3HNIA

Crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hniA00
2XLEA 1MQVA 4L6RA 3DE8A 4CX9A 1CGNA 2BC5A 1QPUA 2YLIA 4IB4A 5JRAA 3C62A 2XLMA 2J8WA 2YL3A 1E83A 4CDYA 1YZCA 4JEBA 3ZWIA 1E84A 1NBBA 5JLIA 2YLGA 3HNLA 3FOPA 1CPRA 1EKYA 3M4CA 1YYXA 4CIPA 5B3IA 3ZTZA 3L1MA 4N6HA 4WGZA 4CJOA 1E86A 2XM4A 1CPQA 3ZQVA 3M4BA 1A7VA 2XL6A 1M6TA 4U9EA 1YYJA 4U9DA 3M79A 2XLDA 2XLHA 1RCPA 3QW0A 5JUAA 3IQ5A 3NMKA 4JEAA 4ULVA 4NC3A 256BA 3C63A 2XLVA 3ZTMA 4EIYA 3VRCA 2CCYA 2YL7A 4N4WA 3NMJA 1E85A 3ZQYA 2YKZA 2J9BA 4CDAA 3M15A 4IARA 1LM3B 4D4XA 3FOOA 5JVEA 4IAQA 3QVYA 5JT4A 2XLOA 2YLDA 4CDVA 3IQ6A 1YZAA 1BBHA 3U8PA 2YL0A 1APCA 4JKVA 1GQAA 5JSLA 3QW1A 1JAFA 4ER9A 4WGYA 3TOLA 5JS5A 1CGOA 1S05A 3NMIA 4JE9A 1QQ3A 3HNKA 3HNJA 3TOMA 2XL8A 5JP7A 4D4NA 2XLWA 3QVZA 3DE9A 5AGFA 4CJGA 2XM0A 2QLAA 2YL1A 3HNIA
chains in the Genus database with same CATH superfamily
1A0BA 3EZIA 4I3MA 1HMDA 1QZXA 5FZTA 3K7DA 3GM1A 3TK0A 2YLIA 5K0IA 4QI2A 1VLTA 1FAPB 2R7XA 4IB4A 5JRAA 4JTDB 1WGWA 2MWQA 4XWJA 3V5ZA 4DRHB 5T3TA 1MNEA 4AX2A 4K7BA 1NU7D 4CDYA 1TFKB 4JEBA 2LK4A 4JURI 3UNGC 1YARO 4C3EA 3JTLO 3TJ5A 4NTBA 4RD9A 2HUJA 4OIQF 3E9VA 3W2VA 2L7AA 1YLMA 3B71A 3QMKA 1SMYF 2A0UA 1D1CA 4LERA 4NTFA 2A1DD 2LD6A 4HFKB 4Q4ZF 4MNDA 3NYLA 5EGYA 3M4CA 1G8XA 4P6IC 3OEOA 2IYLD 3U3FA 5B3IA 1D1BA 3TJ6A 3EG9B 4U5HA 1LI5A 1A41A 3SXYA 3DM9B 3HTKC 2R7TA 4WGZA 5A6KA 3HJCA 1BR4A 1LS4A 1M2VB 2VASA 1Q0DA 4CJOA 1A7EA 2BE5F 1NSGB 3ZC4A 1TQGA 3M4BA 2WL8A 4MVSA 5L0CA 1D0YA 5KYYA 4DBQA 4G7HF 1C03A 3KL4A 2V26A 1M2OA 1YYJA 4N06A 4PACA 3GORA 2XLHA 5KYNA 3IQTA 4J30B 2QE9A 2R7SA 2IOQA 3QW0A 2Z15A 3OWTA 4CS9C 4MS2A 2W4BA 1HE9A 4ULVA 2C04A 1LKXA 2LCHA 5CI9A 1ZZPA 4CS8C 3LAYA 2G62A 2L81A 3C8GA 1VYKA 3EFOB 3GWLA 3JT1A 3JZ0A 4IAOA 2JPUA 3O10A 4U5CE 3VM6A 1A7DA 4N6CA 1FNTc 3NMJA 4LACB 4JIOA 1GGQA 1I5NA 3BEHA 2YHSA 1UFBA 2ETSA 4QDLA 4IARA 4D4XA 5F5HA 1V74B 1JOGA 5JVEA 1OR2A 1WATA 4C3DA 5A6BD 4IJJA 4MVRA 3KPHA 4G0HA 3FXHA 4XEVA 3BRJA 2R05A 2KYHA 2NUTA 2HV7A 1YZAA 1BBHA 3RKOF 3TULA 4HEAJ 1NU9C 3RH3A 1UG7A 3A11A 2QUPA 5L0HA 1TFOB 1FFHA 1TWHA 2YL0A 5L0JA 2NUPB 1L3PA 2EIJC 4ZLDA 2Q4FA 4OD5A 4OINF 4YT2A 4H54A 4KC9A 1QVXA 1VMAA 3QW1A 1JAFA 2AWCA 2HS5A 1D0ZA 5JSLA 1Q0KA 3V7OA 3ZVRA 3PDMP 1GS9A 4ER9A 2NUTB 3RF3A 1OXKA 3DKAA 2YVKA 3B0PA 4JCHA 2G3KA 2QTVA 3RYLA 2KQ9A 1BR1A 3NMIA 3B0VC 3SP1A 1QQ3A 3DM5A 2Y3BA 3K1IC 3RW0A 3WAQA 4E0IA 4E0HA 2ZXRA 2D4UA 3TOMA 3T6GB 2J0XA 1PV3A 4O7GA 2Y3DA 5L3VA 2B0JA 3S0XA 1MNDA 3ZSUA 3Q6MA 4OD4A 3TD7A 1FR0A 1SZIA 2CYDA 5L0FA 3GM3A 5EHHA 1V55C 4BPMA 2WVOA 4EWCA 3QTHA 4Q5SF 1T6IA 2R7RA 1Z7Qc 3JYHA 4G7ZF 2UUHA 3DAGA 3O55A 3UMIA 3CZ6A 2J7PD 4YL0A 1YVIA 1RKCA 4Q7CA 1MQVA 1Q0FA 4XEKA 4L6RA 1LVKA 3DE8A 4CX9A 3J06A 1T6QA 1OCZC 1QPUA 2HZ8A 1M57C 3A9CA 4NTAA 4M63A 2DB4A 2UUIA 5DS6A 1Z5ZA 1QLEC 2I8BA 4AE4A 1I4YA 1JPJA 2J8WA 3GODA 3CAXA 1XZPA 3Q6NA 5B1AC 3G50A 2PX0A 3ZWIA 5E2QA 4YWQA 3EZHA 1E84A 4JC7A 2J9VA 3DI5A 5JLIA 1TWGA 4JZAA 5D91A 3LJBA 4WJ0A 2YWAA 5CI8A 2H7BA 4YJWA 2IBFA 3Q7LA 1CPRA 4LDQA 4J7YA 2A69F 4H4KC 3UR3C 1ZYRF 2XRHA 1T01A 2Q9BA 5E3AA 2GDCA 3U0CA 3ZTZA 2FAPB 3IPMO 4O6NA 4E18A 3L1MA 3LLKA 3LS0A 1H7IA 3HLZA 3ITFA 3L8IA 2KSFA 1OXBA 2R25A 4CSAC 5B3SC 3VAYA 1ZHZA 3NDBB 1T6UA 4AK9A 1E86A 3ZQVA 2X0CA 3LNMB 5L3QA 2PX3A 5T1DB 4EBJA 1SF8A 1RKEB 2EIMC 5GPGB 3WG7C 1A7VA 1ORYA 4O6YA 5L0DA 1AUEA 1M6TA 2YRFA 3EG9A 1R4TA 4K1OA 4P9TA 4U9DA 5COGA 2XLDA 4I1OB 4A4AA 3IQ5A 1M2VA 2VB6A 1H9GA 2YQYA 3EH2A 1C02A 1QSPA 1JRAA 1Z6AA 3QZCA 4XPXA 256BA 3PCVA 4U5EE 3S9OA 2L9JA 5HSWA 3U2LA 2J7PA 1C17M 2MYSA 4YL1A 4DRJB 1AVOB 3DMDA 2H7OA 2KNHA 2CCYA 2JX0A 2YL7A 3DJNB 2OJQA 4N4WA 1H6GA 3SNHA 5DLJA 1VYIA 3I5QA 1QKRA 2P0NA 3KMIA 5FCLA 5BUOA 1E85A 4BJ5C 2GA0A 2HSBA 3T4RA 4CS7A 3FDQA 2M64A 3MYIA 2J9BA 3DZAA 4FWVA 3RFYA 1Z63A 1KNYA 1ST6A 5IY5C 1H9TA 3L8JA 5JT4A 4EBBA 1T5OA 1OR3A 3EFOA 4DXWA 2TMVP 4BEMJ 1OKKA 2KGOA 4KNWA 4AL1A 3U8PA 1J8MF 1OCOC 1WN0A 4AL0A 2R02A 4JTAB 4ONSA 4XLNF 4U5FE 3IHUA 5L0GA 1K05A 5F5FA 1ZW3A 2W4MA 1HW2A 2H8AA 3R2PA 5TJ5E 1LE4A 3TOLA 4LDKA 2Y3HA 3FVYA 3Q7GA 4XPYA 5DQZA 4G78A 2CW0F 2KK1A 3EQLF 4C7OB 1JR8A 4BJ1A 3EGXA 3EJNA 2KJGA 3NKEA 4JE9A 2NUPA 3ABLC 3ASNC 4XTKA 4BJ6C 2AU5A 1JPNA 1RJ9A 1Y4CA 2OEVA 1PD0A 4P9FA 5JP7A 4D4NA 3DD7A 3N0TA 3QVZA 2IXMA 3DE9A 2XM0A 1ORSC 3SZRA 2Q3TA 2B0HA 2VCCA 3EGXB 2QLAA 4Z9HA 2YL1A 1ZU4A 1MMDA 2XSEA 3HNIA 2LFFA 4GQHA 4YK5A 2CNWD 1WTYA 1RJ9B 4CBEA 4CIHA 2XLEA 3DJUB 2BL2A 2OCCC 2ZD9A 4DBRA 3UGPA 2EPOA 2PF4E 3JRMO 3NG1A 4KI2A 2IXNA 2R03A 3C62A 5HV9A 2XLMA 1J8YF 4W8KA 4JRZA 2QY9A 2P1AA 2YL3A 3K66A 3NRHA 4I1MA 1OCCC 2L6HA 4PFPA 3W8IA 2R7UA 3U9MA 5AC4A 4BEJA 1YZCA 4Z9IA 3W4YA 1NBBA 2J9WA 1M56C 3MX3A 2PNOA 2OJED 2OEXA 1MMAA 1KU2A 4CS9A 4DVYP 2GAQA 3E70C 3S84A 2PP4A 1U89A 2RSEB 1HMOA 4U5DE 3S28A 3JYYA 1ZVZA 1EKYA 4FAPB 4CS8A 1YYXA 3V5XA 4CIPA 4KBLA 1D0XA 1JMWA 2XS8A 4YN0B 4LLEA 1TR2A 4FX5A 3S29A 2A6HF 1LI7A 2HFIA 2MHRA 1YA9A 2CGEA 2V3CC 2R7VA 4N6HA 1N1CA 3MYFA 1OQCA 2A68F 1CGME 1SR2A 4YT5A 1TKNA 2X51A 3POVA 1W2WA 3WHNA 2JD3A 3T6JA 4W8PA 3AG3C 3GWNA 2XM4A 3GANA 3G4ZA 1AEPA 1Q0GA 4FESA 1B68A 4X0RA 1Z3IX 3G4XA 4OIOF 2XS1A 2R7QA 2XL6A 3IQCA 2DYRC 4PJLA 4NQFA 5D92A 5T3WA 4U9EA 4E7ZA 5A6BA 2A6EF 5KYWA 2VC9A 2LFDA 2IXOA 2IM8A 3KYJA 4A2NB 3LLIA 5A6AA 2ASRA 5JUAA 3ATPA 4MW3A 3EPVA 5BQHA 2HJMA 4NC3A 4JCZA 2Q9AA 3F46A 3JSZA 1ZHWA 3C63A 2XLVA 3KYIA 2CNWA 3N2ZB 4MW8A 3O6XA 3VRCA 4IRUA 1RKEA 1HW1A 1E2XA 3VF0A 4GEHA 1L7CA 3FHDA 2AP3A 5KYWB 3T6BA 2HSQA 4HFFB 3JRTA 2OU6A 3K1IA 3OA1A 4EBKA 2ZPAA 3O39A 1FFTC 3UMKA 3AQCA 3F47A 2YKZA 3CSKA 3M15A 4JJFA 1LM3B 1V4AA 4MTOA 2J0WA 3SXKA 3EHMA 3S27A 4IAQA 3L34A 1ZHYA 3QVYA 1DOVA 2XLOA 2YLDA 3AQBA 4ZLCA 3MLGA 4EKWA 3N24A 1BDJB 4E17A 2XL4A 2HMZA 4MVUA 4JJGA 2ICWG 4MVZA 4XPWA 2EIKC 3LS1A 1LS1A 5KYXB 1HY5A 3C7JA 2FFHA 1FMVA 1WOLA 1Y6DA 3ZIBA 4MVOA 4U5GA 1EI7A 4JKVA 3U3BA 2LP4A 1ZHXA 1G4WR 3M1CB 2Y39A 3RQFA 1GQAA 2R9RB 4JVSA 4NY3A 1MMGA 3C8GD 1DOWA 5DQTA 3UMHA 4E7SA 2EPLX 2WZFA 3W8HA 4F4BA 4HE8D 1XZQA 4YT4A 3S90A 3U9JA 3T9OA 4XLPF 1CGOA 4O6MA 1OW8A 4IGGA 4YL3A 4DJ9A 2P6VA 2H7VC 4B6IA 3HNJA 3WODF 1K40A 1PD1A 1TWCA 5AC5A 4G7OF 4EHPA 3EH1A 2HV6A 2WVNA 2P61A 3PMRA 4PR9A 1PCXA 2F22A 2XLWA 4RDAA 2NSGA 4DOZA 2I15A 4BJTA 2HJ3A 1RXQA 3B9QA 3JSEO 2R7OA 3MBGA 3SXZA 3UGOA 5B1BC 2W9YA 2YZSA 4JW1A 5AGFA 4CJGA 2DGJA 3ECSA 4C7OA 1O87A 3SXMA 3EGDA 4RBNA 2C03A 1T9KA 2KC3A 2L6GA 2O9XA 1EQ1A 5A6JA 3B0UX 5E3CA 3AOUA 2WZLA 5KYUA 4CSAA 1CGNA 5DS4A 2BC5A 1VOMA 2XXAA 1YDIA 1OW7A 1MMNA 2Y3GA 4PJJA 1SYQA 4J32B 5L0IA 4XQ1A 1S7ZA 3LUTB 2GFHA 2CDQA 2OQMA 4PJNA 1E83A 3R7CA 3EGDB 4YT8A 1BR2A 1WASA 4Z9JA 4I44A 2Y69C 1O5HA 1HE1A 1FTSA 5KYUB 2NPUA 3AGUA 2XXAB 2YLGA 3HNLA 3GM2A 1ORJA 1LIHA 1YJGA 3FOPA 4LLCA 3PHF2 3MFNA 2VCAA 5DVWA 3ABKC 1Q0MA 3X2QC 4UDVA 3RVZA 1RMVA 5KYYB 3KKBA 1Z23A 4WABA 2W45A 2AVKA 1U6HA 2Q7RA 1NFOA 4LDRA 4BJ5A 2PFDA 4MQ9F 2M4EA 3B29A 4MTFA 1NFNA 1OW6A 1WWPA 3K6BA 3L0IA 5BQGA 3U8VA 2Q00A 2NG1A 2G3VA 1CPQA 3U5SA 2ZXWC 5COMA 4C3BA 1U0BB 3C8GB 1ZU5A 4MTGA 2Q9CA 3DXJF 2EPKX 3AG1C 1OCRC 3GEHA 3M79A 3RIPA 3ZG1A 1V54C 3W2WA 4BG0A 4ULWA 3VYWA 2NSFA 5A69A 1O3UA 2J9UA 1RCPA 1TWAA 2DI3A 2EPMX 2OKUA 3C18A 3NMKA 4JEAA 2LQGA 3AGTA 3X1OA 3SEOA 3KH2A 4EUKB 3FAJA 3H2UA 2VH3A 3ZTMA 4O79A 4PFOA 4EIYA 2IXPA 3H65A 2WVQA 2YEVA 2DYSC 3NKDA 2A0BA 4IWBA 1FMWA 3I4UA 3LEOA 3LEVA 3V5YA 3K33A 3DAFA 5EK0A 3ABMC 2LIGA 4BJ6A 1VK5A 3C8ZA 3ZQYA 1ZW2A 2LSEA 4CDAA 4XEFA 3FOOA 3AJMA 1GM5A 2D5RB 3AG2C 2J46A 1NZEA 2PBEA 4J7TA 4ANJA 1VLSA 1IZMA 1NG1A 3FAPB 2OG2A 3I5PA 4CDVA 2E87A 3IQ6A 2OOCA 2EILC 2P7VA 4NCQA 2RD9A 1KTMA 1VB5A 2AWYA 1G4US 3RQEA 2QNLA 3GEEA 2WZGA 3LNRA 1APCA 4DVZA 3LESA 1LPEA 2L6FA 4DRIB 2J45A 2KW3C 2HKVA 3ASOC 1LE2A 4K0DA 3K1HA 1VTMP 4R32A 5BQIA 2R7WA 1BZ4A 3AG4C 3TQOA 4WGYA 3JCUQ 1XWJA 4GYTA 4QI0A 5JS5A 5COFA 5DS5A 2EINC 2HMQA 3CEXA 2WB7A 3FMSA 3IEEA 3NYMA 5KYXA 4OIRF 4OIPF 2ZXOA 1K04A 3H2VA 1I4ZA 3HNKA 2ZXPA 4PJMA 2VCBA 2EPNA 4PK4A 2XL8A 3DWWA 4KNVA 3CQZA 1NLXA 1F1MA 1IW7F 1YA7O 2FGYA 3HKKA 4MVQA 3RQGA 1OKKD 3EHNA 3SYNA 1G5ZA 4MVMA 5CIVA 3RVYA 3U2MA 3GEIA 1D1AA 3US6A 4AE4B 1ZHTA 3NYJA 4U5BE 1YAUO 5E33A 1EA8A 5F28E 1R5ID 3ZDLA 2GWWA 1S05A 4JTCB
chains in the Genus database with same CATH topology
2XLEA 1MQVA 4L6RA 3DE8A 4CX9A 1CGNA 2BC5A 1QPUA 2YLIA 4IB4A 5JRAA 3C62A 2XLMA 2J8WA 2YL3A 1E83A 4CDYA 1YZCA 4JEBA 3ZWIA 1E84A 1NBBA 5JLIA 2YLGA 3HNLA 3FOPA 1CPRA 1EKYA 3M4CA 1YYXA 4CIPA 5B3IA 3ZTZA 3L1MA 4N6HA 4WGZA 4CJOA 1E86A 2XM4A 1CPQA 3ZQVA 3M4BA 1A7VA 2XL6A 1M6TA 4U9EA 1YYJA 4U9DA 3M79A 2XLDA 2XLHA 1RCPA 3QW0A 5JUAA 3IQ5A 3NMKA 4JEAA 4ULVA 4NC3A 256BA 3C63A 2XLVA 3ZTMA 4EIYA 3VRCA 2CCYA 2YL7A 4N4WA 3NMJA 1E85A 3ZQYA 2YKZA 2J9BA 4CDAA 3M15A 4IARA 1LM3B 4D4XA 3FOOA 5JVEA 4IAQA 3QVYA 5JT4A 2XLOA 2YLDA 4CDVA 3IQ6A 1YZAA 1BBHA 3U8PA 2YL0A 1APCA 4JKVA 1GQAA 5JSLA 3QW1A 1JAFA 4ER9A 4WGYA 3TOLA 5JS5A 1CGOA 1S05A 3NMIA 4JE9A 1QQ3A 3HNKA 3HNJA 3TOMA 2XL8A 5JP7A 4D4NA 2XLWA 3QVZA 3DE9A 5AGFA 4CJGA 2XM0A 2QLAA 2YL1A 3HNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLE A;  1MQV A;  4L6R A;  3DE8 A;  4CX9 A;  1CGN A;  2BC5 A;  1QPU A;  2YLI A;  4IB4 A;  5JRA A;  3C62 A;  2XLM A;  2J8W A;  2YL3 A;  1E83 A;  4CDY A;  1YZC A;  4JEB A;  3ZWI A;  1E84 A;  1NBB A;  5JLI A;  2YLG A;  3HNL A;  3FOP A;  1CPR A;  1EKY A;  3M4C A;  1YYX A;  4CIP A;  5B3I A;  3ZTZ A;  3L1M A;  4N6H A;  4WGZ A;  4CJO A;  1E86 A;  2XM4 A;  1CPQ A;  3ZQV A;  3M4B A;  1A7V A;  2XL6 A;  1M6T A;  4U9E A;  1YYJ A;  4U9D A;  3M79 A;  2XLD A;  2XLH A;  1RCP A;  3QW0 A;  5JUA A;  3IQ5 A;  3NMK A;  4JEA A;  4ULV A;  4NC3 A;  256B A;  3C63 A;  2XLV A;  3ZTM A;  4EIY A;  3VRC A;  2CCY A;  2YL7 A;  4N4W A;  3NMJ A;  1E85 A;  3ZQY A;  2YKZ A;  2J9B A;  4CDA A;  3M15 A;  4IAR A;  1LM3 B;  4D4X A;  3FOO A;  5JVE A;  4IAQ A;  3QVY A;  5JT4 A;  2XLO A;  2YLD A;  4CDV A;  3IQ6 A;  1YZA A;  1BBH A;  3U8P A;  2YL0 A;  1APC A;  4JKV A;  1GQA A;  5JSL A;  3QW1 A;  1JAF A;  4ER9 A;  4WGY A;  3TOL A;  5JS5 A;  1CGO A;  1S05 A;  3NMI A;  4JE9 A;  1QQ3 A;  3HNK A;  3HNJ A;  3TOM A;  2XL8 A;  5JP7 A;  4D4N A;  2XLW A;  3QVZ A;  3DE9 A;  5AGF A;  4CJG A;  2XM0 A;  2QLA A;  2YL1 A;  3HNI A; 
#chains in the Genus database with same CATH topology
 1A0B A;  3EZI A;  4I3M A;  1HMD A;  1QZX A;  5FZT A;  3K7D A;  3GM1 A;  3TK0 A;  2YLI A;  5K0I A;  4QI2 A;  1VLT A;  1FAP B;  2R7X A;  4IB4 A;  5JRA A;  4JTD B;  1WGW A;  2MWQ A;  4XWJ A;  3V5Z A;  4DRH B;  5T3T A;  1MNE A;  4AX2 A;  4K7B A;  1NU7 D;  4CDY A;  1TFK B;  4JEB A;  2LK4 A;  4JUR I;  3UNG C;  1YAR O;  4C3E A;  3JTL O;  3TJ5 A;  4NTB A;  4RD9 A;  2HUJ A;  4OIQ F;  3E9V A;  3W2V A;  2L7A A;  1YLM A;  3B71 A;  3QMK A;  1SMY F;  2A0U A;  1D1C A;  4LER A;  4NTF A;  2A1D D;  2LD6 A;  4HFK B;  4Q4Z F;  4MND A;  3NYL A;  5EGY A;  3M4C A;  1G8X A;  4P6I C;  3OEO A;  2IYL D;  3U3F A;  5B3I A;  1D1B A;  3TJ6 A;  3EG9 B;  4U5H A;  1LI5 A;  1A41 A;  3SXY A;  3DM9 B;  3HTK C;  2R7T A;  4WGZ A;  5A6K A;  3HJC A;  1BR4 A;  1LS4 A;  1M2V B;  2VAS A;  1Q0D A;  4CJO A;  1A7E A;  2BE5 F;  1NSG B;  3ZC4 A;  1TQG A;  3M4B A;  2WL8 A;  4MVS A;  5L0C A;  1D0Y A;  5KYY A;  4DBQ A;  4G7H F;  1C03 A;  3KL4 A;  2V26 A;  1M2O A;  1YYJ A;  4N06 A;  4PAC A;  3GOR A;  2XLH A;  5KYN A;  3IQT A;  4J30 B;  2QE9 A;  2R7S A;  2IOQ A;  3QW0 A;  2Z15 A;  3OWT A;  4CS9 C;  4MS2 A;  2W4B A;  1HE9 A;  4ULV A;  2C04 A;  1LKX A;  2LCH A;  5CI9 A;  1ZZP A;  4CS8 C;  3LAY A;  2G62 A;  2L81 A;  3C8G A;  1VYK A;  3EFO B;  3GWL A;  3JT1 A;  3JZ0 A;  4IAO A;  2JPU A;  3O10 A;  4U5C E;  3VM6 A;  1A7D A;  4N6C A;  1FNT c;  3NMJ A;  4LAC B;  4JIO A;  1GGQ A;  1I5N A;  3BEH A;  2YHS A;  1UFB A;  2ETS A;  4QDL A;  4IAR A;  4D4X A;  5F5H A;  1V74 B;  1JOG A;  5JVE A;  1OR2 A;  1WAT A;  4C3D A;  5A6B D;  4IJJ A;  4MVR A;  3KPH A;  4G0H A;  3FXH A;  4XEV A;  3BRJ A;  2R05 A;  2KYH A;  2NUT A;  2HV7 A;  1YZA A;  1BBH A;  3RKO F;  3TUL A;  4HEA J;  1NU9 C;  3RH3 A;  1UG7 A;  3A11 A;  2QUP A;  5L0H A;  1TFO B;  1FFH A;  1TWH A;  2YL0 A;  5L0J A;  2NUP B;  1L3P A;  2EIJ C;  4ZLD A;  2Q4F A;  4OD5 A;  4OIN F;  4YT2 A;  4H54 A;  4KC9 A;  1QVX A;  1VMA A;  3QW1 A;  1JAF A;  2AWC A;  2HS5 A;  1D0Z A;  5JSL A;  1Q0K A;  3V7O A;  3ZVR A;  3PDM P;  1GS9 A;  4ER9 A;  2NUT B;  3RF3 A;  1OXK A;  3DKA A;  2YVK A;  3B0P A;  4JCH A;  2G3K A;  2QTV A;  3RYL A;  2KQ9 A;  1BR1 A;  3NMI A;  3B0V C;  3SP1 A;  1QQ3 A;  3DM5 A;  2Y3B A;  3K1I C;  3RW0 A;  3WAQ A;  4E0I A;  4E0H A;  2ZXR A;  2D4U A;  3TOM A;  3T6G B;  2J0X A;  1PV3 A;  4O7G A;  2Y3D A;  5L3V A;  2B0J A;  3S0X A;  1MND A;  3ZSU A;  3Q6M A;  4OD4 A;  3TD7 A;  1FR0 A;  1SZI A;  2CYD A;  5L0F A;  3GM3 A;  5EHH A;  1V55 C;  4BPM A;  2WVO A;  4EWC A;  3QTH A;  4Q5S F;  1T6I A;  2R7R A;  1Z7Q c;  3JYH A;  4G7Z F;  2UUH A;  3DAG A;  3O55 A;  3UMI A;  3CZ6 A;  2J7P D;  4YL0 A;  1YVI A;  1RKC A;  4Q7C A;  1MQV A;  1Q0F A;  4XEK A;  4L6R A;  1LVK A;  3DE8 A;  4CX9 A;  3J06 A;  1T6Q A;  1OCZ C;  1QPU A;  2HZ8 A;  1M57 C;  3A9C A;  4NTA A;  4M63 A;  2DB4 A;  2UUI A;  5DS6 A;  1Z5Z A;  1QLE C;  2I8B A;  4AE4 A;  1I4Y A;  1JPJ A;  2J8W A;  3GOD A;  3CAX A;  1XZP A;  3Q6N A;  5B1A C;  3G50 A;  2PX0 A;  3ZWI A;  5E2Q A;  4YWQ A;  3EZH A;  1E84 A;  4JC7 A;  2J9V A;  3DI5 A;  5JLI A;  1TWG A;  4JZA A;  5D91 A;  3LJB A;  4WJ0 A;  2YWA A;  5CI8 A;  2H7B A;  4YJW A;  2IBF A;  3Q7L A;  1CPR A;  4LDQ A;  4J7Y A;  2A69 F;  4H4K C;  3UR3 C;  1ZYR F;  2XRH A;  1T01 A;  2Q9B A;  5E3A A;  2GDC A;  3U0C A;  3ZTZ A;  2FAP B;  3IPM O;  4O6N A;  4E18 A;  3L1M A;  3LLK A;  3LS0 A;  1H7I A;  3HLZ A;  3ITF A;  3L8I A;  2KSF A;  1OXB A;  2R25 A;  4CSA C;  5B3S C;  3VAY A;  1ZHZ A;  3NDB B;  1T6U A;  4AK9 A;  1E86 A;  3ZQV A;  2X0C A;  3LNM B;  5L3Q A;  2PX3 A;  5T1D B;  4EBJ A;  1SF8 A;  1RKE B;  2EIM C;  5GPG B;  3WG7 C;  1A7V A;  1ORY A;  4O6Y A;  5L0D A;  1AUE A;  1M6T A;  2YRF A;  3EG9 A;  1R4T A;  4K1O A;  4P9T A;  4U9D A;  5COG A;  2XLD A;  4I1O B;  4A4A A;  3IQ5 A;  1M2V A;  2VB6 A;  1H9G A;  2YQY A;  3EH2 A;  1C02 A;  1QSP A;  1JRA A;  1Z6A A;  3QZC A;  4XPX A;  256B A;  3PCV A;  4U5E E;  3S9O A;  2L9J A;  5HSW A;  3U2L A;  2J7P A;  1C17 M;  2MYS A;  4YL1 A;  4DRJ B;  1AVO B;  3DMD A;  2H7O A;  2KNH A;  2CCY A;  2JX0 A;  2YL7 A;  3DJN B;  2OJQ A;  4N4W A;  1H6G A;  3SNH A;  5DLJ A;  1VYI A;  3I5Q A;  1QKR A;  2P0N A;  3KMI A;  5FCL A;  5BUO A;  1E85 A;  4BJ5 C;  2GA0 A;  2HSB A;  3T4R A;  4CS7 A;  3FDQ A;  2M64 A;  3MYI A;  2J9B A;  3DZA A;  4FWV A;  3RFY A;  1Z63 A;  1KNY A;  1ST6 A;  5IY5 C;  1H9T A;  3L8J A;  5JT4 A;  4EBB A;  1T5O A;  1OR3 A;  3EFO A;  4DXW A;  2TMV P;  4BEM J;  1OKK A;  2KGO A;  4KNW A;  4AL1 A;  3U8P A;  1J8M F;  1OCO C;  1WN0 A;  4AL0 A;  2R02 A;  4JTA B;  4ONS A;  4XLN F;  4U5F E;  3IHU A;  5L0G A;  1K05 A;  5F5F A;  1ZW3 A;  2W4M A;  1HW2 A;  2H8A A;  3R2P A;  5TJ5 E;  1LE4 A;  3TOL A;  4LDK A;  2Y3H A;  3FVY A;  3Q7G A;  4XPY A;  5DQZ A;  4G78 A;  2CW0 F;  2KK1 A;  3EQL F;  4C7O B;  1JR8 A;  4BJ1 A;  3EGX A;  3EJN A;  2KJG A;  3NKE A;  4JE9 A;  2NUP A;  3ABL C;  3ASN C;  4XTK A;  4BJ6 C;  2AU5 A;  1JPN A;  1RJ9 A;  1Y4C A;  2OEV A;  1PD0 A;  4P9F A;  5JP7 A;  4D4N A;  3DD7 A;  3N0T A;  3QVZ A;  2IXM A;  3DE9 A;  2XM0 A;  1ORS C;  3SZR A;  2Q3T A;  2B0H A;  2VCC A;  3EGX B;  2QLA A;  4Z9H A;  2YL1 A;  1ZU4 A;  1MMD A;  2XSE A;  3HNI A;  2LFF A;  4GQH A;  4YK5 A;  2CNW D;  1WTY A;  1RJ9 B;  4CBE A;  4CIH A;  2XLE A;  3DJU B;  2BL2 A;  2OCC C;  2ZD9 A;  4DBR A;  3UGP A;  2EPO A;  2PF4 E;  3JRM O;  3NG1 A;  4KI2 A;  2IXN A;  2R03 A;  3C62 A;  5HV9 A;  2XLM A;  1J8Y F;  4W8K A;  4JRZ A;  2QY9 A;  2P1A A;  2YL3 A;  3K66 A;  3NRH A;  4I1M A;  1OCC C;  2L6H A;  4PFP A;  3W8I A;  2R7U A;  3U9M A;  5AC4 A;  4BEJ A;  1YZC A;  4Z9I A;  3W4Y A;  1NBB A;  2J9W A;  1M56 C;  3MX3 A;  2PNO A;  2OJE D;  2OEX A;  1MMA A;  1KU2 A;  4CS9 A;  4DVY P;  2GAQ A;  3E70 C;  3S84 A;  2PP4 A;  1U89 A;  2RSE B;  1HMO A;  4U5D E;  3S28 A;  3JYY A;  1ZVZ A;  1EKY A;  4FAP B;  4CS8 A;  1YYX A;  3V5X A;  4CIP A;  4KBL A;  1D0X A;  1JMW A;  2XS8 A;  4YN0 B;  4LLE A;  1TR2 A;  4FX5 A;  3S29 A;  2A6H F;  1LI7 A;  2HFI A;  2MHR A;  1YA9 A;  2CGE A;  2V3C C;  2R7V A;  4N6H A;  1N1C A;  3MYF A;  1OQC A;  2A68 F;  1CGM E;  1SR2 A;  4YT5 A;  1TKN A;  2X51 A;  3POV A;  1W2W A;  3WHN A;  2JD3 A;  3T6J A;  4W8P A;  3AG3 C;  3GWN A;  2XM4 A;  3GAN A;  3G4Z A;  1AEP A;  1Q0G A;  4FES A;  1B68 A;  4X0R A;  1Z3I X;  3G4X A;  4OIO F;  2XS1 A;  2R7Q A;  2XL6 A;  3IQC A;  2DYR C;  4PJL A;  4NQF A;  5D92 A;  5T3W A;  4U9E A;  4E7Z A;  5A6B A;  2A6E F;  5KYW A;  2VC9 A;  2LFD A;  2IXO A;  2IM8 A;  3KYJ A;  4A2N B;  3LLI A;  5A6A A;  2ASR A;  5JUA A;  3ATP A;  4MW3 A;  3EPV A;  5BQH A;  2HJM A;  4NC3 A;  4JCZ A;  2Q9A A;  3F46 A;  3JSZ A;  1ZHW A;  3C63 A;  2XLV A;  3KYI A;  2CNW A;  3N2Z B;  4MW8 A;  3O6X A;  3VRC A;  4IRU A;  1RKE A;  1HW1 A;  1E2X A;  3VF0 A;  4GEH A;  1L7C A;  3FHD A;  2AP3 A;  5KYW B;  3T6B A;  2HSQ A;  4HFF B;  3JRT A;  2OU6 A;  3K1I A;  3OA1 A;  4EBK A;  2ZPA A;  3O39 A;  1FFT C;  3UMK A;  3AQC A;  3F47 A;  2YKZ A;  3CSK A;  3M15 A;  4JJF A;  1LM3 B;  1V4A A;  4MTO A;  2J0W A;  3SXK A;  3EHM A;  3S27 A;  4IAQ A;  3L34 A;  1ZHY A;  3QVY A;  1DOV A;  2XLO A;  2YLD A;  3AQB A;  4ZLC A;  3MLG A;  4EKW A;  3N24 A;  1BDJ B;  4E17 A;  2XL4 A;  2HMZ A;  4MVU A;  4JJG A;  2ICW G;  4MVZ A;  4XPW A;  2EIK C;  3LS1 A;  1LS1 A;  5KYX B;  1HY5 A;  3C7J A;  2FFH A;  1FMV A;  1WOL A;  1Y6D A;  3ZIB A;  4MVO A;  4U5G A;  1EI7 A;  4JKV A;  3U3B A;  2LP4 A;  1ZHX A;  1G4W R;  3M1C B;  2Y39 A;  3RQF A;  1GQA A;  2R9R B;  4JVS A;  4NY3 A;  1MMG A;  3C8G D;  1DOW A;  5DQT A;  3UMH A;  4E7S A;  2EPL X;  2WZF A;  3W8H A;  4F4B A;  4HE8 D;  1XZQ A;  4YT4 A;  3S90 A;  3U9J A;  3T9O A;  4XLP F;  1CGO A;  4O6M A;  1OW8 A;  4IGG A;  4YL3 A;  4DJ9 A;  2P6V A;  2H7V C;  4B6I A;  3HNJ A;  3WOD F;  1K40 A;  1PD1 A;  1TWC A;  5AC5 A;  4G7O F;  4EHP A;  3EH1 A;  2HV6 A;  2WVN A;  2P61 A;  3PMR A;  4PR9 A;  1PCX A;  2F22 A;  2XLW A;  4RDA A;  2NSG A;  4DOZ A;  2I15 A;  4BJT A;  2HJ3 A;  1RXQ A;  3B9Q A;  3JSE O;  2R7O A;  3MBG A;  3SXZ A;  3UGO A;  5B1B C;  2W9Y A;  2YZS A;  4JW1 A;  5AGF A;  4CJG A;  2DGJ A;  3ECS A;  4C7O A;  1O87 A;  3SXM A;  3EGD A;  4RBN A;  2C03 A;  1T9K A;  2KC3 A;  2L6G A;  2O9X A;  1EQ1 A;  5A6J A;  3B0U X;  5E3C A;  3AOU A;  2WZL A;  5KYU A;  4CSA A;  1CGN A;  5DS4 A;  2BC5 A;  1VOM A;  2XXA A;  1YDI A;  1OW7 A;  1MMN A;  2Y3G A;  4PJJ A;  1SYQ A;  4J32 B;  5L0I A;  4XQ1 A;  1S7Z A;  3LUT B;  2GFH A;  2CDQ A;  2OQM A;  4PJN A;  1E83 A;  3R7C A;  3EGD B;  4YT8 A;  1BR2 A;  1WAS A;  4Z9J A;  4I44 A;  2Y69 C;  1O5H A;  1HE1 A;  1FTS A;  5KYU B;  2NPU A;  3AGU A;  2XXA B;  2YLG A;  3HNL A;  3GM2 A;  1ORJ A;  1LIH A;  1YJG A;  3FOP A;  4LLC A;  3PHF 2;  3MFN A;  2VCA A;  5DVW A;  3ABK C;  1Q0M A;  3X2Q C;  4UDV A;  3RVZ A;  1RMV A;  5KYY B;  3KKB A;  1Z23 A;  4WAB A;  2W45 A;  2AVK A;  1U6H A;  2Q7R A;  1NFO A;  4LDR A;  4BJ5 A;  2PFD A;  4MQ9 F;  2M4E A;  3B29 A;  4MTF A;  1NFN A;  1OW6 A;  1WWP A;  3K6B A;  3L0I A;  5BQG A;  3U8V A;  2Q00 A;  2NG1 A;  2G3V A;  1CPQ A;  3U5S A;  2ZXW C;  5COM A;  4C3B A;  1U0B B;  3C8G B;  1ZU5 A;  4MTG A;  2Q9C A;  3DXJ F;  2EPK X;  3AG1 C;  1OCR C;  3GEH A;  3M79 A;  3RIP A;  3ZG1 A;  1V54 C;  3W2W A;  4BG0 A;  4ULW A;  3VYW A;  2NSF A;  5A69 A;  1O3U A;  2J9U A;  1RCP A;  1TWA A;  2DI3 A;  2EPM X;  2OKU A;  3C18 A;  3NMK A;  4JEA A;  2LQG A;  3AGT A;  3X1O A;  3SEO A;  3KH2 A;  4EUK B;  3FAJ A;  3H2U A;  2VH3 A;  3ZTM A;  4O79 A;  4PFO A;  4EIY A;  2IXP A;  3H65 A;  2WVQ A;  2YEV A;  2DYS C;  3NKD A;  2A0B A;  4IWB A;  1FMW A;  3I4U A;  3LEO A;  3LEV A;  3V5Y A;  3K33 A;  3DAF A;  5EK0 A;  3ABM C;  2LIG A;  4BJ6 A;  1VK5 A;  3C8Z A;  3ZQY A;  1ZW2 A;  2LSE A;  4CDA A;  4XEF A;  3FOO A;  3AJM A;  1GM5 A;  2D5R B;  3AG2 C;  2J46 A;  1NZE A;  2PBE A;  4J7T A;  4ANJ A;  1VLS A;  1IZM A;  1NG1 A;  3FAP B;  2OG2 A;  3I5P A;  4CDV A;  2E87 A;  3IQ6 A;  2OOC A;  2EIL C;  2P7V A;  4NCQ A;  2RD9 A;  1KTM A;  1VB5 A;  2AWY A;  1G4U S;  3RQE A;  2QNL A;  3GEE A;  2WZG A;  3LNR A;  1APC A;  4DVZ A;  3LES A;  1LPE A;  2L6F A;  4DRI B;  2J45 A;  2KW3 C;  2HKV A;  3ASO C;  1LE2 A;  4K0D A;  3K1H A;  1VTM P;  4R32 A;  5BQI A;  2R7W A;  1BZ4 A;  3AG4 C;  3TQO A;  4WGY A;  3JCU Q;  1XWJ A;  4GYT A;  4QI0 A;  5JS5 A;  5COF A;  5DS5 A;  2EIN C;  2HMQ A;  3CEX A;  2WB7 A;  3FMS A;  3IEE A;  3NYM A;  5KYX A;  4OIR F;  4OIP F;  2ZXO A;  1K04 A;  3H2V A;  1I4Z A;  3HNK A;  2ZXP A;  4PJM A;  2VCB A;  2EPN A;  4PK4 A;  2XL8 A;  3DWW A;  4KNV A;  3CQZ A;  1NLX A;  1F1M A;  1IW7 F;  1YA7 O;  2FGY A;  3HKK A;  4MVQ A;  3RQG A;  1OKK D;  3EHN A;  3SYN A;  1G5Z A;  4MVM A;  5CIV A;  3RVY A;  3U2M A;  3GEI A;  1D1A A;  3US6 A;  4AE4 B;  1ZHT A;  3NYJ A;  4U5B E;  1YAU O;  5E33 A;  1EA8 A;  5F28 E;  1R5I D;  3ZDL A;  2GWW A;  1S05 A;  4JTC B; 
#chains in the Genus database with same CATH homology
 2XLE A;  1MQV A;  4L6R A;  3DE8 A;  4CX9 A;  1CGN A;  2BC5 A;  1QPU A;  2YLI A;  4IB4 A;  5JRA A;  3C62 A;  2XLM A;  2J8W A;  2YL3 A;  1E83 A;  4CDY A;  1YZC A;  4JEB A;  3ZWI A;  1E84 A;  1NBB A;  5JLI A;  2YLG A;  3HNL A;  3FOP A;  1CPR A;  1EKY A;  3M4C A;  1YYX A;  4CIP A;  5B3I A;  3ZTZ A;  3L1M A;  4N6H A;  4WGZ A;  4CJO A;  1E86 A;  2XM4 A;  1CPQ A;  3ZQV A;  3M4B A;  1A7V A;  2XL6 A;  1M6T A;  4U9E A;  1YYJ A;  4U9D A;  3M79 A;  2XLD A;  2XLH A;  1RCP A;  3QW0 A;  5JUA A;  3IQ5 A;  3NMK A;  4JEA A;  4ULV A;  4NC3 A;  256B A;  3C63 A;  2XLV A;  3ZTM A;  4EIY A;  3VRC A;  2CCY A;  2YL7 A;  4N4W A;  3NMJ A;  1E85 A;  3ZQY A;  2YKZ A;  2J9B A;  4CDA A;  3M15 A;  4IAR A;  1LM3 B;  4D4X A;  3FOO A;  5JVE A;  4IAQ A;  3QVY A;  5JT4 A;  2XLO A;  2YLD A;  4CDV A;  3IQ6 A;  1YZA A;  1BBH A;  3U8P A;  2YL0 A;  1APC A;  4JKV A;  1GQA A;  5JSL A;  3QW1 A;  1JAF A;  4ER9 A;  4WGY A;  3TOL A;  5JS5 A;  1CGO A;  1S05 A;  3NMI A;  4JE9 A;  1QQ3 A;  3HNK A;  3HNJ A;  3TOM A;  2XL8 A;  5JP7 A;  4D4N A;  2XLW A;  3QVZ A;  3DE9 A;  5AGF A;  4CJG A;  2XM0 A;  2QLA A;  2YL1 A;  3HNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...