3HNIA

Crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hniA00
2XLWA 3C62A 3QW0A 1A7VA 2XM4A 4CDVA 3L1MA 4ULVA 4CDAA 3HNJA 1EKYA 5JP7A 1YZCA 1CPQA 3ZTZA 5JUAA 2CCYA 2YL3A 3ZTMA 2YLGA 4WGZA 3IQ5A 5B3IA 2XLVA 5JRAA 1E83A 256BA 3FOPA 4IAQA 3TOMA 4ER9A 3HNLA 2YLIA 4JKVA 1CGOA 2BC5A 1APCA 3NMJA 4D4NA 2XM0A 2J9BA 2QLAA 5JT4A 3M79A 1QQ3A 4JEBA 5JLIA 3M4CA 3VRCA 3ZWIA 1YYXA 4JEAA 3QW1A 3NMKA 1M6TA 2YKZA 4L6RA 4CX9A 2XLOA 5JVEA 4WGYA 3DE9A 2XLEA 1RCPA 1NBBA 3QVYA 1MQVA 4U9DA 1YYJA 1LM3B 4NC3A 3ZQVA 4D4XA 1S05A 2XLHA 3FOOA 3TOLA 4CIPA 4EIYA 1E85A 1JAFA 3U8PA 4N6HA 3QVZA 3M15A 5JSLA 2XL6A 5AGFA 1YZAA 2YL7A 2XL8A 2XLDA 3ZQYA 4CDYA 4CJOA 4JE9A 3NMIA 3C63A 1E84A 4U9EA 1CGNA 2YL0A 5JS5A 3HNKA 4IARA 1GQAA 1E86A 3DE8A 2XLMA 3IQ6A 2J8WA 4N4WA 1BBHA 4IB4A 4CJGA 1QPUA 2YL1A 1CPRA 2YLDA 3M4BA 3HNIA
chains in the Genus database with same CATH superfamily
3SXMA 2QTVA 3C62A 3Q7LA 1R4TA 2XM4A 4P9TA 2OJED 4MVRA 2HS5A 2AWCA 3L1MA 4U5FE 2EPLX 2DB4A 3HNJA 4CDAA 3FXHA 1EKYA 4DRHB 2ZXRA 4XQ1A 2YZSA 3U3FA 1Q0MA 2P61A 2IM8A 4OIOF 4XEKA 4AK9A 4MTOA 4DJ9A 1NG1A 1RXQA 2L9JA 4G78A 3TJ5A 3EGDA 4MVMA 3ZTZA 4EKWA 2C04A 4Z9JA 2LCHA 4EHPA 3FDQA 3RQFA 3ZTMA 1CGME 1KTMA 3SP1A 2EIJC 5B3IA 3KL4A 4GQHA 5B1BC 4R32A 4UDVA 2PFDA 4W8PA 4P9FA 2M64A 1ORJA 1AEPA 3C8GD 5JRAA 3L8JA 2J9VA 1L3PA 4ER9A 3HNLA 4CSAC 4JKVA 3U9JA 1VLTA 1D0ZA 1TWGA 4NTBA 4FAPB 4Q4ZF 3IQTA 2A1DD 3UGOA 3IHUA 2J45A 4PK4A 1O3UA 1OW6A 1BR1A 2Y69C 1HY5A 4FX5A 3EH2A 3B0VC 5FCLA 2QLAA 4ANJA 1OCOC 1M2VB 3DJUB 3ZIBA 1LIHA 4BJ5C 4E0IA 5JT4A 1VTMP 2W9YA 4JEBA 1K40A 3LLKA 3M4CA 5DLJA 3NKDA 3DJNB 4YL3A 1PD1A 3GEEA 5T3TA 3IQCA 3W2WA 3SZRA 4G7OF 1V55C 5F28E 3U5SA 1JPNA 4G7ZF 2GA0A 4Z9HA 1BZ4A 2IOQA 3C18A 2LQGA 4CX9A 3I5QA 4JJGA 1ZU5A 3UR3C 4CS8C 4DRJB 3DAFA 4F4BA 1V54C 4MTGA 2EPKX 2E87A 4MVSA 3T6JA 2R7UA 3S9OA 5K0IA 1L7CA 2W4BA 4XPXA 3JTLO 3JYHA 2FFHA 2XL4A 1LM3B 1I5NA 4O6YA 1ZVZA 1MMGA 1VOMA 2KNHA 2XLHA 3MLGA 3G4ZA 2MWQA 1SMYF 2LSEA 1FNTc 4IRUA 1VLSA 4JTCB 1D0YA 2Y3HA 3QMKA 5T3WA 3IPMO 3KPHA 3RW0A 3TD7A 2JD3A 2NUPA 3E70C 3SXYA 1YAUO 3DMDA 3ZVRA 2OEXA 2NG1A 3ATPA 2H7BA 1UG7A 1FMWA 4JC7A 4XTKA 1Z3IX 3LAYA 2XRHA 4G7HF 1R5ID 1ORSC 1Q0KA 4RD9A 4YWQA 5L0IA 5JSLA 5BUOA 2XL6A 3RKOF 3C7JA 1YZAA 3JSZA 2A68F 1OR3A 2P0NA 4MVQA 4BJ1A 2HV6A 4C3EA 3EGXB 4BJ6A 4OIQF 4JJFA 1OR2A 2XLDA 3ZQYA 4CJOA 3Q7GA 3SNHA 3KYIA 3X1OA 2YQYA 2LIGA 4U9EA 4J32B 2CNWA 4H54A 5JS5A 2P1AA 2H7OA 4C3BA 4HE8D 1T6IA 1H7IA 1A41A 1EA8A 2J8WA 5BQHA 1ZW2A 2F22A 3CAXA 1Y4CA 4O6MA 1VK5A 4U5EE 4FWVA 4YT2A 2G3VA 4CJGA 1QPUA 1HMDA 2WZFA 2BE5F 1YA9A 4JIOA 1A0BA 1J8MF 2Q9CA 2WZGA 4I3MA 2L6FA 3H2VA 3K33A 2NPUA 1Z23A 3L8IA 2XLWA 3T9OA 3QW0A 1DOVA 4EBBA 2R7VA 3GWNA 3G4XA 2FAPB 1K05A 2P7VA 3I4UA 4PJLA 1G8XA 1JMWA 1LVKA 4B6IA 5JP7A 2DGJA 3B71A 1FFTC 1YZCA 2NSFA 3DD7A 3UMKA 1RJ9B 2HJMA 5AC4A 3AOUA 4OD4A 4JW1A 4KBLA 2QE9A 4MQ9F 4E0HA 3VM6A 3O10A 3T6BA 3DKAA 3ABLC 2EIMC 2DYRC 4RBNA 2HV7A 5DS6A 2D5RB 5KYNA 3CSKA 4NQFA 1YJGA 2YLGA 3RH3A 1ORYA 1YA7O 5L0CA 2LFFA 3AQCA 3DM9B 5EHHA 2R7WA 2HZ8A 3JZ0A 5B1AC 2CDQA 3EJNA 1ZHTA 3EHNA 2WB7A 3K1IA 3W8HA 2J0WA 1YDIA 1HW1A 2PX0A 3AG4C 3FOPA 2LFDA 4YL0A 1LI5A 4LACB 4RDAA 3C8GB 2YLIA 4I1MA 1CGOA 4MW3A 1APCA 1OKKD 2QNLA 3GANA 4IWBA 2NSGA 4YK5A 2XM0A 4CBEA 2O9XA 5A6AA 2XSEA 1EQ1A 2EINC 4EWCA 3ASNC 3EHMA 2GAQA 1OKKA 4LERA 3AG3C 1T6UA 1JR8A 3W8IA 2PP4A 3U3BA 3GM2A 3JYYA 1QQ3A 4HFKB 4JZAA 1WASA 4U5CE 2RD9A 1UFBA 3K1HA 1YYXA 4ULWA 1PD0A 4J30B 2J9UA 5F5HA 3S28A 5KYUB 1TKNA 2A0BA 1M6TA 1VYIA 2YKZA 4L6RA 1ZYRF 2XLOA 1H9TA 2CGEA 3ZDLA 2D4UA 2J0XA 1XZPA 3B0UX 2L81A 1BDJB 2HSQA 1NBBA 3JRTA 3N0TA 1MQVA 4I44A 5CI8A 4DOZA 1ZZPA 1JRAA 2B0JA 3U2MA 4OIRF 3C8GA 4CIHA 3O6XA 1YYJA 3WHNA 2LK4A 4P6IC 1XZQA 2IBFA 4D4XA 3TJ6A 2R7SA 1S05A 5E3CA 2WVOA 5A6JA 1RKCA 4J7YA 5GPGB 2R25A 3RVZA 1Q0GA 2J46A 3G50A 4LLEA 1RKEB 2OU6A 4YJWA 1QKRA 2R7OA 1V4AA 2B0HA 3TK0A 3FVYA 3RYLA 4EIYA 2AVKA 2PBEA 5DVWA 3ABMC 3JRMO 2I8BA 1E85A 4BJTA 1AUEA 4YT5A 4XWJA 2KJGA 2Q9AA 1D1BA 3RFYA 2L6GA 3DM5A 5KYUA 3U2LA 3JT1A 2AWYA 4N6HA 4JRZA 3HKKA 3S0XA 2YEVA 3QVZA 4YT8A 1NLXA 5CI9A 5BQIA 5AGFA 5TJ5E 3H2UA 4A4AA 4K0DA 3CQZA 2L7AA 3GM3A 3N2ZB 3C8ZA 3WAQA 3AGUA 2YL7A 4BG0A 1T5OA 4CSAA 4JE9A 2HUJA 2J7PD 1E84A 3DAGA 2TMVP 5KYXB 2OJQA 2ZXPA 5L0JA 3NYJA 2OG2A 3B9QA 5A6KA 2R7QA 1GQAA 3DE8A 1TFOB 3OA1A 1QZXA 2R02A 1MNDA 3IQ6A 1M2VA 3M4BA 2G62A 5B3SC 2M4EA 1RKEA 3VYWA 3NDBB 1OCRC 1Q0FA 1SR2A 3KKBA 4U5BE 2JPUA 2IXNA 1OXKA 2YL1A 3S29A 4JTDB 4OINF 4DRIB 3PMRA 2PF4E 3AG1C 2G3KA 1KU2A 3O55A 2OOCA 4LDKA 5A6BD 4MVZA 2CW0F 1V74B 2QUPA 1WOLA 4CDVA 4XPYA 1M56C 2Y39A 4CS8A 4XEFA 3RQGA 5D91A 1VB5A 4YT4A 3DZAA 3GORA 2PX3A 4N6CA 2OQMA 3RQEA 1JOGA 3SYNA 2BL2A 4CS9A 2FGYA 1CPQA 3BRJA 3OEOA 1QLEC 2OCCC 4KNWA 2R9RB 2QY9A 1SYQA 2ZXWC 3F47A 1U6HA 1ZW3A 1EI7A 1TWCA 2CCYA 2VC9A 4WABA 3EG9B 4WGZA 2XS1A 3LLIA 1A7DA 4Z9IA 3JCUQ 4MVOA 2GWWA 3K6BA 3SXZA 1D0XA 5L3QA 3KMIA 4Q7CA 3B29A 5BQGA 3HJCA 4EBKA 1E83A 3GODA 3FMSA 1ZHYA 4IAQA 4E7ZA 5AC5A 4IGGA 4JCHA 3I5PA 2IXPA 2VASA 3FAPB 4AE4B 3UMIA 3NRHA 4MNDA 1HMOA 1XWJA 3LESA 1T9KA 3NMJA 3V7OA 3KYJA 4D4NA 3UGPA 4O7GA 3LEOA 1LS1A 3V5ZA 2EPOA 4GEHA 4PFPA 4XPWA 3POVA 2LD6A 2H8AA 3EGXA 4M63A 2V3CC 1C17M 2ETSA 2EIKC 2IXOA 1PV3A 3M79A 2HJ3A 2KK1A 4KI2A 5JLIA 2R7TA 3AQBA 1GS9A 1JPJA 1GGQA 1YLMA 3ASOC 3GEHA 4NCQA 4PJJA 3ZWIA 5L0HA 3EFOB 1SZIA 5IY5C 2EILC 1C02A 4O6NA 3NMKA 4WJ0A 3EG9A 1NU9C 4DBRA 5KYWB 3UNGC 5D92A 4U5GA 1H9GA 2EPNA 5L0GA 5E33A 4WGYA 1G5ZA 5COGA 3VF0A 3Q6NA 1I4YA 1O5HA 4BPMA 1RCPA 5DS5A 3QVYA 1WN0A 3EPVA 4G0HA 3ZC4A 4U9DA 3DWWA 4ZLCA 3AG2C 3O39A 3WODF 5E3AA 4MVUA 4EBJA 1LPEA 3N24A 4NC3A 3ZQVA 4AE4A 2AP3A 2AU5A 1QVXA 1H6GA 3MYIA 3A11A 4IAOA 1RMVA 3ITFA 2H7VC 3EQLF 3ABKC 3QZCA 2Q9BA 2P6VA 1Y6DA 3NYLA 1RJ9A 2EPMX 4CIPA 4JVSA 4PFOA 1LKXA 1LE2A 4PJMA 1VMAA 1OCCC 3CEXA 3NYMA 2XXAB 1IW7F 1TQGA 1HE9A 1JAFA 3U8PA 2VCCA 3AJMA 1MMNA 5DQTA 3SEOA 1MMDA 2I15A 1FR0A 2VCBA 2ZPAA 4PACA 2YHSA 5KYWA 3M15A 3W2VA 1F1MA 2W4MA 3U8VA 3S90A 1DOWA 3LUTB 3PHF2 4J7TA 1G4US 2C03A 1K04A 3FAJA 2Q7RA 1HE1A 4CDYA 1YARO 2HSBA 4AL0A 4K7BA 3E9VA 3EH1A 4W8KA 3NMIA 3C63A 4N06A 2YWAA 1PCXA 4IJJA 4DVZA 2YL0A 3DXJF 4EUKB 5HV9A 3HTKC 2WL8A 1OXBA 2HMZA 4HFFB 4ONSA 4KC9A 1E86A 5E2QA 1WGWA 3Q6MA 2XLMA 3JSEO 2Z15A 3TQOA 2R03A 3AGTA 4LLCA 1NFNA 4LDQA 4N4WA 3T4RA 2OKUA 1WTYA 1VYKA 2YRFA 4KNVA 5L0FA 5DS4A 3PDMP 2R7XA 1WATA 1NU7D 2WZLA 4DVYP 5CIVA 4DXWA 1CPRA 2YLDA 2XXAA 2OEVA 1HW2A 1LS4A 1IZMA 3NG1A 1A7VA 5DQZA 2J9WA 4Q5SF 3LNMB 1E2XA 1T01A 2DI3A 2VB6A 2W45A 4NY3A 1OW7A 4ULVA 1NFOA 3QTHA 4ZLDA 1SF8A 3LJBA 3LS1A 3S27A 4OIPF 4QI2A 2ZD9A 3MFNA 1KNYA 3WG7C 2UUIA 2NUPB 3K7DA 3CZ6A 4AX2A 1S7ZA 2LP4A 1U0BB 4NTFA 4NTAA 3L0IA 3ZG1A 4XLPF 1LE4A 3S84A 3H65A 2A0UA 5JUAA 4X0RA 5EGYA 4BEMJ 4DBQA 2J7PA 3J06A 2HKVA 2HMQA 2YL3A 3RIPA 4BJ5A 1Z5ZA 3IQ5A 3UMHA 1YVIA 3LEVA 5L0DA 2V26A 4A2NB 1O87A 4MS2A 2KW3C 4YN0B 2R05A 2JX0A 2XLVA 3GWLA 2UUHA 3U9MA 1NZEA 2WVQA 2KQ9A 5T1DB 2VCAA 3R7CA 256BA 2XS8A 4BJ6C 3TOMA 2R7RA 3ZSUA 1ZHZA 2A69F 3LS0A 4PR9A 4C7OB 3NKEA 3U0CA 4QDLA 1NSGB 5COMA 4CS9C 2MYSA 2Y3GA 4FESA 5A6BA 2Q00A 2J9BA 2CYDA 4HEAJ 2YVKA 5KYYB 1Z63A 1BR4A 1M57C 1Z6AA 2L6HA 3LNRA 3MYFA 1C03A 1QSPA 4CS7A 3F46A 1MMAA 2A6HF 5FZTA 1J8YF 4XEVA 1U89A 3VRCA 5KYXA 2ZXOA 1D1CA 3PCVA 2Q4FA 4JURI 4JEAA 2KGOA 3B0PA 3QW1A 2IYLD 4U5HA 2Y3BA 4OD5A 3US6A 1D1AA 2X0CA 1AVOB 4QI0A 1TWHA 3T6GB 1Z7Qc 5JVEA 3DE9A 3V5XA 2XLEA 2Q3TA 2X51A 1G4WR 3EZIA 2CNWD 1OQCA 3MBGA 2Y3DA 2ICWG 3EFOA 4O79A 4YL1A 4K1OA 4JTAB 1OCZC 3EZHA 3R2PA 3MX3A 1BR2A 5F5FA 4C7OA 4PJNA 2NUTB 3GEIA 1W2WA 3KH2A 1Q0DA 1TWAA 1ZHWA 3FOOA 1FMVA 4H4KC 3FHDA 3W4YA 5KYYA 3K66A 3TOLA 3VAYA 4I1OB 1T6QA 1GM5A 1LI7A 1ZHXA 1OW8A 3K1IC 5EK0A 2GDCA 2RSEB 4E17A 2DYSC 3A9CA 1I4ZA 3DI5A 3ECSA 4JCZA 4MW8A 5HSWA 2GFHA 4MTFA 4E7SA 3BEHA 3HLZA 5COFA 3RF3A 4XLNF 1MNEA 3M1CB 1TFKB 3X2QC 2A6EF 2XL8A 5L3VA 1FAPB 3V5YA 3OWTA 3TULA 3EGDB 2IXMA 4AL1A 1B68A 1CGNA 2KSFA 1WWPA 1A7EA 2MHRA 2ASRA 1FFHA 3HNKA 2NUTA 4U5DE 4IARA 1ST6A 4E18A 2KYHA 3GM1A 2VH3A 2HFIA 1ZU4A 3L34A 4GYTA 4LDRA 1BBHA 3SXKA 2PNOA 1FTSA 4IB4A 3RVYA 2KC3A 3IEEA 1M2OA 1TR2A 4BEJA 2WVNA 5A69A 2BC5A 1N1CA 4C3DA 3HNIA
chains in the Genus database with same CATH topology
2XLWA 3C62A 3QW0A 1A7VA 2XM4A 4CDVA 3L1MA 4ULVA 4CDAA 3HNJA 1EKYA 5JP7A 1YZCA 1CPQA 3ZTZA 5JUAA 2CCYA 2YL3A 3ZTMA 2YLGA 4WGZA 3IQ5A 5B3IA 2XLVA 5JRAA 1E83A 256BA 3FOPA 4IAQA 3TOMA 4ER9A 3HNLA 2YLIA 4JKVA 1CGOA 2BC5A 1APCA 3NMJA 4D4NA 2XM0A 2J9BA 2QLAA 5JT4A 3M79A 1QQ3A 4JEBA 5JLIA 3M4CA 3VRCA 3ZWIA 1YYXA 4JEAA 3QW1A 3NMKA 1M6TA 2YKZA 4L6RA 4CX9A 2XLOA 5JVEA 4WGYA 3DE9A 2XLEA 1RCPA 1NBBA 3QVYA 1MQVA 4U9DA 1YYJA 1LM3B 4NC3A 3ZQVA 4D4XA 1S05A 2XLHA 3FOOA 3TOLA 4CIPA 4EIYA 1E85A 1JAFA 3U8PA 4N6HA 3QVZA 3M15A 5JSLA 2XL6A 5AGFA 1YZAA 2YL7A 2XL8A 2XLDA 3ZQYA 4CDYA 4CJOA 4JE9A 3NMIA 3C63A 1E84A 4U9EA 1CGNA 2YL0A 5JS5A 3HNKA 4IARA 1GQAA 1E86A 3DE8A 2XLMA 3IQ6A 2J8WA 4N4WA 1BBHA 4IB4A 4CJGA 1QPUA 2YL1A 1CPRA 2YLDA 3M4BA 3HNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLW A;  3C62 A;  3QW0 A;  1A7V A;  2XM4 A;  4CDV A;  3L1M A;  4ULV A;  4CDA A;  3HNJ A;  1EKY A;  5JP7 A;  1YZC A;  1CPQ A;  3ZTZ A;  5JUA A;  2CCY A;  2YL3 A;  3ZTM A;  2YLG A;  4WGZ A;  3IQ5 A;  5B3I A;  2XLV A;  5JRA A;  1E83 A;  256B A;  3FOP A;  4IAQ A;  3TOM A;  4ER9 A;  3HNL A;  2YLI A;  4JKV A;  1CGO A;  2BC5 A;  1APC A;  3NMJ A;  4D4N A;  2XM0 A;  2J9B A;  2QLA A;  5JT4 A;  3M79 A;  1QQ3 A;  4JEB A;  5JLI A;  3M4C A;  3VRC A;  3ZWI A;  1YYX A;  4JEA A;  3QW1 A;  3NMK A;  1M6T A;  2YKZ A;  4L6R A;  4CX9 A;  2XLO A;  5JVE A;  4WGY A;  3DE9 A;  2XLE A;  1RCP A;  1NBB A;  3QVY A;  1MQV A;  4U9D A;  1YYJ A;  1LM3 B;  4NC3 A;  3ZQV A;  4D4X A;  1S05 A;  2XLH A;  3FOO A;  3TOL A;  4CIP A;  4EIY A;  1E85 A;  1JAF A;  3U8P A;  4N6H A;  3QVZ A;  3M15 A;  5JSL A;  2XL6 A;  5AGF A;  1YZA A;  2YL7 A;  2XL8 A;  2XLD A;  3ZQY A;  4CDY A;  4CJO A;  4JE9 A;  3NMI A;  3C63 A;  1E84 A;  4U9E A;  1CGN A;  2YL0 A;  5JS5 A;  3HNK A;  4IAR A;  1GQA A;  1E86 A;  3DE8 A;  2XLM A;  3IQ6 A;  2J8W A;  4N4W A;  1BBH A;  4IB4 A;  4CJG A;  1QPU A;  2YL1 A;  1CPR A;  2YLD A;  3M4B A;  3HNI A; 
#chains in the Genus database with same CATH topology
 3SXM A;  2QTV A;  3C62 A;  3Q7L A;  1R4T A;  2XM4 A;  4P9T A;  2OJE D;  4MVR A;  2HS5 A;  2AWC A;  3L1M A;  4U5F E;  2EPL X;  2DB4 A;  3HNJ A;  4CDA A;  3FXH A;  1EKY A;  4DRH B;  2ZXR A;  4XQ1 A;  2YZS A;  3U3F A;  1Q0M A;  2P61 A;  2IM8 A;  4OIO F;  4XEK A;  4AK9 A;  4MTO A;  4DJ9 A;  1NG1 A;  1RXQ A;  2L9J A;  4G78 A;  3TJ5 A;  3EGD A;  4MVM A;  3ZTZ A;  4EKW A;  2C04 A;  4Z9J A;  2LCH A;  4EHP A;  3FDQ A;  3RQF A;  3ZTM A;  1CGM E;  1KTM A;  3SP1 A;  2EIJ C;  5B3I A;  3KL4 A;  4GQH A;  5B1B C;  4R32 A;  4UDV A;  2PFD A;  4W8P A;  4P9F A;  2M64 A;  1ORJ A;  1AEP A;  3C8G D;  5JRA A;  3L8J A;  2J9V A;  1L3P A;  4ER9 A;  3HNL A;  4CSA C;  4JKV A;  3U9J A;  1VLT A;  1D0Z A;  1TWG A;  4NTB A;  4FAP B;  4Q4Z F;  3IQT A;  2A1D D;  3UGO A;  3IHU A;  2J45 A;  4PK4 A;  1O3U A;  1OW6 A;  1BR1 A;  2Y69 C;  1HY5 A;  4FX5 A;  3EH2 A;  3B0V C;  5FCL A;  2QLA A;  4ANJ A;  1OCO C;  1M2V B;  3DJU B;  3ZIB A;  1LIH A;  4BJ5 C;  4E0I A;  5JT4 A;  1VTM P;  2W9Y A;  4JEB A;  1K40 A;  3LLK A;  3M4C A;  5DLJ A;  3NKD A;  3DJN B;  4YL3 A;  1PD1 A;  3GEE A;  5T3T A;  3IQC A;  3W2W A;  3SZR A;  4G7O F;  1V55 C;  5F28 E;  3U5S A;  1JPN A;  4G7Z F;  2GA0 A;  4Z9H A;  1BZ4 A;  2IOQ A;  3C18 A;  2LQG A;  4CX9 A;  3I5Q A;  4JJG A;  1ZU5 A;  3UR3 C;  4CS8 C;  4DRJ B;  3DAF A;  4F4B A;  1V54 C;  4MTG A;  2EPK X;  2E87 A;  4MVS A;  3T6J A;  2R7U A;  3S9O A;  5K0I A;  1L7C A;  2W4B A;  4XPX A;  3JTL O;  3JYH A;  2FFH A;  2XL4 A;  1LM3 B;  1I5N A;  4O6Y A;  1ZVZ A;  1MMG A;  1VOM A;  2KNH A;  2XLH A;  3MLG A;  3G4Z A;  2MWQ A;  1SMY F;  2LSE A;  1FNT c;  4IRU A;  1VLS A;  4JTC B;  1D0Y A;  2Y3H A;  3QMK A;  5T3W A;  3IPM O;  3KPH A;  3RW0 A;  3TD7 A;  2JD3 A;  2NUP A;  3E70 C;  3SXY A;  1YAU O;  3DMD A;  3ZVR A;  2OEX A;  2NG1 A;  3ATP A;  2H7B A;  1UG7 A;  1FMW A;  4JC7 A;  4XTK A;  1Z3I X;  3LAY A;  2XRH A;  4G7H F;  1R5I D;  1ORS C;  1Q0K A;  4RD9 A;  4YWQ A;  5L0I A;  5JSL A;  5BUO A;  2XL6 A;  3RKO F;  3C7J A;  1YZA A;  3JSZ A;  2A68 F;  1OR3 A;  2P0N A;  4MVQ A;  4BJ1 A;  2HV6 A;  4C3E A;  3EGX B;  4BJ6 A;  4OIQ F;  4JJF A;  1OR2 A;  2XLD A;  3ZQY A;  4CJO A;  3Q7G A;  3SNH A;  3KYI A;  3X1O A;  2YQY A;  2LIG A;  4U9E A;  4J32 B;  2CNW A;  4H54 A;  5JS5 A;  2P1A A;  2H7O A;  4C3B A;  4HE8 D;  1T6I A;  1H7I A;  1A41 A;  1EA8 A;  2J8W A;  5BQH A;  1ZW2 A;  2F22 A;  3CAX A;  1Y4C A;  4O6M A;  1VK5 A;  4U5E E;  4FWV A;  4YT2 A;  2G3V A;  4CJG A;  1QPU A;  1HMD A;  2WZF A;  2BE5 F;  1YA9 A;  4JIO A;  1A0B A;  1J8M F;  2Q9C A;  2WZG A;  4I3M A;  2L6F A;  3H2V A;  3K33 A;  2NPU A;  1Z23 A;  3L8I A;  2XLW A;  3T9O A;  3QW0 A;  1DOV A;  4EBB A;  2R7V A;  3GWN A;  3G4X A;  2FAP B;  1K05 A;  2P7V A;  3I4U A;  4PJL A;  1G8X A;  1JMW A;  1LVK A;  4B6I A;  5JP7 A;  2DGJ A;  3B71 A;  1FFT C;  1YZC A;  2NSF A;  3DD7 A;  3UMK A;  1RJ9 B;  2HJM A;  5AC4 A;  3AOU A;  4OD4 A;  4JW1 A;  4KBL A;  2QE9 A;  4MQ9 F;  4E0H A;  3VM6 A;  3O10 A;  3T6B A;  3DKA A;  3ABL C;  2EIM C;  2DYR C;  4RBN A;  2HV7 A;  5DS6 A;  2D5R B;  5KYN A;  3CSK A;  4NQF A;  1YJG A;  2YLG A;  3RH3 A;  1ORY A;  1YA7 O;  5L0C A;  2LFF A;  3AQC A;  3DM9 B;  5EHH A;  2R7W A;  2HZ8 A;  3JZ0 A;  5B1A C;  2CDQ A;  3EJN A;  1ZHT A;  3EHN A;  2WB7 A;  3K1I A;  3W8H A;  2J0W A;  1YDI A;  1HW1 A;  2PX0 A;  3AG4 C;  3FOP A;  2LFD A;  4YL0 A;  1LI5 A;  4LAC B;  4RDA A;  3C8G B;  2YLI A;  4I1M A;  1CGO A;  4MW3 A;  1APC A;  1OKK D;  2QNL A;  3GAN A;  4IWB A;  2NSG A;  4YK5 A;  2XM0 A;  4CBE A;  2O9X A;  5A6A A;  2XSE A;  1EQ1 A;  2EIN C;  4EWC A;  3ASN C;  3EHM A;  2GAQ A;  1OKK A;  4LER A;  3AG3 C;  1T6U A;  1JR8 A;  3W8I A;  2PP4 A;  3U3B A;  3GM2 A;  3JYY A;  1QQ3 A;  4HFK B;  4JZA A;  1WAS A;  4U5C E;  2RD9 A;  1UFB A;  3K1H A;  1YYX A;  4ULW A;  1PD0 A;  4J30 B;  2J9U A;  5F5H A;  3S28 A;  5KYU B;  1TKN A;  2A0B A;  1M6T A;  1VYI A;  2YKZ A;  4L6R A;  1ZYR F;  2XLO A;  1H9T A;  2CGE A;  3ZDL A;  2D4U A;  2J0X A;  1XZP A;  3B0U X;  2L81 A;  1BDJ B;  2HSQ A;  1NBB A;  3JRT A;  3N0T A;  1MQV A;  4I44 A;  5CI8 A;  4DOZ A;  1ZZP A;  1JRA A;  2B0J A;  3U2M A;  4OIR F;  3C8G A;  4CIH A;  3O6X A;  1YYJ A;  3WHN A;  2LK4 A;  4P6I C;  1XZQ A;  2IBF A;  4D4X A;  3TJ6 A;  2R7S A;  1S05 A;  5E3C A;  2WVO A;  5A6J A;  1RKC A;  4J7Y A;  5GPG B;  2R25 A;  3RVZ A;  1Q0G A;  2J46 A;  3G50 A;  4LLE A;  1RKE B;  2OU6 A;  4YJW A;  1QKR A;  2R7O A;  1V4A A;  2B0H A;  3TK0 A;  3FVY A;  3RYL A;  4EIY A;  2AVK A;  2PBE A;  5DVW A;  3ABM C;  3JRM O;  2I8B A;  1E85 A;  4BJT A;  1AUE A;  4YT5 A;  4XWJ A;  2KJG A;  2Q9A A;  1D1B A;  3RFY A;  2L6G A;  3DM5 A;  5KYU A;  3U2L A;  3JT1 A;  2AWY A;  4N6H A;  4JRZ A;  3HKK A;  3S0X A;  2YEV A;  3QVZ A;  4YT8 A;  1NLX A;  5CI9 A;  5BQI A;  5AGF A;  5TJ5 E;  3H2U A;  4A4A A;  4K0D A;  3CQZ A;  2L7A A;  3GM3 A;  3N2Z B;  3C8Z A;  3WAQ A;  3AGU A;  2YL7 A;  4BG0 A;  1T5O A;  4CSA A;  4JE9 A;  2HUJ A;  2J7P D;  1E84 A;  3DAG A;  2TMV P;  5KYX B;  2OJQ A;  2ZXP A;  5L0J A;  3NYJ A;  2OG2 A;  3B9Q A;  5A6K A;  2R7Q A;  1GQA A;  3DE8 A;  1TFO B;  3OA1 A;  1QZX A;  2R02 A;  1MND A;  3IQ6 A;  1M2V A;  3M4B A;  2G62 A;  5B3S C;  2M4E A;  1RKE A;  3VYW A;  3NDB B;  1OCR C;  1Q0F A;  1SR2 A;  3KKB A;  4U5B E;  2JPU A;  2IXN A;  1OXK A;  2YL1 A;  3S29 A;  4JTD B;  4OIN F;  4DRI B;  3PMR A;  2PF4 E;  3AG1 C;  2G3K A;  1KU2 A;  3O55 A;  2OOC A;  4LDK A;  5A6B D;  4MVZ A;  2CW0 F;  1V74 B;  2QUP A;  1WOL A;  4CDV A;  4XPY A;  1M56 C;  2Y39 A;  4CS8 A;  4XEF A;  3RQG A;  5D91 A;  1VB5 A;  4YT4 A;  3DZA A;  3GOR A;  2PX3 A;  4N6C A;  2OQM A;  3RQE A;  1JOG A;  3SYN A;  2BL2 A;  4CS9 A;  2FGY A;  1CPQ A;  3BRJ A;  3OEO A;  1QLE C;  2OCC C;  4KNW A;  2R9R B;  2QY9 A;  1SYQ A;  2ZXW C;  3F47 A;  1U6H A;  1ZW3 A;  1EI7 A;  1TWC A;  2CCY A;  2VC9 A;  4WAB A;  3EG9 B;  4WGZ A;  2XS1 A;  3LLI A;  1A7D A;  4Z9I A;  3JCU Q;  4MVO A;  2GWW A;  3K6B A;  3SXZ A;  1D0X A;  5L3Q A;  3KMI A;  4Q7C A;  3B29 A;  5BQG A;  3HJC A;  4EBK A;  1E83 A;  3GOD A;  3FMS A;  1ZHY A;  4IAQ A;  4E7Z A;  5AC5 A;  4IGG A;  4JCH A;  3I5P A;  2IXP A;  2VAS A;  3FAP B;  4AE4 B;  3UMI A;  3NRH A;  4MND A;  1HMO A;  1XWJ A;  3LES A;  1T9K A;  3NMJ A;  3V7O A;  3KYJ A;  4D4N A;  3UGP A;  4O7G A;  3LEO A;  1LS1 A;  3V5Z A;  2EPO A;  4GEH A;  4PFP A;  4XPW A;  3POV A;  2LD6 A;  2H8A A;  3EGX A;  4M63 A;  2V3C C;  1C17 M;  2ETS A;  2EIK C;  2IXO A;  1PV3 A;  3M79 A;  2HJ3 A;  2KK1 A;  4KI2 A;  5JLI A;  2R7T A;  3AQB A;  1GS9 A;  1JPJ A;  1GGQ A;  1YLM A;  3ASO C;  3GEH A;  4NCQ A;  4PJJ A;  3ZWI A;  5L0H A;  3EFO B;  1SZI A;  5IY5 C;  2EIL C;  1C02 A;  4O6N A;  3NMK A;  4WJ0 A;  3EG9 A;  1NU9 C;  4DBR A;  5KYW B;  3UNG C;  5D92 A;  4U5G A;  1H9G A;  2EPN A;  5L0G A;  5E33 A;  4WGY A;  1G5Z A;  5COG A;  3VF0 A;  3Q6N A;  1I4Y A;  1O5H A;  4BPM A;  1RCP A;  5DS5 A;  3QVY A;  1WN0 A;  3EPV A;  4G0H A;  3ZC4 A;  4U9D A;  3DWW A;  4ZLC A;  3AG2 C;  3O39 A;  3WOD F;  5E3A A;  4MVU A;  4EBJ A;  1LPE A;  3N24 A;  4NC3 A;  3ZQV A;  4AE4 A;  2AP3 A;  2AU5 A;  1QVX A;  1H6G A;  3MYI A;  3A11 A;  4IAO A;  1RMV A;  3ITF A;  2H7V C;  3EQL F;  3ABK C;  3QZC A;  2Q9B A;  2P6V A;  1Y6D A;  3NYL A;  1RJ9 A;  2EPM X;  4CIP A;  4JVS A;  4PFO A;  1LKX A;  1LE2 A;  4PJM A;  1VMA A;  1OCC C;  3CEX A;  3NYM A;  2XXA B;  1IW7 F;  1TQG A;  1HE9 A;  1JAF A;  3U8P A;  2VCC A;  3AJM A;  1MMN A;  5DQT A;  3SEO A;  1MMD A;  2I15 A;  1FR0 A;  2VCB A;  2ZPA A;  4PAC A;  2YHS A;  5KYW A;  3M15 A;  3W2V A;  1F1M A;  2W4M A;  3U8V A;  3S90 A;  1DOW A;  3LUT B;  3PHF 2;  4J7T A;  1G4U S;  2C03 A;  1K04 A;  3FAJ A;  2Q7R A;  1HE1 A;  4CDY A;  1YAR O;  2HSB A;  4AL0 A;  4K7B A;  3E9V A;  3EH1 A;  4W8K A;  3NMI A;  3C63 A;  4N06 A;  2YWA A;  1PCX A;  4IJJ A;  4DVZ A;  2YL0 A;  3DXJ F;  4EUK B;  5HV9 A;  3HTK C;  2WL8 A;  1OXB A;  2HMZ A;  4HFF B;  4ONS A;  4KC9 A;  1E86 A;  5E2Q A;  1WGW A;  3Q6M A;  2XLM A;  3JSE O;  2Z15 A;  3TQO A;  2R03 A;  3AGT A;  4LLC A;  1NFN A;  4LDQ A;  4N4W A;  3T4R A;  2OKU A;  1WTY A;  1VYK A;  2YRF A;  4KNV A;  5L0F A;  5DS4 A;  3PDM P;  2R7X A;  1WAT A;  1NU7 D;  2WZL A;  4DVY P;  5CIV A;  4DXW A;  1CPR A;  2YLD A;  2XXA A;  2OEV A;  1HW2 A;  1LS4 A;  1IZM A;  3NG1 A;  1A7V A;  5DQZ A;  2J9W A;  4Q5S F;  3LNM B;  1E2X A;  1T01 A;  2DI3 A;  2VB6 A;  2W45 A;  4NY3 A;  1OW7 A;  4ULV A;  1NFO A;  3QTH A;  4ZLD A;  1SF8 A;  3LJB A;  3LS1 A;  3S27 A;  4OIP F;  4QI2 A;  2ZD9 A;  3MFN A;  1KNY A;  3WG7 C;  2UUI A;  2NUP B;  3K7D A;  3CZ6 A;  4AX2 A;  1S7Z A;  2LP4 A;  1U0B B;  4NTF A;  4NTA A;  3L0I A;  3ZG1 A;  4XLP F;  1LE4 A;  3S84 A;  3H65 A;  2A0U A;  5JUA A;  4X0R A;  5EGY A;  4BEM J;  4DBQ A;  2J7P A;  3J06 A;  2HKV A;  2HMQ A;  2YL3 A;  3RIP A;  4BJ5 A;  1Z5Z A;  3IQ5 A;  3UMH A;  1YVI A;  3LEV A;  5L0D A;  2V26 A;  4A2N B;  1O87 A;  4MS2 A;  2KW3 C;  4YN0 B;  2R05 A;  2JX0 A;  2XLV A;  3GWL A;  2UUH A;  3U9M A;  1NZE A;  2WVQ A;  2KQ9 A;  5T1D B;  2VCA A;  3R7C A;  256B A;  2XS8 A;  4BJ6 C;  3TOM A;  2R7R A;  3ZSU A;  1ZHZ A;  2A69 F;  3LS0 A;  4PR9 A;  4C7O B;  3NKE A;  3U0C A;  4QDL A;  1NSG B;  5COM A;  4CS9 C;  2MYS A;  2Y3G A;  4FES A;  5A6B A;  2Q00 A;  2J9B A;  2CYD A;  4HEA J;  2YVK A;  5KYY B;  1Z63 A;  1BR4 A;  1M57 C;  1Z6A A;  2L6H A;  3LNR A;  3MYF A;  1C03 A;  1QSP A;  4CS7 A;  3F46 A;  1MMA A;  2A6H F;  5FZT A;  1J8Y F;  4XEV A;  1U89 A;  3VRC A;  5KYX A;  2ZXO A;  1D1C A;  3PCV A;  2Q4F A;  4JUR I;  4JEA A;  2KGO A;  3B0P A;  3QW1 A;  2IYL D;  4U5H A;  2Y3B A;  4OD5 A;  3US6 A;  1D1A A;  2X0C A;  1AVO B;  4QI0 A;  1TWH A;  3T6G B;  1Z7Q c;  5JVE A;  3DE9 A;  3V5X A;  2XLE A;  2Q3T A;  2X51 A;  1G4W R;  3EZI A;  2CNW D;  1OQC A;  3MBG A;  2Y3D A;  2ICW G;  3EFO A;  4O79 A;  4YL1 A;  4K1O A;  4JTA B;  1OCZ C;  3EZH A;  3R2P A;  3MX3 A;  1BR2 A;  5F5F A;  4C7O A;  4PJN A;  2NUT B;  3GEI A;  1W2W A;  3KH2 A;  1Q0D A;  1TWA A;  1ZHW A;  3FOO A;  1FMV A;  4H4K C;  3FHD A;  3W4Y A;  5KYY A;  3K66 A;  3TOL A;  3VAY A;  4I1O B;  1T6Q A;  1GM5 A;  1LI7 A;  1ZHX A;  1OW8 A;  3K1I C;  5EK0 A;  2GDC A;  2RSE B;  4E17 A;  2DYS C;  3A9C A;  1I4Z A;  3DI5 A;  3ECS A;  4JCZ A;  4MW8 A;  5HSW A;  2GFH A;  4MTF A;  4E7S A;  3BEH A;  3HLZ A;  5COF A;  3RF3 A;  4XLN F;  1MNE A;  3M1C B;  1TFK B;  3X2Q C;  2A6E F;  2XL8 A;  5L3V A;  1FAP B;  3V5Y A;  3OWT A;  3TUL A;  3EGD B;  2IXM A;  4AL1 A;  1B68 A;  1CGN A;  2KSF A;  1WWP A;  1A7E A;  2MHR A;  2ASR A;  1FFH A;  3HNK A;  2NUT A;  4U5D E;  4IAR A;  1ST6 A;  4E18 A;  2KYH A;  3GM1 A;  2VH3 A;  2HFI A;  1ZU4 A;  3L34 A;  4GYT A;  4LDR A;  1BBH A;  3SXK A;  2PNO A;  1FTS A;  4IB4 A;  3RVY A;  2KC3 A;  3IEE A;  1M2O A;  1TR2 A;  4BEJ A;  2WVN A;  5A69 A;  2BC5 A;  1N1C A;  4C3D A;  3HNI A; 
#chains in the Genus database with same CATH homology
 2XLW A;  3C62 A;  3QW0 A;  1A7V A;  2XM4 A;  4CDV A;  3L1M A;  4ULV A;  4CDA A;  3HNJ A;  1EKY A;  5JP7 A;  1YZC A;  1CPQ A;  3ZTZ A;  5JUA A;  2CCY A;  2YL3 A;  3ZTM A;  2YLG A;  4WGZ A;  3IQ5 A;  5B3I A;  2XLV A;  5JRA A;  1E83 A;  256B A;  3FOP A;  4IAQ A;  3TOM A;  4ER9 A;  3HNL A;  2YLI A;  4JKV A;  1CGO A;  2BC5 A;  1APC A;  3NMJ A;  4D4N A;  2XM0 A;  2J9B A;  2QLA A;  5JT4 A;  3M79 A;  1QQ3 A;  4JEB A;  5JLI A;  3M4C A;  3VRC A;  3ZWI A;  1YYX A;  4JEA A;  3QW1 A;  3NMK A;  1M6T A;  2YKZ A;  4L6R A;  4CX9 A;  2XLO A;  5JVE A;  4WGY A;  3DE9 A;  2XLE A;  1RCP A;  1NBB A;  3QVY A;  1MQV A;  4U9D A;  1YYJ A;  1LM3 B;  4NC3 A;  3ZQV A;  4D4X A;  1S05 A;  2XLH A;  3FOO A;  3TOL A;  4CIP A;  4EIY A;  1E85 A;  1JAF A;  3U8P A;  4N6H A;  3QVZ A;  3M15 A;  5JSL A;  2XL6 A;  5AGF A;  1YZA A;  2YL7 A;  2XL8 A;  2XLD A;  3ZQY A;  4CDY A;  4CJO A;  4JE9 A;  3NMI A;  3C63 A;  1E84 A;  4U9E A;  1CGN A;  2YL0 A;  5JS5 A;  3HNK A;  4IAR A;  1GQA A;  1E86 A;  3DE8 A;  2XLM A;  3IQ6 A;  2J8W A;  4N4W A;  1BBH A;  4IB4 A;  4CJG A;  1QPU A;  2YL1 A;  1CPR A;  2YLD A;  3M4B A;  3HNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...