2XLVA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124f variant with bound no
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 52
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlvA00
3QVYA 3IQ6A 2YL7A 2J8WA 3FOOA 5JP7A 1RCPA 1QQ3A 5JVEA 5JS5A 5JLIA 2XM0A 256BA 3FOPA 1YYXA 2CCYA 2XLVA 1YZAA 2YLDA 2YL0A 1GQAA 3HNLA 2YLGA 4EIYA 3M4BA 1M6TA 4CDYA 3ZTMA 4ER9A 3ZQYA 3ZQVA 4D4NA 4WGYA 5AGFA 3M79A 1CGNA 2XLHA 1S05A 4L6RA 2XLMA 1A7VA 4N4WA 1YYJA 3QW1A 2BC5A 3HNIA 3QVZA 4CDVA 2YLIA 3DE8A 1E86A 1JAFA 5JUAA 4D4XA 3NMKA 4IAQA 5JSLA 2YL3A 4CX9A 1NBBA 2XL6A 4WGZA 3NMJA 2J9BA 3C63A 4NC3A 4U9DA 4JEAA 2YL1A 5JT4A 4N6HA 1YZCA 4JE9A 3ZWIA 5JRAA 3QW0A 1E85A 2YKZA 3HNKA 1LM3B 3M4CA 4JKVA 4U9EA 3TOMA 2XLWA 4ULVA 4IARA 2XLDA 2XLEA 2XLOA 3DE9A 3L1MA 4IB4A 3IQ5A 1EKYA 3U8PA 1BBHA 1E83A 1CPRA 3VRCA 1CPQA 2XM4A 1E84A 1MQVA 3M15A 3NMIA 4CDAA 1APCA 4JEBA 4CIPA 4CJOA 1QPUA 2XL8A 4CJGA 5B3IA 2QLAA 3C62A 3TOLA 1CGOA 3HNJA 3ZTZA
chains in the Genus database with same CATH superfamily
2LK4A 2YVKA 3NG1A 4YWQA 2KQ9A 4G78A 3MLGA 4XEKA 2J8WA 1DOWA 4YT4A 3U5SA 4JJFA 2R7SA 1HE9A 1RCPA 4EWCA 1GGQA 1C02A 3MX3A 5JLIA 1BZ4A 3NKEA 5CI9A 3GM1A 2QY9A 5A6BA 1H7IA 4YT2A 1T5OA 3I5QA 2OQMA 3K6BA 2JPUA 4PK4A 3U2LA 2CCYA 2ICWG 2NSFA 3JSZA 3AOUA 2YL0A 3PMRA 2A0UA 3AGUA 4OINF 1GQAA 3V5XA 4MTGA 5K0IA 3LEVA 2YLGA 4EIYA 1RJ9A 3B0VC 4P9TA 4HE8D 2WB7A 2R7RA 2CGEA 3ZTMA 1RKCA 4XQ1A 1FFTC 1XZQA 2Q9BA 4Z9JA 2ZXWC 4U5HA 3V7OA 4QDLA 3W2WA 3O6XA 2MHRA 2YWAA 4XLPF 1ZHWA 3M79A 4XPWA 1CGNA 2XLMA 1A7VA 3AQCA 2OJED 1MNDA 1K40A 1YYJA 2P6VA 3K1HA 4JURI 4PJNA 1KNYA 2LFDA 2YHSA 3IHUA 1VYKA 2ETSA 3GWLA 4OIRF 4BJ6C 4B6IA 2Y3BA 3C8GB 1G5ZA 1ORYA 3HNIA 1LE2A 3L8JA 4XPXA 1JOGA 1U6HA 1C03A 1ZZPA 3H65A 2XXAA 4XWJA 2H7VC 1E86A 2A6EF 5T3TA 5L0DA 2L9JA 4NQFA 4QI2A 1RMVA 1T01A 4X0RA 2PBEA 3NMKA 3F47A 3G50A 2HUJA 3Q7LA 5E3CA 3PHF2 3KL4A 3EHMA 3PDMP 3LUTB 2YL3A 3GEEA 4OD4A 5DVWA 5F28E 3S28A 3ABLC 4F4BA 4CSAA 2R7UA 3ABMC 4UDVA 2XL6A 5EGYA 3MBGA 3ASOC 1M2VB 2VCBA 2R7QA 2Z15A 3AQBA 2YL1A 4DVZA 3JT1A 1Q0FA 5B1BC 4E7ZA 3R7CA 1T6QA 3C7JA 4E0HA 1IW7F 2CDQA 4GEHA 3US6A 5L3VA 4XEVA 1OCCC 2IXOA 2J46A 2WZFA 4JE9A 3AG1C 3SP1A 5HSWA 3W8HA 1LE4A 4BJ5C 4G7HF 1Z7Qc 2P1AA 4H54A 4NTBA 3SYNA 3HNKA 2IM8A 3AG4C 2L6HA 5BQGA 3JYYA 3FAJA 3Q6MA 3WODF 4OIOF 3HKKA 3FVYA 1A7DA 4NY3A 2WVOA 3DI5A 1BR4A 4ULVA 2KYHA 2VCAA 4JCHA 3RFYA 1O87A 2XLDA 1GS9A 3W2VA 3AG2C 3DE9A 5D92A 5T1DB 1YARO 4EBJA 4ZLDA 4WABA 2KNHA 1I4YA 3UR3C 1MMGA 1ZU4A 2Y69C 4PJMA 2ZXOA 3DAGA 1AEPA 3A9CA 1EKYA 1E83A 2H7OA 1YA7O 2J7PA 2OKUA 2PNOA 1WASA 4JZAA 4MTOA 1FAPB 3HLZA 2NG1A 1VMAA 2Q9AA 1NFNA 2GDCA 4EBKA 2AVKA 1J8YF 3LAYA 3PCVA 4YL3A 4EUKB 1APCA 4MVQA 1KTMA 1LS4A 2E87A 2Q00A 3U9JA 2IOQA 1Q0DA 2YZSA 3Q6NA 1RKEB 1V74B 2LSEA 4Z9IA 1OQCA 1ORJA 3GODA 4MTFA 1OKKD 2HZ8A 2OJQA 3ZIBA 5DS4A 3SEOA 1K04A 2IXPA 4CIPA 5FCLA 2DI3A 1QPUA 4K1OA 1D1CA 3S27A 5AC4A 5KYYB 1FFHA 3C62A 3TOLA 2L81A 3CQZA 3RW0A 3HNJA 2AWCA 2R03A 5A6AA 4G0HA 2A68F 2EIMC 3QVYA 1LI7A 1KU2A 4OIPF 4MVSA 4O6YA 4KBLA 1TWAA 2XL4A 4PFOA 4ZLCA 3RH3A 3RKOF 4HFFB 4DXWA 5A6JA 1QQ3A 2OOCA 3EPVA 3FMSA 1VTMP 4DBRA 1D0ZA 3DAFA 3H2UA 2HS5A 1JR8A 3A11A 2VASA 3SXMA 1YYXA 3BEHA 1M2OA 1R5ID 2FGYA 2YLDA 4BPMA 4DJ9A 3HNLA 2EILC 2P7VA 3UMIA 3TJ5A 3M4BA 5BQHA 2Q3TA 1M6TA 3C8GA 2BE5F 2R7TA 3RIPA 3ZQVA 3CEXA 1YDIA 4LDRA 3UNGC 2CYDA 3V5ZA 4CS7A 4EBBA 4W8KA 4LLEA 3ITFA 3I5PA 2XLHA 1S05A 2OG2A 4L6RA 1Y4CA 3E70C 4K0DA 4Q7CA 1I4ZA 2A0BA 3RVYA 2XS1A 3GM3A 2P0NA 4LDKA 2GA0A 2BL2A 3DD7A 2V26A 3TD7A 2R05A 2C04A 4PJJA 4IJJA 4NTFA 1A0BA 5KYWA 4CDVA 2IXMA 2A69F 3DE8A 3DMDA 3U3BA 3IEEA 2ASRA 3L8IA 3QTHA 4J7TA 4RBNA 3DM9B 4JTAB 1V54C 2X51A 4JTCB 2QTVA 2PF4E 2M64A 3E9VA 2VH3A 3T6GB 1NLXA 2J0XA 1H9GA 3SXZA 2IBFA 4G7ZF 1TWCA 1A41A 2D4UA 5E3AA 3B0UX 1HW1A 4DRJB 3GORA 3EFOB 1Q0GA 3NMJA 1HW2A 1BR2A 4BJ5A 3RF3A 4NTAA 3TULA 2M4EA 5BQIA 2R25A 1O5HA 4DVYP 3UMKA 2LFFA 4BJTA 1LVKA 3X2QC 4FAPB 1WN0A 3NRHA 2J9VA 2NUPB 5COGA 4AE4A 4U5FE 2GWWA 3IQCA 4ANJA 1UG7A 2HMQA 1E85A 2YKZA 3H2VA 3UMHA 4Q5SF 3ZDLA 3EQLF 3L0IA 3MYFA 5KYUB 3M4CA 4JKVA 3TOMA 4BG0A 2J45A 1T9KA 1PD0A 2XLWA 4MW8A 1H6GA 1NU7D 4IAOA 1Z5ZA 2PP4A 1ORSC 3T6JA 4I44A 1TWGA 2W9YA 1T6IA 2Q4FA 3MYIA 3B71A 2EPOA 3KPHA 3N24A 4H4KC 1FMWA 4NCQA 5DS6A 2RD9A 3KYJA 2Y3GA 3JTLO 3LS1A 3QMKA 3IQ5A 3RVZA 1SZIA 3FAPB 3SNHA 3POVA 3EGDA 3GEIA 2XM4A 3JRMO 4U5GA 5KYYA 2B0HA 3K7DA 1OW8A 2W4BA 3C18A 5DQTA 5L0GA 5A6BD 4P9FA 4U5DE 5GPGB 2R7VA 1SYQA 3IPMO 4J30B 1N1CA 4LLCA 5CI8A 1QZXA 1G4US 3LESA 4EHPA 5HV9A 1D0YA 2DYRC 3TQOA 4PR9A 2NSGA 3SXYA 4CJOA 2MWQA 3GM2A 1ZHTA 4CJGA 4MW3A 3B9QA 4IGGA 1CGOA 2F22A 2HSQA 4Z9HA 3TK0A 2WZLA 3ZTZA 3WHNA 3IQ6A 2YL7A 3NYLA 4JC7A 3U0CA 4O6NA 3FOOA 4DRHB 5E33A 3I4UA 2DB4A 4JCZA 1WTYA 4PJLA 3U8VA 5A69A 5DS5A 3BRJA 1YAUO 3NKDA 2KGOA 3GEHA 1LKXA 3OEOA 1TFOB 1NSGB 2UUHA 2WVNA 2AWYA 4LACB 3W8IA 3DWWA 3ECSA 2Q7RA 5D91A 5A6KA 2XLVA 3EZIA 1YZAA 2QUPA 2G3KA 1TR2A 3B0PA 5AC5A 3U2MA 1XWJA 2TMVP 4MVUA 1U89A 3VAYA 1HY5A 1ZW2A 4KNWA 4YL1A 1S7ZA 4O79A 3VYWA 4CDYA 4DOZA 3ATPA 4J32B 1R4TA 2A1DD 4D4NA 3UGPA 2XXAB 5F5FA 3EG9B 3U3FA 2GAQA 4WGYA 5AGFA 1OCRC 1WOLA 2XRHA 3EGXB 3K1IC 4N4WA 1WATA 2JX0A 3ZC4A 3ZVRA 3NYJA 1SR2A 4JTDB 1JPJA 5L3QA 1ZU5A 4CS9C 1D1BA 1YA9A 2BC5A 3QVZA 3W4YA 5L0CA 1C17M 4XPYA 3RYLA 4E18A 2UUIA 2Y3HA 2YLIA 1Q0MA 1JAFA 3KYIA 5JUAA 5FZTA 4XEFA 5KYNA 1JMWA 1FTSA 1OCOC 1OW6A 4D4XA 4FWVA 2HSBA 2L6GA 3J06A 4LDQA 1ZHYA 4N06A 1OXKA 2LIGA 2YQYA 3F46A 3G4XA 4EKWA 4K7BA 4Q4ZF 3OA1A 1UFBA 1EA8A 1V4AA 3IQTA 1LPEA 1HMDA 1ZHZA 2NUPA 1J8MF 1NBBA 2HJMA 2VB6A 1OR3A 1IZMA 3CZ6A 1GM5A 5COFA 3JSEO 3B29A 3LNMB 3NYMA 2I15A 4JVSA 4U9DA 3Q7GA 1B68A 1ST6A 2J7PD 2KJGA 2PX3A 3JCUQ 3EJNA 3CSKA 4CBEA 2R7XA 1TFKB 3EH1A 1NZEA 1O3UA 2R7WA 5DLJA 5JRAA 3LNRA 2IXNA 2QE9A 5F5HA 3JZ0A 2LD6A 2C03A 4CS8A 3EHNA 3T9OA 3NDBB 2FAPB 5L0IA 3FXHA 1ZVZA 1LM3B 1LS1A 1M2VA 2ZXRA 1K05A 1T6UA 4GYTA 4M63A 1NG1A 2JD3A 4I3MA 1L3PA 1U0BB 4PFPA 1Z63A 2HV6A 4YJWA 2WVQA 2OEVA 2XLOA 2NUTB 4MNDA 3SZRA 1CGME 1TWHA 4U5EE 3ZG1A 3FHDA 3X1OA 4IB4A 2KW3C 2EPLX 4J7YA 4QI0A 2P61A 2L7AA 3U8PA 4DBQA 1QVXA 4CX9A 4E7SA 1A7EA 2HKVA 4JJGA 1CPRA 3VF0A 2L6FA 4C7OB 3NMIA 5TJ5E 4FESA 3S90A 5B1AC 2PFDA 4OD5A 5L0JA 3N2ZB 2OEXA 2XSEA 2B0JA 1Z3IX 2O9XA 2R7OA 2ZPAA 1D1AA 1E2XA 2CNWA 2I8BA 4N6CA 4XLNF 5L0HA 1JRAA 1PCXA 2W45A 2HFIA 4G7OF 1VOMA 3C8GD 1VLTA 3O55A 5CIVA 4YT5A 1SF8A 4BEJA 5B3IA 3EZHA 4CS8C 5EHHA 2HMZA 3TJ6A 1TKNA 3GANA 2EINC 3ABKC 1YJGA 2Q9CA 1YLMA 3U9MA 3L34A 3K33A 3DZAA 4MVMA 1RKEA 4YN0B 3WAQA 3G4ZA 2WL8A 5KYXB 2PX0A 5JP7A 1HE1A 2W4MA 4BJ1A 3GWNA 4C3DA 5JVEA 3WG7C 2J0WA 5DQZA 5JS5A 4AK9A 1MMAA 3O39A 4A4AA 2XM0A 3R2PA 1QLEC 3EG9A 3RQGA 256BA 2YEVA 3FOPA 2MYSA 3DXJF 3JRTA 4WJ0A 4CIHA 3EGXA 3AJMA 3C8ZA 1OKKA 4JIOA 3RQEA 1EQ1A 2RSEB 4FX5A 3LJBA 3S0XA 2D5RB 3K1IA 4MQ9F 3JYHA 4O6MA 1DOVA 2DGJA 3ZSUA 4YT8A 1NFOA 3HJCA 4YL0A 3S9OA 3ZQYA 4ER9A 4ULWA 4CS9A 3T4RA 1BR1A 2AP3A 2NPUA 1ZYRF 1NU9C 2QNLA 3HTKC 5KYWB 4RD9A 3S29A 3N0TA 2H8AA 1H9TA 2R9RB 4YK5A 4AX2A 3V5YA 1Z6AA 2OCCC 5E2QA 4I1OB 4U5BE 3K66A 2EIKC 3AG3C 3M1CB 4A2NB 1RJ9B 3S84A 1FNTc 3T6BA 1VB5A 3QW1A 3MFNA 4R32A 2VCCA 2X0CA 3KH2A 1HMOA 1LIHA 3DKAA 2ZXPA 1MMDA 1WGWA 1ZW3A 5T3WA 3VM6A 2R02A 3SXKA 1Q0KA 2HV7A 4BEMJ 4XTKA 4E17A 4IAQA 3DJUB 3ASNC 2CNWD 1G4WR 5JSLA 2LQGA 4C3EA 1QSPA 4AE4B 1G8XA 3DM5A 3UGOA 4U5CE 2G62A 3DJNB 2AU5A 3EH2A 2EIJC 4WGZA 1M57C 2J9BA 1OR2A 3KKBA 4RDAA 5B3SC 3C63A 2XS8A 4NC3A 4JEAA 1D0XA 3AGTA 1LI5A 5JT4A 4O7GA 4CSAC 3LS0A 1I5NA 1YZCA 4N6HA 3OWTA 1L7CA 1QKRA 1Z23A 2NUTA 3ZWIA 1MNEA 3QW0A 4IWBA 1OW7A 3LLKA 3FDQA 1MMNA 4OIQF 4KI2A 2V3CC 3KMIA 1OXBA 3EFOA 4IRUA 1RXQA 3RQFA 4C3BA 4JRZA 2LP4A 1M56C 4U9EA 2EPKX 5EK0A 2IYLD 4I1MA 1FR0A 4HEAJ 2EPNA 3EGDB 4IARA 2YRFA 2Y3DA 2XLEA 2A6HF 3O10A 4C7OA 1FMVA 1PV3A 1ZHXA 2GFHA 2H7BA 2KSFA 1SMYF 4W8PA 4KC9A 3LEOA 2J9WA 1VYIA 3L1MA 2CW0F 1AUEA 2LCHA 2G3VA 4MS2A 4AL1A 1BBHA 5KYUA 1AVOB 1BDJB 1W2WA 4MVRA 1EI7A 4LERA 2KC3A 1VK5A 1V55C 4P6IC 1CPQA 1F1MA 2HJ3A 3VRCA 4DRIB 1E84A 1MQVA 3M15A 2VC9A 4CDAA 4E0IA 3CAXA 2FFHA 1Y6DA 1XZPA 3LLIA 1JPNA 2ZD9A 2WZGA 1TQGA 2EPMX 4MVZA 4MVOA 4KNVA 4PACA 1PD1A 5KYXA 1YVIA 2J9UA 4JEBA 5COMA 4JW1A 1WWPA 2Y39A 2OU6A 5L0FA 4HFKB 1OCZC 2KK1A 4GQHA 2XL8A 4BJ6A 2QLAA 5BUOA 4ONSA 2DYSC 3QZCA 1VLSA 4AL0A 5IY5C
chains in the Genus database with same CATH topology
3QVYA 3IQ6A 2YL7A 2J8WA 3FOOA 5JP7A 1RCPA 1QQ3A 5JVEA 5JS5A 5JLIA 2XM0A 256BA 3FOPA 1YYXA 2CCYA 2XLVA 1YZAA 2YLDA 2YL0A 1GQAA 3HNLA 2YLGA 4EIYA 3M4BA 1M6TA 4CDYA 3ZTMA 4ER9A 3ZQYA 3ZQVA 4D4NA 4WGYA 5AGFA 3M79A 1CGNA 2XLHA 1S05A 4L6RA 2XLMA 1A7VA 4N4WA 1YYJA 3QW1A 2BC5A 3HNIA 3QVZA 4CDVA 2YLIA 3DE8A 1E86A 1JAFA 5JUAA 4D4XA 3NMKA 4IAQA 5JSLA 2YL3A 4CX9A 1NBBA 2XL6A 4WGZA 3NMJA 2J9BA 3C63A 4NC3A 4U9DA 4JEAA 2YL1A 5JT4A 4N6HA 1YZCA 4JE9A 3ZWIA 5JRAA 3QW0A 1E85A 2YKZA 3HNKA 1LM3B 3M4CA 4JKVA 4U9EA 3TOMA 2XLWA 4ULVA 4IARA 2XLDA 2XLEA 2XLOA 3DE9A 3L1MA 4IB4A 3IQ5A 1EKYA 3U8PA 1BBHA 1E83A 1CPRA 3VRCA 1CPQA 2XM4A 1E84A 1MQVA 3M15A 3NMIA 4CDAA 1APCA 4JEBA 4CIPA 4CJOA 1QPUA 2XL8A 4CJGA 5B3IA 2QLAA 3C62A 3TOLA 1CGOA 3HNJA 3ZTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVY A;  3IQ6 A;  2YL7 A;  2J8W A;  3FOO A;  5JP7 A;  1RCP A;  1QQ3 A;  5JVE A;  5JS5 A;  5JLI A;  2XM0 A;  256B A;  3FOP A;  1YYX A;  2CCY A;  2XLV A;  1YZA A;  2YLD A;  2YL0 A;  1GQA A;  3HNL A;  2YLG A;  4EIY A;  3M4B A;  1M6T A;  4CDY A;  3ZTM A;  4ER9 A;  3ZQY A;  3ZQV A;  4D4N A;  4WGY A;  5AGF A;  3M79 A;  1CGN A;  2XLH A;  1S05 A;  4L6R A;  2XLM A;  1A7V A;  4N4W A;  1YYJ A;  3QW1 A;  2BC5 A;  3HNI A;  3QVZ A;  4CDV A;  2YLI A;  3DE8 A;  1E86 A;  1JAF A;  5JUA A;  4D4X A;  3NMK A;  4IAQ A;  5JSL A;  2YL3 A;  4CX9 A;  1NBB A;  2XL6 A;  4WGZ A;  3NMJ A;  2J9B A;  3C63 A;  4NC3 A;  4U9D A;  4JEA A;  2YL1 A;  5JT4 A;  4N6H A;  1YZC A;  4JE9 A;  3ZWI A;  5JRA A;  3QW0 A;  1E85 A;  2YKZ A;  3HNK A;  1LM3 B;  3M4C A;  4JKV A;  4U9E A;  3TOM A;  2XLW A;  4ULV A;  4IAR A;  2XLD A;  2XLE A;  2XLO A;  3DE9 A;  3L1M A;  4IB4 A;  3IQ5 A;  1EKY A;  3U8P A;  1BBH A;  1E83 A;  1CPR A;  3VRC A;  1CPQ A;  2XM4 A;  1E84 A;  1MQV A;  3M15 A;  3NMI A;  4CDA A;  1APC A;  4JEB A;  4CIP A;  4CJO A;  1QPU A;  2XL8 A;  4CJG A;  5B3I A;  2QLA A;  3C62 A;  3TOL A;  1CGO A;  3HNJ A;  3ZTZ A; 
#chains in the Genus database with same CATH topology
 2LK4 A;  2YVK A;  3NG1 A;  4YWQ A;  2KQ9 A;  4G78 A;  3MLG A;  4XEK A;  2J8W A;  1DOW A;  4YT4 A;  3U5S A;  4JJF A;  2R7S A;  1HE9 A;  1RCP A;  4EWC A;  1GGQ A;  1C02 A;  3MX3 A;  5JLI A;  1BZ4 A;  3NKE A;  5CI9 A;  3GM1 A;  2QY9 A;  5A6B A;  1H7I A;  4YT2 A;  1T5O A;  3I5Q A;  2OQM A;  3K6B A;  2JPU A;  4PK4 A;  3U2L A;  2CCY A;  2ICW G;  2NSF A;  3JSZ A;  3AOU A;  2YL0 A;  3PMR A;  2A0U A;  3AGU A;  4OIN F;  1GQA A;  3V5X A;  4MTG A;  5K0I A;  3LEV A;  2YLG A;  4EIY A;  1RJ9 A;  3B0V C;  4P9T A;  4HE8 D;  2WB7 A;  2R7R A;  2CGE A;  3ZTM A;  1RKC A;  4XQ1 A;  1FFT C;  1XZQ A;  2Q9B A;  4Z9J A;  2ZXW C;  4U5H A;  3V7O A;  4QDL A;  3W2W A;  3O6X A;  2MHR A;  2YWA A;  4XLP F;  1ZHW A;  3M79 A;  4XPW A;  1CGN A;  2XLM A;  1A7V A;  3AQC A;  2OJE D;  1MND A;  1K40 A;  1YYJ A;  2P6V A;  3K1H A;  4JUR I;  4PJN A;  1KNY A;  2LFD A;  2YHS A;  3IHU A;  1VYK A;  2ETS A;  3GWL A;  4OIR F;  4BJ6 C;  4B6I A;  2Y3B A;  3C8G B;  1G5Z A;  1ORY A;  3HNI A;  1LE2 A;  3L8J A;  4XPX A;  1JOG A;  1U6H A;  1C03 A;  1ZZP A;  3H65 A;  2XXA A;  4XWJ A;  2H7V C;  1E86 A;  2A6E F;  5T3T A;  5L0D A;  2L9J A;  4NQF A;  4QI2 A;  1RMV A;  1T01 A;  4X0R A;  2PBE A;  3NMK A;  3F47 A;  3G50 A;  2HUJ A;  3Q7L A;  5E3C A;  3PHF 2;  3KL4 A;  3EHM A;  3PDM P;  3LUT B;  2YL3 A;  3GEE A;  4OD4 A;  5DVW A;  5F28 E;  3S28 A;  3ABL C;  4F4B A;  4CSA A;  2R7U A;  3ABM C;  4UDV A;  2XL6 A;  5EGY A;  3MBG A;  3ASO C;  1M2V B;  2VCB A;  2R7Q A;  2Z15 A;  3AQB A;  2YL1 A;  4DVZ A;  3JT1 A;  1Q0F A;  5B1B C;  4E7Z A;  3R7C A;  1T6Q A;  3C7J A;  4E0H A;  1IW7 F;  2CDQ A;  4GEH A;  3US6 A;  5L3V A;  4XEV A;  1OCC C;  2IXO A;  2J46 A;  2WZF A;  4JE9 A;  3AG1 C;  3SP1 A;  5HSW A;  3W8H A;  1LE4 A;  4BJ5 C;  4G7H F;  1Z7Q c;  2P1A A;  4H54 A;  4NTB A;  3SYN A;  3HNK A;  2IM8 A;  3AG4 C;  2L6H A;  5BQG A;  3JYY A;  3FAJ A;  3Q6M A;  3WOD F;  4OIO F;  3HKK A;  3FVY A;  1A7D A;  4NY3 A;  2WVO A;  3DI5 A;  1BR4 A;  4ULV A;  2KYH A;  2VCA A;  4JCH A;  3RFY A;  1O87 A;  2XLD A;  1GS9 A;  3W2V A;  3AG2 C;  3DE9 A;  5D92 A;  5T1D B;  1YAR O;  4EBJ A;  4ZLD A;  4WAB A;  2KNH A;  1I4Y A;  3UR3 C;  1MMG A;  1ZU4 A;  2Y69 C;  4PJM A;  2ZXO A;  3DAG A;  1AEP A;  3A9C A;  1EKY A;  1E83 A;  2H7O A;  1YA7 O;  2J7P A;  2OKU A;  2PNO A;  1WAS A;  4JZA A;  4MTO A;  1FAP B;  3HLZ A;  2NG1 A;  1VMA A;  2Q9A A;  1NFN A;  2GDC A;  4EBK A;  2AVK A;  1J8Y F;  3LAY A;  3PCV A;  4YL3 A;  4EUK B;  1APC A;  4MVQ A;  1KTM A;  1LS4 A;  2E87 A;  2Q00 A;  3U9J A;  2IOQ A;  1Q0D A;  2YZS A;  3Q6N A;  1RKE B;  1V74 B;  2LSE A;  4Z9I A;  1OQC A;  1ORJ A;  3GOD A;  4MTF A;  1OKK D;  2HZ8 A;  2OJQ A;  3ZIB A;  5DS4 A;  3SEO A;  1K04 A;  2IXP A;  4CIP A;  5FCL A;  2DI3 A;  1QPU A;  4K1O A;  1D1C A;  3S27 A;  5AC4 A;  5KYY B;  1FFH A;  3C62 A;  3TOL A;  2L81 A;  3CQZ A;  3RW0 A;  3HNJ A;  2AWC A;  2R03 A;  5A6A A;  4G0H A;  2A68 F;  2EIM C;  3QVY A;  1LI7 A;  1KU2 A;  4OIP F;  4MVS A;  4O6Y A;  4KBL A;  1TWA A;  2XL4 A;  4PFO A;  4ZLC A;  3RH3 A;  3RKO F;  4HFF B;  4DXW A;  5A6J A;  1QQ3 A;  2OOC A;  3EPV A;  3FMS A;  1VTM P;  4DBR A;  1D0Z A;  3DAF A;  3H2U A;  2HS5 A;  1JR8 A;  3A11 A;  2VAS A;  3SXM A;  1YYX A;  3BEH A;  1M2O A;  1R5I D;  2FGY A;  2YLD A;  4BPM A;  4DJ9 A;  3HNL A;  2EIL C;  2P7V A;  3UMI A;  3TJ5 A;  3M4B A;  5BQH A;  2Q3T A;  1M6T A;  3C8G A;  2BE5 F;  2R7T A;  3RIP A;  3ZQV A;  3CEX A;  1YDI A;  4LDR A;  3UNG C;  2CYD A;  3V5Z A;  4CS7 A;  4EBB A;  4W8K A;  4LLE A;  3ITF A;  3I5P A;  2XLH A;  1S05 A;  2OG2 A;  4L6R A;  1Y4C A;  3E70 C;  4K0D A;  4Q7C A;  1I4Z A;  2A0B A;  3RVY A;  2XS1 A;  3GM3 A;  2P0N A;  4LDK A;  2GA0 A;  2BL2 A;  3DD7 A;  2V26 A;  3TD7 A;  2R05 A;  2C04 A;  4PJJ A;  4IJJ A;  4NTF A;  1A0B A;  5KYW A;  4CDV A;  2IXM A;  2A69 F;  3DE8 A;  3DMD A;  3U3B A;  3IEE A;  2ASR A;  3L8I A;  3QTH A;  4J7T A;  4RBN A;  3DM9 B;  4JTA B;  1V54 C;  2X51 A;  4JTC B;  2QTV A;  2PF4 E;  2M64 A;  3E9V A;  2VH3 A;  3T6G B;  1NLX A;  2J0X A;  1H9G A;  3SXZ A;  2IBF A;  4G7Z F;  1TWC A;  1A41 A;  2D4U A;  5E3A A;  3B0U X;  1HW1 A;  4DRJ B;  3GOR A;  3EFO B;  1Q0G A;  3NMJ A;  1HW2 A;  1BR2 A;  4BJ5 A;  3RF3 A;  4NTA A;  3TUL A;  2M4E A;  5BQI A;  2R25 A;  1O5H A;  4DVY P;  3UMK A;  2LFF A;  4BJT A;  1LVK A;  3X2Q C;  4FAP B;  1WN0 A;  3NRH A;  2J9V A;  2NUP B;  5COG A;  4AE4 A;  4U5F E;  2GWW A;  3IQC A;  4ANJ A;  1UG7 A;  2HMQ A;  1E85 A;  2YKZ A;  3H2V A;  3UMH A;  4Q5S F;  3ZDL A;  3EQL F;  3L0I A;  3MYF A;  5KYU B;  3M4C A;  4JKV A;  3TOM A;  4BG0 A;  2J45 A;  1T9K A;  1PD0 A;  2XLW A;  4MW8 A;  1H6G A;  1NU7 D;  4IAO A;  1Z5Z A;  2PP4 A;  1ORS C;  3T6J A;  4I44 A;  1TWG A;  2W9Y A;  1T6I A;  2Q4F A;  3MYI A;  3B71 A;  2EPO A;  3KPH A;  3N24 A;  4H4K C;  1FMW A;  4NCQ A;  5DS6 A;  2RD9 A;  3KYJ A;  2Y3G A;  3JTL O;  3LS1 A;  3QMK A;  3IQ5 A;  3RVZ A;  1SZI A;  3FAP B;  3SNH A;  3POV A;  3EGD A;  3GEI A;  2XM4 A;  3JRM O;  4U5G A;  5KYY A;  2B0H A;  3K7D A;  1OW8 A;  2W4B A;  3C18 A;  5DQT A;  5L0G A;  5A6B D;  4P9F A;  4U5D E;  5GPG B;  2R7V A;  1SYQ A;  3IPM O;  4J30 B;  1N1C A;  4LLC A;  5CI8 A;  1QZX A;  1G4U S;  3LES A;  4EHP A;  5HV9 A;  1D0Y A;  2DYR C;  3TQO A;  4PR9 A;  2NSG A;  3SXY A;  4CJO A;  2MWQ A;  3GM2 A;  1ZHT A;  4CJG A;  4MW3 A;  3B9Q A;  4IGG A;  1CGO A;  2F22 A;  2HSQ A;  4Z9H A;  3TK0 A;  2WZL A;  3ZTZ A;  3WHN A;  3IQ6 A;  2YL7 A;  3NYL A;  4JC7 A;  3U0C A;  4O6N A;  3FOO A;  4DRH B;  5E33 A;  3I4U A;  2DB4 A;  4JCZ A;  1WTY A;  4PJL A;  3U8V A;  5A69 A;  5DS5 A;  3BRJ A;  1YAU O;  3NKD A;  2KGO A;  3GEH A;  1LKX A;  3OEO A;  1TFO B;  1NSG B;  2UUH A;  2WVN A;  2AWY A;  4LAC B;  3W8I A;  3DWW A;  3ECS A;  2Q7R A;  5D91 A;  5A6K A;  2XLV A;  3EZI A;  1YZA A;  2QUP A;  2G3K A;  1TR2 A;  3B0P A;  5AC5 A;  3U2M A;  1XWJ A;  2TMV P;  4MVU A;  1U89 A;  3VAY A;  1HY5 A;  1ZW2 A;  4KNW A;  4YL1 A;  1S7Z A;  4O79 A;  3VYW A;  4CDY A;  4DOZ A;  3ATP A;  4J32 B;  1R4T A;  2A1D D;  4D4N A;  3UGP A;  2XXA B;  5F5F A;  3EG9 B;  3U3F A;  2GAQ A;  4WGY A;  5AGF A;  1OCR C;  1WOL A;  2XRH A;  3EGX B;  3K1I C;  4N4W A;  1WAT A;  2JX0 A;  3ZC4 A;  3ZVR A;  3NYJ A;  1SR2 A;  4JTD B;  1JPJ A;  5L3Q A;  1ZU5 A;  4CS9 C;  1D1B A;  1YA9 A;  2BC5 A;  3QVZ A;  3W4Y A;  5L0C A;  1C17 M;  4XPY A;  3RYL A;  4E18 A;  2UUI A;  2Y3H A;  2YLI A;  1Q0M A;  1JAF A;  3KYI A;  5JUA A;  5FZT A;  4XEF A;  5KYN A;  1JMW A;  1FTS A;  1OCO C;  1OW6 A;  4D4X A;  4FWV A;  2HSB A;  2L6G A;  3J06 A;  4LDQ A;  1ZHY A;  4N06 A;  1OXK A;  2LIG A;  2YQY A;  3F46 A;  3G4X A;  4EKW A;  4K7B A;  4Q4Z F;  3OA1 A;  1UFB A;  1EA8 A;  1V4A A;  3IQT A;  1LPE A;  1HMD A;  1ZHZ A;  2NUP A;  1J8M F;  1NBB A;  2HJM A;  2VB6 A;  1OR3 A;  1IZM A;  3CZ6 A;  1GM5 A;  5COF A;  3JSE O;  3B29 A;  3LNM B;  3NYM A;  2I15 A;  4JVS A;  4U9D A;  3Q7G A;  1B68 A;  1ST6 A;  2J7P D;  2KJG A;  2PX3 A;  3JCU Q;  3EJN A;  3CSK A;  4CBE A;  2R7X A;  1TFK B;  3EH1 A;  1NZE A;  1O3U A;  2R7W A;  5DLJ A;  5JRA A;  3LNR A;  2IXN A;  2QE9 A;  5F5H A;  3JZ0 A;  2LD6 A;  2C03 A;  4CS8 A;  3EHN A;  3T9O A;  3NDB B;  2FAP B;  5L0I A;  3FXH A;  1ZVZ A;  1LM3 B;  1LS1 A;  1M2V A;  2ZXR A;  1K05 A;  1T6U A;  4GYT A;  4M63 A;  1NG1 A;  2JD3 A;  4I3M A;  1L3P A;  1U0B B;  4PFP A;  1Z63 A;  2HV6 A;  4YJW A;  2WVQ A;  2OEV A;  2XLO A;  2NUT B;  4MND A;  3SZR A;  1CGM E;  1TWH A;  4U5E E;  3ZG1 A;  3FHD A;  3X1O A;  4IB4 A;  2KW3 C;  2EPL X;  4J7Y A;  4QI0 A;  2P61 A;  2L7A A;  3U8P A;  4DBQ A;  1QVX A;  4CX9 A;  4E7S A;  1A7E A;  2HKV A;  4JJG A;  1CPR A;  3VF0 A;  2L6F A;  4C7O B;  3NMI A;  5TJ5 E;  4FES A;  3S90 A;  5B1A C;  2PFD A;  4OD5 A;  5L0J A;  3N2Z B;  2OEX A;  2XSE A;  2B0J A;  1Z3I X;  2O9X A;  2R7O A;  2ZPA A;  1D1A A;  1E2X A;  2CNW A;  2I8B A;  4N6C A;  4XLN F;  5L0H A;  1JRA A;  1PCX A;  2W45 A;  2HFI A;  4G7O F;  1VOM A;  3C8G D;  1VLT A;  3O55 A;  5CIV A;  4YT5 A;  1SF8 A;  4BEJ A;  5B3I A;  3EZH A;  4CS8 C;  5EHH A;  2HMZ A;  3TJ6 A;  1TKN A;  3GAN A;  2EIN C;  3ABK C;  1YJG A;  2Q9C A;  1YLM A;  3U9M A;  3L34 A;  3K33 A;  3DZA A;  4MVM A;  1RKE A;  4YN0 B;  3WAQ A;  3G4Z A;  2WL8 A;  5KYX B;  2PX0 A;  5JP7 A;  1HE1 A;  2W4M A;  4BJ1 A;  3GWN A;  4C3D A;  5JVE A;  3WG7 C;  2J0W A;  5DQZ A;  5JS5 A;  4AK9 A;  1MMA A;  3O39 A;  4A4A A;  2XM0 A;  3R2P A;  1QLE C;  3EG9 A;  3RQG A;  256B A;  2YEV A;  3FOP A;  2MYS A;  3DXJ F;  3JRT A;  4WJ0 A;  4CIH A;  3EGX A;  3AJM A;  3C8Z A;  1OKK A;  4JIO A;  3RQE A;  1EQ1 A;  2RSE B;  4FX5 A;  3LJB A;  3S0X A;  2D5R B;  3K1I A;  4MQ9 F;  3JYH A;  4O6M A;  1DOV A;  2DGJ A;  3ZSU A;  4YT8 A;  1NFO A;  3HJC A;  4YL0 A;  3S9O A;  3ZQY A;  4ER9 A;  4ULW A;  4CS9 A;  3T4R A;  1BR1 A;  2AP3 A;  2NPU A;  1ZYR F;  1NU9 C;  2QNL A;  3HTK C;  5KYW B;  4RD9 A;  3S29 A;  3N0T A;  2H8A A;  1H9T A;  2R9R B;  4YK5 A;  4AX2 A;  3V5Y A;  1Z6A A;  2OCC C;  5E2Q A;  4I1O B;  4U5B E;  3K66 A;  2EIK C;  3AG3 C;  3M1C B;  4A2N B;  1RJ9 B;  3S84 A;  1FNT c;  3T6B A;  1VB5 A;  3QW1 A;  3MFN A;  4R32 A;  2VCC A;  2X0C A;  3KH2 A;  1HMO A;  1LIH A;  3DKA A;  2ZXP A;  1MMD A;  1WGW A;  1ZW3 A;  5T3W A;  3VM6 A;  2R02 A;  3SXK A;  1Q0K A;  2HV7 A;  4BEM J;  4XTK A;  4E17 A;  4IAQ A;  3DJU B;  3ASN C;  2CNW D;  1G4W R;  5JSL A;  2LQG A;  4C3E A;  1QSP A;  4AE4 B;  1G8X A;  3DM5 A;  3UGO A;  4U5C E;  2G62 A;  3DJN B;  2AU5 A;  3EH2 A;  2EIJ C;  4WGZ A;  1M57 C;  2J9B A;  1OR2 A;  3KKB A;  4RDA A;  5B3S C;  3C63 A;  2XS8 A;  4NC3 A;  4JEA A;  1D0X A;  3AGT A;  1LI5 A;  5JT4 A;  4O7G A;  4CSA C;  3LS0 A;  1I5N A;  1YZC A;  4N6H A;  3OWT A;  1L7C A;  1QKR A;  1Z23 A;  2NUT A;  3ZWI A;  1MNE A;  3QW0 A;  4IWB A;  1OW7 A;  3LLK A;  3FDQ A;  1MMN A;  4OIQ F;  4KI2 A;  2V3C C;  3KMI A;  1OXB A;  3EFO A;  4IRU A;  1RXQ A;  3RQF A;  4C3B A;  4JRZ A;  2LP4 A;  1M56 C;  4U9E A;  2EPK X;  5EK0 A;  2IYL D;  4I1M A;  1FR0 A;  4HEA J;  2EPN A;  3EGD B;  4IAR A;  2YRF A;  2Y3D A;  2XLE A;  2A6H F;  3O10 A;  4C7O A;  1FMV A;  1PV3 A;  1ZHX A;  2GFH A;  2H7B A;  2KSF A;  1SMY F;  4W8P A;  4KC9 A;  3LEO A;  2J9W A;  1VYI A;  3L1M A;  2CW0 F;  1AUE A;  2LCH A;  2G3V A;  4MS2 A;  4AL1 A;  1BBH A;  5KYU A;  1AVO B;  1BDJ B;  1W2W A;  4MVR A;  1EI7 A;  4LER A;  2KC3 A;  1VK5 A;  1V55 C;  4P6I C;  1CPQ A;  1F1M A;  2HJ3 A;  3VRC A;  4DRI B;  1E84 A;  1MQV A;  3M15 A;  2VC9 A;  4CDA A;  4E0I A;  3CAX A;  2FFH A;  1Y6D A;  1XZP A;  3LLI A;  1JPN A;  2ZD9 A;  2WZG A;  1TQG A;  2EPM X;  4MVZ A;  4MVO A;  4KNV A;  4PAC A;  1PD1 A;  5KYX A;  1YVI A;  2J9U A;  4JEB A;  5COM A;  4JW1 A;  1WWP A;  2Y39 A;  2OU6 A;  5L0F A;  4HFK B;  1OCZ C;  2KK1 A;  4GQH A;  2XL8 A;  4BJ6 A;  2QLA A;  5BUO A;  4ONS A;  2DYS C;  3QZC A;  1VLS A;  4AL0 A;  5IY5 C; 
#chains in the Genus database with same CATH homology
 3QVY A;  3IQ6 A;  2YL7 A;  2J8W A;  3FOO A;  5JP7 A;  1RCP A;  1QQ3 A;  5JVE A;  5JS5 A;  5JLI A;  2XM0 A;  256B A;  3FOP A;  1YYX A;  2CCY A;  2XLV A;  1YZA A;  2YLD A;  2YL0 A;  1GQA A;  3HNL A;  2YLG A;  4EIY A;  3M4B A;  1M6T A;  4CDY A;  3ZTM A;  4ER9 A;  3ZQY A;  3ZQV A;  4D4N A;  4WGY A;  5AGF A;  3M79 A;  1CGN A;  2XLH A;  1S05 A;  4L6R A;  2XLM A;  1A7V A;  4N4W A;  1YYJ A;  3QW1 A;  2BC5 A;  3HNI A;  3QVZ A;  4CDV A;  2YLI A;  3DE8 A;  1E86 A;  1JAF A;  5JUA A;  4D4X A;  3NMK A;  4IAQ A;  5JSL A;  2YL3 A;  4CX9 A;  1NBB A;  2XL6 A;  4WGZ A;  3NMJ A;  2J9B A;  3C63 A;  4NC3 A;  4U9D A;  4JEA A;  2YL1 A;  5JT4 A;  4N6H A;  1YZC A;  4JE9 A;  3ZWI A;  5JRA A;  3QW0 A;  1E85 A;  2YKZ A;  3HNK A;  1LM3 B;  3M4C A;  4JKV A;  4U9E A;  3TOM A;  2XLW A;  4ULV A;  4IAR A;  2XLD A;  2XLE A;  2XLO A;  3DE9 A;  3L1M A;  4IB4 A;  3IQ5 A;  1EKY A;  3U8P A;  1BBH A;  1E83 A;  1CPR A;  3VRC A;  1CPQ A;  2XM4 A;  1E84 A;  1MQV A;  3M15 A;  3NMI A;  4CDA A;  1APC A;  4JEB A;  4CIP A;  4CJO A;  1QPU A;  2XL8 A;  4CJG A;  5B3I A;  2QLA A;  3C62 A;  3TOL A;  1CGO A;  3HNJ A;  3ZTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...