3HNIA

Crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hniA00
4D4XA 4CJGA 2XM4A 5JUAA 4D4NA 3TOLA 1A7VA 1NBBA 1E86A 3C63A 3FOPA 1GQAA 3QW1A 2YL3A 4CDVA 1MQVA 4NC3A 2XLWA 4JEAA 3C62A 1CGOA 3TOMA 256BA 4L6RA 4IARA 3ZQVA 3ZTZA 2YL0A 2XL6A 5JVEA 3IQ6A 4WGYA 2XLHA 1CPQA 2QLAA 4JE9A 4CJOA 2YLGA 4WGZA 1BBHA 3HNJA 1RCPA 3QVYA 1S05A 2XLEA 3NMIA 3HNLA 2YL7A 5JRAA 4U9DA 2XL8A 3VRCA 5AGFA 4JKVA 4ULVA 5JLIA 4N6HA 3U8PA 4CX9A 1YYJA 2YL1A 3ZWIA 1QQ3A 5JS5A 2J8WA 2YLDA 3DE9A 2CCYA 4CDYA 1YZAA 3M79A 4U9EA 3NMKA 3HNKA 4JEBA 2YKZA 5JSLA 1E84A 3ZTMA 3L1MA 1YZCA 3ZQYA 2BC5A 2XLVA 2XLOA 3IQ5A 5B3IA 5JT4A 4ER9A 3HNIA 1YYXA 1APCA 4CIPA 3NMJA 4N4WA 5JP7A 1M6TA 1QPUA 3M15A 2J9BA 3M4BA 2YLIA 2XLDA 3M4CA 3QVZA 4IB4A 1E85A 1CGNA 1LM3B 3QW0A 2XLMA 4EIYA 4IAQA 1CPRA 2XM0A 1JAFA 3FOOA 3DE8A 1E83A 1EKYA 4CDAA
chains in the Genus database with same CATH superfamily
2VCBA 3ABMC 3B71A 3T6JA 4F4BA 3EQLF 4C7OA 2NUTB 2XM4A 2XRHA 1N1CA 3NYLA 4EBBA 3C18A 1VYKA 3QTHA 4WJ0A 2Z15A 3SXYA 4BEMJ 3EHNA 3W8IA 3DJNB 1A7EA 3E9VA 3VM6A 5A6BD 4JRZA 3IQCA 3NG1A 1NFOA 1JRAA 4U5EE 3SNHA 4D4NA 2VB6A 2CNWD 3Q7LA 3S9OA 1V54C 4ZLCA 1ZHYA 4CS8A 2A69F 1OW6A 2Y69C 5E33A 3X2QC 3N0TA 2L6HA 4O6YA 4YT2A 4KI2A 5EK0A 1G8XA 1ZVZA 3RQFA 1T9KA 3C63A 1FR0A 1U0BB 5F5FA 3QW1A 3LLIA 1G4US 2NSFA 3FMSA 4NTFA 4G7HF 3ECSA 1KNYA 1XZPA 1ORJA 4NC3A 2CW0F 4PFPA 4RDAA 2GWWA 1QZXA 4BG0A 2WVNA 3ZIBA 2EPNA 1JPJA 3EH1A 1GM5A 3NDBB 3NKEA 1WN0A 2EILC 2IXMA 3S28A 3LUTB 5B3SC 5COMA 2KJGA 2W9YA 4LDQA 1NU9C 3RW0A 3EGXA 4JCZA 2HJ3A 2XL4A 4DJ9A 4MTGA 4RD9A 1MMGA 2D5RB 1CPQA 5GPGB 1D0XA 3GM2A 3X1OA 2LQGA 2PX0A 1ZU5A 2YLGA 4G78A 4JE9A 4ULWA 5D91A 4AE4B 2PX3A 4CJOA 4MVRA 4YT8A 5KYWB 1BBHA 4W8KA 4BJ6C 1RCPA 2Q9CA 2LD6A 5TJ5E 1SF8A 1JPNA 2YL7A 5JRAA 3I5PA 3DI5A 4JVSA 5FZTA 3BRJA 1VLTA 3L0IA 3DKAA 3RYLA 2EINC 3UNGC 4GQHA 4ULVA 1WGWA 1YDIA 4N6HA 4CX9A 4BJ5A 2YL1A 1QQ3A 1HE1A 4J30B 2J8WA 1NZEA 4J7TA 3OWTA 3JT1A 5KYNA 3S84A 2LIGA 3ABKC 4MVSA 1UFBA 2ZD9A 2Q3TA 1WATA 1W2WA 2FAPB 2RD9A 2CCYA 4BJTA 4CDYA 3AQBA 1UG7A 2HUJA 3MX3A 1OXBA 3HNKA 2KSFA 1LVKA 2YKZA 5AC5A 5L0HA 1CGME 3ZTMA 3EPVA 1WASA 4RBNA 3TJ5A 4Q4ZF 2ZXWC 2BC5A 1D1AA 3OA1A 2XLVA 3AG4C 2XLOA 4FX5A 1QKRA 4JURI 1Z6AA 4DRJB 5B3IA 4MTOA 5L0JA 4XEKA 1OR2A 1TKNA 3HNIA 2WZFA 4MVMA 1APCA 3VYWA 2PBEA 5HSWA 4OIOF 2R7UA 4XWJA 3LLKA 1TR2A 1WOLA 1ZHXA 2H7BA 4PR9A 2KNHA 1EI7A 4DBRA 3L8IA 2H7VC 1M6TA 3N24A 1RKEA 1ZU4A 2HMZA 1IZMA 2L81A 1QPUA 3W2VA 2L6GA 2J9BA 4JC7A 1XWJA 3LEOA 2KC3A 1K04A 4AL1A 4I1OB 2P0NA 3CZ6A 3SYNA 1CGNA 3J06A 1VLSA 3IHUA 4Z9HA 3U3FA 4IAQA 3WODF 4MTFA 1CPRA 3UMKA 1H9GA 4O79A 3K1HA 3RVYA 3K7DA 4H54A 1NG1A 2B0HA 4U5DE 1M2VB 2J7PA 2P7VA 2G3KA 5KYUA 3UGPA 2R7SA 2OEVA 5AC4A 3FOOA 2CGEA 3DE8A 1LS1A 4LACB 4EKWA 4CDAA 1D1CA 4CJGA 1QSPA 2C03A 1HE9A 1BDJB 5KYYB 1YAUO 4M63A 4CS9C 4DRIB 1Z7Qc 4CSAA 2HZ8A 3I4UA 3RVZA 5CIVA 3DD7A 3HLZA 3U3BA 4XPXA 1MNDA 2LFDA 5JUAA 2JD3A 2E87A 3B0PA 4J7YA 1C02A 3DMDA 4U5HA 2AWYA 2H8AA 4OIRF 1A7VA 1NBBA 3DZAA 5B1BC 4OIQF 4AX2A 1E86A 1VMAA 2HSBA 3O55A 4IWBA 1NFNA 2BE5F 1I4YA 1OQCA 3I5QA 4XPYA 5T3TA 2B0JA 3RQEA 3GM1A 4CDVA 2YQYA 1M2OA 1MMAA 2XS8A 5FCLA 1MQVA 4Q7CA 1LS4A 1T01A 4JEAA 3EFOA 5A69A 2FGYA 5D92A 1OW7A 2Q9BA 3C62A 3GEHA 4J32B 4C3BA 2L9JA 3ASNC 4NQFA 4OD4A 4YJWA 3ZQVA 4DXWA 4EHPA 5L0IA 5F28E 2W4MA 2V26A 2YL0A 1L3PA 2AP3A 1TWGA 2XL6A 3A11A 3KYIA 3NYJA 3UGOA 2R9RB 4U5FE 4X0RA 1FFTC 3SXKA 4P9TA 3S0XA 4IGGA 2VH3A 3U9JA 3FXHA 2X0CA 4MNDA 1AUEA 1FMVA 3KH2A 1RJ9B 3POVA 3HNJA 4MVUA 2TMVP 4A4AA 4KNWA 2HMQA 3MYIA 5DLJA 3H2UA 1T6IA 2MYSA 1TQGA 2XLEA 3H65A 1O5HA 3NMIA 4I3MA 4AK9A 4ANJA 4YK5A 1Q0MA 3AGUA 3JZ0A 4U9DA 1Q0KA 2J0WA 1H7IA 1VB5A 4OD5A 5AGFA 2Q00A 3GEIA 2LSEA 3W4YA 2Y3HA 4JW1A 2CYDA 2LP4A 3AG1C 4DOZA 3R7CA 2BL2A 4DRHB 1J8YF 2ZXRA 1ZZPA 2M4EA 3JCUQ 3HTKC 3TULA 2O9XA 1HY5A 2YLDA 1EQ1A 4U5BE 2J46A 2Y3BA 2ZXOA 3NKDA 3TD7A 4CBEA 3Q7GA 1SR2A 1ZHTA 4U9EA 2DYSC 2L6FA 2YHSA 2C04A 3T6GB 4JTDB 2XXAB 2HS5A 3MLGA 5JSLA 4ONSA 3H2VA 2GDCA 4YL1A 1Y6DA 2PF4E 4HEAJ 1A0BA 2DYRC 2QE9A 2J45A 3EGDA 2XS1A 4N6CA 1WWPA 3RH3A 3PHF2 2DI3A 5JT4A 3A9CA 3K1IA 3ZG1A 4G0HA 1NSGB 2NUPB 1Q0DA 5BQGA 5EGYA 3WG7C 2JX0A 2G3VA 1FTSA 1LIHA 1Z23A 2IOQA 1E2XA 3DWWA 3WAQA 4E7ZA 3C7JA 1OCZC 1ZW2A 2LFFA 5COGA 2V3CC 2DB4A 2OEXA 4N4WA 5KYXB 3SEOA 4E18A 2YZSA 4YL0A 4XEVA 3V5XA 5BUOA 4NCQA 3KKBA 5L3QA 2NUTA 4CIHA 4DBQA 4IB4A 3NRHA 3C8GB 3U8VA 3ZQYA 1U6HA 3QW0A 2XLMA 2GA0A 3M1CB 4LLCA 1A41A 2DGJA 1M57C 2HFIA 4K7BA 5DVWA 1JMWA 3T6BA 1Y4CA 1TWHA 4XQ1A 1DOWA 4OIPF 4CS8C 2I8BA 2I15A 3LJBA 1OR3A 3GEEA 2R7VA 1F1MA 3K66A 4K0DA 1EKYA 1JR8A 5A6KA 3JRTA 4D4XA 3DAGA 3HJCA 4JZAA 2IYLD 2J0XA 4C3DA 4EWCA 2P61A 2WB7A 3EG9B 4KNVA 4LLEA 3G50A 2ZXPA 4U5CE 1XZQA 3PCVA 2IXNA 1D0YA 1U89A 3JYHA 2EPOA 3ATPA 2QY9A 4P9FA 1ZYRF 3K33A 2HJMA 4YL3A 1G4WR 3TOLA 4UDVA 1ZHWA 5DQTA 2ICWG 1TFOB 1PCXA 2OKUA 3SXMA 2EPLX 3S29A 2WL8A 4OINF 3B0UX 3BEHA 1D1BA 3KPHA 1FAPB 2R05A 1BR2A 2Y3GA 5KYYA 2R25A 1YJGA 1LE2A 4FWVA 4I44A 4O7GA 4C7OB 2YWAA 4XTKA 3W8HA 4AE4A 5KYWA 4HFFB 3SZRA 2R7TA 2J9WA 5L0DA 3B0VC 2XLWA 4XPWA 4Z9JA 3UR3C 1Q0FA 5COFA 1KU2A 1LKXA 3TOMA 1B68A 4IARA 2LK4A 4L6RA 1JOGA 4XLNF 3ZTZA 4AL0A 4JIOA 2KGOA 1VYIA 3WHNA 5JVEA 4BJ5C 2IXOA 1FNTc 2A6EF 3LS1A 2R7XA 2KYHA 2XLHA 3FDQA 3DXJF 2J7PD 3GODA 1T5OA 2J9UA 3CQZA 1T6UA 3F47A 4E7SA 1BR4A 5BQIA 5L0CA 4O6NA 1QVXA 3UMHA 3MFNA 4GYTA 1LI7A 3AG2C 4NTAA 1GGQA 3QVYA 4CS7A 2NG1A 2P1AA 5L3VA 3AQCA 4JJFA 3HNLA 4LDKA 5CI9A 1FMWA 3E70C 1M56C 1VOMA 1R4TA 3EHMA 2OCCC 4JKVA 4G7ZF 5JLIA 1WTYA 2OQMA 3U8PA 1YYJA 3RKOF 3EGXB 3IEEA 1I5NA 3ZWIA 1T6QA 5E2QA 1AEPA 1C17M 3EZHA 3GANA 5JS5A 4MS2A 5E3CA 4R32A 1H6GA 1ST6A 3EJNA 4P6IC 4QI0A 4KC9A 5HV9A 1AVOB 4BJ6A 2A1DD 1LI5A 1BZ4A 3JSEO 2A0UA 4U5GA 2AVKA 3M79A 2F22A 4LERA 1O87A 2LCHA 4E0IA 1E84A 3JRMO 2HV6A 5T1DB 3L1MA 4MVZA 1YZCA 5A6BA 4I1MA 5DS5A 3V5ZA 2P6VA 3O39A 3DM9B 4GEHA 2UUHA 1Z63A 4PJNA 1R5ID 4ER9A 1J8MF 3ABLC 2XSEA 3Q6NA 1QLEC 2L7AA 1YYXA 4NY3A 3TQOA 3AJMA 2Q7RA 1HMOA 3SP1A 1M2VA 2PFDA 3LS0A 4BEJA 3JTLO 1ZW3A 2R03A 4CIPA 1S7ZA 3Q6MA 3O6XA 1ORYA 1TFKB 3NMJA 4YN0B 5CI8A 1G5ZA 2X51A 3M15A 3M4BA 3RIPA 1SYQA 1OCRC 3M4CA 3MYFA 1YARO 4DVZA 3U2MA 1LM3B 2YEVA 3FVYA 3JYYA 1Q0GA 3AOUA 2JPUA 3US6A 4CSAC 1SMYF 3ZC4A 2XM0A 3HKKA 2YRFA 4PK4A 3RF3A 3ZSUA 5A6JA 2YVKA 4FAPB 1HW1A 1YA9A 2VC9A 2R7WA 2EPKX 3GWLA 3V5YA 1O3UA 2AU5A 1HMDA 3ASOC 3LNRA 1E83A 1OKKA 4ZLDA 3UMIA 1RKEB 4C3EA 4YT5A 2Y3DA 1YVIA 2ASRA 4PJJA 3PMRA 3FHDA 4WABA 4MW8A 4MVOA 3U5SA 3S90A 5A6AA 3C8ZA 1RXQA 2QTVA 2GFHA 2A0BA 2WZGA 3EZIA 4IJJA 3U2LA 4G7OF 3AGTA 4JTCB 4PACA 4YT4A 3MBGA 1D0ZA 2EIMC 4N06A 2VASA 2EIKC 2OJQA 3L8JA 1RKCA 3N2ZB 4NTBA 5KYUB 3NYMA 1OKKD 5BQHA 3U0CA 2R7OA 3OEOA 5F5HA 1BR1A 4EUKB 3S27A 2HSQA 5DS6A 3FOPA 3CEXA 1GQAA 2NSGA 1YLMA 2IM8A 2RSEB 3QMKA 1C03A 1V4AA 5DQZA 2MWQA 4YWQA 2YL3A 1RJ9A 1NU7D 2IBFA 4CS9A 1Z5ZA 4IAOA 4JCHA 2OOCA 3DAFA 5L0GA 2A6HF 3TJ6A 2R7QA 2QNLA 1CGOA 256BA 1OCCC 1SZIA 2Q4FA 2Q9AA 1MMNA 1VTMP 4Q5SF 1IW7F 3IQ6A 3LAYA 4WGYA 4A2NB 2EPMX 2W4BA 3KMIA 2QLAA 1OXKA 4WGZA 5K0IA 2ZPAA 2PP4A 4PFOA 1VK5A 1TWCA 4JJGA 2EIJC 4K1OA 1I4ZA 1GS9A 1K05A 1PD1A 1S05A 4MVQA 3EFOB 3ZDLA 2A68F 3EH2A 5DS4A 3R2PA 2XXAA 2J9VA 4FESA 2XL8A 3VRCA 2WVQA 3GM3A 3IPMO 1L7CA 1Z3IX 4B6IA 4XLPF 4H4KC 3V7OA 3SXZA 3KL4A 2MHRA 4HFKB 1FFHA 2CDQA 2WVOA 3ITFA 4QDLA 3TK0A 4KBLA 1DOVA 2VCAA 3KYJA 2H7OA 3K1IC 3K6BA 5E3AA 2G62A 1MMDA 3DJUB 2KK1A 3FAPB 4HE8D 2NUPA 1RMVA 1MNEA 2FFHA 2UUIA 3GORA 3DE9A 1ORSC 3B9QA 3CAXA 1YZAA 2W45A 1PD0A 4E0HA 3B29A 3NMKA 4MQ9F 3T9OA 4JEBA 3CSKA 5KYXA 1H9TA 3F46A 2HKVA 1KTMA 3O10A 3VAYA 3LNMB 3W2WA 2AWCA 1YA7O 3LESA 3ZVRA 4BJ1A 3FAJA 3IQ5A 4BPMA 2OU6A 5T3WA 1OW8A 4QI2A 3AG3C 1EA8A 3C8GA 4EBJA 1TWAA 2KQ9A 1V55C 1OCOC 5B1AC 1A7DA 5IY5C 3RFYA 3QZCA 3JSZA 4XEFA 3GWNA 2QUPA 1LPEA 2OG2A 5L0FA 2D4UA 3LEVA 4LDRA 3PDMP 4IRUA 2M64A 4Z9IA 1V74B 2YLIA 3EGDB 2R02A 2XLDA 2PNOA 3C8GD 1LE4A 3DM5A 3EG9A 4DVYP 1K40A 2OJED 2WZLA 3QVZA 2NPUA 1ZHZA 4MW3A 2ETSA 2HV7A 1E85A 2R7RA 4EIYA 5EHHA 4W8PA 3RQGA 3U9MA 3VF0A 3G4XA 4PJLA 2GAQA 4E17A 2KW3C 1JAFA 3T4RA 3G4ZA 3IQTA 2IXPA 1NLXA 3L34A 4EBKA 5JP7A 2CNWA 4PJMA 1PV3A 2Y39A 1HW2A 4JTAB 4O6MA 2VCCA
chains in the Genus database with same CATH topology
4D4XA 4CJGA 2XM4A 5JUAA 4D4NA 3TOLA 1A7VA 1NBBA 1E86A 3C63A 3FOPA 1GQAA 3QW1A 2YL3A 4CDVA 1MQVA 4NC3A 2XLWA 4JEAA 3C62A 1CGOA 3TOMA 256BA 4L6RA 4IARA 3ZQVA 3ZTZA 2YL0A 2XL6A 5JVEA 3IQ6A 4WGYA 2XLHA 1CPQA 2QLAA 4JE9A 4CJOA 2YLGA 4WGZA 1BBHA 3HNJA 1RCPA 3QVYA 1S05A 2XLEA 3NMIA 3HNLA 2YL7A 5JRAA 4U9DA 2XL8A 3VRCA 5AGFA 4JKVA 4ULVA 5JLIA 4N6HA 3U8PA 4CX9A 1YYJA 2YL1A 3ZWIA 1QQ3A 5JS5A 2J8WA 2YLDA 3DE9A 2CCYA 4CDYA 1YZAA 3M79A 4U9EA 3NMKA 3HNKA 4JEBA 2YKZA 5JSLA 1E84A 3ZTMA 3L1MA 1YZCA 3ZQYA 2BC5A 2XLVA 2XLOA 3IQ5A 5B3IA 5JT4A 4ER9A 3HNIA 1YYXA 1APCA 4CIPA 3NMJA 4N4WA 5JP7A 1M6TA 1QPUA 3M15A 2J9BA 3M4BA 2YLIA 2XLDA 3M4CA 3QVZA 4IB4A 1E85A 1CGNA 1LM3B 3QW0A 2XLMA 4EIYA 4IAQA 1CPRA 2XM0A 1JAFA 3FOOA 3DE8A 1E83A 1EKYA 4CDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4X A;  4CJG A;  2XM4 A;  5JUA A;  4D4N A;  3TOL A;  1A7V A;  1NBB A;  1E86 A;  3C63 A;  3FOP A;  1GQA A;  3QW1 A;  2YL3 A;  4CDV A;  1MQV A;  4NC3 A;  2XLW A;  4JEA A;  3C62 A;  1CGO A;  3TOM A;  256B A;  4L6R A;  4IAR A;  3ZQV A;  3ZTZ A;  2YL0 A;  2XL6 A;  5JVE A;  3IQ6 A;  4WGY A;  2XLH A;  1CPQ A;  2QLA A;  4JE9 A;  4CJO A;  2YLG A;  4WGZ A;  1BBH A;  3HNJ A;  1RCP A;  3QVY A;  1S05 A;  2XLE A;  3NMI A;  3HNL A;  2YL7 A;  5JRA A;  4U9D A;  2XL8 A;  3VRC A;  5AGF A;  4JKV A;  4ULV A;  5JLI A;  4N6H A;  3U8P A;  4CX9 A;  1YYJ A;  2YL1 A;  3ZWI A;  1QQ3 A;  5JS5 A;  2J8W A;  2YLD A;  3DE9 A;  2CCY A;  4CDY A;  1YZA A;  3M79 A;  4U9E A;  3NMK A;  3HNK A;  4JEB A;  2YKZ A;  5JSL A;  1E84 A;  3ZTM A;  3L1M A;  1YZC A;  3ZQY A;  2BC5 A;  2XLV A;  2XLO A;  3IQ5 A;  5B3I A;  5JT4 A;  4ER9 A;  3HNI A;  1YYX A;  1APC A;  4CIP A;  3NMJ A;  4N4W A;  5JP7 A;  1M6T A;  1QPU A;  3M15 A;  2J9B A;  3M4B A;  2YLI A;  2XLD A;  3M4C A;  3QVZ A;  4IB4 A;  1E85 A;  1CGN A;  1LM3 B;  3QW0 A;  2XLM A;  4EIY A;  4IAQ A;  1CPR A;  2XM0 A;  1JAF A;  3FOO A;  3DE8 A;  1E83 A;  1EKY A;  4CDA A; 
#chains in the Genus database with same CATH topology
 2VCB A;  3ABM C;  3B71 A;  3T6J A;  4F4B A;  3EQL F;  4C7O A;  2NUT B;  2XM4 A;  2XRH A;  1N1C A;  3NYL A;  4EBB A;  3C18 A;  1VYK A;  3QTH A;  4WJ0 A;  2Z15 A;  3SXY A;  4BEM J;  3EHN A;  3W8I A;  3DJN B;  1A7E A;  3E9V A;  3VM6 A;  5A6B D;  4JRZ A;  3IQC A;  3NG1 A;  1NFO A;  1JRA A;  4U5E E;  3SNH A;  4D4N A;  2VB6 A;  2CNW D;  3Q7L A;  3S9O A;  1V54 C;  4ZLC A;  1ZHY A;  4CS8 A;  2A69 F;  1OW6 A;  2Y69 C;  5E33 A;  3X2Q C;  3N0T A;  2L6H A;  4O6Y A;  4YT2 A;  4KI2 A;  5EK0 A;  1G8X A;  1ZVZ A;  3RQF A;  1T9K A;  3C63 A;  1FR0 A;  1U0B B;  5F5F A;  3QW1 A;  3LLI A;  1G4U S;  2NSF A;  3FMS A;  4NTF A;  4G7H F;  3ECS A;  1KNY A;  1XZP A;  1ORJ A;  4NC3 A;  2CW0 F;  4PFP A;  4RDA A;  2GWW A;  1QZX A;  4BG0 A;  2WVN A;  3ZIB A;  2EPN A;  1JPJ A;  3EH1 A;  1GM5 A;  3NDB B;  3NKE A;  1WN0 A;  2EIL C;  2IXM A;  3S28 A;  3LUT B;  5B3S C;  5COM A;  2KJG A;  2W9Y A;  4LDQ A;  1NU9 C;  3RW0 A;  3EGX A;  4JCZ A;  2HJ3 A;  2XL4 A;  4DJ9 A;  4MTG A;  4RD9 A;  1MMG A;  2D5R B;  1CPQ A;  5GPG B;  1D0X A;  3GM2 A;  3X1O A;  2LQG A;  2PX0 A;  1ZU5 A;  2YLG A;  4G78 A;  4JE9 A;  4ULW A;  5D91 A;  4AE4 B;  2PX3 A;  4CJO A;  4MVR A;  4YT8 A;  5KYW B;  1BBH A;  4W8K A;  4BJ6 C;  1RCP A;  2Q9C A;  2LD6 A;  5TJ5 E;  1SF8 A;  1JPN A;  2YL7 A;  5JRA A;  3I5P A;  3DI5 A;  4JVS A;  5FZT A;  3BRJ A;  1VLT A;  3L0I A;  3DKA A;  3RYL A;  2EIN C;  3UNG C;  4GQH A;  4ULV A;  1WGW A;  1YDI A;  4N6H A;  4CX9 A;  4BJ5 A;  2YL1 A;  1QQ3 A;  1HE1 A;  4J30 B;  2J8W A;  1NZE A;  4J7T A;  3OWT A;  3JT1 A;  5KYN A;  3S84 A;  2LIG A;  3ABK C;  4MVS A;  1UFB A;  2ZD9 A;  2Q3T A;  1WAT A;  1W2W A;  2FAP B;  2RD9 A;  2CCY A;  4BJT A;  4CDY A;  3AQB A;  1UG7 A;  2HUJ A;  3MX3 A;  1OXB A;  3HNK A;  2KSF A;  1LVK A;  2YKZ A;  5AC5 A;  5L0H A;  1CGM E;  3ZTM A;  3EPV A;  1WAS A;  4RBN A;  3TJ5 A;  4Q4Z F;  2ZXW C;  2BC5 A;  1D1A A;  3OA1 A;  2XLV A;  3AG4 C;  2XLO A;  4FX5 A;  1QKR A;  4JUR I;  1Z6A A;  4DRJ B;  5B3I A;  4MTO A;  5L0J A;  4XEK A;  1OR2 A;  1TKN A;  3HNI A;  2WZF A;  4MVM A;  1APC A;  3VYW A;  2PBE A;  5HSW A;  4OIO F;  2R7U A;  4XWJ A;  3LLK A;  1TR2 A;  1WOL A;  1ZHX A;  2H7B A;  4PR9 A;  2KNH A;  1EI7 A;  4DBR A;  3L8I A;  2H7V C;  1M6T A;  3N24 A;  1RKE A;  1ZU4 A;  2HMZ A;  1IZM A;  2L81 A;  1QPU A;  3W2V A;  2L6G A;  2J9B A;  4JC7 A;  1XWJ A;  3LEO A;  2KC3 A;  1K04 A;  4AL1 A;  4I1O B;  2P0N A;  3CZ6 A;  3SYN A;  1CGN A;  3J06 A;  1VLS A;  3IHU A;  4Z9H A;  3U3F A;  4IAQ A;  3WOD F;  4MTF A;  1CPR A;  3UMK A;  1H9G A;  4O79 A;  3K1H A;  3RVY A;  3K7D A;  4H54 A;  1NG1 A;  2B0H A;  4U5D E;  1M2V B;  2J7P A;  2P7V A;  2G3K A;  5KYU A;  3UGP A;  2R7S A;  2OEV A;  5AC4 A;  3FOO A;  2CGE A;  3DE8 A;  1LS1 A;  4LAC B;  4EKW A;  4CDA A;  1D1C A;  4CJG A;  1QSP A;  2C03 A;  1HE9 A;  1BDJ B;  5KYY B;  1YAU O;  4M63 A;  4CS9 C;  4DRI B;  1Z7Q c;  4CSA A;  2HZ8 A;  3I4U A;  3RVZ A;  5CIV A;  3DD7 A;  3HLZ A;  3U3B A;  4XPX A;  1MND A;  2LFD A;  5JUA A;  2JD3 A;  2E87 A;  3B0P A;  4J7Y A;  1C02 A;  3DMD A;  4U5H A;  2AWY A;  2H8A A;  4OIR F;  1A7V A;  1NBB A;  3DZA A;  5B1B C;  4OIQ F;  4AX2 A;  1E86 A;  1VMA A;  2HSB A;  3O55 A;  4IWB A;  1NFN A;  2BE5 F;  1I4Y A;  1OQC A;  3I5Q A;  4XPY A;  5T3T A;  2B0J A;  3RQE A;  3GM1 A;  4CDV A;  2YQY A;  1M2O A;  1MMA A;  2XS8 A;  5FCL A;  1MQV A;  4Q7C A;  1LS4 A;  1T01 A;  4JEA A;  3EFO A;  5A69 A;  2FGY A;  5D92 A;  1OW7 A;  2Q9B A;  3C62 A;  3GEH A;  4J32 B;  4C3B A;  2L9J A;  3ASN C;  4NQF A;  4OD4 A;  4YJW A;  3ZQV A;  4DXW A;  4EHP A;  5L0I A;  5F28 E;  2W4M A;  2V26 A;  2YL0 A;  1L3P A;  2AP3 A;  1TWG A;  2XL6 A;  3A11 A;  3KYI A;  3NYJ A;  3UGO A;  2R9R B;  4U5F E;  4X0R A;  1FFT C;  3SXK A;  4P9T A;  3S0X A;  4IGG A;  2VH3 A;  3U9J A;  3FXH A;  2X0C A;  4MND A;  1AUE A;  1FMV A;  3KH2 A;  1RJ9 B;  3POV A;  3HNJ A;  4MVU A;  2TMV P;  4A4A A;  4KNW A;  2HMQ A;  3MYI A;  5DLJ A;  3H2U A;  1T6I A;  2MYS A;  1TQG A;  2XLE A;  3H65 A;  1O5H A;  3NMI A;  4I3M A;  4AK9 A;  4ANJ A;  4YK5 A;  1Q0M A;  3AGU A;  3JZ0 A;  4U9D A;  1Q0K A;  2J0W A;  1H7I A;  1VB5 A;  4OD5 A;  5AGF A;  2Q00 A;  3GEI A;  2LSE A;  3W4Y A;  2Y3H A;  4JW1 A;  2CYD A;  2LP4 A;  3AG1 C;  4DOZ A;  3R7C A;  2BL2 A;  4DRH B;  1J8Y F;  2ZXR A;  1ZZP A;  2M4E A;  3JCU Q;  3HTK C;  3TUL A;  2O9X A;  1HY5 A;  2YLD A;  1EQ1 A;  4U5B E;  2J46 A;  2Y3B A;  2ZXO A;  3NKD A;  3TD7 A;  4CBE A;  3Q7G A;  1SR2 A;  1ZHT A;  4U9E A;  2DYS C;  2L6F A;  2YHS A;  2C04 A;  3T6G B;  4JTD B;  2XXA B;  2HS5 A;  3MLG A;  5JSL A;  4ONS A;  3H2V A;  2GDC A;  4YL1 A;  1Y6D A;  2PF4 E;  4HEA J;  1A0B A;  2DYR C;  2QE9 A;  2J45 A;  3EGD A;  2XS1 A;  4N6C A;  1WWP A;  3RH3 A;  3PHF 2;  2DI3 A;  5JT4 A;  3A9C A;  3K1I A;  3ZG1 A;  4G0H A;  1NSG B;  2NUP B;  1Q0D A;  5BQG A;  5EGY A;  3WG7 C;  2JX0 A;  2G3V A;  1FTS A;  1LIH A;  1Z23 A;  2IOQ A;  1E2X A;  3DWW A;  3WAQ A;  4E7Z A;  3C7J A;  1OCZ C;  1ZW2 A;  2LFF A;  5COG A;  2V3C C;  2DB4 A;  2OEX A;  4N4W A;  5KYX B;  3SEO A;  4E18 A;  2YZS A;  4YL0 A;  4XEV A;  3V5X A;  5BUO A;  4NCQ A;  3KKB A;  5L3Q A;  2NUT A;  4CIH A;  4DBQ A;  4IB4 A;  3NRH A;  3C8G B;  3U8V A;  3ZQY A;  1U6H A;  3QW0 A;  2XLM A;  2GA0 A;  3M1C B;  4LLC A;  1A41 A;  2DGJ A;  1M57 C;  2HFI A;  4K7B A;  5DVW A;  1JMW A;  3T6B A;  1Y4C A;  1TWH A;  4XQ1 A;  1DOW A;  4OIP F;  4CS8 C;  2I8B A;  2I15 A;  3LJB A;  1OR3 A;  3GEE A;  2R7V A;  1F1M A;  3K66 A;  4K0D A;  1EKY A;  1JR8 A;  5A6K A;  3JRT A;  4D4X A;  3DAG A;  3HJC A;  4JZA A;  2IYL D;  2J0X A;  4C3D A;  4EWC A;  2P61 A;  2WB7 A;  3EG9 B;  4KNV A;  4LLE A;  3G50 A;  2ZXP A;  4U5C E;  1XZQ A;  3PCV A;  2IXN A;  1D0Y A;  1U89 A;  3JYH A;  2EPO A;  3ATP A;  2QY9 A;  4P9F A;  1ZYR F;  3K33 A;  2HJM A;  4YL3 A;  1G4W R;  3TOL A;  4UDV A;  1ZHW A;  5DQT A;  2ICW G;  1TFO B;  1PCX A;  2OKU A;  3SXM A;  2EPL X;  3S29 A;  2WL8 A;  4OIN F;  3B0U X;  3BEH A;  1D1B A;  3KPH A;  1FAP B;  2R05 A;  1BR2 A;  2Y3G A;  5KYY A;  2R25 A;  1YJG A;  1LE2 A;  4FWV A;  4I44 A;  4O7G A;  4C7O B;  2YWA A;  4XTK A;  3W8H A;  4AE4 A;  5KYW A;  4HFF B;  3SZR A;  2R7T A;  2J9W A;  5L0D A;  3B0V C;  2XLW A;  4XPW A;  4Z9J A;  3UR3 C;  1Q0F A;  5COF A;  1KU2 A;  1LKX A;  3TOM A;  1B68 A;  4IAR A;  2LK4 A;  4L6R A;  1JOG A;  4XLN F;  3ZTZ A;  4AL0 A;  4JIO A;  2KGO A;  1VYI A;  3WHN A;  5JVE A;  4BJ5 C;  2IXO A;  1FNT c;  2A6E F;  3LS1 A;  2R7X A;  2KYH A;  2XLH A;  3FDQ A;  3DXJ F;  2J7P D;  3GOD A;  1T5O A;  2J9U A;  3CQZ A;  1T6U A;  3F47 A;  4E7S A;  1BR4 A;  5BQI A;  5L0C A;  4O6N A;  1QVX A;  3UMH A;  3MFN A;  4GYT A;  1LI7 A;  3AG2 C;  4NTA A;  1GGQ A;  3QVY A;  4CS7 A;  2NG1 A;  2P1A A;  5L3V A;  3AQC A;  4JJF A;  3HNL A;  4LDK A;  5CI9 A;  1FMW A;  3E70 C;  1M56 C;  1VOM A;  1R4T A;  3EHM A;  2OCC C;  4JKV A;  4G7Z F;  5JLI A;  1WTY A;  2OQM A;  3U8P A;  1YYJ A;  3RKO F;  3EGX B;  3IEE A;  1I5N A;  3ZWI A;  1T6Q A;  5E2Q A;  1AEP A;  1C17 M;  3EZH A;  3GAN A;  5JS5 A;  4MS2 A;  5E3C A;  4R32 A;  1H6G A;  1ST6 A;  3EJN A;  4P6I C;  4QI0 A;  4KC9 A;  5HV9 A;  1AVO B;  4BJ6 A;  2A1D D;  1LI5 A;  1BZ4 A;  3JSE O;  2A0U A;  4U5G A;  2AVK A;  3M79 A;  2F22 A;  4LER A;  1O87 A;  2LCH A;  4E0I A;  1E84 A;  3JRM O;  2HV6 A;  5T1D B;  3L1M A;  4MVZ A;  1YZC A;  5A6B A;  4I1M A;  5DS5 A;  3V5Z A;  2P6V A;  3O39 A;  3DM9 B;  4GEH A;  2UUH A;  1Z63 A;  4PJN A;  1R5I D;  4ER9 A;  1J8M F;  3ABL C;  2XSE A;  3Q6N A;  1QLE C;  2L7A A;  1YYX A;  4NY3 A;  3TQO A;  3AJM A;  2Q7R A;  1HMO A;  3SP1 A;  1M2V A;  2PFD A;  3LS0 A;  4BEJ A;  3JTL O;  1ZW3 A;  2R03 A;  4CIP A;  1S7Z A;  3Q6M A;  3O6X A;  1ORY A;  1TFK B;  3NMJ A;  4YN0 B;  5CI8 A;  1G5Z A;  2X51 A;  3M15 A;  3M4B A;  3RIP A;  1SYQ A;  1OCR C;  3M4C A;  3MYF A;  1YAR O;  4DVZ A;  3U2M A;  1LM3 B;  2YEV A;  3FVY A;  3JYY A;  1Q0G A;  3AOU A;  2JPU A;  3US6 A;  4CSA C;  1SMY F;  3ZC4 A;  2XM0 A;  3HKK A;  2YRF A;  4PK4 A;  3RF3 A;  3ZSU A;  5A6J A;  2YVK A;  4FAP B;  1HW1 A;  1YA9 A;  2VC9 A;  2R7W A;  2EPK X;  3GWL A;  3V5Y A;  1O3U A;  2AU5 A;  1HMD A;  3ASO C;  3LNR A;  1E83 A;  1OKK A;  4ZLD A;  3UMI A;  1RKE B;  4C3E A;  4YT5 A;  2Y3D A;  1YVI A;  2ASR A;  4PJJ A;  3PMR A;  3FHD A;  4WAB A;  4MW8 A;  4MVO A;  3U5S A;  3S90 A;  5A6A A;  3C8Z A;  1RXQ A;  2QTV A;  2GFH A;  2A0B A;  2WZG A;  3EZI A;  4IJJ A;  3U2L A;  4G7O F;  3AGT A;  4JTC B;  4PAC A;  4YT4 A;  3MBG A;  1D0Z A;  2EIM C;  4N06 A;  2VAS A;  2EIK C;  2OJQ A;  3L8J A;  1RKC A;  3N2Z B;  4NTB A;  5KYU B;  3NYM A;  1OKK D;  5BQH A;  3U0C A;  2R7O A;  3OEO A;  5F5H A;  1BR1 A;  4EUK B;  3S27 A;  2HSQ A;  5DS6 A;  3FOP A;  3CEX A;  1GQA A;  2NSG A;  1YLM A;  2IM8 A;  2RSE B;  3QMK A;  1C03 A;  1V4A A;  5DQZ A;  2MWQ A;  4YWQ A;  2YL3 A;  1RJ9 A;  1NU7 D;  2IBF A;  4CS9 A;  1Z5Z A;  4IAO A;  4JCH A;  2OOC A;  3DAF A;  5L0G A;  2A6H F;  3TJ6 A;  2R7Q A;  2QNL A;  1CGO A;  256B A;  1OCC C;  1SZI A;  2Q4F A;  2Q9A A;  1MMN A;  1VTM P;  4Q5S F;  1IW7 F;  3IQ6 A;  3LAY A;  4WGY A;  4A2N B;  2EPM X;  2W4B A;  3KMI A;  2QLA A;  1OXK A;  4WGZ A;  5K0I A;  2ZPA A;  2PP4 A;  4PFO A;  1VK5 A;  1TWC A;  4JJG A;  2EIJ C;  4K1O A;  1I4Z A;  1GS9 A;  1K05 A;  1PD1 A;  1S05 A;  4MVQ A;  3EFO B;  3ZDL A;  2A68 F;  3EH2 A;  5DS4 A;  3R2P A;  2XXA A;  2J9V A;  4FES A;  2XL8 A;  3VRC A;  2WVQ A;  3GM3 A;  3IPM O;  1L7C A;  1Z3I X;  4B6I A;  4XLP F;  4H4K C;  3V7O A;  3SXZ A;  3KL4 A;  2MHR A;  4HFK B;  1FFH A;  2CDQ A;  2WVO A;  3ITF A;  4QDL A;  3TK0 A;  4KBL A;  1DOV A;  2VCA A;  3KYJ A;  2H7O A;  3K1I C;  3K6B A;  5E3A A;  2G62 A;  1MMD A;  3DJU B;  2KK1 A;  3FAP B;  4HE8 D;  2NUP A;  1RMV A;  1MNE A;  2FFH A;  2UUI A;  3GOR A;  3DE9 A;  1ORS C;  3B9Q A;  3CAX A;  1YZA A;  2W45 A;  1PD0 A;  4E0H A;  3B29 A;  3NMK A;  4MQ9 F;  3T9O A;  4JEB A;  3CSK A;  5KYX A;  1H9T A;  3F46 A;  2HKV A;  1KTM A;  3O10 A;  3VAY A;  3LNM B;  3W2W A;  2AWC A;  1YA7 O;  3LES A;  3ZVR A;  4BJ1 A;  3FAJ A;  3IQ5 A;  4BPM A;  2OU6 A;  5T3W A;  1OW8 A;  4QI2 A;  3AG3 C;  1EA8 A;  3C8G A;  4EBJ A;  1TWA A;  2KQ9 A;  1V55 C;  1OCO C;  5B1A C;  1A7D A;  5IY5 C;  3RFY A;  3QZC A;  3JSZ A;  4XEF A;  3GWN A;  2QUP A;  1LPE A;  2OG2 A;  5L0F A;  2D4U A;  3LEV A;  4LDR A;  3PDM P;  4IRU A;  2M64 A;  4Z9I A;  1V74 B;  2YLI A;  3EGD B;  2R02 A;  2XLD A;  2PNO A;  3C8G D;  1LE4 A;  3DM5 A;  3EG9 A;  4DVY P;  1K40 A;  2OJE D;  2WZL A;  3QVZ A;  2NPU A;  1ZHZ A;  4MW3 A;  2ETS A;  2HV7 A;  1E85 A;  2R7R A;  4EIY A;  5EHH A;  4W8P A;  3RQG A;  3U9M A;  3VF0 A;  3G4X A;  4PJL A;  2GAQ A;  4E17 A;  2KW3 C;  1JAF A;  3T4R A;  3G4Z A;  3IQT A;  2IXP A;  1NLX A;  3L34 A;  4EBK A;  5JP7 A;  2CNW A;  4PJM A;  1PV3 A;  2Y39 A;  1HW2 A;  4JTA B;  4O6M A;  2VCC A; 
#chains in the Genus database with same CATH homology
 4D4X A;  4CJG A;  2XM4 A;  5JUA A;  4D4N A;  3TOL A;  1A7V A;  1NBB A;  1E86 A;  3C63 A;  3FOP A;  1GQA A;  3QW1 A;  2YL3 A;  4CDV A;  1MQV A;  4NC3 A;  2XLW A;  4JEA A;  3C62 A;  1CGO A;  3TOM A;  256B A;  4L6R A;  4IAR A;  3ZQV A;  3ZTZ A;  2YL0 A;  2XL6 A;  5JVE A;  3IQ6 A;  4WGY A;  2XLH A;  1CPQ A;  2QLA A;  4JE9 A;  4CJO A;  2YLG A;  4WGZ A;  1BBH A;  3HNJ A;  1RCP A;  3QVY A;  1S05 A;  2XLE A;  3NMI A;  3HNL A;  2YL7 A;  5JRA A;  4U9D A;  2XL8 A;  3VRC A;  5AGF A;  4JKV A;  4ULV A;  5JLI A;  4N6H A;  3U8P A;  4CX9 A;  1YYJ A;  2YL1 A;  3ZWI A;  1QQ3 A;  5JS5 A;  2J8W A;  2YLD A;  3DE9 A;  2CCY A;  4CDY A;  1YZA A;  3M79 A;  4U9E A;  3NMK A;  3HNK A;  4JEB A;  2YKZ A;  5JSL A;  1E84 A;  3ZTM A;  3L1M A;  1YZC A;  3ZQY A;  2BC5 A;  2XLV A;  2XLO A;  3IQ5 A;  5B3I A;  5JT4 A;  4ER9 A;  3HNI A;  1YYX A;  1APC A;  4CIP A;  3NMJ A;  4N4W A;  5JP7 A;  1M6T A;  1QPU A;  3M15 A;  2J9B A;  3M4B A;  2YLI A;  2XLD A;  3M4C A;  3QVZ A;  4IB4 A;  1E85 A;  1CGN A;  1LM3 B;  3QW0 A;  2XLM A;  4EIY A;  4IAQ A;  1CPR A;  2XM0 A;  1JAF A;  3FOO A;  3DE8 A;  1E83 A;  1EKY A;  4CDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...