1MQVA

Crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
ATDVIAQRKAILKQMGEATKPIAAMLKGEAKWDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIFEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Structural Features of Cytochrome c' Folding Intermediates Revealed by Fluorescence Energy-Transfer Kinetics
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 47
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1mqvA00
1YZCA 2YLDA 256BA 4IARA 3QVYA 3TOMA 3HNJA 1E83A 3M4BA 4JEAA 1RCPA 1A7VA 3U8PA 2YLIA 3HNLA 2XLWA 1LM3B 5JT4A 3NMIA 1E84A 4CIPA 2YL0A 1CGNA 3HNKA 3M79A 4CJGA 4CDAA 4IAQA 3ZWIA 2J9BA 1NBBA 2YL1A 1APCA 3FOOA 3FOPA 1CPQA 2XLHA 5JLIA 2XLDA 4EIYA 5JS5A 3DE8A 3C63A 4WGZA 4ER9A 4L6RA 4JKVA 3ZTMA 5JVEA 3C62A 2YL7A 3IQ5A 4NC3A 3L1MA 2YL3A 4ULVA 2XM0A 1QQ3A 1CPRA 2YLGA 1YZAA 1BBHA 4JE9A 3TOLA 4U9DA 4N4WA 4CDYA 3QVZA 2BC5A 1EKYA 3M15A 4CJOA 2QLAA 4CX9A 2CCYA 1JAFA 4U9EA 4CDVA 1YYXA 3NMJA 4WGYA 4N6HA 5JP7A 3DE9A 3QW0A 5JRAA 4D4XA 3QW1A 4D4NA 1MQVA 1YYJA 2XL8A 4JEBA 5AGFA 1CGOA 3M4CA 3VRCA 3IQ6A 5JUAA 1GQAA 2XL6A 1QPUA 2XLMA 1S05A 2XLOA 2XLVA 2XM4A 1M6TA 3HNIA 2J8WA 4IB4A 3ZQVA 2XLEA 1E86A 2YKZA 5JSLA 5B3IA 1E85A 3ZQYA 3ZTZA 3NMKA
chains in the Genus database with same CATH superfamily
2YLDA 3EPVA 3HLZA 4LLEA 2R7QA 4OIRF 5A6KA 3EG9A 1ZU5A 1EA8A 3EFOB 2C04A 3GEHA 3DKAA 3GODA 3HKKA 1A41A 3C18A 3LAYA 3LS1A 1D1CA 4IARA 3U3BA 1WOLA 4AK9A 1Z6AA 4A4AA 4C7OB 3TJ5A 2E87A 1H9GA 4JCZA 4XPWA 4PFPA 4JEAA 5BQHA 1HMDA 3DWWA 4U5HA 3U8PA 3UMIA 3S90A 3HNLA 2W4BA 2XLWA 2F22A 2ZPAA 1NFOA 5JT4A 4C7OA 4JCHA 4CS8A 2LK4A 2X51A 3RIPA 1ORYA 1FTSA 2MWQA 1HW2A 2PF4E 1B68A 2Y3DA 2QUPA 4BJTA 1MMGA 3ZWIA 4J7YA 3UR3C 4AE4A 4Q5SF 4C3DA 1XZQA 1AUEA 2DGJA 1BR1A 2A6EF 4PR9A 1TR2A 4JW1A 3K1IC 4LDQA 1APCA 3FOOA 4IJJA 3MFNA 4MQ9F 3FOPA 5AC4A 5L0HA 4KNVA 2Y69C 3L0IA 1C17M 4AX2A 2OEXA 2HJ3A 1CPQA 2AVKA 2OJQA 1NG1A 5GPGB 3DE8A 1ZHXA 1LKXA 4ER9A 3OWTA 4EBBA 4JJFA 4JKVA 4NQFA 2GA0A 2CNWD 5D91A 3KKBA 2L81A 4NY3A 4QI2A 5KYNA 4MNDA 3L1MA 1LI5A 4LERA 4N6CA 5DQZA 4G7HF 2J9UA 4R32A 2HMQA 5KYUA 4BJ6C 4C3EA 1D1BA 1S7ZA 1OCCC 1QQ3A 4BJ5A 1ZHZA 2VCAA 1PV3A 4O6NA 4FAPB 2CDQA 3S27A 4Q4ZF 1XWJA 2D5RB 5B3SC 5BUOA 2PBEA 4JE9A 1QKRA 2XL4A 1HE1A 4CS7A 5D92A 1TFKB 3U2LA 5KYYB 1QLEC 1ORSC 3GEEA 2Y39A 2VH3A 2R7WA 3QVZA 3MLGA 2J7PA 2EIMC 2BC5A 5T3TA 3SEOA 5DS5A 1QSPA 3I4UA 2P7VA 4CBEA 4PFOA 4CX9A 5F5FA 5K0IA 3FXHA 3LESA 2CCYA 1VLTA 1M56C 3T9OA 5B1BC 1WGWA 4O79A 1T6QA 2CYDA 4MS2A 4ONSA 2VC9A 1Z63A 3US6A 3VM6A 1K05A 1ST6A 4DJ9A 3KYJA 3DJNB 3V5YA 1LIHA 4NTFA 4RDAA 3B29A 3UGPA 2EIKC 2VCCA 3LNMB 5FZTA 3FVYA 1RMVA 1JR8A 2A0UA 5KYWB 3PDMP 3MBGA 4D4XA 2NPUA 1V55C 1O3UA 4LLCA 3KYIA 3NYJA 1I4YA 4HE8D 1L7CA 1OR3A 1MNDA 2DYSC 2LIGA 3EH2A 2XRHA 4MVZA 4N06A 4MW3A 1BR4A 1JPJA 4QDLA 3NDBB 3LLIA 3ZC4A 2OOCA 4I3MA 4E18A 2XLMA 3B9QA 1OXBA 3AG4C 2R7OA 1VYKA 4IB4A 5COMA 1KTMA 3G4XA 1E86A 3AQBA 3CZ6A 2P0NA 4PJNA 2L6FA 2LD6A 3LUTB 4MVUA 2UUHA 2WB7A 3FDQA 1CGME 1E85A 4I1OB 3SZRA 3S29A 4YL3A 3KL4A 3NMKA 2XS8A 4HEAJ 4BEMJ 1LE2A 256BA 2H7OA 4IWBA 3ZDLA 1O5HA 5FCLA 2V3CC 1GS9A 4AL1A 4OD5A 3CEXA 2A6HF 3RF3A 2EPMX 2QNLA 1E2XA 3K33A 1Y4CA 2YZSA 1T01A 5IY5C 1OW8A 3G50A 3M4BA 4MVRA 2L6GA 2KQ9A 5DLJA 4DRHB 4XWJA 2GDCA 2O9XA 2IXPA 4WABA 3U5SA 5CI9A 3MX3A 3J06A 4I44A 1YJGA 3PMRA 1V4AA 3FMSA 2WL8A 2R25A 3RKOF 5L0CA 3EG9B 4E7SA 1DOVA 3HNKA 3AQCA 3NKEA 3DMDA 3UMKA 1YA9A 2IM8A 4B6IA 1HMOA 3SXZA 3OA1A 4XEFA 1W2WA 2KSFA 2L6HA 4MVOA 2EPOA 1NBBA 4CS9A 1OCZC 1IW7F 1JRAA 2KK1A 3F47A 5T3WA 3AG3C 2KYHA 1NSGB 2YL1A 4MVSA 5E3CA 3TD7A 5COFA 4EBKA 5AGFA 4EWCA 4DBQA 3S84A 2AWYA 2VCBA 1A0BA 3NYMA 1WN0A 3JSEO 2FGYA 1OQCA 3VAYA 3U2MA 4PK4A 2XLHA 5JLIA 1Q0FA 1ZHTA 3NG1A 2P61A 1NFNA 5JS5A 4XQ1A 1Q0MA 1V54C 2HSBA 4XEKA 1D0YA 4DRJB 4DOZA 3AGUA 2XXAA 4YT8A 4J7TA 1WASA 4JC7A 2KNHA 4P6IC 4W8PA 2J46A 3RFYA 3VYWA 4AE4B 3ABLC 5T1DB 2OEVA 2B0HA 4XLPF 1I4ZA 2EILC 2YQYA 3L8JA 4NC3A 3O39A 4Z9IA 2CNWA 2A68F 2KGOA 4CSAC 2KJGA 1MNEA 3JSZA 5KYXA 2XM0A 1YARO 2EPNA 2LCHA 1A7DA 3S9OA 3SXKA 1CPRA 3U0CA 1GM5A 3DI5A 2YLGA 3RVYA 2YEVA 5F5HA 4JTDB 4JTAB 2EIJC 4XPXA 5F28E 2GWWA 1AVOB 3JZ0A 1JPNA 4MTGA 1L3PA 4U9DA 3I5QA 4PJLA 2IOQA 3IQCA 4OIOF 1LS4A 2OU6A 2J0XA 1EKYA 5EGYA 3NKDA 4CJOA 3TJ6A 2PX3A 1FAPB 5KYUB 4ZLCA 1SR2A 4X0RA 2J9WA 3IEEA 4MTOA 4CDVA 5L3VA 1NZEA 1RKEB 2GAQA 2QY9A 3NMJA 2P1AA 4E7ZA 1T6IA 3HJCA 4LDRA 4WGYA 3GEIA 3QZCA 1SF8A 4Q7CA 4ULWA 3C8GA 3ZSUA 2PX0A 4FWVA 3AJMA 1Q0KA 4YJWA 2UUIA 1TWGA 3ABMC 3WAQA 3EHNA 3ZIBA 2R7VA 1RKEA 1SZIA 1VMAA 4DVZA 4XPYA 5CIVA 1FNTc 2R7SA 1TQGA 4YT4A 2AP3A 4QI0A 3TK0A 5JUAA 4Z9HA 3R7CA 4ZLDA 1HW1A 1QPUA 2HFIA 1S05A 1G5ZA 1C03A 2XLOA 3UMHA 1WWPA 2H8AA 2AWCA 2J8WA 1H7IA 2XLEA 4KBLA 2LFDA 3ASNC 4I1MA 3ZQVA 3ITFA 3Q7LA 1YVIA 2G3VA 3IQTA 3S0XA 1VTMP 3BEHA 2Q00A 3H65A 4NTAA 2HS5A 1PD1A 4PJJA 3ZTZA 1MMDA 3C8GD 2HMZA 3JRMO 3KH2A 4AL0A 2M4EA 5CI8A 3ASOC 2QE9A 2WVQA 3HTKC 3QMKA 3SXMA 3WG7C 3L34A 3RH3A 5DS4A 1D0XA 1AEPA 5HV9A 4DXWA 1VYIA 3U8VA 3SYNA 2FFHA 4CS9C 1F1MA 4H54A 5L0JA 2FAPB 3IPMO 4GYTA 2PFDA 3UGOA 1RCPA 1H6GA 3LJBA 3AOUA 1LVKA 2KW3C 1A7VA 2YHSA 4XTKA 3W8IA 5EHHA 1YA7O 1IZMA 3EHMA 2ICWG 3W4YA 1J8YF 3I5PA 1N1CA 1R4TA 4CIPA 2HUJA 2MHRA 5DQTA 1CGNA 1MMNA 3M79A 4JVSA 2V26A 4U5EE 4CJGA 2AU5A 3RQFA 1U89A 4CDAA 2Z15A 3E9VA 3EJNA 4IAQA 2J9BA 2HKVA 4G0HA 1TWAA 1MMAA 3DZAA 2YWAA 4EUKB 2Q9CA 3JT1A 4U5CE 4K0DA 3SP1A 1OR2A 2C03A 2A69F 3PCVA 2EPLX 1FMVA 2L7AA 2OG2A 2ZXRA 3U9MA 2R9RB 2D4UA 1ZHYA 2JD3A 2R7RA 4GEHA 4K1OA 2XLDA 4EIYA 1ZW3A 2XSEA 3Q6NA 4MTFA 2CW0F 3ECSA 2Q4FA 3F46A 1Q0GA 1T9KA 2J9VA 5A69A 2LP4A 3N2ZB 2WVNA 4FESA 1TKNA 4L6RA 4MVQA 1JOGA 3MYFA 2X0CA 3CSKA 3ZTMA 4E0IA 4JZAA 2IYLD 3C62A 1RXQA 1YAUO 2YL7A 1SMYF 4NTBA 1VK5A 3GM3A 1RJ9A 2I15A 2YL3A 2JPUA 4ULVA 3K66A 1QZXA 1G4WR 2NSGA 2DI3A 2WZFA 4IGGA 4MVMA 4P9TA 3X1OA 1SYQA 5DS6A 2XXAB 2HSQA 1YZAA 4E0HA 1T6UA 3T6JA 4FX5A 3GWNA 1C02A 2ASRA 1DOWA 2PP4A 3EH1A 4O6MA 1LPEA 1FMWA 3TOLA 1NU9C 3JYYA 4N4WA 1FR0A 4CDYA 3GM1A 1I5NA 2NUPA 5KYWA 3V5XA 2LQGA 3EGXA 2OCCC 3O6XA 1EI7A 3BRJA 3T6BA 5L3QA 3PHF2 5KYXB 1ZW2A 2Q3TA 2CGEA 4IAOA 3DM5A 3AG1C 1RKCA 3DXJF 3RYLA 2I8BA 1U6HA 1VOMA 4XEVA 2LSEA 1D0ZA 1NLXA 4BPMA 4CSAA 1ZYRF 2EINC 3TQOA 4PJMA 4UDVA 1WATA 1BDJB 1YYXA 3DJUB 2NUTA 3O10A 2ZXPA 2IXMA 3KPHA 4N6HA 5JP7A 4YL1A 2J0WA 3K1IA 4E17A 2TMVP 3DE9A 1K40A 1LE4A 2BE5F 3CAXA 4JJGA 1V74B 1H9TA 2OJED 1TWHA 2R7XA 4U5FE 3U9JA 3MYIA 3LEVA 4EKWA 5A6BA 1PCXA 4RD9A 1J8MF 1MQVA 4MW8A 1WTYA 2R05A 4K7BA 1YYJA 2OQMA 1CGOA 5L0FA 3IQ6A 3ZVRA 3EFOA 1Z7Qc 3UNGC 5AC5A 1GQAA 2XL6A 2WZLA 2DYRC 2IBFA 4M63A 1OW7A 3FHDA 3HNIA 3K1HA 1TFOB 2HV6A 3C8GB 2R03A 5JSLA 1G4US 4BEJA 4CS8C 3AGTA 3KMIA 4NCQA 1U0BB 3EZIA 1XZPA 3G4ZA 3GM2A 3IHUA 2IXNA 4H4KC 5B1AC 3RQEA 3B71A 4O6YA 3ZQYA 4BG0A 1GGQA 4BJ6A 1OW6A 1TWCA 1YZCA 2H7VC 2NSFA 3AG2C 2QTVA 3FAJA 3RW0A 5L0DA 4YWQA 2YRFA 2DB4A 2RSEB 4ANJA 3LEOA 5A6BD 1G8XA 5E3AA 3SXYA 4P9FA 3QVYA 3EGDB 4JRZA 3W2VA 1ORJA 2IXOA 3TOMA 3HNJA 3X2QC 1E83A 1K04A 4KNWA 4G78A 1Q0DA 3Q6MA 4U5DE 4JURI 4RBNA 3N24A 3V7OA 2Y3GA 2YLIA 4EHPA 4J30B 1LM3B 3NYLA 3NMIA 4C3BA 3EGDA 2W9YA 4WJ0A 1E84A 3B0PA 3E70C 2YL0A 1UFBA 1M57C 2L9JA 3L8IA 2G62A 2XS1A 4J32B 3M1CB 3GWLA 2R7TA 4OD4A 3N0TA 1NU7D 4U5BE 3U3FA 1ZU4A 1UG7A 3K7DA 3C7JA 3EQLF 5DVWA 2ZXOA 3CQZA 3RQGA 5BQIA 1ZZPA 3JRTA 4YL0A 5TJ5E 4OIPF 3WHNA 1Z5ZA 4BJ5C 2PNOA 4G7OF 2EPKX 1OCRC 3LNRA 3B0VC 2Y3HA 3T4RA 2ZXWC 4YT5A 1FFHA 3A11A 3C63A 2Q9AA 4WGZA 4O7GA 4Z9JA 4YN0B 3H2VA 4YK5A 3Q7GA 1EQ1A 3K6BA 4BJ1A 2J45A 2HV7A 2VB6A 4LACB 5JVEA 3JCUQ 4EBJA 3FAPB 5KYYA 3W8HA 1VB5A 3IQ5A 5A6JA 4LDKA 1OXKA 2H7BA 1KU2A 4F4BA 5E2QA 2LFFA 1R5ID 1BR2A 2ZD9A 3C8ZA 3JYHA 2BL2A 4CIHA 2HZ8A 4G7ZF 1LI7A 3S28A 2YVKA 4W8KA 4KC9A 1OCOC 2J7PD 3DAGA 1BBHA 2ETSA 3EZHA 5E33A 2R7UA 5COGA 2Q9BA 4OINF 2GFHA 2VASA 3LS0A 2OKUA 3VF0A 2G3KA 2R02A 1PD0A 2WZGA 3M15A 2Y3BA 1RJ9B 4OIQF 3W2WA 1T5OA 2QLAA 3WODF 5HSWA 3ZG1A 1D1AA 1M2OA 1VLSA 1JAFA 5A6AA 2Q7RA 1Z3IX 1YLMA 4XLNF 3POVA 1YDIA 2A0BA 1LS1A 3R2PA 4U9EA 2JX0A 3ATPA 1ZHWA 2KC3A 5L0GA 1OKKA 2A1DD 2W45A 1M2VB 3DD7A 3OEOA 1O87A 2NUPB 3QW0A 1Y6DA 3RVZA 3EGXB 5JRAA 3QTHA 4DRIB 4JTCB 4DBRA 2B0JA 3QW1A 1KNYA 1Z23A 1BZ4A 2NG1A 4IRUA 4PACA 4D4NA 5EK0A 3TULA 2XL8A 4JEBA 3A9CA 2P6VA 1M2VA 3M4CA 1QVXA 3VRCA 2RD9A 3NRHA 4KI2A 5BQGA 2NUTB 4JIOA 2XM4A 2XLVA 3B0UX 4HFKB 1FFTC 2WVOA 3JTLO 2W4MA 3H2UA 4DVYP 1M6TA 3ABKC 1ZVZA 1HY5A 3T6GB 2YKZA 3DM9B 2M64A 1JMWA 2HJMA 4A2NB 5B3IA 1OKKD 1A7EA 2MYSA 3GANA 3LLKA 3V5ZA 3DAFA 4HFFB 5L0IA 1HE9A 3SNHA 3GORA 4U5GA 3O55A 4YT2A 4GQHA
chains in the Genus database with same CATH topology
1YZCA 2YLDA 256BA 4IARA 3QVYA 3TOMA 3HNJA 1E83A 3M4BA 4JEAA 1RCPA 1A7VA 3U8PA 2YLIA 3HNLA 2XLWA 1LM3B 5JT4A 3NMIA 1E84A 4CIPA 2YL0A 1CGNA 3HNKA 3M79A 4CJGA 4CDAA 4IAQA 3ZWIA 2J9BA 1NBBA 2YL1A 1APCA 3FOOA 3FOPA 1CPQA 2XLHA 5JLIA 2XLDA 4EIYA 5JS5A 3DE8A 3C63A 4WGZA 4ER9A 4L6RA 4JKVA 3ZTMA 5JVEA 3C62A 2YL7A 3IQ5A 4NC3A 3L1MA 2YL3A 4ULVA 2XM0A 1QQ3A 1CPRA 2YLGA 1YZAA 1BBHA 4JE9A 3TOLA 4U9DA 4N4WA 4CDYA 3QVZA 2BC5A 1EKYA 3M15A 4CJOA 2QLAA 4CX9A 2CCYA 1JAFA 4U9EA 4CDVA 1YYXA 3NMJA 4WGYA 4N6HA 5JP7A 3DE9A 3QW0A 5JRAA 4D4XA 3QW1A 4D4NA 1MQVA 1YYJA 2XL8A 4JEBA 5AGFA 1CGOA 3M4CA 3VRCA 3IQ6A 5JUAA 1GQAA 2XL6A 1QPUA 2XLMA 1S05A 2XLOA 2XLVA 2XM4A 1M6TA 3HNIA 2J8WA 4IB4A 3ZQVA 2XLEA 1E86A 2YKZA 5JSLA 5B3IA 1E85A 3ZQYA 3ZTZA 3NMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZC A;  2YLD A;  256B A;  4IAR A;  3QVY A;  3TOM A;  3HNJ A;  1E83 A;  3M4B A;  4JEA A;  1RCP A;  1A7V A;  3U8P A;  2YLI A;  3HNL A;  2XLW A;  1LM3 B;  5JT4 A;  3NMI A;  1E84 A;  4CIP A;  2YL0 A;  1CGN A;  3HNK A;  3M79 A;  4CJG A;  4CDA A;  4IAQ A;  3ZWI A;  2J9B A;  1NBB A;  2YL1 A;  1APC A;  3FOO A;  3FOP A;  1CPQ A;  2XLH A;  5JLI A;  2XLD A;  4EIY A;  5JS5 A;  3DE8 A;  3C63 A;  4WGZ A;  4ER9 A;  4L6R A;  4JKV A;  3ZTM A;  5JVE A;  3C62 A;  2YL7 A;  3IQ5 A;  4NC3 A;  3L1M A;  2YL3 A;  4ULV A;  2XM0 A;  1QQ3 A;  1CPR A;  2YLG A;  1YZA A;  1BBH A;  4JE9 A;  3TOL A;  4U9D A;  4N4W A;  4CDY A;  3QVZ A;  2BC5 A;  1EKY A;  3M15 A;  4CJO A;  2QLA A;  4CX9 A;  2CCY A;  1JAF A;  4U9E A;  4CDV A;  1YYX A;  3NMJ A;  4WGY A;  4N6H A;  5JP7 A;  3DE9 A;  3QW0 A;  5JRA A;  4D4X A;  3QW1 A;  4D4N A;  1MQV A;  1YYJ A;  2XL8 A;  4JEB A;  5AGF A;  1CGO A;  3M4C A;  3VRC A;  3IQ6 A;  5JUA A;  1GQA A;  2XL6 A;  1QPU A;  2XLM A;  1S05 A;  2XLO A;  2XLV A;  2XM4 A;  1M6T A;  3HNI A;  2J8W A;  4IB4 A;  3ZQV A;  2XLE A;  1E86 A;  2YKZ A;  5JSL A;  5B3I A;  1E85 A;  3ZQY A;  3ZTZ A;  3NMK A; 
#chains in the Genus database with same CATH topology
 2YLD A;  3EPV A;  3HLZ A;  4LLE A;  2R7Q A;  4OIR F;  5A6K A;  3EG9 A;  1ZU5 A;  1EA8 A;  3EFO B;  2C04 A;  3GEH A;  3DKA A;  3GOD A;  3HKK A;  1A41 A;  3C18 A;  3LAY A;  3LS1 A;  1D1C A;  4IAR A;  3U3B A;  1WOL A;  4AK9 A;  1Z6A A;  4A4A A;  4C7O B;  3TJ5 A;  2E87 A;  1H9G A;  4JCZ A;  4XPW A;  4PFP A;  4JEA A;  5BQH A;  1HMD A;  3DWW A;  4U5H A;  3U8P A;  3UMI A;  3S90 A;  3HNL A;  2W4B A;  2XLW A;  2F22 A;  2ZPA A;  1NFO A;  5JT4 A;  4C7O A;  4JCH A;  4CS8 A;  2LK4 A;  2X51 A;  3RIP A;  1ORY A;  1FTS A;  2MWQ A;  1HW2 A;  2PF4 E;  1B68 A;  2Y3D A;  2QUP A;  4BJT A;  1MMG A;  3ZWI A;  4J7Y A;  3UR3 C;  4AE4 A;  4Q5S F;  4C3D A;  1XZQ A;  1AUE A;  2DGJ A;  1BR1 A;  2A6E F;  4PR9 A;  1TR2 A;  4JW1 A;  3K1I C;  4LDQ A;  1APC A;  3FOO A;  4IJJ A;  3MFN A;  4MQ9 F;  3FOP A;  5AC4 A;  5L0H A;  4KNV A;  2Y69 C;  3L0I A;  1C17 M;  4AX2 A;  2OEX A;  2HJ3 A;  1CPQ A;  2AVK A;  2OJQ A;  1NG1 A;  5GPG B;  3DE8 A;  1ZHX A;  1LKX A;  4ER9 A;  3OWT A;  4EBB A;  4JJF A;  4JKV A;  4NQF A;  2GA0 A;  2CNW D;  5D91 A;  3KKB A;  2L81 A;  4NY3 A;  4QI2 A;  5KYN A;  4MND A;  3L1M A;  1LI5 A;  4LER A;  4N6C A;  5DQZ A;  4G7H F;  2J9U A;  4R32 A;  2HMQ A;  5KYU A;  4BJ6 C;  4C3E A;  1D1B A;  1S7Z A;  1OCC C;  1QQ3 A;  4BJ5 A;  1ZHZ A;  2VCA A;  1PV3 A;  4O6N A;  4FAP B;  2CDQ A;  3S27 A;  4Q4Z F;  1XWJ A;  2D5R B;  5B3S C;  5BUO A;  2PBE A;  4JE9 A;  1QKR A;  2XL4 A;  1HE1 A;  4CS7 A;  5D92 A;  1TFK B;  3U2L A;  5KYY B;  1QLE C;  1ORS C;  3GEE A;  2Y39 A;  2VH3 A;  2R7W A;  3QVZ A;  3MLG A;  2J7P A;  2EIM C;  2BC5 A;  5T3T A;  3SEO A;  5DS5 A;  1QSP A;  3I4U A;  2P7V A;  4CBE A;  4PFO A;  4CX9 A;  5F5F A;  5K0I A;  3FXH A;  3LES A;  2CCY A;  1VLT A;  1M56 C;  3T9O A;  5B1B C;  1WGW A;  4O79 A;  1T6Q A;  2CYD A;  4MS2 A;  4ONS A;  2VC9 A;  1Z63 A;  3US6 A;  3VM6 A;  1K05 A;  1ST6 A;  4DJ9 A;  3KYJ A;  3DJN B;  3V5Y A;  1LIH A;  4NTF A;  4RDA A;  3B29 A;  3UGP A;  2EIK C;  2VCC A;  3LNM B;  5FZT A;  3FVY A;  1RMV A;  1JR8 A;  2A0U A;  5KYW B;  3PDM P;  3MBG A;  4D4X A;  2NPU A;  1V55 C;  1O3U A;  4LLC A;  3KYI A;  3NYJ A;  1I4Y A;  4HE8 D;  1L7C A;  1OR3 A;  1MND A;  2DYS C;  2LIG A;  3EH2 A;  2XRH A;  4MVZ A;  4N06 A;  4MW3 A;  1BR4 A;  1JPJ A;  4QDL A;  3NDB B;  3LLI A;  3ZC4 A;  2OOC A;  4I3M A;  4E18 A;  2XLM A;  3B9Q A;  1OXB A;  3AG4 C;  2R7O A;  1VYK A;  4IB4 A;  5COM A;  1KTM A;  3G4X A;  1E86 A;  3AQB A;  3CZ6 A;  2P0N A;  4PJN A;  2L6F A;  2LD6 A;  3LUT B;  4MVU A;  2UUH A;  2WB7 A;  3FDQ A;  1CGM E;  1E85 A;  4I1O B;  3SZR A;  3S29 A;  4YL3 A;  3KL4 A;  3NMK A;  2XS8 A;  4HEA J;  4BEM J;  1LE2 A;  256B A;  2H7O A;  4IWB A;  3ZDL A;  1O5H A;  5FCL A;  2V3C C;  1GS9 A;  4AL1 A;  4OD5 A;  3CEX A;  2A6H F;  3RF3 A;  2EPM X;  2QNL A;  1E2X A;  3K33 A;  1Y4C A;  2YZS A;  1T01 A;  5IY5 C;  1OW8 A;  3G50 A;  3M4B A;  4MVR A;  2L6G A;  2KQ9 A;  5DLJ A;  4DRH B;  4XWJ A;  2GDC A;  2O9X A;  2IXP A;  4WAB A;  3U5S A;  5CI9 A;  3MX3 A;  3J06 A;  4I44 A;  1YJG A;  3PMR A;  1V4A A;  3FMS A;  2WL8 A;  2R25 A;  3RKO F;  5L0C A;  3EG9 B;  4E7S A;  1DOV A;  3HNK A;  3AQC A;  3NKE A;  3DMD A;  3UMK A;  1YA9 A;  2IM8 A;  4B6I A;  1HMO A;  3SXZ A;  3OA1 A;  4XEF A;  1W2W A;  2KSF A;  2L6H A;  4MVO A;  2EPO A;  1NBB A;  4CS9 A;  1OCZ C;  1IW7 F;  1JRA A;  2KK1 A;  3F47 A;  5T3W A;  3AG3 C;  2KYH A;  1NSG B;  2YL1 A;  4MVS A;  5E3C A;  3TD7 A;  5COF A;  4EBK A;  5AGF A;  4EWC A;  4DBQ A;  3S84 A;  2AWY A;  2VCB A;  1A0B A;  3NYM A;  1WN0 A;  3JSE O;  2FGY A;  1OQC A;  3VAY A;  3U2M A;  4PK4 A;  2XLH A;  5JLI A;  1Q0F A;  1ZHT A;  3NG1 A;  2P61 A;  1NFN A;  5JS5 A;  4XQ1 A;  1Q0M A;  1V54 C;  2HSB A;  4XEK A;  1D0Y A;  4DRJ B;  4DOZ A;  3AGU A;  2XXA A;  4YT8 A;  4J7T A;  1WAS A;  4JC7 A;  2KNH A;  4P6I C;  4W8P A;  2J46 A;  3RFY A;  3VYW A;  4AE4 B;  3ABL C;  5T1D B;  2OEV A;  2B0H A;  4XLP F;  1I4Z A;  2EIL C;  2YQY A;  3L8J A;  4NC3 A;  3O39 A;  4Z9I A;  2CNW A;  2A68 F;  2KGO A;  4CSA C;  2KJG A;  1MNE A;  3JSZ A;  5KYX A;  2XM0 A;  1YAR O;  2EPN A;  2LCH A;  1A7D A;  3S9O A;  3SXK A;  1CPR A;  3U0C A;  1GM5 A;  3DI5 A;  2YLG A;  3RVY A;  2YEV A;  5F5H A;  4JTD B;  4JTA B;  2EIJ C;  4XPX A;  5F28 E;  2GWW A;  1AVO B;  3JZ0 A;  1JPN A;  4MTG A;  1L3P A;  4U9D A;  3I5Q A;  4PJL A;  2IOQ A;  3IQC A;  4OIO F;  1LS4 A;  2OU6 A;  2J0X A;  1EKY A;  5EGY A;  3NKD A;  4CJO A;  3TJ6 A;  2PX3 A;  1FAP B;  5KYU B;  4ZLC A;  1SR2 A;  4X0R A;  2J9W A;  3IEE A;  4MTO A;  4CDV A;  5L3V A;  1NZE A;  1RKE B;  2GAQ A;  2QY9 A;  3NMJ A;  2P1A A;  4E7Z A;  1T6I A;  3HJC A;  4LDR A;  4WGY A;  3GEI A;  3QZC A;  1SF8 A;  4Q7C A;  4ULW A;  3C8G A;  3ZSU A;  2PX0 A;  4FWV A;  3AJM A;  1Q0K A;  4YJW A;  2UUI A;  1TWG A;  3ABM C;  3WAQ A;  3EHN A;  3ZIB A;  2R7V A;  1RKE A;  1SZI A;  1VMA A;  4DVZ A;  4XPY A;  5CIV A;  1FNT c;  2R7S A;  1TQG A;  4YT4 A;  2AP3 A;  4QI0 A;  3TK0 A;  5JUA A;  4Z9H A;  3R7C A;  4ZLD A;  1HW1 A;  1QPU A;  2HFI A;  1S05 A;  1G5Z A;  1C03 A;  2XLO A;  3UMH A;  1WWP A;  2H8A A;  2AWC A;  2J8W A;  1H7I A;  2XLE A;  4KBL A;  2LFD A;  3ASN C;  4I1M A;  3ZQV A;  3ITF A;  3Q7L A;  1YVI A;  2G3V A;  3IQT A;  3S0X A;  1VTM P;  3BEH A;  2Q00 A;  3H65 A;  4NTA A;  2HS5 A;  1PD1 A;  4PJJ A;  3ZTZ A;  1MMD A;  3C8G D;  2HMZ A;  3JRM O;  3KH2 A;  4AL0 A;  2M4E A;  5CI8 A;  3ASO C;  2QE9 A;  2WVQ A;  3HTK C;  3QMK A;  3SXM A;  3WG7 C;  3L34 A;  3RH3 A;  5DS4 A;  1D0X A;  1AEP A;  5HV9 A;  4DXW A;  1VYI A;  3U8V A;  3SYN A;  2FFH A;  4CS9 C;  1F1M A;  4H54 A;  5L0J A;  2FAP B;  3IPM O;  4GYT A;  2PFD A;  3UGO A;  1RCP A;  1H6G A;  3LJB A;  3AOU A;  1LVK A;  2KW3 C;  1A7V A;  2YHS A;  4XTK A;  3W8I A;  5EHH A;  1YA7 O;  1IZM A;  3EHM A;  2ICW G;  3W4Y A;  1J8Y F;  3I5P A;  1N1C A;  1R4T A;  4CIP A;  2HUJ A;  2MHR A;  5DQT A;  1CGN A;  1MMN A;  3M79 A;  4JVS A;  2V26 A;  4U5E E;  4CJG A;  2AU5 A;  3RQF A;  1U89 A;  4CDA A;  2Z15 A;  3E9V A;  3EJN A;  4IAQ A;  2J9B A;  2HKV A;  4G0H A;  1TWA A;  1MMA A;  3DZA A;  2YWA A;  4EUK B;  2Q9C A;  3JT1 A;  4U5C E;  4K0D A;  3SP1 A;  1OR2 A;  2C03 A;  2A69 F;  3PCV A;  2EPL X;  1FMV A;  2L7A A;  2OG2 A;  2ZXR A;  3U9M A;  2R9R B;  2D4U A;  1ZHY A;  2JD3 A;  2R7R A;  4GEH A;  4K1O A;  2XLD A;  4EIY A;  1ZW3 A;  2XSE A;  3Q6N A;  4MTF A;  2CW0 F;  3ECS A;  2Q4F A;  3F46 A;  1Q0G A;  1T9K A;  2J9V A;  5A69 A;  2LP4 A;  3N2Z B;  2WVN A;  4FES A;  1TKN A;  4L6R A;  4MVQ A;  1JOG A;  3MYF A;  2X0C A;  3CSK A;  3ZTM A;  4E0I A;  4JZA A;  2IYL D;  3C62 A;  1RXQ A;  1YAU O;  2YL7 A;  1SMY F;  4NTB A;  1VK5 A;  3GM3 A;  1RJ9 A;  2I15 A;  2YL3 A;  2JPU A;  4ULV A;  3K66 A;  1QZX A;  1G4W R;  2NSG A;  2DI3 A;  2WZF A;  4IGG A;  4MVM A;  4P9T A;  3X1O A;  1SYQ A;  5DS6 A;  2XXA B;  2HSQ A;  1YZA A;  4E0H A;  1T6U A;  3T6J A;  4FX5 A;  3GWN A;  1C02 A;  2ASR A;  1DOW A;  2PP4 A;  3EH1 A;  4O6M A;  1LPE A;  1FMW A;  3TOL A;  1NU9 C;  3JYY A;  4N4W A;  1FR0 A;  4CDY A;  3GM1 A;  1I5N A;  2NUP A;  5KYW A;  3V5X A;  2LQG A;  3EGX A;  2OCC C;  3O6X A;  1EI7 A;  3BRJ A;  3T6B A;  5L3Q A;  3PHF 2;  5KYX B;  1ZW2 A;  2Q3T A;  2CGE A;  4IAO A;  3DM5 A;  3AG1 C;  1RKC A;  3DXJ F;  3RYL A;  2I8B A;  1U6H A;  1VOM A;  4XEV A;  2LSE A;  1D0Z A;  1NLX A;  4BPM A;  4CSA A;  1ZYR F;  2EIN C;  3TQO A;  4PJM A;  4UDV A;  1WAT A;  1BDJ B;  1YYX A;  3DJU B;  2NUT A;  3O10 A;  2ZXP A;  2IXM A;  3KPH A;  4N6H A;  5JP7 A;  4YL1 A;  2J0W A;  3K1I A;  4E17 A;  2TMV P;  3DE9 A;  1K40 A;  1LE4 A;  2BE5 F;  3CAX A;  4JJG A;  1V74 B;  1H9T A;  2OJE D;  1TWH A;  2R7X A;  4U5F E;  3U9J A;  3MYI A;  3LEV A;  4EKW A;  5A6B A;  1PCX A;  4RD9 A;  1J8M F;  1MQV A;  4MW8 A;  1WTY A;  2R05 A;  4K7B A;  1YYJ A;  2OQM A;  1CGO A;  5L0F A;  3IQ6 A;  3ZVR A;  3EFO A;  1Z7Q c;  3UNG C;  5AC5 A;  1GQA A;  2XL6 A;  2WZL A;  2DYR C;  2IBF A;  4M63 A;  1OW7 A;  3FHD A;  3HNI A;  3K1H A;  1TFO B;  2HV6 A;  3C8G B;  2R03 A;  5JSL A;  1G4U S;  4BEJ A;  4CS8 C;  3AGT A;  3KMI A;  4NCQ A;  1U0B B;  3EZI A;  1XZP A;  3G4Z A;  3GM2 A;  3IHU A;  2IXN A;  4H4K C;  5B1A C;  3RQE A;  3B71 A;  4O6Y A;  3ZQY A;  4BG0 A;  1GGQ A;  4BJ6 A;  1OW6 A;  1TWC A;  1YZC A;  2H7V C;  2NSF A;  3AG2 C;  2QTV A;  3FAJ A;  3RW0 A;  5L0D A;  4YWQ A;  2YRF A;  2DB4 A;  2RSE B;  4ANJ A;  3LEO A;  5A6B D;  1G8X A;  5E3A A;  3SXY A;  4P9F A;  3QVY A;  3EGD B;  4JRZ A;  3W2V A;  1ORJ A;  2IXO A;  3TOM A;  3HNJ A;  3X2Q C;  1E83 A;  1K04 A;  4KNW A;  4G78 A;  1Q0D A;  3Q6M A;  4U5D E;  4JUR I;  4RBN A;  3N24 A;  3V7O A;  2Y3G A;  2YLI A;  4EHP A;  4J30 B;  1LM3 B;  3NYL A;  3NMI A;  4C3B A;  3EGD A;  2W9Y A;  4WJ0 A;  1E84 A;  3B0P A;  3E70 C;  2YL0 A;  1UFB A;  1M57 C;  2L9J A;  3L8I A;  2G62 A;  2XS1 A;  4J32 B;  3M1C B;  3GWL A;  2R7T A;  4OD4 A;  3N0T A;  1NU7 D;  4U5B E;  3U3F A;  1ZU4 A;  1UG7 A;  3K7D A;  3C7J A;  3EQL F;  5DVW A;  2ZXO A;  3CQZ A;  3RQG A;  5BQI A;  1ZZP A;  3JRT A;  4YL0 A;  5TJ5 E;  4OIP F;  3WHN A;  1Z5Z A;  4BJ5 C;  2PNO A;  4G7O F;  2EPK X;  1OCR C;  3LNR A;  3B0V C;  2Y3H A;  3T4R A;  2ZXW C;  4YT5 A;  1FFH A;  3A11 A;  3C63 A;  2Q9A A;  4WGZ A;  4O7G A;  4Z9J A;  4YN0 B;  3H2V A;  4YK5 A;  3Q7G A;  1EQ1 A;  3K6B A;  4BJ1 A;  2J45 A;  2HV7 A;  2VB6 A;  4LAC B;  5JVE A;  3JCU Q;  4EBJ A;  3FAP B;  5KYY A;  3W8H A;  1VB5 A;  3IQ5 A;  5A6J A;  4LDK A;  1OXK A;  2H7B A;  1KU2 A;  4F4B A;  5E2Q A;  2LFF A;  1R5I D;  1BR2 A;  2ZD9 A;  3C8Z A;  3JYH A;  2BL2 A;  4CIH A;  2HZ8 A;  4G7Z F;  1LI7 A;  3S28 A;  2YVK A;  4W8K A;  4KC9 A;  1OCO C;  2J7P D;  3DAG A;  1BBH A;  2ETS A;  3EZH A;  5E33 A;  2R7U A;  5COG A;  2Q9B A;  4OIN F;  2GFH A;  2VAS A;  3LS0 A;  2OKU A;  3VF0 A;  2G3K A;  2R02 A;  1PD0 A;  2WZG A;  3M15 A;  2Y3B A;  1RJ9 B;  4OIQ F;  3W2W A;  1T5O A;  2QLA A;  3WOD F;  5HSW A;  3ZG1 A;  1D1A A;  1M2O A;  1VLS A;  1JAF A;  5A6A A;  2Q7R A;  1Z3I X;  1YLM A;  4XLN F;  3POV A;  1YDI A;  2A0B A;  1LS1 A;  3R2P A;  4U9E A;  2JX0 A;  3ATP A;  1ZHW A;  2KC3 A;  5L0G A;  1OKK A;  2A1D D;  2W45 A;  1M2V B;  3DD7 A;  3OEO A;  1O87 A;  2NUP B;  3QW0 A;  1Y6D A;  3RVZ A;  3EGX B;  5JRA A;  3QTH A;  4DRI B;  4JTC B;  4DBR A;  2B0J A;  3QW1 A;  1KNY A;  1Z23 A;  1BZ4 A;  2NG1 A;  4IRU A;  4PAC A;  4D4N A;  5EK0 A;  3TUL A;  2XL8 A;  4JEB A;  3A9C A;  2P6V A;  1M2V A;  3M4C A;  1QVX A;  3VRC A;  2RD9 A;  3NRH A;  4KI2 A;  5BQG A;  2NUT B;  4JIO A;  2XM4 A;  2XLV A;  3B0U X;  4HFK B;  1FFT C;  2WVO A;  3JTL O;  2W4M A;  3H2U A;  4DVY P;  1M6T A;  3ABK C;  1ZVZ A;  1HY5 A;  3T6G B;  2YKZ A;  3DM9 B;  2M64 A;  1JMW A;  2HJM A;  4A2N B;  5B3I A;  1OKK D;  1A7E A;  2MYS A;  3GAN A;  3LLK A;  3V5Z A;  3DAF A;  4HFF B;  5L0I A;  1HE9 A;  3SNH A;  3GOR A;  4U5G A;  3O55 A;  4YT2 A;  4GQH A; 
#chains in the Genus database with same CATH homology
 1YZC A;  2YLD A;  256B A;  4IAR A;  3QVY A;  3TOM A;  3HNJ A;  1E83 A;  3M4B A;  4JEA A;  1RCP A;  1A7V A;  3U8P A;  2YLI A;  3HNL A;  2XLW A;  1LM3 B;  5JT4 A;  3NMI A;  1E84 A;  4CIP A;  2YL0 A;  1CGN A;  3HNK A;  3M79 A;  4CJG A;  4CDA A;  4IAQ A;  3ZWI A;  2J9B A;  1NBB A;  2YL1 A;  1APC A;  3FOO A;  3FOP A;  1CPQ A;  2XLH A;  5JLI A;  2XLD A;  4EIY A;  5JS5 A;  3DE8 A;  3C63 A;  4WGZ A;  4ER9 A;  4L6R A;  4JKV A;  3ZTM A;  5JVE A;  3C62 A;  2YL7 A;  3IQ5 A;  4NC3 A;  3L1M A;  2YL3 A;  4ULV A;  2XM0 A;  1QQ3 A;  1CPR A;  2YLG A;  1YZA A;  1BBH A;  4JE9 A;  3TOL A;  4U9D A;  4N4W A;  4CDY A;  3QVZ A;  2BC5 A;  1EKY A;  3M15 A;  4CJO A;  2QLA A;  4CX9 A;  2CCY A;  1JAF A;  4U9E A;  4CDV A;  1YYX A;  3NMJ A;  4WGY A;  4N6H A;  5JP7 A;  3DE9 A;  3QW0 A;  5JRA A;  4D4X A;  3QW1 A;  4D4N A;  1MQV A;  1YYJ A;  2XL8 A;  4JEB A;  5AGF A;  1CGO A;  3M4C A;  3VRC A;  3IQ6 A;  5JUA A;  1GQA A;  2XL6 A;  1QPU A;  2XLM A;  1S05 A;  2XLO A;  2XLV A;  2XM4 A;  1M6T A;  3HNI A;  2J8W A;  4IB4 A;  3ZQV A;  2XLE A;  1E86 A;  2YKZ A;  5JSL A;  5B3I A;  1E85 A;  3ZQY A;  3ZTZ A;  3NMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...