2XLVA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124f variant with bound no
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
125
structure length
125
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 52
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlvA00
2XL8A 3M79A 3HNIA 2J8WA 1APCA 2J9BA 4CIPA 4JE9A 2XLVA 5JVEA 1S05A 1E85A 4CDYA 2XM0A 3DE9A 1CGOA 1MQVA 4U9DA 256BA 3FOOA 3IQ6A 4IAQA 2XL6A 1RCPA 3TOMA 3M4BA 3M15A 2CCYA 2YLDA 5B3IA 5JLIA 5JSLA 2YL1A 3FOPA 1CGNA 3ZQVA 2YL0A 4ER9A 5JP7A 1CPRA 1LM3B 3TOLA 3QW0A 5JUAA 4IARA 3ZTMA 3IQ5A 1JAFA 4EIYA 1M6TA 4JKVA 3NMIA 1BBHA 3ZTZA 1GQAA 1QPUA 4D4NA 2XLEA 3L1MA 3NMKA 1YZAA 2XLWA 4JEAA 2YLGA 2YKZA 2XLDA 3U8PA 4NC3A 1YZCA 4CJGA 4JEBA 4CJOA 4N6HA 1YYJA 2YL3A 5AGFA 3HNJA 2BC5A 1E83A 2XLMA 3QVZA 3QVYA 1EKYA 3VRCA 5JT4A 2YL7A 4IB4A 4WGYA 4D4XA 3C63A 4U9EA 3QW1A 3NMJA 2XM4A 3M4CA 4WGZA 1E84A 4CDVA 3HNLA 4ULVA 2XLHA 1CPQA 5JRAA 3ZWIA 3HNKA 2YLIA 3C62A 1NBBA 2QLAA 4CX9A 5JS5A 3DE8A 3ZQYA 4L6RA 1YYXA 2XLOA 4CDAA 1A7VA 1QQ3A 1E86A 4N4WA
chains in the Genus database with same CATH superfamily
1RKEB 3QTHA 3J06A 4LDKA 3HNIA 1APCA 1TFOB 3HKKA 1E2XA 3WAQA 4JCHA 4XPXA 2XS1A 1O3UA 3W2WA 2YHSA 2XLVA 2R9RB 4KNVA 1K04A 3OEOA 1VYIA 3RH3A 2FFHA 5FZTA 3KL4A 4MVMA 3E9VA 1M2VB 1SYQA 3DM9B 2R03A 4MNDA 4HEAJ 3JSEO 5KYUA 1LI5A 3N24A 4IWBA 5CIVA 1Z3IX 4LERA 2NUTB 1XWJA 3LUTB 5K0IA 2I15A 2J9VA 5T3WA 3U3FA 2LCHA 4IAQA 1J8MF 4U5GA 1C02A 3AOUA 2OU6A 3M4BA 3W8IA 3DXJF 1OR2A 1AUEA 1R4TA 1JOGA 2CCYA 4JIOA 3POVA 5KYXB 3EJNA 1G5ZA 2A1DD 5JSLA 4G7HF 3K1IC 3FOPA 4CS9C 2X0CA 2F22A 1CGNA 2A6HF 3C8GB 5KYWB 3B0VC 3PMRA 4NQFA 3S0XA 4OINF 4ER9A 3ZSUA 3PHF2 1YLMA 1Z5ZA 3Q6MA 4EKWA 4R32A 3LEOA 4ANJA 1CPRA 3TJ5A 2WZLA 1LM3B 2EILC 3QW0A 5CI9A 3TOLA 5JUAA 1JAFA 3UGPA 2JD3A 3ABMC 1D0ZA 1A7EA 3CSKA 4C3DA 2R05A 4E0HA 2R7VA 4QI0A 2MWQA 4JCZA 4NTFA 3RQFA 2AVKA 3K6BA 1Z7Qc 3ZTZA 1GQAA 1WGWA 1SMYF 2VCAA 3MYFA 4KNWA 2XLEA 4DBQA 3X2QC 3L1MA 2O9XA 3U0CA 2PF4E 5IY5C 1HE9A 4O79A 1T01A 1NG1A 2Y69C 1VTMP 2WB7A 2EPKX 2FGYA 1M2OA 4JEAA 2A0BA 1WATA 2J7PA 2PX3A 2OCCC 3U5SA 1RJ9A 2YKZA 2XLDA 3H2UA 3U8PA 4DRJB 2NPUA 2NSGA 4LLCA 4LDRA 1HW1A 2DGJA 3V7OA 2HJMA 2P7VA 3CAXA 4AE4B 4DJ9A 3I5PA 1ZW3A 4C7OA 1Y4CA 3GEEA 1V4AA 4M63A 3HNJA 4LACB 2HMZA 2HUJA 2XLMA 3QVZA 3RW0A 3S9OA 4OIPF 2QE9A 4W8KA 1YARO 1OW8A 2LSEA 1S7ZA 2EINC 2XXAA 1D1CA 2AWCA 3EH2A 4GEHA 1GS9A 2XSEA 4PJJA 1ZU4A 2EPOA 4I3MA 4CS8C 4PJNA 4WGYA 5F5FA 3Q7GA 3V5XA 1RMVA 2ETSA 3ZC4A 2MYSA 3G4ZA 4J7YA 1OCRC 2J9UA 3AGUA 4BJ5C 3AG4C 2OJQA 4U9EA 2VH3A 4EWCA 3OA1A 3OWTA 4MTFA 2EPLX 2M64A 2WVNA 3VAYA 4BJ1A 2WZGA 1LPEA 1RKEA 1K05A 3W4YA 5L0HA 2R7UA 3SYNA 1EA8A 4J7TA 4O6MA 3FHDA 4PACA 4CDVA 4JTDB 1TWCA 2B0HA 3DI5A 3R2PA 4JJGA 3SNHA 3B71A 4BG0A 1W2WA 3O10A 1D1BA 2KSFA 5BQIA 5JRAA 2L7AA 1M2VA 3HNKA 4HFFB 4U5DE 4XWJA 4U5EE 4U5CE 3NDBB 3F46A 1RKCA 4CS7A 3KYJA 4HFKB 1WASA 4YT8A 1NBBA 1JPNA 1Q0MA 2Q9AA 3AQCA 1VLSA 2NUTA 3RQEA 3U2MA 4NTAA 4MW3A 1OQCA 4WABA 3S27A 1TWHA 1ZVZA 3DWWA 5HV9A 5HSWA 1YYXA 2XLOA 4CDAA 2ICWG 2Y3BA 2CYDA 1QQ3A 4Z9IA 3GM1A 3NKEA 4H54A 1A41A 4CSAC 1KTMA 2Q3TA 3ABKC 4C3BA 3NYMA 3O39A 5KYXA 1YJGA 4CS9A 1ORJA 3AGTA 3C8GA 3FAJA 3H65A 5KYWA 2CGEA 4XPYA 5L0FA 2EPNA 5JVEA 2KK1A 1S05A 4JJFA 4CDYA 4BPMA 2KJGA 2L9JA 3VF0A 1BR2A 1ZU5A 2XM0A 3DE9A 1HMOA 4E17A 3LNMB 4U9DA 2AU5A 4O6NA 1U6HA 3IQ6A 3L0IA 3ZG1A 1NFOA 1RCPA 4YT4A 3QMKA 5E3AA 2IM8A 2J45A 2RD9A 4YWQA 5L3VA 1YVIA 3AG2C 2A0UA 3IPMO 2A68F 1ZW2A 2QY9A 4WJ0A 1BDJB 3WODF 2IXPA 5DQTA 2R7OA 3EH1A 4FESA 4XEVA 5JP7A 2H8AA 4AL1A 1H6GA 2YZSA 3EG9B 1DOWA 3NKDA 1V55C 5A6BA 1XZPA 2CNWA 3V5ZA 3AG1C 4EIYA 4AE4A 1TQGA 3N2ZB 2L81A 5B3SC 3ASNC 1M6TA 3TULA 1YDIA 3CEXA 3GM2A 4JKVA 4UDVA 4DXWA 1BBHA 4EBJA 4OD4A 1PV3A 1QPUA 1VLTA 2J0XA 1V54C 1JR8A 1B68A 1ZHXA 4EHPA 3EFOB 3NMKA 1Q0FA 4YT5A 4BJ6C 2C03A 2IXOA 4OIRF 3ZDLA 4BJTA 3EGDB 1SR2A 1YZAA 2YQYA 4G7ZF 1YAUO 2Y3DA 1ZHYA 4ULWA 3TD7A 1H9TA 2LD6A 5JLIA 5L0CA 2KQ9A 3T9OA 3RIPA 4G7OF 5F5HA 1MNDA 4I1MA 1SF8A 2AWYA 3EZHA 5DVWA 1JPJA 1OCCC 2G62A 3FAPB 3DMDA 1TWGA 4JVSA 3GWLA 2J0WA 4JURI 3HJCA 1I5NA 4MW8A 4OD5A 3EHNA 1KU2A 1L7CA 4XEFA 5D92A 3DD7A 1VMAA 2P0NA 3NG1A 2Q9BA 3S29A 2YL7A 1OW6A 3MBGA 2EIMC 2HKVA 3TJ6A 2C04A 4D4XA 1ZYRF 3B0UX 1CGME 2D4UA 2W4BA 2JPUA 1DOVA 1AEPA 1BZ4A 3KPHA 1QSPA 4KI2A 1T6UA 4ZLCA 3NRHA 3NYLA 4PFOA 1WOLA 2OQMA 3EGXB 3JYYA 3Q6NA 3PDMP 2CDQA 3NMJA 2NG1A 2OOCA 2GA0A 2NSFA 3AJMA 3M4CA 4GQHA 2IXNA 2W4MA 1LS1A 4U5BE 5DLJA 1E84A 2TMVP 2H7BA 1Y6DA 5COFA 4E7ZA 1LVKA 3HNLA 2BE5F 2L6GA 4MQ9F 2R7TA 4NTBA 1QLEC 4YL1A 5EHHA 2ZPAA 1TKNA 2YLIA 3C62A 3DJUB 3BRJA 2FAPB 1MMDA 1LIHA 1ST6A 1TR2A 3C8ZA 3UMKA 3X1OA 2HJ3A 4CX9A 4CIHA 2QNLA 1KNYA 1HW2A 4GYTA 3EQLF 3ZQYA 4AX2A 3UMIA 4XLPF 1EQ1A 4U5FE 2ZXOA 1TWAA 1YA9A 2HMQA 2A6EF 1IZMA 2EIKC 2HS5A 2OEVA 4EBBA 4KBLA 1G4WR 2H7OA 4JTAB 3M79A 2OEXA 2Q7RA 2V3CC 2OJED 1OXKA 2J8WA 2LFFA 2XL4A 2J9BA 3CZ6A 2KYHA 3GODA 1PCXA 4JE9A 4YK5A 2L6HA 4MVOA 1PD0A 4OIOF 4XQ1A 3C18A 3WHNA 3C8GD 3HTKC 3SP1A 1FR0A 3SXKA 1LE2A 4OIQF 2PX0A 4ZLDA 3E70C 2KNHA 2W45A 2HZ8A 3EG9A 2H7VC 2EPMX 4YL3A 2W9YA 5EK0A 1CGOA 1C17M 3S84A 3DJNB 3M1CB 1MQVA 3I5QA 5A6AA 2OKUA 2Y39A 5L0JA 1I4ZA 1Z6AA 2DI3A 2R7XA 2XL6A 3L8IA 4G78A 1OW7A 5GPGB 3M15A 4B6IA 1OR3A 3L34A 5B3IA 3EFOA 2P61A 3O55A 4LLEA 4QDLA 2NUPB 5E3CA 5BQGA 2ZXPA 1L3PA 3ATPA 3JRMO 3EGDA 1FFHA 3QZCA 5T3TA 2YL0A 3ZQVA 4AL0A 5BUOA 2R7RA 1NSGB 3I4UA 1T6IA 2IOQA 3K1IA 3VYWA 1V74B 3A9CA 3FVYA 4RD9A 2R7SA 3FXHA 3JZ0A 1TFKB 3JT1A 2KW3C 2LQGA 3L8JA 3G50A 5DS6A 2YRFA 5L0IA 3A11A 4Z9HA 2PFDA 4XTKA 2CNWD 3U2LA 2ZXWC 5DS4A 5A6BD 2DYSC 2LIGA 2XS8A 3LEVA 3U8VA 1MMGA 3W2VA 4D4NA 4PFPA 3KH2A 4EBKA 1U0BB 2DYRC 4W8PA 3SXYA 3MYIA 3Q7LA 4MVUA 3ABLC 2WVOA 2XLWA 4MTOA 4P6IC 5E33A 2HFIA 4MVSA 3O6XA 2WZFA 1ZHWA 1QVXA 4CBEA 3JCUQ 3EGXA 2RSEB 3H2VA 1EI7A 2J46A 3JRTA 3LS0A 4H4KC 1D0XA 5AC4A 1G8XA 1F1MA 1U89A 3IHUA 1VB5A 4ONSA 5B1AC 3S28A 4CJOA 2V26A 1YYJA 3JYHA 2YL3A 1E83A 4RDAA 3W8HA 3QVYA 2YVKA 4J32B 1EKYA 4IAOA 2LP4A 3TK0A 2R25A 3VRCA 4DRIB 4KC9A 3DAFA 2HSBA 3DAGA 3BEHA 4NY3A 4Q5SF 2IBFA 1VYKA 4IB4A 1K40A 4Q4ZF 1WWPA 1M56C 4MVZA 1SZIA 3C63A 3EPVA 1OKKA 2QTVA 4FX5A 3JTLO 2LK4A 4MVQA 4CS8A 3UR3C 2KGOA 1WN0A 5BQHA 1UFBA 4BJ5A 2XM4A 4K1OA 3GEHA 4N06A 1N1CA 1XZQA 1HMDA 2J7PD 3NYJA 3PCVA 4WGZA 1FFTC 5F28E 1I4YA 3GORA 1OXBA 3MFNA 3T6GB 2EIJC 4ULVA 4IGGA 2XLHA 1T5OA 2HSQA 3SXZA 2GAQA 2VC9A 1ZZPA 2P1AA 2BL2A 3UGOA 3T6BA 4O6YA 4MVRA 2M4EA 4DRHB 1NU9C 2CW0F 3K33A 1FMWA 1ZHZA 2AP3A 2L6FA 3DE8A 5JS5A 1LKXA 3GANA 1OCOC 4L6RA 5CI8A 2ASRA 1ORYA 4NCQA 3EZIA 1A7VA 2PBEA 4DVYP 1MNEA 4N4WA 3LESA 1RXQA 2XL8A 3LNRA 5COMA 3T4RA 5DS5A 1Z63A 1BR4A 4AK9A 2R7WA 3HLZA 3B9QA 1A7DA 2GWWA 2NUPA 4JTCB 4U5HA 5T1DB 2QUPA 2YEVA 3IEEA 3K7DA 3JSZA 4E18A 4EUKB 4CSAA 4YL0A 1HE1A 1QZXA 4JZAA 4YN0B 3V5YA 2B0JA 3K66A 3FMSA 2YWAA 3VM6A 1E85A 2VASA 5KYYB 3DKAA 1OCZC 2OG2A 2WVQA 1LS4A 2XRHA 3GWNA 1GM5A 4JRZA 3KKBA 3LAYA 3ZVRA 4FAPB 1QKRA 2Q00A 1FTSA 256BA 4HE8D 3SZRA 3FOOA 3US6A 4BEMJ 2GDCA 4MS2A 2J9WA 3RVZA 3U3BA 3RF3A 3TOMA 2PNOA 4MTGA 3R7CA 3UNGC 4XLNF 3U9MA 1VK5A 2YLDA 5COGA 4A4AA 1NFNA 1T6QA 1GGQA 2Z15A 3ASOC 3N0TA 2I8BA 3F47A 4P9TA 3LJBA 2YL1A 1R5ID 4XPWA 5TJ5E 3RQGA 3U9JA 5A69A 3RKOF 3UMHA 2DB4A 4RBNA 2VCBA 3FDQA 1Q0GA 3KYIA 1NLXA 4K0DA 4IJJA 5KYUB 5L0DA 1UG7A 4P9FA 1LI7A 4C3EA 4IARA 3ZTMA 3IQTA 3IQ5A 1O87A 4K7BA 1PD1A 3T6JA 3C7JA 4I1OB 4DOZA 4F4BA 1BR1A 3G4XA 2R02A 2VB6A 2A69F 3NMIA 3WG7C 2HV6A 2JX0A 5A6JA 4PK4A 4YT2A 1MMAA 4X0RA 4JW1A 3LLKA 3RVYA 1YA7O 4PJLA 1ZHTA 5A6KA 1Z23A 3MLGA 3SEOA 1HY5A 5D91A 5E2QA 5DQZA 5EGYA 3B29A 3EHMA 4Z9JA 4BJ6A 1T9KA 1O5HA 2YLGA 2P6VA 3DZAA 3GEIA 1FAPB 1VOMA 5AC5A 4DBRA 1G4US 1FNTc 1NU7D 4NC3A 3S90A 1YZCA 3RYLA 2X51A 4N6CA 4PR9A 3AQBA 4CJGA 1H9GA 4FWVA 4JEBA 3IQCA 4N6HA 2LFDA 2PP4A 5KYNA 4XEKA 5AGFA 5B1BC 2BC5A 2IYLD 3ZIBA 3MX3A 4Q7CA 1WTYA 3TQOA 5JT4A 3SXMA 2MHRA 4J30B 2ZXRA 1J8YF 2Y3HA 2GFHA 3DM5A 4I44A 4DVZA 2E87A 1A0BA 4A2NB 3KMIA 4JC7A 4BEJA 4O7GA 1JRAA 1RJ9B 4YJWA 1JMWA 2ZD9A 1OKKD 1Q0KA 3QW1A 3K1HA 3ITFA 4QI2A 1AVOB 2HV7A 4E0IA 4CIPA 3B0PA 1H7IA 3RFYA 4C7OB 3LS1A 1D0YA 2G3KA 1M57C 4G0HA 5L0GA 2G3VA 1ORSC 2XXAB 1NZEA 3GM3A 1CPQA 3ZWIA 3ECSA 2UUIA 2D5RB 3AG3C 3LLIA 2WL8A 5KYYA 1D1AA 2Y3GA 1C03A 4E7SA 4IRUA 1IW7F 1Q0DA 1FMVA 2KC3A 2Q4FA 2QLAA 4LDQA 5FCLA 5L3QA 2IXMA 2Q9CA 4PJMA 1LE4A 2UUHA 2R7QA 3CQZA 1MMNA 1E86A 2VCCA
chains in the Genus database with same CATH topology
2XL8A 3M79A 3HNIA 2J8WA 1APCA 2J9BA 4CIPA 4JE9A 2XLVA 5JVEA 1S05A 1E85A 4CDYA 2XM0A 3DE9A 1CGOA 1MQVA 4U9DA 256BA 3FOOA 3IQ6A 4IAQA 2XL6A 1RCPA 3TOMA 3M4BA 3M15A 2CCYA 2YLDA 5B3IA 5JLIA 5JSLA 2YL1A 3FOPA 1CGNA 3ZQVA 2YL0A 4ER9A 5JP7A 1CPRA 1LM3B 3TOLA 3QW0A 5JUAA 4IARA 3ZTMA 3IQ5A 1JAFA 4EIYA 1M6TA 4JKVA 3NMIA 1BBHA 3ZTZA 1GQAA 1QPUA 4D4NA 2XLEA 3L1MA 3NMKA 1YZAA 2XLWA 4JEAA 2YLGA 2YKZA 2XLDA 3U8PA 4NC3A 1YZCA 4CJGA 4JEBA 4CJOA 4N6HA 1YYJA 2YL3A 5AGFA 3HNJA 2BC5A 1E83A 2XLMA 3QVZA 3QVYA 1EKYA 3VRCA 5JT4A 2YL7A 4IB4A 4WGYA 4D4XA 3C63A 4U9EA 3QW1A 3NMJA 2XM4A 3M4CA 4WGZA 1E84A 4CDVA 3HNLA 4ULVA 2XLHA 1CPQA 5JRAA 3ZWIA 3HNKA 2YLIA 3C62A 1NBBA 2QLAA 4CX9A 5JS5A 3DE8A 3ZQYA 4L6RA 1YYXA 2XLOA 4CDAA 1A7VA 1QQ3A 1E86A 4N4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL8 A;  3M79 A;  3HNI A;  2J8W A;  1APC A;  2J9B A;  4CIP A;  4JE9 A;  2XLV A;  5JVE A;  1S05 A;  1E85 A;  4CDY A;  2XM0 A;  3DE9 A;  1CGO A;  1MQV A;  4U9D A;  256B A;  3FOO A;  3IQ6 A;  4IAQ A;  2XL6 A;  1RCP A;  3TOM A;  3M4B A;  3M15 A;  2CCY A;  2YLD A;  5B3I A;  5JLI A;  5JSL A;  2YL1 A;  3FOP A;  1CGN A;  3ZQV A;  2YL0 A;  4ER9 A;  5JP7 A;  1CPR A;  1LM3 B;  3TOL A;  3QW0 A;  5JUA A;  4IAR A;  3ZTM A;  3IQ5 A;  1JAF A;  4EIY A;  1M6T A;  4JKV A;  3NMI A;  1BBH A;  3ZTZ A;  1GQA A;  1QPU A;  4D4N A;  2XLE A;  3L1M A;  3NMK A;  1YZA A;  2XLW A;  4JEA A;  2YLG A;  2YKZ A;  2XLD A;  3U8P A;  4NC3 A;  1YZC A;  4CJG A;  4JEB A;  4CJO A;  4N6H A;  1YYJ A;  2YL3 A;  5AGF A;  3HNJ A;  2BC5 A;  1E83 A;  2XLM A;  3QVZ A;  3QVY A;  1EKY A;  3VRC A;  5JT4 A;  2YL7 A;  4IB4 A;  4WGY A;  4D4X A;  3C63 A;  4U9E A;  3QW1 A;  3NMJ A;  2XM4 A;  3M4C A;  4WGZ A;  1E84 A;  4CDV A;  3HNL A;  4ULV A;  2XLH A;  1CPQ A;  5JRA A;  3ZWI A;  3HNK A;  2YLI A;  3C62 A;  1NBB A;  2QLA A;  4CX9 A;  5JS5 A;  3DE8 A;  3ZQY A;  4L6R A;  1YYX A;  2XLO A;  4CDA A;  1A7V A;  1QQ3 A;  1E86 A;  4N4W A; 
#chains in the Genus database with same CATH topology
 1RKE B;  3QTH A;  3J06 A;  4LDK A;  3HNI A;  1APC A;  1TFO B;  3HKK A;  1E2X A;  3WAQ A;  4JCH A;  4XPX A;  2XS1 A;  1O3U A;  3W2W A;  2YHS A;  2XLV A;  2R9R B;  4KNV A;  1K04 A;  3OEO A;  1VYI A;  3RH3 A;  2FFH A;  5FZT A;  3KL4 A;  4MVM A;  3E9V A;  1M2V B;  1SYQ A;  3DM9 B;  2R03 A;  4MND A;  4HEA J;  3JSE O;  5KYU A;  1LI5 A;  3N24 A;  4IWB A;  5CIV A;  1Z3I X;  4LER A;  2NUT B;  1XWJ A;  3LUT B;  5K0I A;  2I15 A;  2J9V A;  5T3W A;  3U3F A;  2LCH A;  4IAQ A;  1J8M F;  4U5G A;  1C02 A;  3AOU A;  2OU6 A;  3M4B A;  3W8I A;  3DXJ F;  1OR2 A;  1AUE A;  1R4T A;  1JOG A;  2CCY A;  4JIO A;  3POV A;  5KYX B;  3EJN A;  1G5Z A;  2A1D D;  5JSL A;  4G7H F;  3K1I C;  3FOP A;  4CS9 C;  2X0C A;  2F22 A;  1CGN A;  2A6H F;  3C8G B;  5KYW B;  3B0V C;  3PMR A;  4NQF A;  3S0X A;  4OIN F;  4ER9 A;  3ZSU A;  3PHF 2;  1YLM A;  1Z5Z A;  3Q6M A;  4EKW A;  4R32 A;  3LEO A;  4ANJ A;  1CPR A;  3TJ5 A;  2WZL A;  1LM3 B;  2EIL C;  3QW0 A;  5CI9 A;  3TOL A;  5JUA A;  1JAF A;  3UGP A;  2JD3 A;  3ABM C;  1D0Z A;  1A7E A;  3CSK A;  4C3D A;  2R05 A;  4E0H A;  2R7V A;  4QI0 A;  2MWQ A;  4JCZ A;  4NTF A;  3RQF A;  2AVK A;  3K6B A;  1Z7Q c;  3ZTZ A;  1GQA A;  1WGW A;  1SMY F;  2VCA A;  3MYF A;  4KNW A;  2XLE A;  4DBQ A;  3X2Q C;  3L1M A;  2O9X A;  3U0C A;  2PF4 E;  5IY5 C;  1HE9 A;  4O79 A;  1T01 A;  1NG1 A;  2Y69 C;  1VTM P;  2WB7 A;  2EPK X;  2FGY A;  1M2O A;  4JEA A;  2A0B A;  1WAT A;  2J7P A;  2PX3 A;  2OCC C;  3U5S A;  1RJ9 A;  2YKZ A;  2XLD A;  3H2U A;  3U8P A;  4DRJ B;  2NPU A;  2NSG A;  4LLC A;  4LDR A;  1HW1 A;  2DGJ A;  3V7O A;  2HJM A;  2P7V A;  3CAX A;  4AE4 B;  4DJ9 A;  3I5P A;  1ZW3 A;  4C7O A;  1Y4C A;  3GEE A;  1V4A A;  4M63 A;  3HNJ A;  4LAC B;  2HMZ A;  2HUJ A;  2XLM A;  3QVZ A;  3RW0 A;  3S9O A;  4OIP F;  2QE9 A;  4W8K A;  1YAR O;  1OW8 A;  2LSE A;  1S7Z A;  2EIN C;  2XXA A;  1D1C A;  2AWC A;  3EH2 A;  4GEH A;  1GS9 A;  2XSE A;  4PJJ A;  1ZU4 A;  2EPO A;  4I3M A;  4CS8 C;  4PJN A;  4WGY A;  5F5F A;  3Q7G A;  3V5X A;  1RMV A;  2ETS A;  3ZC4 A;  2MYS A;  3G4Z A;  4J7Y A;  1OCR C;  2J9U A;  3AGU A;  4BJ5 C;  3AG4 C;  2OJQ A;  4U9E A;  2VH3 A;  4EWC A;  3OA1 A;  3OWT A;  4MTF A;  2EPL X;  2M64 A;  2WVN A;  3VAY A;  4BJ1 A;  2WZG A;  1LPE A;  1RKE A;  1K05 A;  3W4Y A;  5L0H A;  2R7U A;  3SYN A;  1EA8 A;  4J7T A;  4O6M A;  3FHD A;  4PAC A;  4CDV A;  4JTD B;  1TWC A;  2B0H A;  3DI5 A;  3R2P A;  4JJG A;  3SNH A;  3B71 A;  4BG0 A;  1W2W A;  3O10 A;  1D1B A;  2KSF A;  5BQI A;  5JRA A;  2L7A A;  1M2V A;  3HNK A;  4HFF B;  4U5D E;  4XWJ A;  4U5E E;  4U5C E;  3NDB B;  3F46 A;  1RKC A;  4CS7 A;  3KYJ A;  4HFK B;  1WAS A;  4YT8 A;  1NBB A;  1JPN A;  1Q0M A;  2Q9A A;  3AQC A;  1VLS A;  2NUT A;  3RQE A;  3U2M A;  4NTA A;  4MW3 A;  1OQC A;  4WAB A;  3S27 A;  1TWH A;  1ZVZ A;  3DWW A;  5HV9 A;  5HSW A;  1YYX A;  2XLO A;  4CDA A;  2ICW G;  2Y3B A;  2CYD A;  1QQ3 A;  4Z9I A;  3GM1 A;  3NKE A;  4H54 A;  1A41 A;  4CSA C;  1KTM A;  2Q3T A;  3ABK C;  4C3B A;  3NYM A;  3O39 A;  5KYX A;  1YJG A;  4CS9 A;  1ORJ A;  3AGT A;  3C8G A;  3FAJ A;  3H65 A;  5KYW A;  2CGE A;  4XPY A;  5L0F A;  2EPN A;  5JVE A;  2KK1 A;  1S05 A;  4JJF A;  4CDY A;  4BPM A;  2KJG A;  2L9J A;  3VF0 A;  1BR2 A;  1ZU5 A;  2XM0 A;  3DE9 A;  1HMO A;  4E17 A;  3LNM B;  4U9D A;  2AU5 A;  4O6N A;  1U6H A;  3IQ6 A;  3L0I A;  3ZG1 A;  1NFO A;  1RCP A;  4YT4 A;  3QMK A;  5E3A A;  2IM8 A;  2J45 A;  2RD9 A;  4YWQ A;  5L3V A;  1YVI A;  3AG2 C;  2A0U A;  3IPM O;  2A68 F;  1ZW2 A;  2QY9 A;  4WJ0 A;  1BDJ B;  3WOD F;  2IXP A;  5DQT A;  2R7O A;  3EH1 A;  4FES A;  4XEV A;  5JP7 A;  2H8A A;  4AL1 A;  1H6G A;  2YZS A;  3EG9 B;  1DOW A;  3NKD A;  1V55 C;  5A6B A;  1XZP A;  2CNW A;  3V5Z A;  3AG1 C;  4EIY A;  4AE4 A;  1TQG A;  3N2Z B;  2L81 A;  5B3S C;  3ASN C;  1M6T A;  3TUL A;  1YDI A;  3CEX A;  3GM2 A;  4JKV A;  4UDV A;  4DXW A;  1BBH A;  4EBJ A;  4OD4 A;  1PV3 A;  1QPU A;  1VLT A;  2J0X A;  1V54 C;  1JR8 A;  1B68 A;  1ZHX A;  4EHP A;  3EFO B;  3NMK A;  1Q0F A;  4YT5 A;  4BJ6 C;  2C03 A;  2IXO A;  4OIR F;  3ZDL A;  4BJT A;  3EGD B;  1SR2 A;  1YZA A;  2YQY A;  4G7Z F;  1YAU O;  2Y3D A;  1ZHY A;  4ULW A;  3TD7 A;  1H9T A;  2LD6 A;  5JLI A;  5L0C A;  2KQ9 A;  3T9O A;  3RIP A;  4G7O F;  5F5H A;  1MND A;  4I1M A;  1SF8 A;  2AWY A;  3EZH A;  5DVW A;  1JPJ A;  1OCC C;  2G62 A;  3FAP B;  3DMD A;  1TWG A;  4JVS A;  3GWL A;  2J0W A;  4JUR I;  3HJC A;  1I5N A;  4MW8 A;  4OD5 A;  3EHN A;  1KU2 A;  1L7C A;  4XEF A;  5D92 A;  3DD7 A;  1VMA A;  2P0N A;  3NG1 A;  2Q9B A;  3S29 A;  2YL7 A;  1OW6 A;  3MBG A;  2EIM C;  2HKV A;  3TJ6 A;  2C04 A;  4D4X A;  1ZYR F;  3B0U X;  1CGM E;  2D4U A;  2W4B A;  2JPU A;  1DOV A;  1AEP A;  1BZ4 A;  3KPH A;  1QSP A;  4KI2 A;  1T6U A;  4ZLC A;  3NRH A;  3NYL A;  4PFO A;  1WOL A;  2OQM A;  3EGX B;  3JYY A;  3Q6N A;  3PDM P;  2CDQ A;  3NMJ A;  2NG1 A;  2OOC A;  2GA0 A;  2NSF A;  3AJM A;  3M4C A;  4GQH A;  2IXN A;  2W4M A;  1LS1 A;  4U5B E;  5DLJ A;  1E84 A;  2TMV P;  2H7B A;  1Y6D A;  5COF A;  4E7Z A;  1LVK A;  3HNL A;  2BE5 F;  2L6G A;  4MQ9 F;  2R7T A;  4NTB A;  1QLE C;  4YL1 A;  5EHH A;  2ZPA A;  1TKN A;  2YLI A;  3C62 A;  3DJU B;  3BRJ A;  2FAP B;  1MMD A;  1LIH A;  1ST6 A;  1TR2 A;  3C8Z A;  3UMK A;  3X1O A;  2HJ3 A;  4CX9 A;  4CIH A;  2QNL A;  1KNY A;  1HW2 A;  4GYT A;  3EQL F;  3ZQY A;  4AX2 A;  3UMI A;  4XLP F;  1EQ1 A;  4U5F E;  2ZXO A;  1TWA A;  1YA9 A;  2HMQ A;  2A6E F;  1IZM A;  2EIK C;  2HS5 A;  2OEV A;  4EBB A;  4KBL A;  1G4W R;  2H7O A;  4JTA B;  3M79 A;  2OEX A;  2Q7R A;  2V3C C;  2OJE D;  1OXK A;  2J8W A;  2LFF A;  2XL4 A;  2J9B A;  3CZ6 A;  2KYH A;  3GOD A;  1PCX A;  4JE9 A;  4YK5 A;  2L6H A;  4MVO A;  1PD0 A;  4OIO F;  4XQ1 A;  3C18 A;  3WHN A;  3C8G D;  3HTK C;  3SP1 A;  1FR0 A;  3SXK A;  1LE2 A;  4OIQ F;  2PX0 A;  4ZLD A;  3E70 C;  2KNH A;  2W45 A;  2HZ8 A;  3EG9 A;  2H7V C;  2EPM X;  4YL3 A;  2W9Y A;  5EK0 A;  1CGO A;  1C17 M;  3S84 A;  3DJN B;  3M1C B;  1MQV A;  3I5Q A;  5A6A A;  2OKU A;  2Y39 A;  5L0J A;  1I4Z A;  1Z6A A;  2DI3 A;  2R7X A;  2XL6 A;  3L8I A;  4G78 A;  1OW7 A;  5GPG B;  3M15 A;  4B6I A;  1OR3 A;  3L34 A;  5B3I A;  3EFO A;  2P61 A;  3O55 A;  4LLE A;  4QDL A;  2NUP B;  5E3C A;  5BQG A;  2ZXP A;  1L3P A;  3ATP A;  3JRM O;  3EGD A;  1FFH A;  3QZC A;  5T3T A;  2YL0 A;  3ZQV A;  4AL0 A;  5BUO A;  2R7R A;  1NSG B;  3I4U A;  1T6I A;  2IOQ A;  3K1I A;  3VYW A;  1V74 B;  3A9C A;  3FVY A;  4RD9 A;  2R7S A;  3FXH A;  3JZ0 A;  1TFK B;  3JT1 A;  2KW3 C;  2LQG A;  3L8J A;  3G50 A;  5DS6 A;  2YRF A;  5L0I A;  3A11 A;  4Z9H A;  2PFD A;  4XTK A;  2CNW D;  3U2L A;  2ZXW C;  5DS4 A;  5A6B D;  2DYS C;  2LIG A;  2XS8 A;  3LEV A;  3U8V A;  1MMG A;  3W2V A;  4D4N A;  4PFP A;  3KH2 A;  4EBK A;  1U0B B;  2DYR C;  4W8P A;  3SXY A;  3MYI A;  3Q7L A;  4MVU A;  3ABL C;  2WVO A;  2XLW A;  4MTO A;  4P6I C;  5E33 A;  2HFI A;  4MVS A;  3O6X A;  2WZF A;  1ZHW A;  1QVX A;  4CBE A;  3JCU Q;  3EGX A;  2RSE B;  3H2V A;  1EI7 A;  2J46 A;  3JRT A;  3LS0 A;  4H4K C;  1D0X A;  5AC4 A;  1G8X A;  1F1M A;  1U89 A;  3IHU A;  1VB5 A;  4ONS A;  5B1A C;  3S28 A;  4CJO A;  2V26 A;  1YYJ A;  3JYH A;  2YL3 A;  1E83 A;  4RDA A;  3W8H A;  3QVY A;  2YVK A;  4J32 B;  1EKY A;  4IAO A;  2LP4 A;  3TK0 A;  2R25 A;  3VRC A;  4DRI B;  4KC9 A;  3DAF A;  2HSB A;  3DAG A;  3BEH A;  4NY3 A;  4Q5S F;  2IBF A;  1VYK A;  4IB4 A;  1K40 A;  4Q4Z F;  1WWP A;  1M56 C;  4MVZ A;  1SZI A;  3C63 A;  3EPV A;  1OKK A;  2QTV A;  4FX5 A;  3JTL O;  2LK4 A;  4MVQ A;  4CS8 A;  3UR3 C;  2KGO A;  1WN0 A;  5BQH A;  1UFB A;  4BJ5 A;  2XM4 A;  4K1O A;  3GEH A;  4N06 A;  1N1C A;  1XZQ A;  1HMD A;  2J7P D;  3NYJ A;  3PCV A;  4WGZ A;  1FFT C;  5F28 E;  1I4Y A;  3GOR A;  1OXB A;  3MFN A;  3T6G B;  2EIJ C;  4ULV A;  4IGG A;  2XLH A;  1T5O A;  2HSQ A;  3SXZ A;  2GAQ A;  2VC9 A;  1ZZP A;  2P1A A;  2BL2 A;  3UGO A;  3T6B A;  4O6Y A;  4MVR A;  2M4E A;  4DRH B;  1NU9 C;  2CW0 F;  3K33 A;  1FMW A;  1ZHZ A;  2AP3 A;  2L6F A;  3DE8 A;  5JS5 A;  1LKX A;  3GAN A;  1OCO C;  4L6R A;  5CI8 A;  2ASR A;  1ORY A;  4NCQ A;  3EZI A;  1A7V A;  2PBE A;  4DVY P;  1MNE A;  4N4W A;  3LES A;  1RXQ A;  2XL8 A;  3LNR A;  5COM A;  3T4R A;  5DS5 A;  1Z63 A;  1BR4 A;  4AK9 A;  2R7W A;  3HLZ A;  3B9Q A;  1A7D A;  2GWW A;  2NUP A;  4JTC B;  4U5H A;  5T1D B;  2QUP A;  2YEV A;  3IEE A;  3K7D A;  3JSZ A;  4E18 A;  4EUK B;  4CSA A;  4YL0 A;  1HE1 A;  1QZX A;  4JZA A;  4YN0 B;  3V5Y A;  2B0J A;  3K66 A;  3FMS A;  2YWA A;  3VM6 A;  1E85 A;  2VAS A;  5KYY B;  3DKA A;  1OCZ C;  2OG2 A;  2WVQ A;  1LS4 A;  2XRH A;  3GWN A;  1GM5 A;  4JRZ A;  3KKB A;  3LAY A;  3ZVR A;  4FAP B;  1QKR A;  2Q00 A;  1FTS A;  256B A;  4HE8 D;  3SZR A;  3FOO A;  3US6 A;  4BEM J;  2GDC A;  4MS2 A;  2J9W A;  3RVZ A;  3U3B A;  3RF3 A;  3TOM A;  2PNO A;  4MTG A;  3R7C A;  3UNG C;  4XLN F;  3U9M A;  1VK5 A;  2YLD A;  5COG A;  4A4A A;  1NFN A;  1T6Q A;  1GGQ A;  2Z15 A;  3ASO C;  3N0T A;  2I8B A;  3F47 A;  4P9T A;  3LJB A;  2YL1 A;  1R5I D;  4XPW A;  5TJ5 E;  3RQG A;  3U9J A;  5A69 A;  3RKO F;  3UMH A;  2DB4 A;  4RBN A;  2VCB A;  3FDQ A;  1Q0G A;  3KYI A;  1NLX A;  4K0D A;  4IJJ A;  5KYU B;  5L0D A;  1UG7 A;  4P9F A;  1LI7 A;  4C3E A;  4IAR A;  3ZTM A;  3IQT A;  3IQ5 A;  1O87 A;  4K7B A;  1PD1 A;  3T6J A;  3C7J A;  4I1O B;  4DOZ A;  4F4B A;  1BR1 A;  3G4X A;  2R02 A;  2VB6 A;  2A69 F;  3NMI A;  3WG7 C;  2HV6 A;  2JX0 A;  5A6J A;  4PK4 A;  4YT2 A;  1MMA A;  4X0R A;  4JW1 A;  3LLK A;  3RVY A;  1YA7 O;  4PJL A;  1ZHT A;  5A6K A;  1Z23 A;  3MLG A;  3SEO A;  1HY5 A;  5D91 A;  5E2Q A;  5DQZ A;  5EGY A;  3B29 A;  3EHM A;  4Z9J A;  4BJ6 A;  1T9K A;  1O5H A;  2YLG A;  2P6V A;  3DZA A;  3GEI A;  1FAP B;  1VOM A;  5AC5 A;  4DBR A;  1G4U S;  1FNT c;  1NU7 D;  4NC3 A;  3S90 A;  1YZC A;  3RYL A;  2X51 A;  4N6C A;  4PR9 A;  3AQB A;  4CJG A;  1H9G A;  4FWV A;  4JEB A;  3IQC A;  4N6H A;  2LFD A;  2PP4 A;  5KYN A;  4XEK A;  5AGF A;  5B1B C;  2BC5 A;  2IYL D;  3ZIB A;  3MX3 A;  4Q7C A;  1WTY A;  3TQO A;  5JT4 A;  3SXM A;  2MHR A;  4J30 B;  2ZXR A;  1J8Y F;  2Y3H A;  2GFH A;  3DM5 A;  4I44 A;  4DVZ A;  2E87 A;  1A0B A;  4A2N B;  3KMI A;  4JC7 A;  4BEJ A;  4O7G A;  1JRA A;  1RJ9 B;  4YJW A;  1JMW A;  2ZD9 A;  1OKK D;  1Q0K A;  3QW1 A;  3K1H A;  3ITF A;  4QI2 A;  1AVO B;  2HV7 A;  4E0I A;  4CIP A;  3B0P A;  1H7I A;  3RFY A;  4C7O B;  3LS1 A;  1D0Y A;  2G3K A;  1M57 C;  4G0H A;  5L0G A;  2G3V A;  1ORS C;  2XXA B;  1NZE A;  3GM3 A;  1CPQ A;  3ZWI A;  3ECS A;  2UUI A;  2D5R B;  3AG3 C;  3LLI A;  2WL8 A;  5KYY A;  1D1A A;  2Y3G A;  1C03 A;  4E7S A;  4IRU A;  1IW7 F;  1Q0D A;  1FMV A;  2KC3 A;  2Q4F A;  2QLA A;  4LDQ A;  5FCL A;  5L3Q A;  2IXM A;  2Q9C A;  4PJM A;  1LE4 A;  2UUH A;  2R7Q A;  3CQZ A;  1MMN A;  1E86 A;  2VCC A; 
#chains in the Genus database with same CATH homology
 2XL8 A;  3M79 A;  3HNI A;  2J8W A;  1APC A;  2J9B A;  4CIP A;  4JE9 A;  2XLV A;  5JVE A;  1S05 A;  1E85 A;  4CDY A;  2XM0 A;  3DE9 A;  1CGO A;  1MQV A;  4U9D A;  256B A;  3FOO A;  3IQ6 A;  4IAQ A;  2XL6 A;  1RCP A;  3TOM A;  3M4B A;  3M15 A;  2CCY A;  2YLD A;  5B3I A;  5JLI A;  5JSL A;  2YL1 A;  3FOP A;  1CGN A;  3ZQV A;  2YL0 A;  4ER9 A;  5JP7 A;  1CPR A;  1LM3 B;  3TOL A;  3QW0 A;  5JUA A;  4IAR A;  3ZTM A;  3IQ5 A;  1JAF A;  4EIY A;  1M6T A;  4JKV A;  3NMI A;  1BBH A;  3ZTZ A;  1GQA A;  1QPU A;  4D4N A;  2XLE A;  3L1M A;  3NMK A;  1YZA A;  2XLW A;  4JEA A;  2YLG A;  2YKZ A;  2XLD A;  3U8P A;  4NC3 A;  1YZC A;  4CJG A;  4JEB A;  4CJO A;  4N6H A;  1YYJ A;  2YL3 A;  5AGF A;  3HNJ A;  2BC5 A;  1E83 A;  2XLM A;  3QVZ A;  3QVY A;  1EKY A;  3VRC A;  5JT4 A;  2YL7 A;  4IB4 A;  4WGY A;  4D4X A;  3C63 A;  4U9E A;  3QW1 A;  3NMJ A;  2XM4 A;  3M4C A;  4WGZ A;  1E84 A;  4CDV A;  3HNL A;  4ULV A;  2XLH A;  1CPQ A;  5JRA A;  3ZWI A;  3HNK A;  2YLI A;  3C62 A;  1NBB A;  2QLA A;  4CX9 A;  5JS5 A;  3DE8 A;  3ZQY A;  4L6R A;  1YYX A;  2XLO A;  4CDA A;  1A7V A;  1QQ3 A;  1E86 A;  4N4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...