 4IYHA 2JJ1G 4FVMA 1Q0MA 1QLEC 2CTWA 2EZPA 2QTOA 1XNQB 4YIPA 4NXNB 4NTWA 2AZ2A 3QVYA 4PJMA 5L0FA 4U5GA 1GQAA 2Q8VA 3WFVA 2QM4A 2J45A 4OIOF 3MYFA 4I44A 1W0KG 2Q7RA 1NBBA 1VK5A 4CSAA 4ANJA 3GM1A 2IXOA 2ZXRA 1OR2A 3CB2A 3RKOF 2FKXA 5J2TB 1H8HG 3GM2A 4EWCA 4NKGB 3G80A 4FESA 5L0JA 4G27B 1Y6DA 4CSAC 4FLTA 1T6IA 3B9QA 5EYPA 2GFHA 2AHZA 5CB4B 4HAMA 2R7SA 3AG4C 2BC5A 2GBOA 4EFEA 5KMGB 3JATA 3D36A 1VQ5V 4DR1O 3HLZA 3L8IA 3SXKA 1BQZA 3S3WA 4JI1B 3RQGA 4LCUC 3ZRVA 1KECA 2X0CA 5ITZA 3LSSA 3S27A 4MW3A 1TWGA 3K06A 4YIOA 4CS4A 2N04A 1RM1B 2XHBA 4WFBV 1CP9A 1QU7A 2VQFO 3LS1A 1K4CC 2EULA 1OCOC 3ABLC 2BE5F 3BRCA 4O2BB 4HZ3A 4Z9JA 4ULWA 4MVQA 1XL6A 5CB4A 5LA6A 5B3IA 2QSAA 4NTXA 4P30A 2KK1A 1M57C 1VF7A 5JVEA 1U97A 3CC4V 4AHCA 3DKAA 3T9OA 4EHPA 4LFBB 4ZLCA 4DV5O 3C8GA 2YKZA 1PP9H 2RJZA 3OMNB 1IBMB 3CCEV 4YJ3B 1VYKA 1VARA 2JD3A 1D0ZA 5JSLA 5BQGA 4JVSA 4CS7A 1D0YA 4GKJB 1WAZA 4UV8A 2ASRA 2EIJC 2RDCA 2QLAA 2Q68A 2ZXWB 1R3IC 5FPOA 2YIBA 1N33O 4JKVA 2XL4A 2RD9A 2XNDG 3LNRA 1ZAUA 2F4VO 2ZQMA 1WGWA 3Q4HA 2OG2A 1ZWIC 2LP4A 2BSKA 2PYJA 3W2WA 3H01A 2UXCO 3HNLA 1Z5WA 2ZE7A 1Q86W 3I5PA 2R25A 2OCCC 3SEOA 3RYFB 2HJMA 2P67A 4LH6A 4X1IA 2X6AA 2JRIA 1OZ0A 2ZM6B 3CEXA 3DZAA 1H2GA 2ZIOA 4O4HA 2J0XA 3EGDB 4LC1A 2A1DD 1FNTc 3QNEA 4CZZA 1FFXB 3K57A 3THOA 1H9TA 4MT8A 2EIKB 4TSFG 2P1AA 4W8PA 3M15A 1LS4A 4K7BA 4PK4A 2UU9B 4B3MB 3GEIA 3Q4HB 1VTMP 2Q9LA 2YLGA 1FAPB 1I5NA 5A6AA 4U5DE 4G28B 5D5PA 4D4XA 1SQVH 3F5WC 4AQYO 1MMDA 1Y67A 3B0UX 4O6NA 3FAPB 1L0LH 2DQ3A 2JJ2G 4X1IB 4H33A 1ZUQA 4DBQA 3NYMA 3T4ZA 2CTRA 3HKDA 3WODF 3S3XA 4JI5B 1K9MW 3NMIA 4Z9IA 3FB6C 4QE7A 1QCEA 2Y69B 1OR3A 1LUVA 3WAQA 2VH3A 2W0XA 4WFAV 1HMDA 4LF6O 3VM6A 3DWWA 4PACA 4FLUA 4I1OB 2PI4A 4U3JB 5JCOC 4ZI7A 1M2VB 2H7BA 4PDMA 4Z2WA 3GWNA 1G6UA 4DR5B 3GORA 2A7WA 3DM9B 4DK1A 5L3QA 4AI8A 2DB4A 2RSEB 3G4XA 3PHF2 1V74B 3ZCCA 1PD0A 1WLEA 4IJJA 1M2OA 2D3OW 3CP1A 4H44B 4DR3B 1UFIA 5CA1A 1MNGA 1R3JC 3IFXA 1A41A 4YK5A 2IU0A 1TR2A 4YL1A 2HEPA 3IQ6A 2EX3A 4TQDA 4I9QA 4TUYB 5KYYA 2Q3TA 3F7VC 2WB7A 3LUTB 1GM8A 256BA 1J5EB 2NSFA 1IXBA 1F23A 1PKXA 1I0HA 4IIJA 3UGPA 1JFFA 1AI5A 4L87A 3EHBB 5JRAA 1P84F 5COGA 1JJ2U 3LDCA 5CA1B 2VQFB 4DRIB 2HG5C 1M4UA 4UVCA 5EZYB 1N33B 1BSMA 3UNGC 3ZTMA 4PA4A 4L8JA 1QVFU 2WWWA 1MMGA 5DN6G 3LNNA 1MMMA 1DF5A 2OEVA 3A9CA 1VQ4V 1Z7Qc 3IC9A 1RP3B 2EIKC 1JCHA 1D5NA 2MWQA 2A06H 3N2GA 4LWSA 2TMVP 1AI6A 1RPRA 1BCCH 2KKWA 4XDLA 3KPHA 3V5XA 4N6CA 2UUCO 1JFFB 2UUAO 2IOQA 4HNAB 3W4YA 3ABMB 1VMAA 5DECA 2W0FC 2BSKB 3EZIA 3I5DA 3NMJA 4HE8D 3CCLV 2Q67A 3RWRD 4PI0A 2YI8A 2E76B 4CH5A 2J9UA 1NVPB 5CIVA 1QVXA 2YI9A 3W8IA 1MZEA 4JJGA
chains in the Genus database with same CATH topology
1V55C 2LP7A 2NNUA 1M1KW 4BAYA 1YI2V 5B1BB 1Q7YW 3CCVV 4JASA 1KP2A 1M56C 2WAMA 3SYAA 3K79A 3W7UA 3GWOA 5IDJA 1NVPD 3JD2A 5EC1C 1GM9A 2XAQA 3IGAC 4JPRA 3CCUV 5CA3A 2XAJA 3CYOA 3ASNB 4GX1A 1VQ8V 4BIUA 3ZRWA 4MS2A 3FB8C 1GTOA 2WLIA 3RW0A 4CBCA 3TCUA 2WLLA 3E8FA 3ABUA 2EIJB 4MVOA 3ZMSA 3I56V 2K1EA 2OCCB 1SZTA 4GT1A 1YSCA 3ZJZA 3SPJA 4H37A 3UM7A 1CPYA 4J9ZB 1JQ0A 3RBZA 4WCEV 1M9NA 2A9HA 2XAGA 1G8MA 1M56B 3E83A 3W7SA 1VQ7V 1SRYA 1EZJA 3MHSC 4FK5C 2GHYA 1OCCB 2JEXA 4MVMA 2W6IG 5GW7A 3ZIAG 3W7TA 5KUMA 1K4DC 1NQTA 3ZMTA 2WLLB 5H6RA 2YEVA 3AEIA 4EKWA 1EBOA 2Y69C 4OXSA 1IXMA 4WF9V 3B77A 5HFMA 3AG4B 3CCQV 2IJHA 2ITDC 1AJPA 1OCOB 3X2QB 3PJSK 2PI5A 1QBZA 5L3FA 2IH3C 2QM8A 4I5SA 2ZDIC 1BHBA 1M57B 3WG7B 1YJNV 4P9PA 3FKSG 5KA5A 5B1AC 2W6JG 1KC8W 1NR7A 4RQFA 2R9IA 2XASA 3QO7A 1NH2D 2V7QG 1ROPA 1TUEB 3DGEA 5FL7G 1S0VA 1ENVA 2DYSC 4DXWA 3RVYA 1QLNA 1V55B 1K92A 4JF3A 4PDRA 4YXWG 3BEHA 3T2MA 4R8CA 2WLNA 1BL8A 2MK3A 1FXKA 4MVSA 3SYPA 5DM6V 1R3KC 2IJKA 2WLMA 3K04A 3ZMUA 1S5HC 4PELA 2F43G 2DWEC 5IY5B 1KP3A 3ZN1A 1FS0G 1YTFB 3R65A 1GKFA 3F7YC 2A79B 4BIZA 4MW8A 4PA3A 4WFGA 5B1OA 1AI4A 1QVGU 4JGSA 3FYEB 1H8EG 3OMAB 2IJIA 1F4NA 1E1QG 4FIPC 5C93A 4GCZA 3G4SV 5B1NA 1AJNA 3ZRWB 5L3CA 3ASNC 3RVZA 3M99B 2Y48A 5E1AC 3AG3C 2P90A 3ABKC 4U7NA 5H6QA 3SPGA 1NR1A 3K3WA 3MD0A 5B1BC 4TT3G 1QR9A 1FXHA 2EJRA 3JYCA 1R6KA 2HVJC 1VQLV 2NLJC 3ETDA 2ATKC 2ZR2A 4I9WA 4ZKIA 1GM7A 5LGUA 5EK0A 1F4MA 1AI7A 2UXNA 4GX2A 4ASUG 1V54B 4MVRA 1KKDA 3EFFK 2H8PC 3JD1A 4LBEC 1B6QA 1K7DA 2X6CA 3OMIB 4TWKA 3OW2U 1OHHG 1FXVA 3AG2C 1R3LC 1K3EA 1W0JG 1Y66A 3ZRSA 1R6NA 2LFSA 1JPXA 4UVAA 3W7XA 1S3JA 1MSWD 1QR8A 3AG1B 3CXCU 3GB7C 1W2BU 1VQMV 4JYCA 2HFEC 3B8MA 5LGTA 2QM7A 3JD4A 1YHQV 1S77D 2WLJA 1K34A 4U7OA 2HVKC 1G4YB 4R7CA 4MTGA 2EZOA 4HYOA 1PL0A 1K8AW 3LSQA 5LHIA 4QJFB 1YJ9V 1YITV 3CMAV 3K9AA 1GMGA 1P4RA 3ASOC 3OE7G 1K97A 3SYQA 2XOKG 5EBWC 5IY5C 4JYBA 2JJ1G 4MTOA 4P2ZA 2X7RB 5L3GA 2WSSG 5LHGA 2DYRB 1QLEC 2YEVB 2EZPA 2QTOA 3ABKB 2A0LA 4WFEA 4N23A 3TETA 4X89A 2KB1A 2IJJA 2B5UA 2XAFA 4DO2A 3WFVA 1OCCC 4UV9A 1W0KG 5J9PC 3OEEG 3ZN0A 1H38A 1GO3F 4MSWC 1QLEB 2HLDG 1E79G 1COWG 3ABTA 3NXSA 1OCRC 1H8HG 1K5QA 4X8AA 2JK5C 3STLC 5IYBO 4QPJA 1J95A 3OAAG 4ZBMA 4G27B 3E8HA 4GX0A 2OTJV 4UXNA 3T4DA 1N8RW 4KUMA 1E1RG 1WPXA 5L3EA 2DWDC 1SERA 3SYOA 2H94A 2AHZA 4RAIA 4HAMA 3AG4C 3KG2A 3T1CA 4Q20A 3D3IA 2QA4V 3CCJV 3D36A 1VQ5V 1PD3A 1FFTB 3E35A 4N21A 1F51A 4LCUC 2BOCC 3ZRVA 1KECA 4PA7A 3LSSA 4MW3A 3K06A 1K73W 3G6EV 1SESA 5KA6A 2DYSB 1RM1B 4WFBV 1CP9A 1RM1C 3VOUA 1K4CC 1HWYA 1OCOC 3X2QC 3E8BA 3ZRXA 2C2AA 3ABLC 1I5XA 4G2KA 1DF4A 3CPWU 4HZ3A 3P32A 5BZBA 4MVQA 1R73A 1XL6A 1S76D 2ZD9A 3P30A 3LDEA 2B1IA 1VQOV 4E2LA 4P30A 1M57C 3CC4V 1M90W 2HKOA 1EFRG 1BHAA 2EINC 5IYDO 4JAVA 4FJCC 1VQKV 1MOFA 3OMNB 2FTKA 3CCEV 4RQEA 3ML0A 4QE9A 4F4LA 1SETA 2X6BA 1VQ9V 2Q69A 4UV8A 3DTUB 3FB7C 1THZA 1PNLA 1XL4A 5L3DA 2EIJC 1Q82W 2Q68A 2ZXWB 1R3IC 4PDVA 3E2EA 2BOBC 2OT5A 4BW5A 3CC2V 2XNDG 1AJQA 2ZQMA 2OTLV 1NKDA 3FB5C 1ZWIC 5HFLA 4GX5A 3H01A 3CCMV 2R9RB 1DTOA 4FMTA 1S72V 1JVMA 5EBMC 3VBBA 3OEHG 1PNKA 1MABG 1Q86W 2OCCC 1L1FA 4JTCB 5B3SB 1K5SA 3FYIB 4MTFA 2P67A 2X6AA 1OZ0A 1BMFG 1H2GA 5CBHA 4FPPA 3SPHA 2IW5A 4JTDB 4LC1A 4J9YB 5CBGA 3SPCA 2EBOA 3QNEA 3SPIA 4CZZA 4MVZA 1VQ6V 4MT8A 2EIKB 4TSFG 3OGCC 1GK9A 5LHHA 3A0RA 4RO2A 4G28B 5CMUA 3OR7C 2AHYA 3F5WC 5LGNA 3OFNG 3OR6C 4QIWF 1FXKC 3OUFA 4XDKA 2X0LA 4P9OA 2DQ3A 4XDJA 2JJ2G 4QNHB 1KD1W 3ZMVA 4H33A 5EC2C 2Z5UA 3E8GA 3T4ZA 2YSUB 2GSMB 1NJIW 1K9MW 1NH2B 2WLHA 4MVUA 3FB6C 4QE7A 1QCEA 2Y69B 3LDDA 4R50A 1Q81W 2IH1C 5CN0A 2CK3G 4WFAV 5CBFA 4R6ZA 4UVBA 2EIMC 2EINB 4RUFA 2PI4A 2LFRA 1P7BA 3K08A 3E86A 3ETEA 3HPLC 1AROP 5EBLC 2EILC 2ZR3A 4PDMA 3LNMB 1YIJV 4WFHA 5H9CA 2QKSA 2WLKA 2DYRC 4JTAB 3SJQC 3MHHC 2UXXA 4WFFA 1YJWV 1YTFD 3QO8A 3B8NA 3ABLB 3ZCCA 1WLEA 3K03A 2D3OW 1Y4MA 3CP1A 3AG3B 2V1DA 2EILB 1R3JC 3HB3B 1MG1A 3IFXA 1KQSU 3CCSV 2JDIG 2IU0A 2P6JA 3W7WA 1RPOA 1PNMA 2P7TC 4Z1MG 3JD0A 4PDLA 1OCZB 4QPKA 2Z3YA 3F7VC 5B3SC 3K0DA 1NBMG 3LUTB 3ZMZA 3E89A 3I55V 1VQPV 1GM8A 2WPDG 1OCZC 4PA6A 3STZC 1F23A 1DLBA 1PKXA 2WLIB 3CMEV 3CCRV 4PA9A 4L87A 1AI5A 2DW4A 3EHBB 2XAHA 1VQNV 1CEZA 1JX9A 1ORQC 3SYCA 1JJ2U 3LDCA 2DQ0A 2ZXWC 2HG5C 4UVCA 3OUSA 4PA4A 3QO5A 1QVFU 2WWWA 1OCRB 3BY6A 5DN6G 1DF5A 3CC7V 1K33A 1VQ4V 1V54C 3ABMC 2B1GA 3OM3B 4RUEA 5IYCO 4UUJC 2ZDIA 5KUKA 2ITCC 2EIKC 2JEUA 1JCHA 4JAUA 3IC7A 4KFMA 2QEXV 3AG1C 1AI6A 1RPRA 3CD6V 1I5YA 4KP4A 1JOYA 4XDLA 2EIMB 4LP8A 3WG7C 5L3BA 3TK1A 4X88A 3AG2B 4MTXA 3ABMB 2W0FC 3UKMA 2HJFC 2M7WA 1LNQA 5LBQA 3JCZA 2Q67A 4XBFA 3CCLV 2HR3A 3ASOB 3G71V 5B1AB 1UJWB 2QE7G 1NVPB 2IU3A 2JIZG 3K0GA 2Q6AA 3JD3A 3ETGA 1AR1B 1FXKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H33 A;  1V55 C;  2DWD C;  5EC2 C;  3E8G A;  3SYO A;  3T4Z A;  3ASN C;  3RVZ A;  2AHZ A;  4RAI A;  5E1A C;  3AG3 C;  3AG4 C;  3KG2 A;  3ABK C;  2WLH A;  3T1C A;  4MVU A;  1M56 C;  3FB6 C;  4QE7 A;  3LDD A;  4R50 A;  3SPG A;  3SYA A;  2IH1 C;  5EC1 C;  5B1B C;  3IGA C;  5CBF A;  4R6Z A;  4GX1 A;  2EIM C;  4LCU C;  4RUF A;  2BOC C;  3JYC A;  4PA7 A;  2HVJ C;  4MS2 A;  3FB8 C;  2NLJ C;  1P7B A;  3K08 A;  2WLI A;  3E86 A;  3K06 A;  4MW3 A;  3RW0 A;  2ATK C;  2WLL A;  3TCU A;  4CBC A;  3HPL C;  4I9W A;  5EBL C;  2EIL C;  4PDM A;  3LNM B;  3E8F A;  4WFH A;  5EK0 A;  4GX2 A;  3VOU A;  2QKS A;  2WLK A;  1K4C C;  1OCO C;  2DYR C;  3E8B A;  4JTA B;  4MVR A;  2K1E A;  3ABL C;  4MVO A;  3SJQ C;  3X2Q C;  3EFF K;  2H8P C;  3ZJZ A;  3SPJ A;  4H37 A;  4HZ3 A;  3UM7 A;  4QNH B;  4J9Z B;  4LBE C;  3RBZ A;  4WFF A;  5BZB A;  4MVQ A;  2A9H A;  1XL6 A;  2ZD9 A;  2X6C A;  3LDE A;  4TWK A;  3K03 A;  3AG2 C;  3E83 A;  4P30 A;  1R3L C;  1M57 C;  3ZRS A;  1R3J C;  3IFX A;  2EIN C;  2P7T C;  4MVM A;  4PDL A;  5KUM A;  1K4D C;  3GB7 C;  2WLL B;  4QE9 A;  2HFE C;  2YEV A;  3F7V C;  4F4L A;  5B3S C;  4EKW A;  3K0D A;  2Y69 C;  3LUT B;  2X6B A;  3E89 A;  4OXS A;  1OCZ C;  2Q69 A;  2WLJ A;  4PA6 A;  3FB7 C;  2ITD C;  3STZ C;  2HVK C;  1G4Y B;  4R7C A;  1XL4 A;  4MTG A;  2EIJ C;  4HYO A;  3PJS K;  2WLI B;  2Q68 A;  4PDV A;  1R3I C;  4PA9 A;  2BOB C;  4BW5 A;  2IH3 C;  1ORQ C;  3SYC A;  4P9P A;  3LDC A;  2ZXW C;  2HG5 C;  3FB5 C;  3ASO C;  1ZWI C;  5B1A C;  3OUS A;  4GX5 A;  4PA4 A;  3SYQ A;  2R9R B;  5EBW C;  5IY5 C;  1JVM A;  5EBM C;  4MTO A;  4P2Z A;  2OCC C;  4JTC B;  1V54 C;  1QLE C;  3ABM C;  4RUE A;  2QTO A;  4MTF A;  4UUJ C;  2A0L A;  5KUK A;  2ITC C;  2EIK C;  4WFE A;  3TET A;  2X6A A;  4DXW A;  2DYS C;  4X89 A;  2KB1 A;  3RVY A;  4KFM A;  3AG1 C;  5CBH A;  1KKD A;  4PDR A;  1OCC C;  3SPH A;  4JTD B;  4XDL A;  4J9Y B;  4LP8 A;  5CBG A;  3SPC A;  3SPI A;  3BEH A;  4MVZ A;  3WG7 C;  5J9P C;  4X88 A;  3T2M A;  3OGC C;  4MSW C;  4R8C A;  2WLN A;  1BL8 A;  4MVS A;  2W0F C;  3SYP A;  3UKM A;  1R3K C;  2HJF C;  2WLM A;  4RO2 A;  4G28 B;  1LNQ A;  3K04 A;  3OR7 C;  1OCR C;  1S5H C;  2AHY A;  3F5W C;  4X8A A;  2DWE C;  2JK5 C;  2Q67 A;  3STL C;  1J95 A;  3R65 A;  3OR6 C;  3F7Y C;  2A79 B;  4ZBM A;  4G27 B;  4MW8 A;  3OUF A;  4PA3 A;  3E8H A;  4GX0 A;  4WFG A;  4P9O A;  4XDK A;  3K0G A;  3T4D A;  2Q6A A;  4XDJ A; 
#chains in the Genus database with same CATH topology
 2A0U A;  1V55 C;  2P61 A;  4FM2 A;  2AWC A;  1KUQ A;  3EGD A;  4GEH A;  4DRJ B;  5B1B B;  2L35 A;  2ADQ B;  3IJ4 A;  3CCV V;  1M56 C;  2G62 A;  3QTH A;  4LF5 O;  4ZHQ B;  3OT7 A;  1GM9 A;  4JPR A;  3U5S A;  3ZWI A;  4GX1 A;  1YVW A;  4UCR A;  4HFK B;  2NR5 A;  2R7X A;  2KW3 C;  3FB8 C;  1V9P A;  3DXJ F;  3W8H A;  2WLI A;  1YLM A;  5LXT A;  2UXD O;  1YYJ A;  3L34 A;  3E8F A;  3GVM A;  3CXH F;  3ZHQ A;  1WNS A;  5AGF A;  3ZMS A;  1RJ9 B;  2K1E A;  2OCC B;  1SZT A;  4GT1 A;  4FLZ A;  2UUI A;  4J30 B;  3SPJ A;  4H37 A;  2KSD A;  5H5N A;  1ZZP A;  1JQ0 A;  4JYY A;  2A9H A;  3S28 A;  2AWY A;  3JAW B;  3CEI A;  1LUW A;  1G8M A;  2JGU A;  3UR3 C;  4J41 A;  4WBN B;  4E0I A;  4QGP A;  4DV7 B;  2AGA A;  2YXY A;  1OCC B;  1XOU A;  4MVM A;  4U3J A;  3C8G D;  1YA9 A;  4ZI7 B;  1M2V A;  3ZIA G;  3NKD A;  1NQT A;  1G1X B;  3LES A;  4EB6 B;  2YEV A;  3AEI A;  4EKW A;  3GM3 A;  2XLE A;  4JCH A;  4AIL C;  5HFM A;  1RJ9 A;  3FHD A;  3CCQ V;  2JS3 A;  2QGN A;  3RT3 C;  3PMR A;  1AJP A;  5KHG A;  3I5Q A;  3K66 A;  4B7K A;  4JI3 O;  5DLJ A;  1PD1 A;  1YJG A;  5BMV B;  3IAY A;  3VYW A;  4P9P A;  3ZED A;  1H7I A;  3ZG1 A;  5GTI Z;  2J9W A;  3PDM P;  2YVK A;  2WZF A;  4E7S A;  1KC8 W;  4I3M A;  2RQ6 A;  1GRJ A;  2R9I A;  3C3S A;  3K5M A;  4DV0 O;  1YF2 A;  3DGE A;  5FL7 G;  2YUA A;  2IYL D;  4H4K C;  1WA8 A;  4DXW A;  1JAF A;  3RVY A;  4RD9 A;  4BEM J;  3SDL A;  1QPU A;  3MYI A;  4PDR A;  2J46 A;  3MDS A;  4LLC A;  3U0C A;  2QKA A;  4X9Q A;  3I4U A;  2Q4P A;  3HKC B;  2YQY A;  4R8C A;  2F93 B;  1SQG A;  1BL8 A;  5DM6 V;  1VLT A;  2IXM A;  5EZY A;  4KXR A;  4D7S A;  3B29 A;  3ZMU A;  1S5H C;  2F43 G;  1TWC A;  5IY5 B;  3RQF A;  4ZLD A;  1EN6 A;  1A7V A;  4GKK B;  1GKF A;  1SQP H;  1BZK A;  1QVG U;  4DRX A;  5L0D A;  4LWS B;  2DI3 A;  3RFY A;  3WU2 Z;  4TOI A;  2OQM A;  3ZRW B;  4LF9 O;  1U0B B;  3CE2 A;  3M99 B;  1LI7 A;  3ZHV A;  2N74 A;  3AG3 C;  5C8Y B;  1X59 A;  3SPG A;  2UXB O;  4NC3 A;  3HKC A;  4JRZ A;  4O4L A;  4LFC B;  1Y4C A;  2EJR A;  3JYC A;  2ETS A;  5BR8 B;  5B5E Z;  4G7Z F;  4P9T A;  2ZR2 A;  2OOC A;  4IAR A;  1EM1 A;  1QSP A;  1F4M A;  2UXN A;  4GX2 A;  4X65 O;  4GLX A;  1AVM A;  1HE1 A;  4DV2 O;  3WB1 A;  1KKD A;  5LP6 A;  3S9O A;  1AB3 A;  1GN2 A;  4BEJ A;  3JD1 A;  1SQX H;  1B6Q A;  3SXM A;  1PM9 A;  1U96 A;  2ZIN A;  4J7T A;  3RGB A;  4LAC B;  1TUB A;  4JZ2 A;  1XMO O;  2K9P A;  2F1M A;  1BS3 A;  4YN0 B;  4O4L B;  2Q5Z A;  2GDC A;  3HNI A;  1XNQ O;  2DOS A;  5LXT B;  1JOG A;  3CXC U;  1VQM V;  4JYC A;  3UCS C;  3JAT B;  2HFE C;  5LGT A;  4RDA A;  3JD4 A;  4DK0 A;  2UUC B;  3JYH A;  3RH3 A;  4U9D A;  1K34 A;  2HVK C;  2LGQ A;  1ZHT A;  5ITZ B;  2YIC A;  3CRA A;  1PL0 A;  2ODM A;  1N34 B;  3LSQ A;  1AIL A;  5LHI A;  3T6G B;  5LMU B;  5FLX N;  5LMU O;  1VF6 A;  4U5B E;  3P3N A;  3US6 A;  4GQH A;  3DC6 A;  2GAQ A;  4CH6 A;  3OE7 G;  3IQ5 A;  4E18 A;  3BA8 A;  1GM5 A;  4JYB A;  3ZS8 C;  2PNO A;  2WSS G;  2YEV B;  3N2K B;  4FLY A;  3BA9 A;  1NFO A;  2OIE A;  1D0X A;  4AE4 A;  4E7Z A;  4MND A;  2R7W A;  1OQC A;  2B5U A;  3C8G B;  4J10 A;  3K33 A;  1Z63 A;  1DOW A;  2F23 A;  2PUS A;  4B3T B;  5J9P C;  3AK2 A;  4GZR B;  3MFN A;  5BMV A;  1ZW3 A;  2KQX A;  2VQE O;  4MSW C;  2HLD G;  3LEO A;  4LF7 O;  1CGN A;  3MLG A;  4JC7 A;  3WB2 A;  2DN9 A;  3JRT A;  1COW G;  3NXS A;  1OCR C;  1K5Q A;  1UPG A;  4BIO A;  5K1P A;  2JK5 C;  4LR3 A;  4FZ1 A;  3EH2 A;  4EBK A;  4D6T H;  3OAA G;  2GUZ A;  3C90 A;  4B3R O;  4PJJ A;  2XLM A;  1ORJ A;  2LQT A;  1A0B A;  1KYO F;  4U5E E;  1NS1 A;  1AUE A;  2AW9 A;  2XL6 A;  5F5H A;  4C7O B;  3V5Y A;  5A2Q N;  1PPJ H;  1PD3 A;  2KG7 B;  1FFT B;  2A6E F;  3HNK A;  5GPG B;  3ZHS A;  1F51 A;  2HV7 A;  4PA7 A;  3FAJ A;  3HJC A;  2CTP A;  2BCC H;  2Y0P A;  5KYX B;  2XUM A;  2P06 A;  5IE9 A;  1RM1 C;  3Q6N A;  3VOU A;  1Z6A A;  1HWY A;  3X2Q C;  3E8B A;  3B0P A;  1ZSP A;  2C2A A;  3G50 A;  1UFB A;  4QI0 A;  2ZD9 A;  3P30 A;  1JPJ A;  3LDE A;  2B1I A;  1VQO V;  3AQC A;  1RMV A;  1IX9 A;  1K40 A;  2ETN A;  2Y3D A;  4JEA A;  4CIP A;  1N1C A;  4WGZ A;  2UUH A;  2HKO A;  2M6Y A;  4LFC O;  1XNR O;  2EIN C;  2A3Q A;  5KYW B;  4FM1 A;  2RCV A;  4GKJ O;  3FAV B;  4RQE A;  1HNW B;  3FX7 A;  1WAT A;  3U0Z A;  1SET A;  3K7D A;  2X6B A;  5LP6 B;  1VP7 A;  1WN7 A;  3DTU B;  3FB7 C;  2Y3H A;  4X1K A;  4LFB O;  3WHN A;  1XL4 A;  2XXA B;  2IBZ H;  1TWA A;  2PF4 E;  4DVZ A;  1M93 A;  4PDV A;  4K0K O;  4XEV A;  4G7O F;  1AJQ A;  1OKK A;  2E3C A;  2CGN A;  1YZC A;  4JI3 B;  2YHS A;  4IAQ A;  2UXD B;  4K3A A;  2YL3 A;  3CCM V;  4BJ5 C;  2R9R B;  3VBB A;  2UUB O;  5DVW A;  2ICW G;  2P5O A;  2R7Q A;  5DED A;  4M63 A;  2QR4 A;  3M7M X;  3B2E E;  1VF6 C;  3KCY A;  1RCP A;  5J2T A;  1XZP A;  1MZF A;  3B4S A;  4DR7 B;  3SPH A;  1LVK A;  2HP8 A;  4CH4 A;  3LJB A;  1VQ6 V;  1L3P A;  3FOO A;  4DV7 O;  1SKV A;  5LHH A;  1PL4 A;  3CQZ A;  4B6I A;  1RKE B;  2WVO A;  5CI9 A;  3JCU Z;  2B9Z A;  2HKV A;  4NY3 A;  5CMU A;  3Q7L A;  1SS3 A;  2AHY A;  4XWJ A;  1ZHY A;  2R7R A;  4K1O A;  4XDK A;  3DJN B;  2X0L A;  2B0J A;  4CS3 A;  4AE4 B;  2QWQ B;  3TJ6 A;  4UCO A;  3JAK A;  4I50 B;  5EC2 C;  2Z5U A;  2FML A;  1TGO A;  3QG5 A;  1NJI W;  4I1M A;  4U5H A;  1Q81 W;  4R50 A;  2H7V C;  2IH1 C;  5GTH Z;  1IBK B;  1IBK O;  1RKE A;  4NB5 A;  2CK3 G;  5CBF A;  3EZH A;  3O39 A;  4O2B A;  4R6Z A;  4UVB A;  4C3B A;  3FD9 A;  3A0B Z;  5LA6 B;  2LFF A;  5KHK A;  1IW7 F;  1G8X A;  3HPL C;  1ARO P;  5EBL C;  2ZR3 A;  4HNA A;  3LNM B;  1YIJ V;  3KKB A;  4FLX A;  1WWP A;  3ZDL A;  5HV9 A;  2DYR C;  4E17 A;  4JI7 O;  3H1K H;  2QDO A;  4I50 A;  4A5U B;  1Z3I X;  3VQX A;  3K03 A;  5F5F A;  2Z15 A;  4AL0 A;  4X62 O;  3AG3 B;  4DW0 A;  3DI5 A;  2EIL B;  2KGO A;  4KBL A;  2JDI G;  2P6J A;  2CTQ A;  5EHH A;  4Z1M G;  1OW8 A;  3JD0 A;  4PDL A;  4JI8 B;  3CRC A;  3LAY A;  4QPK A;  1DK1 A;  1ZHZ A;  3LSU A;  4IB4 A;  3ZMZ A;  1NBM G;  5L3V A;  3I55 V;  3E89 A;  3UMK A;  4B3T O;  2WPD G;  1T6Q A;  4EIY A;  4G0H A;  2ADP A;  3BVO A;  4FFK A;  2OWO A;  2HUJ A;  2WLI B;  2WVN A;  4OIQ F;  1CEZ A;  2XAH A;  2KC3 A;  4FLW A;  4JV5 B;  1ORQ C;  4JYA O;  4JYA B;  3KCX A;  2A0B A;  4JI8 O;  4LLE A;  4XPY A;  1APC A;  1QZX A;  3TOM A;  4O4H B;  3BY6 A;  1FFX A;  1TVK A;  3CC7 V;  1JR9 A;  1LR1 A;  1Q6H A;  3HR0 A;  1GN6 A;  4DV2 B;  3KYI A;  2B1G A;  4RUE A;  2EPK X;  3AQB A;  4DUY B;  3CWB H;  4A2N B;  2VRZ A;  4DV3 B;  1SR2 A;  4X1K B;  2CW0 F;  3WG7 C;  4JJF A;  1HW7 A;  3TK1 A;  4X88 A;  4EB6 A;  3TXS A;  5JQG A;  5GON A;  2UXB B;  3BHP A;  1HNW O;  2FB5 A;  3VQW A;  2Y4T A;  4OPA A;  2M4E A;  2VCC A;  2HJF C;  2N05 A;  2PYL A;  3JTL O;  4XBF A;  4NXM O;  1TFK B;  3U3F A;  4LF6 B;  4CJO A;  5B1A B;  2PX3 A;  2VWK A;  1H9G A;  4K0K B;  4LER A;  2YIB D;  1QNM A;  4BJ6 C;  3K0G A;  1NLX A;  3JD3 A;  3ETG A;  2YIA A;  1D1A A;  3C18 A;  3GWL A;  4JI6 O;  4XEK A;  2CAZ C;  2FGY A;  4X0R A;  2NNU A;  3VRC A;  5CI8 A;  1O5H A;  1KP2 A;  2P22 C;  5EIB C;  2WAM A;  4YJW A;  3K5N A;  2OJE D;  2YWA A;  2BE3 A;  5A69 A;  3BFR A;  5EC1 C;  1GN3 A;  4OD5 A;  3IGA C;  1M6T A;  5JH7 A;  3CCU V;  3CYO A;  2EPM X;  2YL0 A;  3CRR A;  1W2W A;  2GA0 A;  3PCV A;  5JS5 A;  1GTO A;  3O6X A;  1LS1 A;  2EPL X;  4JUR I;  3TK0 A;  4DR2 O;  2AVK A;  1AP6 A;  2EIJ B;  4MVO A;  3UT5 B;  4BG0 A;  4DV1 B;  1P49 A;  3UM7 A;  2VAS A;  1M9N A;  5KYY B;  3U9J A;  2XRH A;  1BR2 A;  2OCH A;  3T4R A;  4LFA O;  4DR6 B;  1LPE A;  5JH7 B;  2JEX A;  1SQQ H;  1DOV A;  4ZOL B;  3B09 A;  2W6I G;  1H2K A;  5E3C A;  4LF7 B;  5B66 Z;  1K4D C;  1Q6I A;  4LF8 O;  4DW1 A;  3T1Y O;  1EBO A;  3HTK C;  2Y69 C;  4FX5 A;  2ARH A;  5IT9 N;  2F22 A;  2UXC B;  2IJH A;  2ITD C;  3PJS K;  4DR6 O;  2PI5 A;  4OX9 O;  2CNW A;  4Q7C A;  1IVS A;  1B04 A;  4I5S A;  1URF A;  1M57 B;  3WG7 B;  4WGY A;  3OTF A;  2XS8 A;  2G3V A;  3N2G B;  1KU9 A;  3POV A;  1G5Z A;  4CX9 A;  3JT1 A;  4ZOL A;  3ZQV A;  5J2U A;  2LCH A;  3IQT A;  2R70 A;  1E83 A;  3CX5 F;  1YCI A;  4KNV A;  4X62 B;  1ROP A;  1TUE B;  4BPM A;  4DOZ A;  4RBN A;  2YS8 A;  2DYS C;  1GH6 A;  4JF3 A;  2PGG A;  2Q4F A;  1JMW A;  4NXN O;  5E79 Z;  3BEH A;  1ST6 A;  4OD4 A;  3T2M A;  3JAL A;  3H9V A;  3QW1 A;  3SYP A;  2EPN A;  1R3K C;  2IJK A;  1WN0 A;  4JE9 A;  4GKK O;  3D3Q A;  3DD7 A;  2LQG A;  5LMN B;  2DWE C;  1E86 A;  4BW9 A;  3ZN1 A;  1TVK B;  3AGU A;  4BIZ A;  4PA3 A;  4CS2 A;  4WFG A;  4ZHQ A;  1GGQ A;  3S29 A;  4X66 O;  3OMA B;  1F4N A;  2IJI A;  2Y39 A;  2Y3G A;  1E1Q G;  2L6F A;  4GCZ A;  4J42 A;  1XQ8 A;  5B1N A;  1AJN A;  1ZX3 A;  1T01 A;  3O55 A;  5L3C A;  3CRM A;  3AK3 A;  5E1A C;  2Y48 A;  3EHN A;  4W8K A;  2P90 A;  1TAE A;  4JZA A;  1KB9 F;  5H6Q A;  1E84 A;  1NR1 A;  4UFZ A;  3JAL B;  3JYY A;  3ZTZ A;  3J7A U;  1LE4 A;  1FXH A;  1R6K A;  4R32 A;  1VQL V;  2NLJ C;  3APQ A;  1U89 A;  3JAW A;  3UO3 A;  1GM7 A;  5LGU A;  1AI7 A;  4WBN A;  3K58 A;  3M79 A;  1YEW A;  3EHM A;  4DV6 B;  1V54 B;  2QWN B;  3EFO B;  3EFF K;  2H8P C;  4DUZ B;  4JI6 B;  3ZVR A;  4FFB B;  2I8B A;  4AL1 A;  1K7D A;  1WPB A;  2XLV A;  2X6C A;  2QKC A;  4TWK A;  1AR4 A;  1OHH G;  4UCT A;  3CZ6 A;  3FVY A;  3AG2 C;  4YT4 A;  4LNU A;  3ZRS A;  1R6N A;  3T1H B;  1JPX A;  1WB7 A;  4JI1 O;  1S3J A;  3KMI A;  4YT2 A;  2PBE A;  3SR2 C;  1QR8 A;  2J8W A;  3AG1 B;  4PR9 A;  4YL3 A;  3R7C A;  5L0H A;  3D36 C;  3GB7 C;  3B8M A;  4I0X B;  4TV8 A;  1FTS A;  4PFO A;  2HJD A;  1XMO B;  1VB5 A;  2KG7 A;  4XEF A;  1K05 A;  1HNZ O;  1XEQ A;  4JCZ A;  2ZE5 A;  5IJ9 A;  2QUP A;  4HYO A;  2BTQ B;  3EGX B;  4QJF B;  5BY1 A;  2Q73 A;  5TIS Z;  2E5L B;  3SXY A;  3ETQ A;  3GWK C;  1WA8 B;  1GMG A;  1Q0D A;  1P4R A;  2KYH A;  4F4B A;  1ZYR F;  1YXB A;  3QMK A;  3L1M A;  5KYU A;  1HW2 A;  2XOK G;  4DV5 B;  5EBW C;  5IY5 C;  5BR8 O;  5IWA O;  4MTO A;  5L3G A;  3ICX A;  1HNZ B;  1F1M A;  1NTZ H;  1IBL B;  3ABK B;  2GTA A;  1XMQ B;  4TV8 B;  1Y76 B;  4N23 A;  3TET A;  4BJT A;  2G3K A;  1SF9 A;  1GAX A;  1ZW2 A;  4IAO A;  1OCC C;  4CC5 A;  5IJ0 B;  4QI2 A;  4UV9 A;  3EPV A;  2H3O A;  3VAY A;  3FAV A;  5L0C A;  3ZN0 A;  3RF3 A;  1H38 A;  1GO3 F;  4NQF A;  4TV9 B;  4GUN A;  3FOP A;  3GAN A;  4BJ1 A;  4DRX B;  1QLE B;  5IWA B;  1Q3E A;  1SMY F;  1OXB A;  2HMZ A;  2JX0 A;  2O57 A;  4N4W A;  1J8M F;  5KYU B;  4X8A A;  3STL C;  5IYB O;  1Q0K A;  5COM A;  1BGY H;  3E22 A;  1YZB A;  2P0N A;  3U11 A;  2KSF A;  1L0N H;  4PJ0 Z;  2DE0 X;  2OTJ V;  1LM3 B;  1C02 A;  1YYX A;  5CA0 B;  1N8R W;  1CPQ A;  4KUM A;  1WPX A;  5L3E A;  1SER A;  2DWD C;  2ZCE A;  3JSZ A;  4KHP O;  3SYO A;  3SGI A;  1Z5V A;  3V5Z A;  1LI5 A;  3KG2 A;  4Q20 A;  1TFO B;  2OJQ A;  3CCJ V;  3CAX A;  1B06 A;  1EZV H;  2X51 A;  4LDR A;  3IEE A;  3EH1 A;  4N21 A;  5DS5 A;  5LYJ A;  2E87 A;  1YAU O;  4Z9H A;  4CJG A;  1K73 W;  3G6E V;  5KA6 A;  2DYS B;  1TUB B;  2YL7 A;  3L9D A;  4X66 B;  1TA8 A;  3TJ5 A;  1JRA A;  2XL8 A;  3SXZ A;  5BZB A;  1S76 D;  5LMN O;  3UO2 A;  3VQY A;  3ZC4 A;  1VF5 B;  4IGG A;  4J7Z A;  4E2L A;  4JV5 O;  1A7E A;  2W9Y A;  1C03 A;  2J9V A;  3JAK B;  1EFR G;  1BHA A;  4PJN A;  5IYD O;  4JAV A;  4U9E A;  4FJC C;  1SYQ A;  1MOF A;  3ML0 A;  4F4L A;  2IXN A;  5TJ5 E;  5JVD B;  4PI2 A;  2C03 A;  3EFO A;  1XHZ A;  2CE4 A;  2Q69 A;  4H13 B;  4XQ1 A;  3K59 A;  4FFB A;  1Q82 W;  2QTS A;  4NTY A;  2BOB C;  2QY9 A;  5T1D B;  3N2K A;  4BW5 A;  1YZA A;  2CUG A;  1MND A;  1D5A A;  3BAB A;  2OTL V;  5FPR A;  3GOD A;  2FFH A;  3FB5 C;  2P7V A;  4QDL A;  5IYZ A;  1WP7 A;  5HFL A;  1G4U S;  4FM0 A;  1DTO A;  2Y4U A;  4FMT A;  1N36 O;  5EBM C;  4Q5S F;  3IHU A;  1PNK A;  1MAB G;  3ZHU A;  4NYK A;  5COF A;  3M8A A;  4EEQ A;  1K5S A;  1QQC A;  4MTF A;  2L7A A;  2VC9 A;  4CS9 C;  1BMF G;  3QW0 A;  2QJ1 A;  5CBH A;  4FPP A;  4JTD B;  2ZXP A;  1NU1 H;  3U2M A;  3SPC A;  3SPI A;  4O4I A;  3HKB B;  4MVZ A;  2XSE A;  2XLD A;  3OGC C;  2E5L O;  5JLI A;  3LS0 A;  2ZIM A;  3A0R A;  4YJ2 A;  1IZM A;  3OFN G;  1FMV A;  3AJM A;  1ZU5 A;  2PTM A;  1SQF A;  4C7O A;  4P9O A;  4DR2 B;  1Y76 A;  2NN4 A;  3ZMV A;  4EFB A;  3EJN A;  1NFN A;  2NUP B;  4DR4 O;  1CGM E;  3N24 A;  2YSU B;  4K35 A;  4B08 A;  3UQ8 A;  1KKC A;  2QWO B;  2WLH A;  4YL0 A;  3LDD A;  5A9G A;  2J7P A;  2W4B A;  1XRE A;  4DR4 B;  4O2A B;  4BWA A;  4K0D A;  2EIN B;  2YLD A;  1JMK C;  1XUQ A;  1HP8 A;  5GON B;  4P6I C;  1KBH A;  1IBL O;  4WFH A;  1OJH A;  2F4V B;  1OW7 A;  1OW6 A;  3A11 A;  5CA0 A;  2XLW A;  3DE8 A;  3V7O A;  2A6H F;  4H54 A;  1E85 A;  3PN1 A;  1YJW V;  3RYC B;  1YTF D;  3QO8 A;  2L6G A;  2QTV A;  1Q0F A;  1Y4M A;  3KH2 A;  1ZHX A;  4LF5 B;  1O87 A;  2DGJ A;  1M5I A;  3NYL A;  4Z1V A;  4E0H A;  2Q7G A;  1KQS U;  3OWT A;  2XXA A;  1PNM A;  4X20 A;  5LYJ B;  2PFD A;  3UMI A;  3B40 A;  4DUY O;  4EBJ A;  4B3M O;  1FJG B;  4ONS A;  1OCZ B;  2WA3 A;  1AEP A;  5B3S C;  3K0D A;  1OCZ C;  4PA6 A;  4OPH A;  1P7G A;  3STZ C;  4CDA A;  1L8D A;  2V4D A;  3J81 N;  1TQG A;  3RYL A;  3NDB B;  1DLB A;  3JAR A;  3CME V;  3QF7 A;  1DGS A;  3CCR V;  4FAP B;  1HW1 A;  2YDE A;  3H65 A;  5KAI Z;  3SYC A;  2DQ0 A;  3DAF A;  1FJG O;  3OUS A;  2W45 A;  3QO5 A;  4O6M A;  3ZIB A;  4X20 B;  1TWH A;  2MW2 B;  4UB8 Z;  2XS1 A;  3A8T A;  4FZ0 A;  4BJ5 A;  4DV6 O;  4DJ9 A;  3ABM C;  1IZ3 A;  4JEB A;  2NG1 A;  5IYC O;  4JI0 B;  2ZDI A;  5EIB D;  1FKA O;  2JEU A;  3IC7 A;  2YZS A;  1QHT A;  2XTA A;  4KFM A;  5DQT A;  2QEX V;  1GN4 A;  3B0V C;  3CD6 V;  1I5Y A;  3JCU Q;  3JAR B;  2JGD A;  2EIM B;  4LP8 A;  4O7G A;  2YXH A;  3TXQ A;  1BT8 A;  3AG2 B;  3KKY A;  4MTX A;  5JJE B;  4YHH O;  1RKC A;  2R03 A;  1XHX A;  2M7W A;  4OGQ B;  2AZ0 A;  4IYI A;  2YLI A;  3GEE A;  5LBQ A;  2XLO A;  2WVQ A;  3JCZ A;  4ZIB A;  2HR3 A;  3ASO B;  2CDQ A;  1UJW B;  2D5R B;  4HFF B;  3L73 H;  2JIZ G;  1CXZ B;  3NG1 A;  1QKR A;  1AR1 B;  1FXK B;  1NZ6 A;  1Q8I A;  2YID A;  4JZG A;  2E75 B;  3U9M A;  5J2U B;  4ABM A;  2JGD B;  1YI2 V;  3HKB A;  3F47 A;  1Q7Y W;  3SYA A;  3K79 A;  3W7U A;  4DR3 O;  5IDJ A;  4DR1 B;  1NVP D;  3JD2 A;  3BCC H;  1KMI Z;  2XAQ A;  2QWP B;  3GEH A;  2WL8 A;  5CA3 A;  2R7T A;  2XAJ A;  4YJ2 B;  3ASN B;  4N06 A;  4BIU A;  2ZNI A;  4E4E A;  1R1B A;  3C8Z A;  4MS2 A;  3NKE A;  3JSE O;  2CGE A;  4CBC A;  3RW0 A;  1V4A A;  3TCU A;  1RFY A;  1SZX A;  1FAF A;  3AG7 A;  2VB6 A;  3ABU A;  3K5L A;  2HHH B;  2P6V A;  3FDQ A;  1R6T A;  3OTO O;  1UG7 A;  1HY5 A;  3ZJZ A;  1YAR O;  5BQI A;  1SA0 A;  1XDC A;  5BUO A;  5LP6 C;  2H8A A;  1T5O A;  5A6J A;  2XAG A;  1VIB A;  2L81 A;  2VS0 A;  1M56 B;  2LIG A;  3TQO A;  4IHJ A;  4PD4 F;  3H1H H;  1VQ7 V;  1MMA A;  3M1C B;  3Q7G A;  2LO1 A;  1T9K A;  2LJ2 A;  2GHY A;  4O2A A;  2P4K A;  5GW7 A;  5JWP A;  3W7T A;  1JA8 A;  3D8C A;  3L71 H;  3ZMT A;  5H6R A;  2IM9 A;  3RFR A;  5T3W A;  4H0L B;  4OXS A;  3B77 A;  4PV1 B;  1XWJ A;  3RYC A;  1OCO B;  1QBZ A;  3B71 A;  5L3F A;  3CS5 A;  2QM8 A;  2ZDI C;  4W4K A;  2UUA B;  1MMN A;  4CIH A;  2F95 B;  1YVI A;  5KA5 A;  4EBB A;  3HKE B;  4YT5 A;  4DRH B;  1JR8 A;  2W6J G;  3J80 N;  1NR7 A;  3AOU A;  3DXR B;  4RQF A;  2XAS A;  5JQG B;  2Q7H A;  2V7Q G;  1NU7 D;  3NYJ A;  3S0X A;  4Q4Z F;  4K8X A;  1ENV A;  4O79 A;  1O9G A;  4BR6 A;  1B68 A;  2LD6 A;  1QLN A;  1K92 A;  2IBF A;  1XZQ A;  4U3F H;  4NTA A;  4I0X A;  2QWR B;  1Y74 A;  5L0G A;  2WLN A;  5LOV A;  4MVS A;  1Q6U A;  1W59 A;  4CBE A;  3DSQ A;  3K04 A;  2ZT9 B;  4X1Y B;  3BRJ A;  1KP3 A;  4J7J A;  3T1H O;  1YTF B;  3G4Z A;  2R9A A;  3F7Y C;  3JSN A;  3RQE A;  5B1O A;  1AI4 A;  4IT5 A;  3FYE B;  1H8E G;  3SJB C;  2MYS A;  4C3D A;  4FIP C;  2LK4 A;  3G4S V;  1PV3 A;  4JW1 A;  4X64 B;  4DYL A;  3T6B A;  3J06 A;  1HNX B;  3C62 A;  3WB0 A;  3ASN C;  3RVZ A;  1ZU4 A;  4DV1 O;  3S90 A;  3ABK C;  1O9H A;  3U10 A;  2VCB A;  3ZHR A;  1Y74 B;  3K3W A;  5K0I A;  3UT5 A;  2J7P D;  4TT3 G;  4J11 A;  4EUK B;  3H2V A;  4JI2 B;  1QR9 A;  5IJ0 A;  5BQH A;  2HVJ C;  4B3S B;  3ETD A;  2ATK C;  5AG2 A;  4C7U A;  1EN5 A;  4MVR A;  2OIG A;  3QZC A;  3G67 A;  1N4C A;  4LBE C;  2XT9 A;  1BBH A;  2ZE8 A;  3OMI B;  3OA1 A;  2ILM A;  3MBG A;  1K3E A;  1W0J G;  4B3S O;  2CGO A;  4OX9 B;  4UVA A;  3W7X A;  3ZHT A;  3ZSU A;  4XTK A;  1S5L Z;  1YA7 O;  2YL1 A;  3K1I C;  5FNV A;  3TJT A;  2QM7 A;  1H2S B;  4D4N A;  4DV0 B;  4UCS A;  1VYI A;  3HKK A;  4UB6 Z;  4P9F A;  3DM5 A;  2D4U A;  4HEA J;  5H2F Z;  4U7O A;  4I7Z B;  4GYT A;  1GS9 A;  2EZO A;  2MHR A;  4LFA B;  4LF4 O;  2Q9A A;  1YIT V;  3CMA V;  2XM4 A;  5DS4 A;  3OD4 A;  2XM0 A;  1HDJ A;  3K9A A;  1YDI A;  3RYI A;  1VEW A;  2P4V A;  4YY3 O;  1K97 A;  3X1O A;  3SYQ A;  2HS5 A;  4OIP F;  1XNR B;  3DMD A;  5F28 E;  4P2Z A;  2X7R B;  1Q43 A;  1AR5 A;  1JJO A;  2KJG A;  4AK9 A;  5LHG A;  2DYR B;  2A0L A;  2KQ9 A;  4WFE A;  1BZ4 A;  4X89 A;  1WAS A;  2KB1 A;  3TD7 A;  2R7V A;  3SP1 A;  4F6E A;  2IJJ A;  2XAF A;  4DO2 A;  1NSG B;  1Q90 D;  3JAS A;  1XBL A;  5JJN B;  3OEE G;  1VMG A;  4NCQ A;  3MAQ A;  1WJZ A;  1E79 G;  3HKE A;  3N0T A;  2L6L A;  1NU9 C;  5JJJ B;  3ABT A;  3K5O A;  4QPJ A;  1J95 A;  3DXR A;  1FD9 A;  5D5Q A;  3SNH A;  1EQ1 A;  1CGO A;  2DMX A;  4ZBM A;  1NTM H;  3E8H A;  4GX0 A;  4UXN A;  4MQ9 F;  4X65 B;  2KNH A;  3T4D A;  3P3P A;  5IYZ B;  1E1R G;  3ZX6 A;  1Q0G A;  3RYH A;  4HBN A;  2GTS A;  2H94 A;  4RAI A;  3EG9 A;  2UU9 O;  2YXL A;  3T1C A;  4F6R A;  1OV9 A;  2RNB A;  3D3I A;  2QA4 V;  3LLK A;  1D1C A;  3O65 A;  5KAF Z;  4PFP A;  2OYQ A;  3A0H Z;  1BR1 A;  1RSO B;  1QQ3 A;  4UDV A;  1L7C A;  3ECS A;  3E35 A;  3TOL A;  4LDK A;  4DR7 O;  2B0H A;  2FL4 A;  2BOC C;  1Z2G A;  3JAM N;  3W2V A;  4YT8 A;  1SES A;  1ZLZ A;  1JPN A;  3C7J A;  4Q6G A;  4LNU B;  2LW1 A;  3ITF A;  3ZRX A;  1SQB H;  1I5X A;  4G2K A;  1DF4 A;  3CPW U;  3P32 A;  3RYH B;  1FFT C;  2PX0 A;  1R73 A;  2CYD A;  4D7T A;  1LKX A;  1US6 A;  3RIP A;  1WTY A;  1T6U A;  1NI8 A;  4GYC B;  1M90 W;  3QVZ A;  2NUP A;  2GWW A;  4UCV A;  1MQV A;  1N32 O;  3DE9 A;  5IJ9 B;  4X64 O;  3FXH A;  2BTQ A;  2PY5 A;  3EGX A;  4XPX A;  5JUA A;  1VQK V;  4YHH B;  4JI4 O;  1ORS C;  2FTK A;  4QE9 A;  1K04 A;  2Q9B A;  1BR4 A;  2NPU A;  1AP5 A;  5F2V O;  1D2D A;  1VQ9 V;  3G6B A;  1R5I D;  3L0I A;  1THZ A;  1PNL A;  5L3D A;  3VQV A;  3QTC A;  2CNW D;  3E2E A;  2OT5 A;  3CC2 V;  4TUY A;  3T1Y B;  2GV9 A;  2Q00 A;  1NKD A;  5A6B A;  4GX5 A;  3CJH A;  2O9X A;  1S72 V;  1JVM A;  3OEH G;  1CPR A;  1L1F A;  1O3U A;  5KX5 B;  4JTC B;  5T3T A;  4CC6 A;  5FNV B;  4TV9 A;  3BPZ A;  5B3S B;  3C3T A;  3FYI B;  5KMG A;  4XLN F;  2Q7E A;  1NT2 B;  2H7O A;  1S7Z A;  2Q0A A;  1LIH A;  3CSK A;  2IW5 A;  1C17 M;  4J9Y B;  1IDS A;  5CBG A;  2EBO A;  3E22 B;  5KYN A;  1J8Y F;  1GK9 A;  1LE2 A;  3H2U A;  3K1I A;  4W4L A;  4RO2 A;  3OR7 C;  2ZKO A;  3CJH B;  1HE9 A;  5KLV H;  2Y3B A;  5LGN A;  2BTO A;  1H6G A;  4ULV A;  2CCY A;  3OR6 C;  1G4W R;  4QIW F;  1FXK C;  3OUF A;  1EN4 A;  4CH3 A;  4KI2 A;  2HHH O;  3CHX A;  4UCU A;  2D2C B;  4XDJ A;  4QNH B;  1KD1 W;  2OU6 A;  1J5E O;  3E8G A;  1FFH A;  2E74 B;  2GSM B;  1MNE A;  1H2M A;  4J7K A;  2CH7 B;  1NH2 B;  2A68 F;  4MVU A;  5EGY A;  4YJ3 A;  1U6H A;  2NUT B;  5CN0 A;  2WZL A;  3NR7 A;  1ZL8 A;  2R72 A;  2EIM C;  4RUF A;  1PCX A;  1ZVZ A;  2Z0A A;  1FMW A;  3TUL A;  2LFR A;  5KHI A;  1P7B A;  3K08 A;  3E86 A;  2IM8 A;  3ETE A;  2EIL C;  2HSQ A;  3ZBH A;  5L0I A;  2V3C C;  3L8J A;  5H9C A;  1R4T A;  2QKS A;  2AU5 A;  2WLK A;  3AGT A;  3SJQ C;  4JTA B;  2QNL A;  3MHH C;  5D92 A;  3JZ0 A;  2FAP B;  3RN4 A;  2UXX A;  3L72 H;  4WFF A;  3R66 A;  2YRF A;  3B8N A;  3EG9 B;  3ABL B;  4I55 B;  3MX3 A;  3S84 A;  3ATP A;  2CH7 A;  3RYF A;  1BDJ B;  2IXP A;  4IL6 Z;  2BL2 A;  5JVD A;  2V1D A;  3LLI A;  4XPW A;  3HB3 B;  1MG1 A;  5KHJ A;  1ZL8 B;  3CCS V;  3W7W A;  1RPO A;  2P7T C;  4JAA A;  2Q9C A;  4G78 A;  2G38 A;  4U5F E;  3SZR A;  2Y0I A;  2OKU A;  4DV4 B;  4K8Z A;  3IPM O;  2V26 A;  2RN9 A;  1XI1 A;  4CS8 A;  2Z3Y A;  2YC0 A;  4WAB A;  2HSB A;  1HR0 O;  1VQP V;  4JI4 B;  4J7Y A;  3U3B A;  4LDQ A;  1OXK A;  4OIN F;  4J80 A;  3JRM O;  3A2F A;  2LFD A;  3EXA A;  4I55 A;  4PA9 A;  1WP8 A;  4BJ6 A;  2DW4 A;  1VQN V;  1ORY A;  1XMQ O;  1HR0 B;  4CS8 C;  1JX9 A;  3BAA A;  4NXM B;  1EA8 A;  2ZXW C;  1S05 A;  4DV4 O;  1MA1 A;  1NTK H;  1OCR B;  3APO A;  1VOM A;  3HKD B;  3EQL F;  4O4I B;  1K33 A;  1V54 C;  3OM3 B;  4B7E A;  4NVP A;  2LSE A;  4UUJ C;  5KUK A;  2ITC C;  4ICG A;  1TKN A;  4ER9 A;  4JAU A;  1EI7 A;  4I4T B;  3AG1 C;  5LL6 Y;  1JOY A;  4JI2 O;  2EJ7 A;  4KP4 A;  2VWJ A;  5FCL A;  3M4B A;  3N27 A;  5L3B A;  3O9O A;  3SYN A;  1Q5O A;  1BQ0 A;  1SC5 B;  2OEX A;  2CDY A;  1I08 A;  5JCO A;  1IBM O;  2ZPA A;  4NR1 A;  3UKM A;  5E2Q A;  1LNQ A;  1N32 B;  2AXT Z;  4RWU A;  3U8V A;  3G71 V;  5KX5 A;  1RXQ A;  4YWQ A;  2QE7 G;  3DC5 A;  2HJ3 A;  5FZT A;  2WA4 A;  2IU3 A;  2Q6A A;  2VQE B;  3CSX A;  5A6B D;  4I4T A;  2LP7 A;  4DVY P;  1H2N A;  1M1K W;  4BAY A;  1WB8 A;  4JAS A;  4IWB A;  1S5J A;  5HSW A;  3GWO A;  2HMQ A;  3DAG A;  2DJV A;  1Y6X A;  1VQ8 V;  3E9V A;  3L70 H;  3ZRW A;  4IIJ B;  4JI7 B;  2WLL A;  5C8Y A;  2I15 A;  4FWV A;  3IQC A;  1A32 A;  2ZE6 A;  4CDV A;  3HNJ A;  1N0J A;  3EVK A;  3SJC C;  1FPO A;  5LOV B;  3I56 V;  1MSD A;  1YSC A;  3L74 H;  3F5T A;  3KL4 A;  3UGO A;  1CPY A;  4J9Z B;  4X1Y A;  3RBZ A;  4WCE V;  1NZE A;  4WJ0 A;  3M4C A;  1NG1 A;  2VCA A;  4DV3 O;  1IUR A;  5AC5 A;  2NUT A;  3H1J H;  3E83 A;  2LGW A;  3W7S A;  4L6R A;  3NRH A;  2M64 A;  1XIL A;  1SRY A;  1EZJ A;  3MHS C;  2QE9 A;  4FK5 C;  1OKK D;  2ZNJ A;  2L6H A;  2JS5 A;  1AVO B;  4O6Y A;  2RMK B;  5KUM A;  2WLL B;  2HZ8 A;  1I4Z A;  3ZQY A;  2PZS A;  2UUB B;  1IXM A;  1I7F A;  3H1I H;  4WF9 V;  3L75 H;  3AG4 B;  2ZXO A;  1ZTE A;  3X2Q B;  3SJA C;  3FFQ A;  4O4J A;  2EPO A;  1SZI A;  3UMH A;  4KL1 A;  2IH3 C;  2Q0O C;  1ZHW A;  2C04 A;  1BHB A;  3KYJ A;  4TQF A;  1YJN V;  1HMO A;  2R7O A;  2J9B A;  3FKS G;  2GDS A;  3F46 A;  5B1A C;  4J32 B;  2R7U A;  2F66 C;  1I4Y A;  1FYJ A;  2ZM6 O;  3QO7 A;  1NH2 D;  1S0V A;  3N2Z B;  5A6K A;  4IRU A;  1VLS A;  1V55 B;  1N36 B;  3OGI B;  3QVN A;  5EYP B;  4YXW G;  3FMS A;  4G7H F;  4O4J B;  4XLP F;  1T5E A;  2AP3 A;  1YDX A;  3JSL A;  2MK3 A;  1FXK A;  3Q6M A;  4JIO A;  2WZG A;  2WLM A;  3E70 C;  4PEL A;  3DJU B;  3U2L A;  1FS0 G;  3R65 A;  4A4A A;  4DUZ O;  2A79 B;  4NTF A;  4MW8 A;  3KZI Z;  3U8P A;  1X4T A;  4JGS A;  1D1B A;  3RYI B;  4CDY A;  2LW7 A;  5E3A A;  5E33 A;  4C3E A;  4JI5 O;  5C93 A;  1PV0 A;  5AC4 A;  5KHH A;  4N6H A;  5BXZ A;  3TGU H;  3K1H A;  3OTO B;  2R02 A;  1H2L A;  5DS6 A;  2A69 F;  4PJL A;  4U7N A;  2GUZ B;  3K9S A;  1A7D A;  3MD0 A;  2JPU A;  2HV6 A;  4NTB A;  5B1B C;  2R05 A;  1E2X A;  1SA0 B;  4DBR A;  2HFI A;  3JAS B;  1HNX O;  1B3Q A;  1Z23 A;  4DR5 O;  5DQZ A;  4I9W A;  4ZKI A;  4IHJ B;  5EK0 A;  4FLV A;  3T6J A;  4ASU G;  1F7Y A;  1BE3 H;  2L9J A;  3OEO A;  4LF4 B;  5D91 A;  1N0N A;  5JT4 A;  2JVD A;  4U5C E;  3VF0 A;  1KNY A;  1FR0 A;  3OW2 U;  3O10 A;  3AK1 A;  1FXV A;  4KC9 A;  4KNW A;  5KYX A;  1R3L C;  1Y66 A;  2W4M A;  3R2P A;  2PP4 A;  2LFS A;  4LH7 A;  4LF8 B;  1KTM A;  4KHP B;  2FYU H;  3LEV A;  4OIR F;  1MSW D;  3H1L H;  1I94 B;  1I94 O;  4F6R B;  2NSG A;  1W2B U;  1WOL A;  5JP7 A;  4B3R B;  1KU2 A;  1Z5Z A;  1YHQ V;  1S77 D;  1RSO A;  4LF9 B;  2J0W A;  4PHZ A;  2WLJ A;  4AQY B;  2XLH A;  1G4Y B;  4R7C A;  4MTG A;  1EKY A;  3K6B A;  5KYW A;  1K8A W;  3NMK A;  1YJ9 V;  3C63 A;  4CS9 A;  4YY3 B;  4JI0 O;  1N34 O;  1SF8 A;  4AX2 A;  3CRQ A;  3ASO C;  5K1X A;  4IYH A;  2JJ1 G;  4FVM A;  1Q0M A;  1QLE C;  2CTW A;  2EZP A;  2QTO A;  1XNQ B;  4YIP A;  4NXN B;  4NTW A;  2AZ2 A;  3QVY A;  4PJM A;  5L0F A;  4U5G A;  1GQA A;  2Q8V A;  3WFV A;  2QM4 A;  2J45 A;  4OIO F;  3MYF A;  4I44 A;  1W0K G;  2Q7R A;  1NBB A;  1VK5 A;  4CSA A;  4ANJ A;  3GM1 A;  2IXO A;  2ZXR A;  1OR2 A;  3CB2 A;  3RKO F;  2FKX A;  5J2T B;  1H8H G;  3GM2 A;  4EWC A;  4NKG B;  3G80 A;  4FES A;  5L0J A;  4G27 B;  1Y6D A;  4CSA C;  4FLT A;  1T6I A;  3B9Q A;  5EYP A;  2GFH A;  2AHZ A;  5CB4 B;  4HAM A;  2R7S A;  3AG4 C;  2BC5 A;  2GBO A;  4EFE A;  5KMG B;  3JAT A;  3D36 A;  1VQ5 V;  4DR1 O;  3HLZ A;  3L8I A;  3SXK A;  1BQZ A;  3S3W A;  4JI1 B;  3RQG A;  4LCU C;  3ZRV A;  1KEC A;  2X0C A;  5ITZ A;  3LSS A;  3S27 A;  4MW3 A;  1TWG A;  3K06 A;  4YIO A;  4CS4 A;  2N04 A;  1RM1 B;  2XHB A;  4WFB V;  1CP9 A;  1QU7 A;  2VQF O;  3LS1 A;  1K4C C;  2EUL A;  1OCO C;  3ABL C;  2BE5 F;  3BRC A;  4O2B B;  4HZ3 A;  4Z9J A;  4ULW A;  4MVQ A;  1XL6 A;  5CB4 A;  5LA6 A;  5B3I A;  2QSA A;  4NTX A;  4P30 A;  2KK1 A;  1M57 C;  1VF7 A;  5JVE A;  1U97 A;  3CC4 V;  4AHC A;  3DKA A;  3T9O A;  4EHP A;  4LFB B;  4ZLC A;  4DV5 O;  3C8G A;  2YKZ A;  1PP9 H;  2RJZ A;  3OMN B;  1IBM B;  3CCE V;  4YJ3 B;  1VYK A;  1VAR A;  2JD3 A;  1D0Z A;  5JSL A;  5BQG A;  4JVS A;  4CS7 A;  1D0Y A;  4GKJ B;  1WAZ A;  4UV8 A;  2ASR A;  2EIJ C;  2RDC A;  2QLA A;  2Q68 A;  2ZXW B;  1R3I C;  5FPO A;  2YIB A;  1N33 O;  4JKV A;  2XL4 A;  2RD9 A;  2XND G;  3LNR A;  1ZAU A;  2F4V O;  2ZQM A;  1WGW A;  3Q4H A;  2OG2 A;  1ZWI C;  2LP4 A;  2BSK A;  2PYJ A;  3W2W A;  3H01 A;  2UXC O;  3HNL A;  1Z5W A;  2ZE7 A;  1Q86 W;  3I5P A;  2R25 A;  2OCC C;  3SEO A;  3RYF B;  2HJM A;  2P67 A;  4LH6 A;  4X1I A;  2X6A A;  2JRI A;  1OZ0 A;  2ZM6 B;  3CEX A;  3DZA A;  1H2G A;  2ZIO A;  4O4H A;  2J0X A;  3EGD B;  4LC1 A;  2A1D D;  1FNT c;  3QNE A;  4CZZ A;  1FFX B;  3K57 A;  3THO A;  1H9T A;  4MT8 A;  2EIK B;  4TSF G;  2P1A A;  4W8P A;  3M15 A;  1LS4 A;  4K7B A;  4PK4 A;  2UU9 B;  4B3M B;  3GEI A;  3Q4H B;  1VTM P;  2Q9L A;  2YLG A;  1FAP B;  1I5N A;  5A6A A;  4U5D E;  4G28 B;  5D5P A;  4D4X A;  1SQV H;  3F5W C;  4AQY O;  1MMD A;  1Y67 A;  3B0U X;  4O6N A;  3FAP B;  1L0L H;  2DQ3 A;  2JJ2 G;  4X1I B;  4H33 A;  1ZUQ A;  4DBQ A;  3NYM A;  3T4Z A;  2CTR A;  3HKD A;  3WOD F;  3S3X A;  4JI5 B;  1K9M W;  3NMI A;  4Z9I A;  3FB6 C;  4QE7 A;  1QCE A;  2Y69 B;  1OR3 A;  1LUV A;  3WAQ A;  2VH3 A;  2W0X A;  4WFA V;  1HMD A;  4LF6 O;  3VM6 A;  3DWW A;  4PAC A;  4FLU A;  4I1O B;  2PI4 A;  4U3J B;  5JCO C;  4ZI7 A;  1M2V B;  2H7B A;  4PDM A;  4Z2W A;  3GWN A;  1G6U A;  4DR5 B;  3GOR A;  2A7W A;  3DM9 B;  4DK1 A;  5L3Q A;  4AI8 A;  2DB4 A;  2RSE B;  3G4X A;  3PHF 2;  1V74 B;  3ZCC A;  1PD0 A;  1WLE A;  4IJJ A;  1M2O A;  2D3O W;  3CP1 A;  4H44 B;  4DR3 B;  1UFI A;  5CA1 A;  1MNG A;  1R3J C;  3IFX A;  1A41 A;  4YK5 A;  2IU0 A;  1TR2 A;  4YL1 A;  2HEP A;  3IQ6 A;  2EX3 A;  4TQD A;  4I9Q A;  4TUY B;  5KYY A;  2Q3T A;  3F7V C;  2WB7 A;  3LUT B;  1GM8 A;  256B A;  1J5E B;  2NSF A;  1IXB A;  1F23 A;  1PKX A;  1I0H A;  4IIJ A;  3UGP A;  1JFF A;  1AI5 A;  4L87 A;  3EHB B;  5JRA A;  1P84 F;  5COG A;  1JJ2 U;  3LDC A;  5CA1 B;  2VQF B;  4DRI B;  2HG5 C;  1M4U A;  4UVC A;  5EZY B;  1N33 B;  1BSM A;  3UNG C;  3ZTM A;  4PA4 A;  4L8J A;  1QVF U;  2WWW A;  1MMG A;  5DN6 G;  3LNN A;  1MMM A;  1DF5 A;  2OEV A;  3A9C A;  1VQ4 V;  1Z7Q c;  3IC9 A;  1RP3 B;  2EIK C;  1JCH A;  1D5N A;  2MWQ A;  2A06 H;  3N2G A;  4LWS A;  2TMV P;  1AI6 A;  1RPR A;  1BCC H;  2KKW A;  4XDL A;  3KPH A;  3V5X A;  4N6C A;  2UUC O;  1JFF B;  2UUA O;  2IOQ A;  4HNA B;  3W4Y A;  3ABM B;  1VMA A;  5DEC A;  2W0F C;  2BSK B;  3EZI A;  3I5D A;  3NMJ A;  4HE8 D;  3CCL V;  2Q67 A;  3RWR D;  4PI0 A;  2YI8 A;  2E76 B;  4CH5 A;  2J9U A;  1NVP B;  5CIV A;  1QVX A;  2YI9 A;  3W8I A;  1MZE A;  4JJG A; 
#chains in the Genus database with same CATH homology
 1V55 C;  2LP7 A;  2NNU A;  1M1K W;  4BAY A;  1YI2 V;  5B1B B;  1Q7Y W;  3CCV V;  4JAS A;  1KP2 A;  1M56 C;  2WAM A;  3SYA A;  3K79 A;  3W7U A;  3GWO A;  5IDJ A;  1NVP D;  3JD2 A;  5EC1 C;  1GM9 A;  2XAQ A;  3IGA C;  4JPR A;  3CCU V;  5CA3 A;  2XAJ A;  3CYO A;  3ASN B;  4GX1 A;  1VQ8 V;  4BIU A;  3ZRW A;  4MS2 A;  3FB8 C;  1GTO A;  2WLI A;  3RW0 A;  4CBC A;  3TCU A;  2WLL A;  3E8F A;  3ABU A;  2EIJ B;  4MVO A;  3ZMS A;  3I56 V;  2K1E A;  2OCC B;  1SZT A;  4GT1 A;  1YSC A;  3ZJZ A;  3SPJ A;  4H37 A;  3UM7 A;  1CPY A;  4J9Z B;  1JQ0 A;  3RBZ A;  4WCE V;  1M9N A;  2A9H A;  2XAG A;  1G8M A;  1M56 B;  3E83 A;  3W7S A;  1VQ7 V;  1SRY A;  1EZJ A;  3MHS C;  4FK5 C;  2GHY A;  1OCC B;  2JEX A;  4MVM A;  2W6I G;  5GW7 A;  3ZIA G;  3W7T A;  5KUM A;  1K4D C;  1NQT A;  3ZMT A;  2WLL B;  5H6R A;  2YEV A;  3AEI A;  4EKW A;  1EBO A;  2Y69 C;  4OXS A;  1IXM A;  4WF9 V;  3B77 A;  5HFM A;  3AG4 B;  3CCQ V;  2IJH A;  2ITD C;  1AJP A;  1OCO B;  3X2Q B;  3PJS K;  2PI5 A;  1QBZ A;  5L3F A;  2IH3 C;  2QM8 A;  4I5S A;  2ZDI C;  1BHB A;  1M57 B;  3WG7 B;  1YJN V;  4P9P A;  3FKS G;  5KA5 A;  5B1A C;  2W6J G;  1KC8 W;  1NR7 A;  4RQF A;  2R9I A;  2XAS A;  3QO7 A;  1NH2 D;  2V7Q G;  1ROP A;  1TUE B;  3DGE A;  5FL7 G;  1S0V A;  1ENV A;  2DYS C;  4DXW A;  3RVY A;  1QLN A;  1V55 B;  1K92 A;  4JF3 A;  4PDR A;  4YXW G;  3BEH A;  3T2M A;  4R8C A;  2WLN A;  1BL8 A;  2MK3 A;  1FXK A;  4MVS A;  3SYP A;  5DM6 V;  1R3K C;  2IJK A;  2WLM A;  3K04 A;  3ZMU A;  1S5H C;  4PEL A;  2F43 G;  2DWE C;  5IY5 B;  1KP3 A;  3ZN1 A;  1FS0 G;  1YTF B;  3R65 A;  1GKF A;  3F7Y C;  2A79 B;  4BIZ A;  4MW8 A;  4PA3 A;  4WFG A;  5B1O A;  1AI4 A;  1QVG U;  4JGS A;  3FYE B;  1H8E G;  3OMA B;  2IJI A;  1F4N A;  1E1Q G;  4FIP C;  5C93 A;  4GCZ A;  3G4S V;  5B1N A;  1AJN A;  3ZRW B;  5L3C A;  3ASN C;  3RVZ A;  3M99 B;  2Y48 A;  5E1A C;  3AG3 C;  2P90 A;  3ABK C;  4U7N A;  5H6Q A;  3SPG A;  1NR1 A;  3K3W A;  3MD0 A;  5B1B C;  4TT3 G;  1QR9 A;  1FXH A;  2EJR A;  3JYC A;  1R6K A;  2HVJ C;  1VQL V;  2NLJ C;  3ETD A;  2ATK C;  2ZR2 A;  4I9W A;  4ZKI A;  1GM7 A;  5LGU A;  5EK0 A;  1F4M A;  1AI7 A;  2UXN A;  4GX2 A;  4ASU G;  1V54 B;  4MVR A;  1KKD A;  3EFF K;  2H8P C;  3JD1 A;  4LBE C;  1B6Q A;  1K7D A;  2X6C A;  3OMI B;  4TWK A;  3OW2 U;  1OHH G;  1FXV A;  3AG2 C;  1R3L C;  1K3E A;  1W0J G;  1Y66 A;  3ZRS A;  1R6N A;  2LFS A;  1JPX A;  4UVA A;  3W7X A;  1S3J A;  1MSW D;  1QR8 A;  3AG1 B;  3CXC U;  3GB7 C;  1W2B U;  1VQM V;  4JYC A;  2HFE C;  3B8M A;  5LGT A;  2QM7 A;  3JD4 A;  1YHQ V;  1S77 D;  2WLJ A;  1K34 A;  4U7O A;  2HVK C;  1G4Y B;  4R7C A;  4MTG A;  2EZO A;  4HYO A;  1PL0 A;  1K8A W;  3LSQ A;  5LHI A;  4QJF B;  1YJ9 V;  1YIT V;  3CMA V;  3K9A A;  1GMG A;  1P4R A;  3ASO C;  3OE7 G;  1K97 A;  3SYQ A;  2XOK G;  5EBW C;  5IY5 C;  4JYB A;  2JJ1 G;  4MTO A;  4P2Z A;  2X7R B;  5L3G A;  2WSS G;  5LHG A;  2DYR B;  1QLE C;  2YEV B;  2EZP A;  2QTO A;  3ABK B;  2A0L A;  4WFE A;  4N23 A;  3TET A;  4X89 A;  2KB1 A;  2IJJ A;  2B5U A;  2XAF A;  4DO2 A;  3WFV A;  1OCC C;  4UV9 A;  1W0K G;  5J9P C;  3OEE G;  3ZN0 A;  1H38 A;  1GO3 F;  4MSW C;  1QLE B;  2HLD G;  1E79 G;  1COW G;  3ABT A;  3NXS A;  1OCR C;  1H8H G;  1K5Q A;  4X8A A;  2JK5 C;  3STL C;  5IYB O;  4QPJ A;  1J95 A;  3OAA G;  4ZBM A;  4G27 B;  3E8H A;  4GX0 A;  2OTJ V;  4UXN A;  3T4D A;  1N8R W;  4KUM A;  1E1R G;  1WPX A;  5L3E A;  2DWD C;  1SER A;  3SYO A;  2H94 A;  2AHZ A;  4RAI A;  4HAM A;  3AG4 C;  3KG2 A;  3T1C A;  4Q20 A;  3D3I A;  2QA4 V;  3CCJ V;  3D36 A;  1VQ5 V;  1PD3 A;  1FFT B;  3E35 A;  4N21 A;  1F51 A;  4LCU C;  2BOC C;  3ZRV A;  1KEC A;  4PA7 A;  3LSS A;  4MW3 A;  3K06 A;  1K73 W;  3G6E V;  1SES A;  5KA6 A;  2DYS B;  1RM1 B;  4WFB V;  1CP9 A;  1RM1 C;  3VOU A;  1K4C C;  1HWY A;  1OCO C;  3X2Q C;  3E8B A;  3ZRX A;  2C2A A;  3ABL C;  1I5X A;  4G2K A;  1DF4 A;  3CPW U;  4HZ3 A;  3P32 A;  5BZB A;  4MVQ A;  1R73 A;  1XL6 A;  1S76 D;  2ZD9 A;  3P30 A;  3LDE A;  2B1I A;  1VQO V;  4E2L A;  4P30 A;  1M57 C;  3CC4 V;  1M90 W;  2HKO A;  1EFR G;  1BHA A;  2EIN C;  5IYD O;  4JAV A;  4FJC C;  1VQK V;  1MOF A;  3OMN B;  2FTK A;  3CCE V;  4RQE A;  3ML0 A;  4QE9 A;  4F4L A;  1SET A;  2X6B A;  1VQ9 V;  2Q69 A;  4UV8 A;  3DTU B;  3FB7 C;  1THZ A;  1PNL A;  1XL4 A;  5L3D A;  2EIJ C;  1Q82 W;  2Q68 A;  2ZXW B;  1R3I C;  4PDV A;  3E2E A;  2BOB C;  2OT5 A;  4BW5 A;  3CC2 V;  2XND G;  1AJQ A;  2ZQM A;  2OTL V;  1NKD A;  3FB5 C;  1ZWI C;  5HFL A;  4GX5 A;  3H01 A;  3CCM V;  2R9R B;  1DTO A;  4FMT A;  1S72 V;  1JVM A;  5EBM C;  3VBB A;  3OEH G;  1PNK A;  1MAB G;  1Q86 W;  2OCC C;  1L1F A;  4JTC B;  5B3S B;  1K5S A;  3FYI B;  4MTF A;  2P67 A;  2X6A A;  1OZ0 A;  1BMF G;  1H2G A;  5CBH A;  4FPP A;  3SPH A;  2IW5 A;  4JTD B;  4LC1 A;  4J9Y B;  5CBG A;  3SPC A;  2EBO A;  3QNE A;  3SPI A;  4CZZ A;  4MVZ A;  1VQ6 V;  4MT8 A;  2EIK B;  4TSF G;  3OGC C;  1GK9 A;  5LHH A;  3A0R A;  4RO2 A;  4G28 B;  5CMU A;  3OR7 C;  2AHY A;  3F5W C;  5LGN A;  3OFN G;  3OR6 C;  4QIW F;  1FXK C;  3OUF A;  4XDK A;  2X0L A;  4P9O A;  2DQ3 A;  4XDJ A;  2JJ2 G;  4QNH B;  1KD1 W;  3ZMV A;  4H33 A;  5EC2 C;  2Z5U A;  3E8G A;  3T4Z A;  2YSU B;  2GSM B;  1NJI W;  1K9M W;  1NH2 B;  2WLH A;  4MVU A;  3FB6 C;  4QE7 A;  1QCE A;  2Y69 B;  3LDD A;  4R50 A;  1Q81 W;  2IH1 C;  5CN0 A;  2CK3 G;  4WFA V;  5CBF A;  4R6Z A;  4UVB A;  2EIM C;  2EIN B;  4RUF A;  2PI4 A;  2LFR A;  1P7B A;  3K08 A;  3E86 A;  3ETE A;  3HPL C;  1ARO P;  5EBL C;  2EIL C;  2ZR3 A;  4PDM A;  3LNM B;  1YIJ V;  4WFH A;  5H9C A;  2QKS A;  2WLK A;  2DYR C;  4JTA B;  3SJQ C;  3MHH C;  2UXX A;  4WFF A;  1YJW V;  1YTF D;  3QO8 A;  3B8N A;  3ABL B;  3ZCC A;  1WLE A;  3K03 A;  2D3O W;  1Y4M A;  3CP1 A;  3AG3 B;  2V1D A;  2EIL B;  1R3J C;  3HB3 B;  1MG1 A;  3IFX A;  1KQS U;  3CCS V;  2JDI G;  2IU0 A;  2P6J A;  3W7W A;  1RPO A;  1PNM A;  2P7T C;  4Z1M G;  3JD0 A;  4PDL A;  1OCZ B;  4QPK A;  2Z3Y A;  3F7V C;  5B3S C;  3K0D A;  1NBM G;  3LUT B;  3ZMZ A;  3E89 A;  3I55 V;  1VQP V;  1GM8 A;  2WPD G;  1OCZ C;  4PA6 A;  3STZ C;  1F23 A;  1DLB A;  1PKX A;  2WLI B;  3CME V;  3CCR V;  4PA9 A;  4L87 A;  1AI5 A;  2DW4 A;  3EHB B;  2XAH A;  1VQN V;  1CEZ A;  1JX9 A;  1ORQ C;  3SYC A;  1JJ2 U;  3LDC A;  2DQ0 A;  2ZXW C;  2HG5 C;  4UVC A;  3OUS A;  4PA4 A;  3QO5 A;  1QVF U;  2WWW A;  1OCR B;  3BY6 A;  5DN6 G;  1DF5 A;  3CC7 V;  1K33 A;  1VQ4 V;  1V54 C;  3ABM C;  2B1G A;  3OM3 B;  4RUE A;  5IYC O;  4UUJ C;  2ZDI A;  5KUK A;  2ITC C;  2EIK C;  2JEU A;  1JCH A;  4JAU A;  3IC7 A;  4KFM A;  2QEX V;  3AG1 C;  1AI6 A;  1RPR A;  3CD6 V;  1I5Y A;  4KP4 A;  1JOY A;  4XDL A;  2EIM B;  4LP8 A;  3WG7 C;  5L3B A;  3TK1 A;  4X88 A;  3AG2 B;  4MTX A;  3ABM B;  2W0F C;  3UKM A;  2HJF C;  2M7W A;  1LNQ A;  5LBQ A;  3JCZ A;  2Q67 A;  4XBF A;  3CCL V;  2HR3 A;  3ASO B;  3G71 V;  5B1A B;  1UJW B;  2QE7 G;  1NVP B;  2IU3 A;  2JIZ G;  3K0G A;  2Q6A A;  3JD3 A;  3ETG A;  1AR1 B;  1FXK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...