3HNIA

Crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hniA00
3HNKA 2YL7A 3QVZA 4NC3A 1E86A 3ZQYA 5B3IA 4N4WA 3QVYA 3HNJA 2XLOA 3NMIA 3NMKA 1EKYA 5JUAA 1RCPA 4EIYA 3HNLA 3ZTMA 2YLIA 1YZCA 2XL8A 1QQ3A 1A7VA 4ER9A 3M15A 3C62A 1E85A 3FOOA 3QW0A 3HNIA 2YLGA 4JEBA 2XLVA 2J9BA 1CGOA 2YL3A 4IARA 4WGYA 1LM3B 2XLDA 1CPQA 1E83A 2XM0A 1E84A 5JLIA 2YKZA 3TOLA 4CIPA 3U8PA 4CX9A 1BBHA 3NMJA 2XM4A 4WGZA 4U9EA 3M79A 2YL0A 2XLWA 3C63A 1GQAA 2J8WA 5JSLA 5JS5A 1APCA 2XLEA 3DE8A 1M6TA 4N6HA 3ZQVA 1JAFA 3M4BA 2CCYA 3QW1A 1YYJA 1S05A 3ZTZA 256BA 3ZWIA 4CJGA 3VRCA 4CDYA 2QLAA 5AGFA 4IAQA 1CPRA 4CDVA 2XLHA 4CJOA 3TOMA 4D4XA 4L6RA 3DE9A 2YLDA 1CGNA 3L1MA 4JE9A 4ULVA 3IQ6A 4D4NA 3IQ5A 2BC5A 2YL1A 3M4CA 4IB4A 5JT4A 1QPUA 3FOPA 4CDAA 5JP7A 1YYXA 1YZAA 4JKVA 5JRAA 1MQVA 4U9DA 5JVEA 2XL6A 1NBBA 2XLMA 4JEAA
chains in the Genus database with same CATH superfamily
2X0CA 3RQEA 1K40A 3DAFA 4IAOA 2YL7A 4C3BA 1LI5A 1SZIA 5COFA 1FFTC 2J45A 1BR4A 2KC3A 4JW1A 5E33A 4E18A 3EFOB 3UR3C 2HV6A 2J46A 2PX0A 1Q0FA 3QTHA 1WATA 3ZQYA 4LLCA 4YT4A 1F1MA 1LE4A 4GQHA 3T4RA 2Y39A 4N4WA 2Y3GA 2LFDA 3K6BA 2P1AA 2X51A 4PR9A 1LS4A 2R03A 5A6AA 1WOLA 4PACA 1NSGB 2DYSC 2LP4A 3EZHA 3OEOA 4ZLCA 1C17M 4DXWA 1J8MF 4J7YA 4LERA 3U3BA 4CBEA 1HE1A 1RCPA 5JUAA 4I44A 2HJ3A 3HKKA 2J9VA 4P9FA 4BEMJ 1G5ZA 3HTKC 4JCZA 1UFBA 1YZCA 1OCCC 2XL8A 3NG1A 5E3AA 4WABA 1BR1A 2DGJA 3F46A 4U5BE 4XWJA 1A7VA 1AVOB 1T6QA 2G62A 1HE9A 5EK0A 1A7DA 1RJ9B 1YLMA 1Z6AA 2Q4FA 4LDKA 3UMKA 3VM6A 1U6HA 3FOOA 1E85A 4UDVA 4XEKA 1XZQA 4ULWA 5L0HA 1YDIA 2J9BA 2J0WA 3RKOF 3LLKA 3SEOA 2CGEA 4MTFA 4Q7CA 1CPQA 5COMA 3LS1A 3MLGA 1M2OA 4R32A 1E83A 1OR2A 4G7ZF 4B6IA 3IQCA 3LJBA 4NTAA 1E84A 2OEXA 4XPYA 1OW7A 3R2PA 3U8PA 3RQGA 1TWGA 3ATPA 4MTOA 4BJ6C 4WJ0A 4CSAC 5KYWB 4PFPA 1T5OA 3BEHA 4M63A 2UUIA 4E17A 4U9EA 3M79A 3RYLA 5A6KA 3EH2A 3DI5A 4MVRA 3U9MA 3S84A 3AGTA 2P0NA 1OXBA 3NKEA 3CEXA 1GQAA 2J8WA 3NKDA 3ZSUA 3KL4A 3GM1A 5FZTA 2TMVP 2WVOA 4E7SA 2LFFA 4PK4A 2R7OA 4OIOF 2Q9CA 3JCUQ 3GORA 4O7GA 3IHUA 3O39A 5D92A 4OIRF 5B1AC 1A0BA 3KMIA 2KQ9A 4MVMA 3PCVA 5D91A 4JJFA 4BPMA 5F5FA 1OR3A 1S05A 3ZTZA 3O55A 2OJED 1VLSA 2XS1A 4E0IA 2HSQA 3AGUA 4CS8C 2R7RA 2D5RB 4DRIB 1FMVA 1FNTc 3RF3A 4Z9HA 3QMKA 2ASRA 3GANA 3TOMA 4D4XA 4L6RA 1H6GA 2EIKC 4I1OB 2IM8A 4EBBA 4XLPF 1YJGA 4K1OA 3PHF2 3UMIA 4YL1A 5A69A 1MMAA 2NUTB 1B68A 3EH1A 4NTFA 1R4TA 4AL1A 1MMDA 1NFNA 3AJMA 4G0HA 5L3QA 4MTGA 1KU2A 1OW8A 1JOGA 1TQGA 2W9YA 2MWQA 1SR2A 4N6CA 3SXMA 4CDAA 3EHNA 2AU5A 2PBEA 1NFOA 3K7DA 4EHPA 4EWCA 3UGOA 1VK5A 2JX0A 4OD5A 1YYXA 4PJJA 1ZHYA 1WGWA 2NSFA 3US6A 2H7VC 3NYLA 3MYFA 4XQ1A 2ZXOA 2Q9AA 2DI3A 1BDJB 2Q00A 4U9DA 4OIPF 4JCHA 3W8IA 1EI7A 2XL6A 1J8YF 1NBBA 3JYYA 3JZ0A 4GEHA 4EKWA 3K66A 4A2NB 2PP4A 2R7TA 3ABKC 3LUTB 4WGYA 2A0UA 3DM5A 4JVSA 1EA8A 3QVZA 4KI2A 1D0XA 3POVA 1LIHA 5DS6A 3H2VA 3GODA 5B3IA 1TFKB 2ZXWC 2D4UA 4H54A 5L0CA 3RVZA 2EPNA 1TKNA 4CSAA 5HV9A 2I8BA 3KYIA 1HMOA 4KBLA 2HMQA 3JYHA 3TJ5A 5HSWA 2OKUA 1WASA 2LSEA 2WZFA 3IPMO 3NMIA 2RSEB 3NMKA 4RBNA 4XPXA 2LCHA 2QNLA 4K0DA 2YWAA 4I1MA 2NUTA 3TULA 1QKRA 4EIYA 1DOVA 3HNLA 3SXYA 1C02A 3ZTMA 1LVKA 1M57C 1ZW3A 1OCZC 1RKCA 1YA9A 4BEJA 4DRHB 1EQ1A 1QQ3A 3L8IA 4O6NA 4P6IC 4H4KC 5DLJA 2HS5A 1NLXA 1LI7A 3C8ZA 1ZVZA 2WB7A 4PJMA 3VYWA 3M15A 1O5HA 1K05A 5KYUA 4DVZA 1FFHA 2XS8A 4JEBA 4MVSA 4CS8A 3QZCA 2YL3A 2XLDA 3NDBB 4XPWA 3J06A 1CGME 3ZDLA 2XM0A 3ITFA 2C04A 2GFHA 5CIVA 5A6BA 1T01A 2QE9A 2OOCA 2YVKA 4IGGA 3TK0A 5F28E 2LQGA 2CDQA 2EIJC 3JT1A 1T6IA 2A6EF 1OQCA 2HFIA 2VCBA 3FXHA 2XM4A 1XWJA 1S7ZA 2YL0A 3GEEA 3T6GB 2XXAA 2V26A 3EGXB 5B3SC 3FAJA 5TJ5E 4P9TA 3ASOC 2O9XA 2CNWD 4NTBA 3UNGC 1D0ZA 3NYJA 4JJGA 4RD9A 4AE4A 1YA7O 3ZIBA 4AX2A 2J0XA 1APCA 2KNHA 2F22A 3JSEO 4U5GA 3V7OA 1M6TA 3F47A 5KYXA 3EGDA 1WWPA 3QW1A 1VYKA 2HJMA 2UUHA 1YYJA 3Q7LA 4CJGA 256BA 5KYYA 3ZVRA 5B1BC 2LIGA 1V4AA 2QLAA 4E0HA 2XL4A 2NUPB 3GWLA 5AGFA 4IAQA 3MFNA 4U5CE 2IXPA 3B0PA 4MS2A 4O6MA 1RMVA 1V55C 3I5QA 4G78A 4YL0A 3AG2C 2AP3A 3SXKA 2R7WA 4C3EA 1GGQA 3KPHA 3SP1A 3L1MA 4PFOA 2PNOA 3VAYA 1L7CA 4LLEA 1VLTA 2RD9A 1T6UA 4XLNF 3IQ6A 4D4NA 3W4YA 2BC5A 1ORYA 1U89A 4HFKB 2CNWA 3UMHA 3N24A 5JT4A 1C03A 4JC7A 3KH2A 1QPUA 3JRTA 3CSKA 5JP7A 2ZXPA 3RFYA 1D1CA 2LK4A 1HY5A 1MMNA 4BJ5C 2L9JA 3EGXA 1ZYRF 3R7CA 4JZAA 5JRAA 1MQVA 3JTLO 5L3VA 3K1HA 5L0JA 3B29A 2J7PD 4MW3A 3M1CB 2VH3A 2EINC 1H9GA 4JEAA 4QDLA 4EUKB 4U5HA 3L8JA 4J30B 2KGOA 2H7OA 3IEEA 3K1IC 4MVUA 4ONSA 4U5EE 3AG3C 3CAXA 3U9JA 1E86A 1OCRC 1HMDA 4J32B 1VMAA 2M64A 3KYJA 1I4YA 4LDQA 4C3DA 2NUPA 2VASA 4JURI 2HKVA 3T6JA 3EHMA 1Z3IX 3L0IA 1LPEA 2GDCA 2L6GA 3BRJA 1Z23A 4BG0A 3EG9A 1WN0A 2A68F 5T3TA 3U0CA 2WVNA 2WVQA 3HNJA 4YL3A 5T3WA 4FAPB 3PDMP 4E7ZA 1VB5A 4C7OA 4JTDB 1Q0KA 5CI8A 1V54C 1K04A 2XSEA 1FR0A 1EKYA 1L3PA 2KW3C 1ZHXA 2QTVA 3CZ6A 3I4UA 1JR8A 3KKBA 2Q7RA 5KYUB 1W2WA 4YK5A 1OW6A 3IQTA 5L0DA 2Y3DA 1D1AA 2EPOA 5BUOA 5DVWA 3RVYA 3U2MA 3AG4C 2OJQA 5T1DB 1AUEA 2J7PA 1XZPA 1FMWA 2IBFA 2XRHA 3O6XA 1A41A 3N2ZB 4GYTA 3WAQA 1Q0GA 1QZXA 2KJGA 3ZG1A 2J9WA 3K33A 3AQCA 3C62A 2R05A 2P7VA 3HJCA 3HLZA 3MX3A 2DYRC 3W2VA 2YLGA 1UG7A 3DM9B 3S9OA 4YT8A 1CGOA 3JSZA 2XXAB 4IARA 1E2XA 2P61A 3ZC4A 2IXOA 2VC9A 1BR2A 1MNDA 2BE5F 4RDAA 5JLIA 4YT2A 2MHRA 2EPMX 4AE4B 1LKXA 1NG1A 2WZLA 2NPUA 1O87A 2A6HF 2OG2A 3B71A 4XEVA 3GM2A 5CI9A 3JRMO 1BBHA 4K7BA 5KYXB 3OWTA 1HW1A 2GA0A 3EGDB 4DOZA 2R7XA 1H7IA 5KYYB 2XLWA 3LLIA 3A11A 2AVKA 3C63A 4IWBA 5JSLA 3SNHA 4JTAB 2GWWA 1GM5A 4BJ5A 3U5SA 4FWVA 1FTSA 1PV3A 1WTYA 2JPUA 3W2WA 5JS5A 2GAQA 3DZAA 4U5FE 4CS7A 4G7OF 1AEPA 2XLEA 2ICWG 3DAGA 4N6HA 4J7TA 3C8GD 1R5ID 3LEOA 4YN0B 4X0RA 2YHSA 4EBKA 1JAFA 2KK1A 2CCYA 3H65A 3EJNA 1YVIA 1JPJA 4KNWA 5DS5A 3ZWIA 2WL8A 4F4BA 4CS9C 3DKAA 1G4WR 2DB4A 2EPKX 3ASNC 3T6BA 1ZHWA 3AG1C 3N0TA 2FFHA 3LEVA 4YT5A 5L0GA 3K1IA 1H9TA 1VOMA 1FAPB 1CPRA 1ORSC 1V74B 2XLHA 3U8VA 4CDVA 4CJOA 5AC5A 2AWYA 3GEIA 5L0FA 2W4MA 3DE9A 3X1OA 1OKKD 2EILC 2A1DD 2R7SA 1CGNA 1D1BA 4O6YA 4JTCB 1TWAA 4HFFB 1M56C 2R02A 5E3CA 4NY3A 4ULVA 2B0HA 2VCCA 3X2QC 3IQ5A 3E9VA 2Q9BA 1Z63A 3TQOA 2YL1A 2ZD9A 3O10A 1VTMP 4IB4A 2HSBA 1NU9C 2QUPA 2QY9A 4N06A 1MNEA 2YRFA 3GWNA 3C8GA 5DQZA 4W8KA 2OEVA 1M2VA 1JMWA 1ZZPA 2IYLD 4W8PA 4MQ9F 2OCCC 5COGA 2IOQA 5EGYA 4JKVA 1ZHZA 5EHHA 1QSPA 5AC4A 2Q3TA 5JVEA 3RW0A 3EG9B 2M4EA 1OCOC 2MYSA 1SMYF 1G8XA 2PX3A 4DJ9A 4O79A 4C7OB 4QI0A 4OIQF 3HNKA 1KNYA 1OKKA 2L7AA 5L0IA 2VCAA 4NC3A 1SF8A 5BQIA 3SYNA 1DOWA 4BJTA 3B0VC 5DS4A 2Y3HA 1PD1A 3E70C 2Y69C 4MVOA 3FDQA 1Z5ZA 3DJNB 2CW0F 3FAPB 5IY5C 3S90A 3CQZA 1T9KA 3QVYA 2Z15A 2XLOA 1ZW2A 4MVZA 5A6JA 4DBRA 1SYQA 1TWHA 1LS1A 3V5YA 1RXQA 4EBJA 1A7EA 1VYIA 2ETSA 3H2UA 3EFOA 1NZEA 2IXNA 3U2LA 4PJLA 3EZIA 2BL2A 3LNMB 1ORJA 2A0BA 2HZ8A 1I5NA 2YLIA 1RKEB 1OXKA 3AQBA 3RIPA 3WODF 5FCLA 4DVYP 5K0IA 4G7HF 3UGPA 1ZU4A 2JD3A 4OD4A 1O3UA 1NU7D 4CS9A 5BQGA 4ER9A 2H8AA 3VF0A 3G4XA 2H7BA 3QW0A 2W4BA 2J9UA 3L34A 4FESA 3HNIA 4OINF 3V5XA 4Q4ZF 1YARO 2LD6A 2HV7A 2XLVA 1G4US 3ABMC 3C7JA 2B0JA 3Q6NA 3TJ6A 3GEHA 1LM3B 2C03A 1GS9A 4A4AA 4IRUA 4JIOA 3DXJF 5GPGB 3RQFA 4QI2A 3FVYA 2YKZA 3SZRA 1JRAA 3TOLA 3FHDA 4DRJB 4CIPA 1KTMA 2R7QA 4Z9JA 4CX9A 1RJ9A 2V3CC 2IXMA 2L6HA 3B9QA 3PMRA 3NMJA 2A69F 3SXZA 3C18A 4WGZA 4XTKA 2VB6A 1Q0MA 3ABLC 3FMSA 2HUJA 2OQMA 4HEAJ 4FX5A 2G3VA 3S28A 3MYIA 1Z7Qc 4PJNA 3Q7GA 2E87A 3DD7A 3Q6MA 3MBGA 1I4ZA 1QVXA 3EPVA 4NQFA 3DE8A 3I5PA 1ZU5A 2EIMC 4U5DE 3DWWA 3ZQVA 5KYWA 2WZGA 3G50A 3TD7A 3M4BA 2FAPB 2ZXRA 2YEVA 3EQLF 2CYDA 5DQTA 4ANJA 2KSFA 2PF4E 1PD0A 1RKEA 3VRCA 4CDYA 4HE8D 2Y3BA 3V5ZA 3G4ZA 4BJ1A 1TFOB 4IJJA 5A6BD 2L81A 4AL0A 1ST6A 4CIHA 3RH3A 1N1CA 2NG1A 2FGYA 2AWCA 3WHNA 3OA1A 1IZMA 2L6FA 2OU6A 4MVQA 3WG7C 2PFDA 2ZPAA 2YLDA 3A9CA 3C8GB 3NYMA 4NCQA 2R25A 1Q0DA 3GM3A 1M2VB 3LNRA 2EPLX 1Y6DA 3DJUB 1QLEC 4YJWA 4JE9A 3S29A 3T9OA 5KYNA 4KNVA 3NRHA 4MW8A 2R7VA 3LS0A 2I15A 4AK9A 4KC9A 3W8HA 1YAUO 3DMDA 3M4CA 4BJ6A 1LE2A 4JRZA 1TR2A 1Y4CA 1PCXA 3FOPA 3S27A 3B0UX 4LDRA 4DBQA 3LAYA 4I3MA 1U0BB 4ZLDA 4YWQA 1ZHTA 2P6VA 1MMGA 4Z9IA 5F5HA 4XEFA 1YZAA 4LACB 4MNDA 3U3FA 1IW7F 1TWCA 3LESA 1JPNA 1D0YA 2R9RB 2KYHA 3AOUA 2YZSA 3S0XA 2R7UA 2HMZA 2YQYA 2W45A 5E2QA 2NSGA 5BQHA 1BZ4A 1HW2A 3ECSA 2XLMA 4Q5SF 2G3KA
chains in the Genus database with same CATH topology
3HNKA 2YL7A 3QVZA 4NC3A 1E86A 3ZQYA 5B3IA 4N4WA 3QVYA 3HNJA 2XLOA 3NMIA 3NMKA 1EKYA 5JUAA 1RCPA 4EIYA 3HNLA 3ZTMA 2YLIA 1YZCA 2XL8A 1QQ3A 1A7VA 4ER9A 3M15A 3C62A 1E85A 3FOOA 3QW0A 3HNIA 2YLGA 4JEBA 2XLVA 2J9BA 1CGOA 2YL3A 4IARA 4WGYA 1LM3B 2XLDA 1CPQA 1E83A 2XM0A 1E84A 5JLIA 2YKZA 3TOLA 4CIPA 3U8PA 4CX9A 1BBHA 3NMJA 2XM4A 4WGZA 4U9EA 3M79A 2YL0A 2XLWA 3C63A 1GQAA 2J8WA 5JSLA 5JS5A 1APCA 2XLEA 3DE8A 1M6TA 4N6HA 3ZQVA 1JAFA 3M4BA 2CCYA 3QW1A 1YYJA 1S05A 3ZTZA 256BA 3ZWIA 4CJGA 3VRCA 4CDYA 2QLAA 5AGFA 4IAQA 1CPRA 4CDVA 2XLHA 4CJOA 3TOMA 4D4XA 4L6RA 3DE9A 2YLDA 1CGNA 3L1MA 4JE9A 4ULVA 3IQ6A 4D4NA 3IQ5A 2BC5A 2YL1A 3M4CA 4IB4A 5JT4A 1QPUA 3FOPA 4CDAA 5JP7A 1YYXA 1YZAA 4JKVA 5JRAA 1MQVA 4U9DA 5JVEA 2XL6A 1NBBA 2XLMA 4JEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNK A;  2YL7 A;  3QVZ A;  4NC3 A;  1E86 A;  3ZQY A;  5B3I A;  4N4W A;  3QVY A;  3HNJ A;  2XLO A;  3NMI A;  3NMK A;  1EKY A;  5JUA A;  1RCP A;  4EIY A;  3HNL A;  3ZTM A;  2YLI A;  1YZC A;  2XL8 A;  1QQ3 A;  1A7V A;  4ER9 A;  3M15 A;  3C62 A;  1E85 A;  3FOO A;  3QW0 A;  3HNI A;  2YLG A;  4JEB A;  2XLV A;  2J9B A;  1CGO A;  2YL3 A;  4IAR A;  4WGY A;  1LM3 B;  2XLD A;  1CPQ A;  1E83 A;  2XM0 A;  1E84 A;  5JLI A;  2YKZ A;  3TOL A;  4CIP A;  3U8P A;  4CX9 A;  1BBH A;  3NMJ A;  2XM4 A;  4WGZ A;  4U9E A;  3M79 A;  2YL0 A;  2XLW A;  3C63 A;  1GQA A;  2J8W A;  5JSL A;  5JS5 A;  1APC A;  2XLE A;  3DE8 A;  1M6T A;  4N6H A;  3ZQV A;  1JAF A;  3M4B A;  2CCY A;  3QW1 A;  1YYJ A;  1S05 A;  3ZTZ A;  256B A;  3ZWI A;  4CJG A;  3VRC A;  4CDY A;  2QLA A;  5AGF A;  4IAQ A;  1CPR A;  4CDV A;  2XLH A;  4CJO A;  3TOM A;  4D4X A;  4L6R A;  3DE9 A;  2YLD A;  1CGN A;  3L1M A;  4JE9 A;  4ULV A;  3IQ6 A;  4D4N A;  3IQ5 A;  2BC5 A;  2YL1 A;  3M4C A;  4IB4 A;  5JT4 A;  1QPU A;  3FOP A;  4CDA A;  5JP7 A;  1YYX A;  1YZA A;  4JKV A;  5JRA A;  1MQV A;  4U9D A;  5JVE A;  2XL6 A;  1NBB A;  2XLM A;  4JEA A; 
#chains in the Genus database with same CATH topology
 2X0C A;  3RQE A;  1K40 A;  3DAF A;  4IAO A;  2YL7 A;  4C3B A;  1LI5 A;  1SZI A;  5COF A;  1FFT C;  2J45 A;  1BR4 A;  2KC3 A;  4JW1 A;  5E33 A;  4E18 A;  3EFO B;  3UR3 C;  2HV6 A;  2J46 A;  2PX0 A;  1Q0F A;  3QTH A;  1WAT A;  3ZQY A;  4LLC A;  4YT4 A;  1F1M A;  1LE4 A;  4GQH A;  3T4R A;  2Y39 A;  4N4W A;  2Y3G A;  2LFD A;  3K6B A;  2P1A A;  2X51 A;  4PR9 A;  1LS4 A;  2R03 A;  5A6A A;  1WOL A;  4PAC A;  1NSG B;  2DYS C;  2LP4 A;  3EZH A;  3OEO A;  4ZLC A;  1C17 M;  4DXW A;  1J8M F;  4J7Y A;  4LER A;  3U3B A;  4CBE A;  1HE1 A;  1RCP A;  5JUA A;  4I44 A;  2HJ3 A;  3HKK A;  2J9V A;  4P9F A;  4BEM J;  1G5Z A;  3HTK C;  4JCZ A;  1UFB A;  1YZC A;  1OCC C;  2XL8 A;  3NG1 A;  5E3A A;  4WAB A;  1BR1 A;  2DGJ A;  3F46 A;  4U5B E;  4XWJ A;  1A7V A;  1AVO B;  1T6Q A;  2G62 A;  1HE9 A;  5EK0 A;  1A7D A;  1RJ9 B;  1YLM A;  1Z6A A;  2Q4F A;  4LDK A;  3UMK A;  3VM6 A;  1U6H A;  3FOO A;  1E85 A;  4UDV A;  4XEK A;  1XZQ A;  4ULW A;  5L0H A;  1YDI A;  2J9B A;  2J0W A;  3RKO F;  3LLK A;  3SEO A;  2CGE A;  4MTF A;  4Q7C A;  1CPQ A;  5COM A;  3LS1 A;  3MLG A;  1M2O A;  4R32 A;  1E83 A;  1OR2 A;  4G7Z F;  4B6I A;  3IQC A;  3LJB A;  4NTA A;  1E84 A;  2OEX A;  4XPY A;  1OW7 A;  3R2P A;  3U8P A;  3RQG A;  1TWG A;  3ATP A;  4MTO A;  4BJ6 C;  4WJ0 A;  4CSA C;  5KYW B;  4PFP A;  1T5O A;  3BEH A;  4M63 A;  2UUI A;  4E17 A;  4U9E A;  3M79 A;  3RYL A;  5A6K A;  3EH2 A;  3DI5 A;  4MVR A;  3U9M A;  3S84 A;  3AGT A;  2P0N A;  1OXB A;  3NKE A;  3CEX A;  1GQA A;  2J8W A;  3NKD A;  3ZSU A;  3KL4 A;  3GM1 A;  5FZT A;  2TMV P;  2WVO A;  4E7S A;  2LFF A;  4PK4 A;  2R7O A;  4OIO F;  2Q9C A;  3JCU Q;  3GOR A;  4O7G A;  3IHU A;  3O39 A;  5D92 A;  4OIR F;  5B1A C;  1A0B A;  3KMI A;  2KQ9 A;  4MVM A;  3PCV A;  5D91 A;  4JJF A;  4BPM A;  5F5F A;  1OR3 A;  1S05 A;  3ZTZ A;  3O55 A;  2OJE D;  1VLS A;  2XS1 A;  4E0I A;  2HSQ A;  3AGU A;  4CS8 C;  2R7R A;  2D5R B;  4DRI B;  1FMV A;  1FNT c;  3RF3 A;  4Z9H A;  3QMK A;  2ASR A;  3GAN A;  3TOM A;  4D4X A;  4L6R A;  1H6G A;  2EIK C;  4I1O B;  2IM8 A;  4EBB A;  4XLP F;  1YJG A;  4K1O A;  3PHF 2;  3UMI A;  4YL1 A;  5A69 A;  1MMA A;  2NUT B;  1B68 A;  3EH1 A;  4NTF A;  1R4T A;  4AL1 A;  1MMD A;  1NFN A;  3AJM A;  4G0H A;  5L3Q A;  4MTG A;  1KU2 A;  1OW8 A;  1JOG A;  1TQG A;  2W9Y A;  2MWQ A;  1SR2 A;  4N6C A;  3SXM A;  4CDA A;  3EHN A;  2AU5 A;  2PBE A;  1NFO A;  3K7D A;  4EHP A;  4EWC A;  3UGO A;  1VK5 A;  2JX0 A;  4OD5 A;  1YYX A;  4PJJ A;  1ZHY A;  1WGW A;  2NSF A;  3US6 A;  2H7V C;  3NYL A;  3MYF A;  4XQ1 A;  2ZXO A;  2Q9A A;  2DI3 A;  1BDJ B;  2Q00 A;  4U9D A;  4OIP F;  4JCH A;  3W8I A;  1EI7 A;  2XL6 A;  1J8Y F;  1NBB A;  3JYY A;  3JZ0 A;  4GEH A;  4EKW A;  3K66 A;  4A2N B;  2PP4 A;  2R7T A;  3ABK C;  3LUT B;  4WGY A;  2A0U A;  3DM5 A;  4JVS A;  1EA8 A;  3QVZ A;  4KI2 A;  1D0X A;  3POV A;  1LIH A;  5DS6 A;  3H2V A;  3GOD A;  5B3I A;  1TFK B;  2ZXW C;  2D4U A;  4H54 A;  5L0C A;  3RVZ A;  2EPN A;  1TKN A;  4CSA A;  5HV9 A;  2I8B A;  3KYI A;  1HMO A;  4KBL A;  2HMQ A;  3JYH A;  3TJ5 A;  5HSW A;  2OKU A;  1WAS A;  2LSE A;  2WZF A;  3IPM O;  3NMI A;  2RSE B;  3NMK A;  4RBN A;  4XPX A;  2LCH A;  2QNL A;  4K0D A;  2YWA A;  4I1M A;  2NUT A;  3TUL A;  1QKR A;  4EIY A;  1DOV A;  3HNL A;  3SXY A;  1C02 A;  3ZTM A;  1LVK A;  1M57 C;  1ZW3 A;  1OCZ C;  1RKC A;  1YA9 A;  4BEJ A;  4DRH B;  1EQ1 A;  1QQ3 A;  3L8I A;  4O6N A;  4P6I C;  4H4K C;  5DLJ A;  2HS5 A;  1NLX A;  1LI7 A;  3C8Z A;  1ZVZ A;  2WB7 A;  4PJM A;  3VYW A;  3M15 A;  1O5H A;  1K05 A;  5KYU A;  4DVZ A;  1FFH A;  2XS8 A;  4JEB A;  4MVS A;  4CS8 A;  3QZC A;  2YL3 A;  2XLD A;  3NDB B;  4XPW A;  3J06 A;  1CGM E;  3ZDL A;  2XM0 A;  3ITF A;  2C04 A;  2GFH A;  5CIV A;  5A6B A;  1T01 A;  2QE9 A;  2OOC A;  2YVK A;  4IGG A;  3TK0 A;  5F28 E;  2LQG A;  2CDQ A;  2EIJ C;  3JT1 A;  1T6I A;  2A6E F;  1OQC A;  2HFI A;  2VCB A;  3FXH A;  2XM4 A;  1XWJ A;  1S7Z A;  2YL0 A;  3GEE A;  3T6G B;  2XXA A;  2V26 A;  3EGX B;  5B3S C;  3FAJ A;  5TJ5 E;  4P9T A;  3ASO C;  2O9X A;  2CNW D;  4NTB A;  3UNG C;  1D0Z A;  3NYJ A;  4JJG A;  4RD9 A;  4AE4 A;  1YA7 O;  3ZIB A;  4AX2 A;  2J0X A;  1APC A;  2KNH A;  2F22 A;  3JSE O;  4U5G A;  3V7O A;  1M6T A;  3F47 A;  5KYX A;  3EGD A;  1WWP A;  3QW1 A;  1VYK A;  2HJM A;  2UUH A;  1YYJ A;  3Q7L A;  4CJG A;  256B A;  5KYY A;  3ZVR A;  5B1B C;  2LIG A;  1V4A A;  2QLA A;  4E0H A;  2XL4 A;  2NUP B;  3GWL A;  5AGF A;  4IAQ A;  3MFN A;  4U5C E;  2IXP A;  3B0P A;  4MS2 A;  4O6M A;  1RMV A;  1V55 C;  3I5Q A;  4G78 A;  4YL0 A;  3AG2 C;  2AP3 A;  3SXK A;  2R7W A;  4C3E A;  1GGQ A;  3KPH A;  3SP1 A;  3L1M A;  4PFO A;  2PNO A;  3VAY A;  1L7C A;  4LLE A;  1VLT A;  2RD9 A;  1T6U A;  4XLN F;  3IQ6 A;  4D4N A;  3W4Y A;  2BC5 A;  1ORY A;  1U89 A;  4HFK B;  2CNW A;  3UMH A;  3N24 A;  5JT4 A;  1C03 A;  4JC7 A;  3KH2 A;  1QPU A;  3JRT A;  3CSK A;  5JP7 A;  2ZXP A;  3RFY A;  1D1C A;  2LK4 A;  1HY5 A;  1MMN A;  4BJ5 C;  2L9J A;  3EGX A;  1ZYR F;  3R7C A;  4JZA A;  5JRA A;  1MQV A;  3JTL O;  5L3V A;  3K1H A;  5L0J A;  3B29 A;  2J7P D;  4MW3 A;  3M1C B;  2VH3 A;  2EIN C;  1H9G A;  4JEA A;  4QDL A;  4EUK B;  4U5H A;  3L8J A;  4J30 B;  2KGO A;  2H7O A;  3IEE A;  3K1I C;  4MVU A;  4ONS A;  4U5E E;  3AG3 C;  3CAX A;  3U9J A;  1E86 A;  1OCR C;  1HMD A;  4J32 B;  1VMA A;  2M64 A;  3KYJ A;  1I4Y A;  4LDQ A;  4C3D A;  2NUP A;  2VAS A;  4JUR I;  2HKV A;  3T6J A;  3EHM A;  1Z3I X;  3L0I A;  1LPE A;  2GDC A;  2L6G A;  3BRJ A;  1Z23 A;  4BG0 A;  3EG9 A;  1WN0 A;  2A68 F;  5T3T A;  3U0C A;  2WVN A;  2WVQ A;  3HNJ A;  4YL3 A;  5T3W A;  4FAP B;  3PDM P;  4E7Z A;  1VB5 A;  4C7O A;  4JTD B;  1Q0K A;  5CI8 A;  1V54 C;  1K04 A;  2XSE A;  1FR0 A;  1EKY A;  1L3P A;  2KW3 C;  1ZHX A;  2QTV A;  3CZ6 A;  3I4U A;  1JR8 A;  3KKB A;  2Q7R A;  5KYU B;  1W2W A;  4YK5 A;  1OW6 A;  3IQT A;  5L0D A;  2Y3D A;  1D1A A;  2EPO A;  5BUO A;  5DVW A;  3RVY A;  3U2M A;  3AG4 C;  2OJQ A;  5T1D B;  1AUE A;  2J7P A;  1XZP A;  1FMW A;  2IBF A;  2XRH A;  3O6X A;  1A41 A;  3N2Z B;  4GYT A;  3WAQ A;  1Q0G A;  1QZX A;  2KJG A;  3ZG1 A;  2J9W A;  3K33 A;  3AQC A;  3C62 A;  2R05 A;  2P7V A;  3HJC A;  3HLZ A;  3MX3 A;  2DYR C;  3W2V A;  2YLG A;  1UG7 A;  3DM9 B;  3S9O A;  4YT8 A;  1CGO A;  3JSZ A;  2XXA B;  4IAR A;  1E2X A;  2P61 A;  3ZC4 A;  2IXO A;  2VC9 A;  1BR2 A;  1MND A;  2BE5 F;  4RDA A;  5JLI A;  4YT2 A;  2MHR A;  2EPM X;  4AE4 B;  1LKX A;  1NG1 A;  2WZL A;  2NPU A;  1O87 A;  2A6H F;  2OG2 A;  3B71 A;  4XEV A;  3GM2 A;  5CI9 A;  3JRM O;  1BBH A;  4K7B A;  5KYX B;  3OWT A;  1HW1 A;  2GA0 A;  3EGD B;  4DOZ A;  2R7X A;  1H7I A;  5KYY B;  2XLW A;  3LLI A;  3A11 A;  2AVK A;  3C63 A;  4IWB A;  5JSL A;  3SNH A;  4JTA B;  2GWW A;  1GM5 A;  4BJ5 A;  3U5S A;  4FWV A;  1FTS A;  1PV3 A;  1WTY A;  2JPU A;  3W2W A;  5JS5 A;  2GAQ A;  3DZA A;  4U5F E;  4CS7 A;  4G7O F;  1AEP A;  2XLE A;  2ICW G;  3DAG A;  4N6H A;  4J7T A;  3C8G D;  1R5I D;  3LEO A;  4YN0 B;  4X0R A;  2YHS A;  4EBK A;  1JAF A;  2KK1 A;  2CCY A;  3H65 A;  3EJN A;  1YVI A;  1JPJ A;  4KNW A;  5DS5 A;  3ZWI A;  2WL8 A;  4F4B A;  4CS9 C;  3DKA A;  1G4W R;  2DB4 A;  2EPK X;  3ASN C;  3T6B A;  1ZHW A;  3AG1 C;  3N0T A;  2FFH A;  3LEV A;  4YT5 A;  5L0G A;  3K1I A;  1H9T A;  1VOM A;  1FAP B;  1CPR A;  1ORS C;  1V74 B;  2XLH A;  3U8V A;  4CDV A;  4CJO A;  5AC5 A;  2AWY A;  3GEI A;  5L0F A;  2W4M A;  3DE9 A;  3X1O A;  1OKK D;  2EIL C;  2A1D D;  2R7S A;  1CGN A;  1D1B A;  4O6Y A;  4JTC B;  1TWA A;  4HFF B;  1M56 C;  2R02 A;  5E3C A;  4NY3 A;  4ULV A;  2B0H A;  2VCC A;  3X2Q C;  3IQ5 A;  3E9V A;  2Q9B A;  1Z63 A;  3TQO A;  2YL1 A;  2ZD9 A;  3O10 A;  1VTM P;  4IB4 A;  2HSB A;  1NU9 C;  2QUP A;  2QY9 A;  4N06 A;  1MNE A;  2YRF A;  3GWN A;  3C8G A;  5DQZ A;  4W8K A;  2OEV A;  1M2V A;  1JMW A;  1ZZP A;  2IYL D;  4W8P A;  4MQ9 F;  2OCC C;  5COG A;  2IOQ A;  5EGY A;  4JKV A;  1ZHZ A;  5EHH A;  1QSP A;  5AC4 A;  2Q3T A;  5JVE A;  3RW0 A;  3EG9 B;  2M4E A;  1OCO C;  2MYS A;  1SMY F;  1G8X A;  2PX3 A;  4DJ9 A;  4O79 A;  4C7O B;  4QI0 A;  4OIQ F;  3HNK A;  1KNY A;  1OKK A;  2L7A A;  5L0I A;  2VCA A;  4NC3 A;  1SF8 A;  5BQI A;  3SYN A;  1DOW A;  4BJT A;  3B0V C;  5DS4 A;  2Y3H A;  1PD1 A;  3E70 C;  2Y69 C;  4MVO A;  3FDQ A;  1Z5Z A;  3DJN B;  2CW0 F;  3FAP B;  5IY5 C;  3S90 A;  3CQZ A;  1T9K A;  3QVY A;  2Z15 A;  2XLO A;  1ZW2 A;  4MVZ A;  5A6J A;  4DBR A;  1SYQ A;  1TWH A;  1LS1 A;  3V5Y A;  1RXQ A;  4EBJ A;  1A7E A;  1VYI A;  2ETS A;  3H2U A;  3EFO A;  1NZE A;  2IXN A;  3U2L A;  4PJL A;  3EZI A;  2BL2 A;  3LNM B;  1ORJ A;  2A0B A;  2HZ8 A;  1I5N A;  2YLI A;  1RKE B;  1OXK A;  3AQB A;  3RIP A;  3WOD F;  5FCL A;  4DVY P;  5K0I A;  4G7H F;  3UGP A;  1ZU4 A;  2JD3 A;  4OD4 A;  1O3U A;  1NU7 D;  4CS9 A;  5BQG A;  4ER9 A;  2H8A A;  3VF0 A;  3G4X A;  2H7B A;  3QW0 A;  2W4B A;  2J9U A;  3L34 A;  4FES A;  3HNI A;  4OIN F;  3V5X A;  4Q4Z F;  1YAR O;  2LD6 A;  2HV7 A;  2XLV A;  1G4U S;  3ABM C;  3C7J A;  2B0J A;  3Q6N A;  3TJ6 A;  3GEH A;  1LM3 B;  2C03 A;  1GS9 A;  4A4A A;  4IRU A;  4JIO A;  3DXJ F;  5GPG B;  3RQF A;  4QI2 A;  3FVY A;  2YKZ A;  3SZR A;  1JRA A;  3TOL A;  3FHD A;  4DRJ B;  4CIP A;  1KTM A;  2R7Q A;  4Z9J A;  4CX9 A;  1RJ9 A;  2V3C C;  2IXM A;  2L6H A;  3B9Q A;  3PMR A;  3NMJ A;  2A69 F;  3SXZ A;  3C18 A;  4WGZ A;  4XTK A;  2VB6 A;  1Q0M A;  3ABL C;  3FMS A;  2HUJ A;  2OQM A;  4HEA J;  4FX5 A;  2G3V A;  3S28 A;  3MYI A;  1Z7Q c;  4PJN A;  3Q7G A;  2E87 A;  3DD7 A;  3Q6M A;  3MBG A;  1I4Z A;  1QVX A;  3EPV A;  4NQF A;  3DE8 A;  3I5P A;  1ZU5 A;  2EIM C;  4U5D E;  3DWW A;  3ZQV A;  5KYW A;  2WZG A;  3G50 A;  3TD7 A;  3M4B A;  2FAP B;  2ZXR A;  2YEV A;  3EQL F;  2CYD A;  5DQT A;  4ANJ A;  2KSF A;  2PF4 E;  1PD0 A;  1RKE A;  3VRC A;  4CDY A;  4HE8 D;  2Y3B A;  3V5Z A;  3G4Z A;  4BJ1 A;  1TFO B;  4IJJ A;  5A6B D;  2L81 A;  4AL0 A;  1ST6 A;  4CIH A;  3RH3 A;  1N1C A;  2NG1 A;  2FGY A;  2AWC A;  3WHN A;  3OA1 A;  1IZM A;  2L6F A;  2OU6 A;  4MVQ A;  3WG7 C;  2PFD A;  2ZPA A;  2YLD A;  3A9C A;  3C8G B;  3NYM A;  4NCQ A;  2R25 A;  1Q0D A;  3GM3 A;  1M2V B;  3LNR A;  2EPL X;  1Y6D A;  3DJU B;  1QLE C;  4YJW A;  4JE9 A;  3S29 A;  3T9O A;  5KYN A;  4KNV A;  3NRH A;  4MW8 A;  2R7V A;  3LS0 A;  2I15 A;  4AK9 A;  4KC9 A;  3W8H A;  1YAU O;  3DMD A;  3M4C A;  4BJ6 A;  1LE2 A;  4JRZ A;  1TR2 A;  1Y4C A;  1PCX A;  3FOP A;  3S27 A;  3B0U X;  4LDR A;  4DBQ A;  3LAY A;  4I3M A;  1U0B B;  4ZLD A;  4YWQ A;  1ZHT A;  2P6V A;  1MMG A;  4Z9I A;  5F5H A;  4XEF A;  1YZA A;  4LAC B;  4MND A;  3U3F A;  1IW7 F;  1TWC A;  3LES A;  1JPN A;  1D0Y A;  2R9R B;  2KYH A;  3AOU A;  2YZS A;  3S0X A;  2R7U A;  2HMZ A;  2YQY A;  2W45 A;  5E2Q A;  2NSG A;  5BQH A;  1BZ4 A;  1HW2 A;  3ECS A;  2XLM A;  4Q5S F;  2G3K A; 
#chains in the Genus database with same CATH homology
 3HNK A;  2YL7 A;  3QVZ A;  4NC3 A;  1E86 A;  3ZQY A;  5B3I A;  4N4W A;  3QVY A;  3HNJ A;  2XLO A;  3NMI A;  3NMK A;  1EKY A;  5JUA A;  1RCP A;  4EIY A;  3HNL A;  3ZTM A;  2YLI A;  1YZC A;  2XL8 A;  1QQ3 A;  1A7V A;  4ER9 A;  3M15 A;  3C62 A;  1E85 A;  3FOO A;  3QW0 A;  3HNI A;  2YLG A;  4JEB A;  2XLV A;  2J9B A;  1CGO A;  2YL3 A;  4IAR A;  4WGY A;  1LM3 B;  2XLD A;  1CPQ A;  1E83 A;  2XM0 A;  1E84 A;  5JLI A;  2YKZ A;  3TOL A;  4CIP A;  3U8P A;  4CX9 A;  1BBH A;  3NMJ A;  2XM4 A;  4WGZ A;  4U9E A;  3M79 A;  2YL0 A;  2XLW A;  3C63 A;  1GQA A;  2J8W A;  5JSL A;  5JS5 A;  1APC A;  2XLE A;  3DE8 A;  1M6T A;  4N6H A;  3ZQV A;  1JAF A;  3M4B A;  2CCY A;  3QW1 A;  1YYJ A;  1S05 A;  3ZTZ A;  256B A;  3ZWI A;  4CJG A;  3VRC A;  4CDY A;  2QLA A;  5AGF A;  4IAQ A;  1CPR A;  4CDV A;  2XLH A;  4CJO A;  3TOM A;  4D4X A;  4L6R A;  3DE9 A;  2YLD A;  1CGN A;  3L1M A;  4JE9 A;  4ULV A;  3IQ6 A;  4D4N A;  3IQ5 A;  2BC5 A;  2YL1 A;  3M4C A;  4IB4 A;  5JT4 A;  1QPU A;  3FOP A;  4CDA A;  5JP7 A;  1YYX A;  1YZA A;  4JKV A;  5JRA A;  1MQV A;  4U9D A;  5JVE A;  2XL6 A;  1NBB A;  2XLM A;  4JEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...