2XLVA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124f variant with bound no
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 52
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlvA00
1CPRA 2YL1A 3U8PA 3TOLA 5B3IA 2YKZA 1M6TA 5JP7A 2YLGA 1MQVA 1E86A 4EIYA 3IQ5A 3TOMA 5JVEA 1GQAA 2J9BA 3ZTMA 1YYJA 3NMIA 5JRAA 4N4WA 1RCPA 3HNKA 3VRCA 1NBBA 1E83A 2BC5A 2XLMA 3HNIA 4JEBA 4ER9A 4U9EA 3ZQVA 2YLIA 4IB4A 5JS5A 1E84A 1YZCA 4IARA 3ZQYA 256BA 4JEAA 4CJGA 3M79A 2XLEA 1CGOA 3M15A 2QLAA 3NMJA 2CCYA 4U9DA 3FOPA 3M4BA 4JE9A 2XLWA 3QVZA 2XLVA 3L1MA 3FOOA 4CDVA 3ZWIA 4WGZA 2XLHA 3C63A 2J8WA 3QW0A 4N6HA 1A7VA 2YLDA 5JUAA 1S05A 1JAFA 3QVYA 4CDYA 3QW1A 2YL0A 2YL3A 2XM0A 1BBHA 1APCA 1QPUA 3DE9A 4ULVA 1EKYA 1CGNA 4NC3A 3IQ6A 3DE8A 1YYXA 4WGYA 5AGFA 1CPQA 2XLDA 2XLOA 4IAQA 5JSLA 4CJOA 3HNJA 3ZTZA 3M4CA 1QQ3A 5JLIA 2XL8A 4D4NA 2XL6A 4L6RA 1LM3B 1YZAA 5JT4A 4CIPA 4CDAA 3C62A 1E85A 2YL7A 3HNLA 4JKVA 4D4XA 4CX9A 3NMKA 2XM4A
chains in the Genus database with same CATH superfamily
3PCVA 1TWHA 2Q4FA 3GM2A 2HJMA 3FXHA 4AL0A 3TULA 2J7PA 2Y3GA 4BEJA 3UMHA 1FTSA 1YLMA 2Q9CA 3KMIA 3AG4C 3AQCA 3C8ZA 5KYUB 1M6TA 3LEOA 3H65A 5JP7A 5FCLA 1T9KA 3RFYA 1JMWA 1VB5A 3V5YA 2ETSA 1GQAA 2VCBA 2Q3TA 4I3MA 2Q7RA 4MVUA 4NY3A 3ZTMA 1SYQA 2D5RB 3AGTA 2GFHA 2IXNA 4A4AA 4OIQF 3NMIA 3JRTA 5JRAA 1RCPA 3G50A 4AX2A 4DBQA 5E33A 3S28A 3U0CA 2A69F 1W2WA 5L3VA 1TWGA 2W4MA 4OIRF 3BEHA 3DZAA 3VYWA 2P0NA 4GEHA 1E83A 3EHMA 3KYJA 2A0BA 1JRAA 5L0IA 3G4ZA 1T6IA 2VB6A 2X0CA 1Q0DA 3CQZA 1EKYA 1OCOC 2EPMX 1FAPB 2R7XA 4O6NA 1Y6DA 4KBLA 1LVKA 1ZZPA 2R7UA 2IBFA 3TJ6A 3ATPA 3HKKA 4CBEA 1YZCA 3SNHA 2XXAB 3K1IA 3CAXA 2R25A 3SZRA 256BA 3SEOA 3FAPB 3IQTA 5CI8A 4CS8A 2HMQA 3JRMO 1I5NA 2I8BA 2OCCC 4HFFB 4F4BA 5BQIA 5A69A 1SZIA 1ZW3A 2GDCA 3GANA 1KTMA 2CGEA 5B3SC 1OW8A 1Z7Qc 1OR3A 4HFKB 5BUOA 1AUEA 1K05A 1LS4A 5F5HA 4JTAB 2RD9A 2Y3DA 5CIVA 3POVA 3CEXA 3AG1C 1NG1A 4JW1A 2R7RA 3O39A 3L1MA 3NYMA 3O6XA 2H7VC 2QUPA 2AVKA 2ZXPA 4U5GA 1WATA 4CDVA 1UFBA 4Q7CA 1D1BA 1ZHTA 2XS1A 2R7VA 2R02A 3Q7LA 3Q6NA 4FESA 1NSGB 3QW0A 3S90A 1M2OA 2CW0F 1R4TA 3O55A 5F5FA 1NZEA 2XRHA 1K04A 2OEVA 5T3TA 3T6JA 1C03A 3TJ5A 2QY9A 3RVYA 3U3FA 1LKXA 2CDQA 1S05A 3BRJA 3RQEA 3LLIA 2A6EF 4QI0A 1RMVA 3QW1A 3FDQA 5KYXB 2XM0A 5EK0A 1BBHA 4LLEA 1FMWA 1ORSC 1G4WR 1ORJA 3T6GB 1T6UA 1J8YF 3J06A 1HW2A 1VLSA 4X0RA 1OR2A 1QLEC 4MQ9F 3RF3A 4P9TA 4ULVA 3UMIA 2PBEA 3ZG1A 4KC9A 3EGXA 4FAPB 1YYXA 3B0PA 2MWQA 3GODA 3EZHA 3IPMO 3NRHA 5IY5C 3LESA 1YVIA 1J8MF 3EGDA 4O6YA 2L6FA 2XLOA 2ZXWC 4XWJA 2IXPA 1VMAA 4U5EE 4Q4ZF 3GM1A 4DJ9A 3B29A 4MTFA 3ZTZA 2W9YA 4G78A 3FMSA 1MMNA 1NFOA 1OCCC 2ASRA 1YDIA 3RVZA 1H7IA 2C04A 4Q5SF 2NUPA 2EPNA 2B0HA 2HZ8A 4LACB 3TD7A 5A6BD 2CYDA 3DWWA 1F1MA 2XL4A 4IAOA 1Z5ZA 2A6HF 3DJNB 1LS1A 3LNRA 4AE4B 4IGGA 3ABLC 4DVZA 3KKBA 4YK5A 3EZIA 2PF4E 4NCQA 1D1CA 4LLCA 3RKOF 2TMVP 2WB7A 3NYLA 4CX9A 2V3CC 3NMKA 2XM4A 3EPVA 2HSQA 2HFIA 2IOQA 3GEIA 4XLNF 3U8PA 1PV3A 1CGME 2EIJC 1KNYA 2GA0A 3C8GD 2XSEA 2BE5F 2J9VA 3LEVA 2OKUA 2NUTA 4IJJA 2VCCA 1HMOA 3F47A 4M63A 2YLGA 4U5HA 3ZVRA 1OCRC 1TR2A 1R5ID 3TOMA 1C17M 4MVMA 1YA9A 2E87A 5GPGB 2NPUA 5T3WA 3U8VA 5KYYB 2KNHA 3MFNA 2J9BA 1RJ9B 3IEEA 3WAQA 3DMDA 4QI2A 1JPJA 4LDQA 2Y39A 1GS9A 3AOUA 4Z9IA 4N6CA 1JR8A 4N06A 2LD6A 2OG2A 4BJ1A 3LAYA 2KYHA 2X51A 3S29A 3TQOA 2GWWA 3E9VA 1K40A 2HS5A 2R7OA 3K33A 1EI7A 1NBBA 2VH3A 3EFOA 5FZTA 4I44A 4PK4A 2OJED 3B9QA 1QVXA 4C3BA 1Z63A 2PFDA 5KYWA 3LLKA 2DYSC 3L0IA 1OW7A 3DAFA 4XEKA 4JRZA 4Z9HA 1HMDA 4ER9A 3ZQVA 1VTMP 2EINC 2YLIA 4IB4A 3ZSUA 2LK4A 3U3BA 2WVQA 1NLXA 1ZHWA 3JT1A 1E84A 1I4YA 2P1AA 3UGPA 4JEAA 4JTDB 2J0XA 2WZGA 2R7WA 3M79A 1D1AA 2AU5A 3M15A 1OW6A 3OWTA 2I15A 3ASNC 4I1MA 4J32B 2J9UA 4PJLA 4BPMA 1T6QA 4EUKB 4W8KA 1GGQA 2LIGA 3N24A 3VF0A 1RKEA 2HMZA 3DD7A 2KW3C 2M64A 3I5QA 3M4BA 4AK9A 3A9CA 1H9GA 1PD1A 1Z3IX 2YEVA 2XLWA 3S84A 1TWCA 2Q9AA 2XLVA 3LS1A 3HTKC 5A6BA 1ZW2A 3S0XA 4FX5A 1HW1A 4E7SA 3KPHA 2XLHA 1TKNA 2FFHA 1VLTA 3AJMA 3MYIA 3US6A 4DBRA 5DS5A 1UG7A 3C63A 2J8WA 4J30B 4JC7A 4MS2A 4N6HA 2WVNA 2YLDA 3Q7GA 4C3DA 2J45A 3CSKA 3SXKA 3SYNA 3DM5A 4PFOA 1OCZC 2AWCA 3JSZA 4MNDA 2A68F 1SMYF 1OKKD 4GQHA 1L3PA 3KYIA 2P61A 1A41A 3EH1A 2ICWG 4FWVA 4GYTA 3K6BA 4QDLA 4RDAA 1SR2A 1TWAA 4WABA 2G3VA 2R9RB 4RBNA 3SP1A 3W2WA 4B6IA 3QVYA 4DRIB 3GORA 1IW7F 3ZIBA 3EG9A 3C8GA 5L3QA 4XPYA 4E0HA 4G7ZF 1APCA 2A0UA 3FAJA 4CSAC 4KI2A 3DI5A 3GWLA 3U9MA 2L7AA 2GAQA 1AVOB 3L8JA 3AG2C 2LP4A 1GM5A 2OU6A 5L0GA 1NFNA 3UNGC 4YT8A 1PCXA 1VYIA 5D92A 1WASA 3PDMP 1H9TA 4WGYA 2PX3A 2LFFA 2XLDA 4PJJA 4XTKA 2VASA 1OQCA 1MNEA 2ZPAA 2LFDA 4NTFA 3OEOA 2XXAA 2QTVA 2KC3A 4YT5A 4U5CE 4O7GA 4D4NA 2XL6A 5AC4A 4L6RA 1LM3B 1U0BB 1YARO 1BR4A 1ZHYA 4IRUA 2UUIA 4K0DA 3MBGA 3C7JA 3JSEO 4JJFA 4CIPA 4CS9A 4CDAA 5L0DA 3UGOA 2EPOA 1E85A 3EGXB 2Q00A 2L9JA 1TQGA 3WHNA 2R03A 4JKVA 3JTLO 3EGDB 2HJ3A 3KL4A 2G3KA 1Q0KA 1LIHA 4LDKA 2YL1A 3C18A 4MVQA 4BEMJ 4MVZA 1NU9C 2AP3A 2YKZA 2YQYA 4NTAA 4DXWA 1LI7A 1I4ZA 5COGA 5L0CA 4CSAA 1KU2A 3RYLA 4A2NB 2OOCA 2MYSA 2RSEB 2JPUA 2NUPB 4EIYA 2CNWD 3S27A 2Y3BA 1M56C 5HV9A 3ZDLA 2P6VA 2LQGA 1VOMA 4LDRA 5COFA 5B1BC 1YYJA 3Q6MA 4UDVA 2J7PD 4N4WA 1E2XA 2R7QA 4CS7A 5KYXA 1OKKA 4H4KC 4ULWA 3U2MA 4DRHB 2W45A 2LSEA 2Z15A 3EH2A 3I5PA 4PJMA 4MW8A 3O10A 4KNVA 4OINF 3ITFA 2EPLX 1ZU5A 1PD0A 3LUTB 1MMDA 2BC5A 1BR2A 4C7OA 1A0BA 1G4US 4ZLDA 3FVYA 3T6BA 4U9EA 1YA7O 1VYKA 2NUTB 4C3EA 5BQGA 2H7OA 4IARA 3X1OA 3ZQYA 1AEPA 1LE2A 4OD4A 3U9JA 1YJGA 2OQMA 3KH2A 4E7ZA 4LERA 3VAYA 3N2ZB 3RW0A 3W8IA 4YN0B 2IM8A 1HE9A 1HY5A 4U9DA 5D91A 4EBJA 1FNTc 3FOPA 4JE9A 3EFOB 4ONSA 2LCHA 4YL1A 1ST6A 3MYFA 3OA1A 4AE4A 4G7OF 5KYWB 1M2VA 2NSFA 2DYRC 4JTCB 5B1AC 3K1HA 3FOOA 3H2VA 4RD9A 3ABKC 4NQFA 2H7BA 3ZWIA 2YWAA 4WGZA 4EKWA 1RKCA 2UUHA 3N0TA 5DQTA 1ZYRF 5EHHA 5TJ5E 3EHNA 1A7VA 1A7DA 2HKVA 4EWCA 3R7CA 5JUAA 3L34A 4K7BA 1DOVA 1O87A 2WL8A 4O79A 4WJ0A 1JAFA 2IXOA 2B0JA 3U5SA 2R7SA 4XLPF 1RKEB 3JCUQ 4IWBA 1S7ZA 1RJ9A 4JVSA 3HJCA 5CI9A 1VK5A 4YJWA 4XPWA 4DRJB 3LS0A 5K0IA 3GWNA 5DLJA 4HEAJ 2QE9A 2PX0A 3NKDA 3AGUA 2CNWA 2YZSA 4ANJA 4CIHA 3DE9A 1OXKA 4H54A 1BR1A 1V74B 4XQ1A 4XPXA 1CGNA 3PHF2 3IQ6A 2YHSA 3IQCA 3DE8A 5COMA 3JYYA 3V5ZA 3B0VC 2F22A 3EQLF 1LI5A 5AGFA 4MW3A 3ECSA 2OEXA 1FFHA 3NYJA 4E18A 1MMAA 3HNJA 3K66A 3WODF 3W4YA 2L6GA 1LPEA 4JCHA 5KYUA 4MVRA 4E17A 4U5BE 2HV6A 3E70C 4PFPA 3M4CA 4E0IA 3NKEA 1QQ3A 2ZXRA 3EG9B 3C8GB 4YT2A 2IXMA 2BL2A 5JT4A 4PACA 3G4XA 3SXMA 3W8HA 2Y3HA 3ZC4A 1JPNA 4BJ5C 5L0FA 2HSBA 1WGWA 2VCAA 1N1CA 2ZXOA 3C62A 1Q0GA 3DM9B 3W2VA 4BJ6C 4JZAA 2YL7A 5A6KA 4JURI 4G7HF 4D4XA 1WTYA 1Q0MA 3L8IA 1D0YA 4YWQA 1ZU4A 1CPRA 2O9XA 3TOLA 1O5HA 1WOLA 5B3IA 4DVYP 2W4BA 3ASOC 1ORYA 1A7EA 1D0ZA 3RQFA 1EQ1A 4G0HA 2DI3A 1NU7D 3F46A 4ZLCA 3HLZA 4BG0A 1FR0A 1MQVA 2ZD9A 1E86A 1TFOB 3IQ5A 3IHUA 1C02A 4JIOA 5JVEA 4MTOA 4W8PA 1SF8A 3NDBB 3V7OA 1QZXA 4EBKA 2KK1A 1QKRA 1G8XA 2WZFA 3JYHA 1LE4A 1ZHXA 3HNKA 4OIPF 2EPKX 3VM6A 5DS4A 2M4EA 4R32A 3VRCA 3JZ0A 4CS9C 4K1OA 1V4AA 2WZLA 2XLMA 3HNIA 2NSGA 2PP4A 4J7TA 4JEBA 4MTGA 5L0HA 4MVOA 2FAPB 2H8AA 5DQZA 4J7YA 4YL3A 1MMGA 1T01A 4O6MA 3SXZA 1XZPA 4PR9A 5KYNA 5JS5A 2G62A 2L81A 5T1DB 1M57C 1EA8A 3M1CB 1DOWA 3AG3C 3RIPA 4BJ5A 2EIMC 4BJ6A 5DS6A 4AL1A 2A1DD 4CJGA 4JJGA 1D0XA 2XLEA 1CGOA 2QLAA 2J9WA 3QTHA 3NMJA 4NTBA 2CCYA 4XEVA 3SXYA 2KGOA 5E2QA 2EIKC 4JCZA 1TFKB 1OXBA 3MLGA 1WWPA 4PJNA 3GM3A 3WG7C 2JD3A 2L6HA 2NG1A 2VC9A 3QVZA 4C7OB 4KNWA 3FHDA 3AQBA 2R05A 3U2LA 3DXJF 3R2PA 2P7VA 3T4RA 3QZCA 1IZMA 4YT4A 1O3UA 3LJBA 1BDJB 3I4UA 2KSFA 4Z9JA 1Z6AA 1XZQA 2V26A 3S9OA 3MX3A 3V5XA 1BZ4A 1RXQA 1T5OA 1Y4CA 3DKAA 3H2UA 4I1OB 3X2QC 2YL0A 2YL3A 3ABMC 4CDYA 3TK0A 4XEFA 1XWJA 3EJNA 2DB4A 4EBBA 2R7TA 4BJTA 1Z23A 4HE8D 2C03A 1M2VB 1U6HA 1QPUA 3A11A 5AC5A 2DGJA 5L0JA 1U89A 2WVOA 5F28E 4NC3A 4P9FA 1FMVA 2Y69C 3UMKA 5A6AA 3B0UX 1G5ZA 3GEEA 4EHPA 2J0WA 5BQHA 2EILC 2MHRA 1ZVZA 2KJGA 2IYLD 2YRFA 3DAGA 3T9OA 1CPQA 1H6GA 1HE1A 3QMKA 2FGYA 4DOZA 4IAQA 3B71A 1WN0A 1Q0FA 5JSLA 4CJOA 3K7DA 1B68A 4OD5A 3UR3C 2AWYA 4YL0A 1V55C 1L7CA 2HV7A 3RH3A 2Q9BA 2YVKA 5E3AA 4U5DE 5HSWA 2JX0A 5JLIA 1ZHZA 1QSPA 2XL8A 5EGYA 3RQGA 5E3CA 3GEHA 1YZAA 5KYYA 2PNOA 2OJQA 5A6JA 5DVWA 2D4UA 2XS8A 1V54C 3K1IC 4U5FE 3PMRA 1JOGA 2J46A 4CS8C 2HUJA 3LNMB 4MVSA 1YAUO 3CZ6A 3HNLA 2QNLA 3NG1A 4P6IC 1FFTC 3DJUB 4OIOF 1MNDA 2KQ9A
chains in the Genus database with same CATH topology
1CPRA 2YL1A 3U8PA 3TOLA 5B3IA 2YKZA 1M6TA 5JP7A 2YLGA 1MQVA 1E86A 4EIYA 3IQ5A 3TOMA 5JVEA 1GQAA 2J9BA 3ZTMA 1YYJA 3NMIA 5JRAA 4N4WA 1RCPA 3HNKA 3VRCA 1NBBA 1E83A 2BC5A 2XLMA 3HNIA 4JEBA 4ER9A 4U9EA 3ZQVA 2YLIA 4IB4A 5JS5A 1E84A 1YZCA 4IARA 3ZQYA 256BA 4JEAA 4CJGA 3M79A 2XLEA 1CGOA 3M15A 2QLAA 3NMJA 2CCYA 4U9DA 3FOPA 3M4BA 4JE9A 2XLWA 3QVZA 2XLVA 3L1MA 3FOOA 4CDVA 3ZWIA 4WGZA 2XLHA 3C63A 2J8WA 3QW0A 4N6HA 1A7VA 2YLDA 5JUAA 1S05A 1JAFA 3QVYA 4CDYA 3QW1A 2YL0A 2YL3A 2XM0A 1BBHA 1APCA 1QPUA 3DE9A 4ULVA 1EKYA 1CGNA 4NC3A 3IQ6A 3DE8A 1YYXA 4WGYA 5AGFA 1CPQA 2XLDA 2XLOA 4IAQA 5JSLA 4CJOA 3HNJA 3ZTZA 3M4CA 1QQ3A 5JLIA 2XL8A 4D4NA 2XL6A 4L6RA 1LM3B 1YZAA 5JT4A 4CIPA 4CDAA 3C62A 1E85A 2YL7A 3HNLA 4JKVA 4D4XA 4CX9A 3NMKA 2XM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPR A;  2YL1 A;  3U8P A;  3TOL A;  5B3I A;  2YKZ A;  1M6T A;  5JP7 A;  2YLG A;  1MQV A;  1E86 A;  4EIY A;  3IQ5 A;  3TOM A;  5JVE A;  1GQA A;  2J9B A;  3ZTM A;  1YYJ A;  3NMI A;  5JRA A;  4N4W A;  1RCP A;  3HNK A;  3VRC A;  1NBB A;  1E83 A;  2BC5 A;  2XLM A;  3HNI A;  4JEB A;  4ER9 A;  4U9E A;  3ZQV A;  2YLI A;  4IB4 A;  5JS5 A;  1E84 A;  1YZC A;  4IAR A;  3ZQY A;  256B A;  4JEA A;  4CJG A;  3M79 A;  2XLE A;  1CGO A;  3M15 A;  2QLA A;  3NMJ A;  2CCY A;  4U9D A;  3FOP A;  3M4B A;  4JE9 A;  2XLW A;  3QVZ A;  2XLV A;  3L1M A;  3FOO A;  4CDV A;  3ZWI A;  4WGZ A;  2XLH A;  3C63 A;  2J8W A;  3QW0 A;  4N6H A;  1A7V A;  2YLD A;  5JUA A;  1S05 A;  1JAF A;  3QVY A;  4CDY A;  3QW1 A;  2YL0 A;  2YL3 A;  2XM0 A;  1BBH A;  1APC A;  1QPU A;  3DE9 A;  4ULV A;  1EKY A;  1CGN A;  4NC3 A;  3IQ6 A;  3DE8 A;  1YYX A;  4WGY A;  5AGF A;  1CPQ A;  2XLD A;  2XLO A;  4IAQ A;  5JSL A;  4CJO A;  3HNJ A;  3ZTZ A;  3M4C A;  1QQ3 A;  5JLI A;  2XL8 A;  4D4N A;  2XL6 A;  4L6R A;  1LM3 B;  1YZA A;  5JT4 A;  4CIP A;  4CDA A;  3C62 A;  1E85 A;  2YL7 A;  3HNL A;  4JKV A;  4D4X A;  4CX9 A;  3NMK A;  2XM4 A; 
#chains in the Genus database with same CATH topology
 3PCV A;  1TWH A;  2Q4F A;  3GM2 A;  2HJM A;  3FXH A;  4AL0 A;  3TUL A;  2J7P A;  2Y3G A;  4BEJ A;  3UMH A;  1FTS A;  1YLM A;  2Q9C A;  3KMI A;  3AG4 C;  3AQC A;  3C8Z A;  5KYU B;  1M6T A;  3LEO A;  3H65 A;  5JP7 A;  5FCL A;  1T9K A;  3RFY A;  1JMW A;  1VB5 A;  3V5Y A;  2ETS A;  1GQA A;  2VCB A;  2Q3T A;  4I3M A;  2Q7R A;  4MVU A;  4NY3 A;  3ZTM A;  1SYQ A;  2D5R B;  3AGT A;  2GFH A;  2IXN A;  4A4A A;  4OIQ F;  3NMI A;  3JRT A;  5JRA A;  1RCP A;  3G50 A;  4AX2 A;  4DBQ A;  5E33 A;  3S28 A;  3U0C A;  2A69 F;  1W2W A;  5L3V A;  1TWG A;  2W4M A;  4OIR F;  3BEH A;  3DZA A;  3VYW A;  2P0N A;  4GEH A;  1E83 A;  3EHM A;  3KYJ A;  2A0B A;  1JRA A;  5L0I A;  3G4Z A;  1T6I A;  2VB6 A;  2X0C A;  1Q0D A;  3CQZ A;  1EKY A;  1OCO C;  2EPM X;  1FAP B;  2R7X A;  4O6N A;  1Y6D A;  4KBL A;  1LVK A;  1ZZP A;  2R7U A;  2IBF A;  3TJ6 A;  3ATP A;  3HKK A;  4CBE A;  1YZC A;  3SNH A;  2XXA B;  3K1I A;  3CAX A;  2R25 A;  3SZR A;  256B A;  3SEO A;  3FAP B;  3IQT A;  5CI8 A;  4CS8 A;  2HMQ A;  3JRM O;  1I5N A;  2I8B A;  2OCC C;  4HFF B;  4F4B A;  5BQI A;  5A69 A;  1SZI A;  1ZW3 A;  2GDC A;  3GAN A;  1KTM A;  2CGE A;  5B3S C;  1OW8 A;  1Z7Q c;  1OR3 A;  4HFK B;  5BUO A;  1AUE A;  1K05 A;  1LS4 A;  5F5H A;  4JTA B;  2RD9 A;  2Y3D A;  5CIV A;  3POV A;  3CEX A;  3AG1 C;  1NG1 A;  4JW1 A;  2R7R A;  3O39 A;  3L1M A;  3NYM A;  3O6X A;  2H7V C;  2QUP A;  2AVK A;  2ZXP A;  4U5G A;  1WAT A;  4CDV A;  1UFB A;  4Q7C A;  1D1B A;  1ZHT A;  2XS1 A;  2R7V A;  2R02 A;  3Q7L A;  3Q6N A;  4FES A;  1NSG B;  3QW0 A;  3S90 A;  1M2O A;  2CW0 F;  1R4T A;  3O55 A;  5F5F A;  1NZE A;  2XRH A;  1K04 A;  2OEV A;  5T3T A;  3T6J A;  1C03 A;  3TJ5 A;  2QY9 A;  3RVY A;  3U3F A;  1LKX A;  2CDQ A;  1S05 A;  3BRJ A;  3RQE A;  3LLI A;  2A6E F;  4QI0 A;  1RMV A;  3QW1 A;  3FDQ A;  5KYX B;  2XM0 A;  5EK0 A;  1BBH A;  4LLE A;  1FMW A;  1ORS C;  1G4W R;  1ORJ A;  3T6G B;  1T6U A;  1J8Y F;  3J06 A;  1HW2 A;  1VLS A;  4X0R A;  1OR2 A;  1QLE C;  4MQ9 F;  3RF3 A;  4P9T A;  4ULV A;  3UMI A;  2PBE A;  3ZG1 A;  4KC9 A;  3EGX A;  4FAP B;  1YYX A;  3B0P A;  2MWQ A;  3GOD A;  3EZH A;  3IPM O;  3NRH A;  5IY5 C;  3LES A;  1YVI A;  1J8M F;  3EGD A;  4O6Y A;  2L6F A;  2XLO A;  2ZXW C;  4XWJ A;  2IXP A;  1VMA A;  4U5E E;  4Q4Z F;  3GM1 A;  4DJ9 A;  3B29 A;  4MTF A;  3ZTZ A;  2W9Y A;  4G78 A;  3FMS A;  1MMN A;  1NFO A;  1OCC C;  2ASR A;  1YDI A;  3RVZ A;  1H7I A;  2C04 A;  4Q5S F;  2NUP A;  2EPN A;  2B0H A;  2HZ8 A;  4LAC B;  3TD7 A;  5A6B D;  2CYD A;  3DWW A;  1F1M A;  2XL4 A;  4IAO A;  1Z5Z A;  2A6H F;  3DJN B;  1LS1 A;  3LNR A;  4AE4 B;  4IGG A;  3ABL C;  4DVZ A;  3KKB A;  4YK5 A;  3EZI A;  2PF4 E;  4NCQ A;  1D1C A;  4LLC A;  3RKO F;  2TMV P;  2WB7 A;  3NYL A;  4CX9 A;  2V3C C;  3NMK A;  2XM4 A;  3EPV A;  2HSQ A;  2HFI A;  2IOQ A;  3GEI A;  4XLN F;  3U8P A;  1PV3 A;  1CGM E;  2EIJ C;  1KNY A;  2GA0 A;  3C8G D;  2XSE A;  2BE5 F;  2J9V A;  3LEV A;  2OKU A;  2NUT A;  4IJJ A;  2VCC A;  1HMO A;  3F47 A;  4M63 A;  2YLG A;  4U5H A;  3ZVR A;  1OCR C;  1TR2 A;  1R5I D;  3TOM A;  1C17 M;  4MVM A;  1YA9 A;  2E87 A;  5GPG B;  2NPU A;  5T3W A;  3U8V A;  5KYY B;  2KNH A;  3MFN A;  2J9B A;  1RJ9 B;  3IEE A;  3WAQ A;  3DMD A;  4QI2 A;  1JPJ A;  4LDQ A;  2Y39 A;  1GS9 A;  3AOU A;  4Z9I A;  4N6C A;  1JR8 A;  4N06 A;  2LD6 A;  2OG2 A;  4BJ1 A;  3LAY A;  2KYH A;  2X51 A;  3S29 A;  3TQO A;  2GWW A;  3E9V A;  1K40 A;  2HS5 A;  2R7O A;  3K33 A;  1EI7 A;  1NBB A;  2VH3 A;  3EFO A;  5FZT A;  4I44 A;  4PK4 A;  2OJE D;  3B9Q A;  1QVX A;  4C3B A;  1Z63 A;  2PFD A;  5KYW A;  3LLK A;  2DYS C;  3L0I A;  1OW7 A;  3DAF A;  4XEK A;  4JRZ A;  4Z9H A;  1HMD A;  4ER9 A;  3ZQV A;  1VTM P;  2EIN C;  2YLI A;  4IB4 A;  3ZSU A;  2LK4 A;  3U3B A;  2WVQ A;  1NLX A;  1ZHW A;  3JT1 A;  1E84 A;  1I4Y A;  2P1A A;  3UGP A;  4JEA A;  4JTD B;  2J0X A;  2WZG A;  2R7W A;  3M79 A;  1D1A A;  2AU5 A;  3M15 A;  1OW6 A;  3OWT A;  2I15 A;  3ASN C;  4I1M A;  4J32 B;  2J9U A;  4PJL A;  4BPM A;  1T6Q A;  4EUK B;  4W8K A;  1GGQ A;  2LIG A;  3N24 A;  3VF0 A;  1RKE A;  2HMZ A;  3DD7 A;  2KW3 C;  2M64 A;  3I5Q A;  3M4B A;  4AK9 A;  3A9C A;  1H9G A;  1PD1 A;  1Z3I X;  2YEV A;  2XLW A;  3S84 A;  1TWC A;  2Q9A A;  2XLV A;  3LS1 A;  3HTK C;  5A6B A;  1ZW2 A;  3S0X A;  4FX5 A;  1HW1 A;  4E7S A;  3KPH A;  2XLH A;  1TKN A;  2FFH A;  1VLT A;  3AJM A;  3MYI A;  3US6 A;  4DBR A;  5DS5 A;  1UG7 A;  3C63 A;  2J8W A;  4J30 B;  4JC7 A;  4MS2 A;  4N6H A;  2WVN A;  2YLD A;  3Q7G A;  4C3D A;  2J45 A;  3CSK A;  3SXK A;  3SYN A;  3DM5 A;  4PFO A;  1OCZ C;  2AWC A;  3JSZ A;  4MND A;  2A68 F;  1SMY F;  1OKK D;  4GQH A;  1L3P A;  3KYI A;  2P61 A;  1A41 A;  3EH1 A;  2ICW G;  4FWV A;  4GYT A;  3K6B A;  4QDL A;  4RDA A;  1SR2 A;  1TWA A;  4WAB A;  2G3V A;  2R9R B;  4RBN A;  3SP1 A;  3W2W A;  4B6I A;  3QVY A;  4DRI B;  3GOR A;  1IW7 F;  3ZIB A;  3EG9 A;  3C8G A;  5L3Q A;  4XPY A;  4E0H A;  4G7Z F;  1APC A;  2A0U A;  3FAJ A;  4CSA C;  4KI2 A;  3DI5 A;  3GWL A;  3U9M A;  2L7A A;  2GAQ A;  1AVO B;  3L8J A;  3AG2 C;  2LP4 A;  1GM5 A;  2OU6 A;  5L0G A;  1NFN A;  3UNG C;  4YT8 A;  1PCX A;  1VYI A;  5D92 A;  1WAS A;  3PDM P;  1H9T A;  4WGY A;  2PX3 A;  2LFF A;  2XLD A;  4PJJ A;  4XTK A;  2VAS A;  1OQC A;  1MNE A;  2ZPA A;  2LFD A;  4NTF A;  3OEO A;  2XXA A;  2QTV A;  2KC3 A;  4YT5 A;  4U5C E;  4O7G A;  4D4N A;  2XL6 A;  5AC4 A;  4L6R A;  1LM3 B;  1U0B B;  1YAR O;  1BR4 A;  1ZHY A;  4IRU A;  2UUI A;  4K0D A;  3MBG A;  3C7J A;  3JSE O;  4JJF A;  4CIP A;  4CS9 A;  4CDA A;  5L0D A;  3UGO A;  2EPO A;  1E85 A;  3EGX B;  2Q00 A;  2L9J A;  1TQG A;  3WHN A;  2R03 A;  4JKV A;  3JTL O;  3EGD B;  2HJ3 A;  3KL4 A;  2G3K A;  1Q0K A;  1LIH A;  4LDK A;  2YL1 A;  3C18 A;  4MVQ A;  4BEM J;  4MVZ A;  1NU9 C;  2AP3 A;  2YKZ A;  2YQY A;  4NTA A;  4DXW A;  1LI7 A;  1I4Z A;  5COG A;  5L0C A;  4CSA A;  1KU2 A;  3RYL A;  4A2N B;  2OOC A;  2MYS A;  2RSE B;  2JPU A;  2NUP B;  4EIY A;  2CNW D;  3S27 A;  2Y3B A;  1M56 C;  5HV9 A;  3ZDL A;  2P6V A;  2LQG A;  1VOM A;  4LDR A;  5COF A;  5B1B C;  1YYJ A;  3Q6M A;  4UDV A;  2J7P D;  4N4W A;  1E2X A;  2R7Q A;  4CS7 A;  5KYX A;  1OKK A;  4H4K C;  4ULW A;  3U2M A;  4DRH B;  2W45 A;  2LSE A;  2Z15 A;  3EH2 A;  3I5P A;  4PJM A;  4MW8 A;  3O10 A;  4KNV A;  4OIN F;  3ITF A;  2EPL X;  1ZU5 A;  1PD0 A;  3LUT B;  1MMD A;  2BC5 A;  1BR2 A;  4C7O A;  1A0B A;  1G4U S;  4ZLD A;  3FVY A;  3T6B A;  4U9E A;  1YA7 O;  1VYK A;  2NUT B;  4C3E A;  5BQG A;  2H7O A;  4IAR A;  3X1O A;  3ZQY A;  1AEP A;  1LE2 A;  4OD4 A;  3U9J A;  1YJG A;  2OQM A;  3KH2 A;  4E7Z A;  4LER A;  3VAY A;  3N2Z B;  3RW0 A;  3W8I A;  4YN0 B;  2IM8 A;  1HE9 A;  1HY5 A;  4U9D A;  5D91 A;  4EBJ A;  1FNT c;  3FOP A;  4JE9 A;  3EFO B;  4ONS A;  2LCH A;  4YL1 A;  1ST6 A;  3MYF A;  3OA1 A;  4AE4 A;  4G7O F;  5KYW B;  1M2V A;  2NSF A;  2DYR C;  4JTC B;  5B1A C;  3K1H A;  3FOO A;  3H2V A;  4RD9 A;  3ABK C;  4NQF A;  2H7B A;  3ZWI A;  2YWA A;  4WGZ A;  4EKW A;  1RKC A;  2UUH A;  3N0T A;  5DQT A;  1ZYR F;  5EHH A;  5TJ5 E;  3EHN A;  1A7V A;  1A7D A;  2HKV A;  4EWC A;  3R7C A;  5JUA A;  3L34 A;  4K7B A;  1DOV A;  1O87 A;  2WL8 A;  4O79 A;  4WJ0 A;  1JAF A;  2IXO A;  2B0J A;  3U5S A;  2R7S A;  4XLP F;  1RKE B;  3JCU Q;  4IWB A;  1S7Z A;  1RJ9 A;  4JVS A;  3HJC A;  5CI9 A;  1VK5 A;  4YJW A;  4XPW A;  4DRJ B;  3LS0 A;  5K0I A;  3GWN A;  5DLJ A;  4HEA J;  2QE9 A;  2PX0 A;  3NKD A;  3AGU A;  2CNW A;  2YZS A;  4ANJ A;  4CIH A;  3DE9 A;  1OXK A;  4H54 A;  1BR1 A;  1V74 B;  4XQ1 A;  4XPX A;  1CGN A;  3PHF 2;  3IQ6 A;  2YHS A;  3IQC A;  3DE8 A;  5COM A;  3JYY A;  3V5Z A;  3B0V C;  2F22 A;  3EQL F;  1LI5 A;  5AGF A;  4MW3 A;  3ECS A;  2OEX A;  1FFH A;  3NYJ A;  4E18 A;  1MMA A;  3HNJ A;  3K66 A;  3WOD F;  3W4Y A;  2L6G A;  1LPE A;  4JCH A;  5KYU A;  4MVR A;  4E17 A;  4U5B E;  2HV6 A;  3E70 C;  4PFP A;  3M4C A;  4E0I A;  3NKE A;  1QQ3 A;  2ZXR A;  3EG9 B;  3C8G B;  4YT2 A;  2IXM A;  2BL2 A;  5JT4 A;  4PAC A;  3G4X A;  3SXM A;  3W8H A;  2Y3H A;  3ZC4 A;  1JPN A;  4BJ5 C;  5L0F A;  2HSB A;  1WGW A;  2VCA A;  1N1C A;  2ZXO A;  3C62 A;  1Q0G A;  3DM9 B;  3W2V A;  4BJ6 C;  4JZA A;  2YL7 A;  5A6K A;  4JUR I;  4G7H F;  4D4X A;  1WTY A;  1Q0M A;  3L8I A;  1D0Y A;  4YWQ A;  1ZU4 A;  1CPR A;  2O9X A;  3TOL A;  1O5H A;  1WOL A;  5B3I A;  4DVY P;  2W4B A;  3ASO C;  1ORY A;  1A7E A;  1D0Z A;  3RQF A;  1EQ1 A;  4G0H A;  2DI3 A;  1NU7 D;  3F46 A;  4ZLC A;  3HLZ A;  4BG0 A;  1FR0 A;  1MQV A;  2ZD9 A;  1E86 A;  1TFO B;  3IQ5 A;  3IHU A;  1C02 A;  4JIO A;  5JVE A;  4MTO A;  4W8P A;  1SF8 A;  3NDB B;  3V7O A;  1QZX A;  4EBK A;  2KK1 A;  1QKR A;  1G8X A;  2WZF A;  3JYH A;  1LE4 A;  1ZHX A;  3HNK A;  4OIP F;  2EPK X;  3VM6 A;  5DS4 A;  2M4E A;  4R32 A;  3VRC A;  3JZ0 A;  4CS9 C;  4K1O A;  1V4A A;  2WZL A;  2XLM A;  3HNI A;  2NSG A;  2PP4 A;  4J7T A;  4JEB A;  4MTG A;  5L0H A;  4MVO A;  2FAP B;  2H8A A;  5DQZ A;  4J7Y A;  4YL3 A;  1MMG A;  1T01 A;  4O6M A;  3SXZ A;  1XZP A;  4PR9 A;  5KYN A;  5JS5 A;  2G62 A;  2L81 A;  5T1D B;  1M57 C;  1EA8 A;  3M1C B;  1DOW A;  3AG3 C;  3RIP A;  4BJ5 A;  2EIM C;  4BJ6 A;  5DS6 A;  4AL1 A;  2A1D D;  4CJG A;  4JJG A;  1D0X A;  2XLE A;  1CGO A;  2QLA A;  2J9W A;  3QTH A;  3NMJ A;  4NTB A;  2CCY A;  4XEV A;  3SXY A;  2KGO A;  5E2Q A;  2EIK C;  4JCZ A;  1TFK B;  1OXB A;  3MLG A;  1WWP A;  4PJN A;  3GM3 A;  3WG7 C;  2JD3 A;  2L6H A;  2NG1 A;  2VC9 A;  3QVZ A;  4C7O B;  4KNW A;  3FHD A;  3AQB A;  2R05 A;  3U2L A;  3DXJ F;  3R2P A;  2P7V A;  3T4R A;  3QZC A;  1IZM A;  4YT4 A;  1O3U A;  3LJB A;  1BDJ B;  3I4U A;  2KSF A;  4Z9J A;  1Z6A A;  1XZQ A;  2V26 A;  3S9O A;  3MX3 A;  3V5X A;  1BZ4 A;  1RXQ A;  1T5O A;  1Y4C A;  3DKA A;  3H2U A;  4I1O B;  3X2Q C;  2YL0 A;  2YL3 A;  3ABM C;  4CDY A;  3TK0 A;  4XEF A;  1XWJ A;  3EJN A;  2DB4 A;  4EBB A;  2R7T A;  4BJT A;  1Z23 A;  4HE8 D;  2C03 A;  1M2V B;  1U6H A;  1QPU A;  3A11 A;  5AC5 A;  2DGJ A;  5L0J A;  1U89 A;  2WVO A;  5F28 E;  4NC3 A;  4P9F A;  1FMV A;  2Y69 C;  3UMK A;  5A6A A;  3B0U X;  1G5Z A;  3GEE A;  4EHP A;  2J0W A;  5BQH A;  2EIL C;  2MHR A;  1ZVZ A;  2KJG A;  2IYL D;  2YRF A;  3DAG A;  3T9O A;  1CPQ A;  1H6G A;  1HE1 A;  3QMK A;  2FGY A;  4DOZ A;  4IAQ A;  3B71 A;  1WN0 A;  1Q0F A;  5JSL A;  4CJO A;  3K7D A;  1B68 A;  4OD5 A;  3UR3 C;  2AWY A;  4YL0 A;  1V55 C;  1L7C A;  2HV7 A;  3RH3 A;  2Q9B A;  2YVK A;  5E3A A;  4U5D E;  5HSW A;  2JX0 A;  5JLI A;  1ZHZ A;  1QSP A;  2XL8 A;  5EGY A;  3RQG A;  5E3C A;  3GEH A;  1YZA A;  5KYY A;  2PNO A;  2OJQ A;  5A6J A;  5DVW A;  2D4U A;  2XS8 A;  1V54 C;  3K1I C;  4U5F E;  3PMR A;  1JOG A;  2J46 A;  4CS8 C;  2HUJ A;  3LNM B;  4MVS A;  1YAU O;  3CZ6 A;  3HNL A;  2QNL A;  3NG1 A;  4P6I C;  1FFT C;  3DJU B;  4OIO F;  1MND A;  2KQ9 A; 
#chains in the Genus database with same CATH homology
 1CPR A;  2YL1 A;  3U8P A;  3TOL A;  5B3I A;  2YKZ A;  1M6T A;  5JP7 A;  2YLG A;  1MQV A;  1E86 A;  4EIY A;  3IQ5 A;  3TOM A;  5JVE A;  1GQA A;  2J9B A;  3ZTM A;  1YYJ A;  3NMI A;  5JRA A;  4N4W A;  1RCP A;  3HNK A;  3VRC A;  1NBB A;  1E83 A;  2BC5 A;  2XLM A;  3HNI A;  4JEB A;  4ER9 A;  4U9E A;  3ZQV A;  2YLI A;  4IB4 A;  5JS5 A;  1E84 A;  1YZC A;  4IAR A;  3ZQY A;  256B A;  4JEA A;  4CJG A;  3M79 A;  2XLE A;  1CGO A;  3M15 A;  2QLA A;  3NMJ A;  2CCY A;  4U9D A;  3FOP A;  3M4B A;  4JE9 A;  2XLW A;  3QVZ A;  2XLV A;  3L1M A;  3FOO A;  4CDV A;  3ZWI A;  4WGZ A;  2XLH A;  3C63 A;  2J8W A;  3QW0 A;  4N6H A;  1A7V A;  2YLD A;  5JUA A;  1S05 A;  1JAF A;  3QVY A;  4CDY A;  3QW1 A;  2YL0 A;  2YL3 A;  2XM0 A;  1BBH A;  1APC A;  1QPU A;  3DE9 A;  4ULV A;  1EKY A;  1CGN A;  4NC3 A;  3IQ6 A;  3DE8 A;  1YYX A;  4WGY A;  5AGF A;  1CPQ A;  2XLD A;  2XLO A;  4IAQ A;  5JSL A;  4CJO A;  3HNJ A;  3ZTZ A;  3M4C A;  1QQ3 A;  5JLI A;  2XL8 A;  4D4N A;  2XL6 A;  4L6R A;  1LM3 B;  1YZA A;  5JT4 A;  4CIP A;  4CDA A;  3C62 A;  1E85 A;  2YL7 A;  3HNL A;  4JKV A;  4D4X A;  4CX9 A;  3NMK A;  2XM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...