1MQVA

Crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
b'ATDVIAQRKAILKQMGEATKPIAAMLKGEAKWDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIFEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
source organism Rhodopseudomonas palustris
publication title Structural Features of Cytochrome c' Folding Intermediates Revealed by Fluorescence Energy-Transfer Kinetics
pubmed doi rcsb
total genus 47
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1mqvA00
4WGYA 3ZWIA 5JSLA 1YYXA 256BA 2XM4A 5JVEA 3DE8A 4N6HA 3HNLA 4U9DA 1RCPA 1GQAA 2XLWA 4IARA 3C63A 4ER9A 2XLOA 2YLDA 4CJGA 4CJOA 2QLAA 4JEAA 2XLEA 4D4XA 3NMJA 3TOLA 3VRCA 4IAQA 2YLIA 4D4NA 4ULVA 3IQ6A 3TOMA 2YL7A 3HNKA 2XLMA 4N4WA 4CX9A 4CDYA 1M6TA 4L6RA 4JKVA 1NBBA 1LM3B 1A7VA 3QVZA 4CDAA 1E86A 1E85A 1CPRA 3U8PA 3QW0A 4CIPA 1E84A 3QVYA 3HNJA 1E83A 2J9BA 5B3IA 1CGNA 1BBHA 5JP7A 5JLIA 2YL0A 3DE9A 1YZAA 1YYJA 2BC5A 2XL8A 3IQ5A 1JAFA 3ZTZA 3QW1A 2XLVA 1QQ3A 2YLGA 5JUAA 3FOPA 2YL1A 4NC3A 1CGOA 1S05A 4JE9A 4EIYA 2XLHA 3L1MA 2XLDA 1EKYA 5AGFA 5JT4A 1YZCA 3ZQYA 3ZQVA 3NMIA 4CDVA 5JRAA 2XM0A 2J8WA 3M4BA 3M79A 3ZTMA 3C62A 1QPUA 3M15A 3NMKA 2YL3A 4IB4A 4U9EA 5JS5A 3HNIA 4WGZA 1MQVA 2XL6A 3FOOA 1CPQA 3M4CA 4JEBA 2YKZA 1APCA 2CCYA
chains in the Genus database with same CATH superfamily
1OW8A 3RH3A 1T6QA 1QKRA 2IXMA 3I5QA 3KPHA 4OINF 1O3UA 4H54A 5FCLA 1KNYA 5L3VA 3U0CA 3GWLA 3CAXA 4JCZA 3H2UA 3WAQA 2DYSC 3JYYA 1WASA 1WGWA 2AU5A 2VASA 5DVWA 2R7XA 4CS8A 4W8KA 1HMDA 3L34A 3K66A 4ZLCA 1GS9A 1N1CA 2NUPA 3MLGA 4IARA 3QTHA 5KYWB 2JX0A 3UGOA 4DXWA 4ER9A 3RF3A 4ULWA 4Z9IA 4U5BE 2J0XA 3AG4C 1VLSA 3U8VA 3G4ZA 4JJFA 4Z9HA 3UMIA 3QMKA 4PJJA 2CW0F 3JCUQ 4O6YA 3W2VA 4ZLDA 2WZFA 4Q7CA 1R5ID 4IAQA 3U3BA 2Y69C 4YJWA 1OR2A 3GEIA 2J9UA 1M2OA 4OIOF 2HV7A 1TFOB 4FESA 3JRTA 4NTAA 3IQ6A 4JTAB 2W4MA 1H9TA 2AP3A 2VCBA 3FAPB 4I3MA 2EILC 3HNKA 2XLMA 1QVXA 4ONSA 4N4WA 3T6GB 1M6TA 2P6VA 4JKVA 4DJ9A 3W8HA 1NBBA 1LM3B 3ABLC 3SXKA 3Q6NA 2R7WA 3KYIA 2UUIA 3AQCA 5IY5C 2Q7RA 1Q0KA 1QZXA 4ANJA 2ZPAA 1C02A 5DS6A 1E85A 3LLKA 3BEHA 1UFBA 1U89A 4XQ1A 4E0IA 4W8PA 1SMYF 3V5YA 5DS4A 3QVYA 3EH2A 5BUOA 1RMVA 4KBLA 4MVUA 4XPWA 2J9BA 3CEXA 2CYDA 5JP7A 5EHHA 3EFOB 2P7VA 1YZAA 1YYJA 4EBKA 3IQ5A 4DVYP 3F46A 1HW1A 1JAFA 2IYLD 2L6GA 3A11A 4LERA 4RBNA 3QW1A 1WN0A 2XLVA 4MVQA 3U5SA 2YLGA 3GWNA 4MVSA 3ZIBA 4E0HA 4O6NA 2R7TA 3DXJF 3RW0A 3EH1A 3RQGA 2LCHA 2OJED 4JE9A 4NTBA 2HKVA 3DWWA 2EPMX 3L1MA 1PV3A 1V55C 3ZVRA 5DQTA 2Y3GA 3LLIA 2A69F 1FFHA 3C8GA 5AC4A 2BL2A 2J7PD 1A41A 1EKYA 1TR2A 3UMKA 5A6AA 5JLIA 4YWQA 1J8YF 1YZCA 5COFA 5COGA 5T1DB 3EFOA 4BJ5C 2TMVP 4NTFA 2H8AA 3V7OA 3WHNA 1C03A 2W4BA 4DRHB 3ZQVA 1D1BA 4AE4B 5JRAA 3TQOA 3ECSA 3G50A 4AX2A 3M4BA 3X2QC 3JT1A 2QUPA 3V5ZA 4LLEA 1PCXA 5L0CA 1TKNA 1ZU5A 5KYYB 2J45A 1OQCA 3B71A 1EI7A 1FFTC 1Q0GA 3DJUB 3EPVA 3R2PA 1KTMA 1G8XA 2C04A 4Q5SF 1WATA 2UUHA 3OEOA 4CSAA 5F28E 4IB4A 4K1OA 2A68F 2CDQA 1Z63A 4MW3A 3ASOC 2PNOA 1Q0MA 3S29A 4M63A 2GFHA 2R9RB 4YT8A 4BG0A 2YRFA 1BR1A 3EZIA 4G7HF 1T01A 2YKZA 3EHMA 1VOMA 1I4ZA 5F5FA 1LPEA 1LKXA 2R03A 1V54C 2EPLX 4AE4A 2V3CC 2G62A 4GYTA 2A6HF 3KKBA 1G5ZA 4GEHA 5JSLA 5B1AC 4K7BA 3NYLA 1YYXA 2HMQA 2KSFA 4PK4A 4OIRF 3WODF 3SYNA 1IW7F 2XM4A 1JOGA 1NZEA 1G4US 1V4AA 5KYYA 1XZPA 3TULA 5L0JA 4LDKA 1TWHA 2D4UA 2LFDA 3MYFA 1RCPA 2J9WA 5L0HA 3T9OA 2LFFA 1GQAA 1NU7D 4DOZA 4NCQA 1ZVZA 3AG1C 2WVNA 2Y3BA 4BEJA 1F1MA 4MW8A 3K1IC 1ORJA 3HJCA 2HFIA 3AQBA 1YLMA 1H9GA 1ZHYA 4LLCA 2A0UA 4U5HA 2HJ3A 4E7SA 5A6BA 5D91A 4EBJA 4PJNA 4CJGA 4EHPA 3FDQA 4JEAA 5KYUA 2NUTB 4IWBA 1VYKA 3VRCA 2I8BA 3DAFA 4CS9C 4PR9A 2DYRC 1Y6DA 2R25A 3AG2C 3BRJA 3FHDA 2KC3A 2PP4A 1O5HA 3UNGC 4BJ5A 1HE1A 3B29A 4MVRA 5A69A 3S0XA 2GAQA 1B68A 4D4NA 2LP4A 3NRHA 2L81A 3O10A 3VYWA 2Q00A 2Q9AA 3CQZA 4CX9A 4XLPF 3DM5A 2NPUA 4L6RA 1FMWA 5KYXA 1HE9A 4J7TA 2KYHA 1OW7A 1U6HA 1ZZPA 3O39A 2R7RA 1VYIA 1E86A 1CPRA 5D92A 5B3SC 1WWPA 3ITFA 4C3BA 3U8PA 3Q7GA 3QW0A 3QZCA 4CIPA 2R05A 2Q4FA 2DI3A 4XEVA 3DAGA 2NUTA 5COMA 2ZXWC 1E83A 4UDVA 2ZXPA 3LNRA 3FAJA 4XLNF 1AEPA 1NG1A 1T5OA 3Q6MA 4G78A 4JTCB 4CS9A 4HEAJ 5BQIA 5A6BD 3HLZA 1LIHA 4MVMA 4J7YA 2KK1A 2Y39A 5L0GA 1TFKB 2OQMA 2OKUA 4I1MA 4E7ZA 3T6BA 5JUAA 3F47A 5T3TA 4FWVA 1SZIA 3JRMO 3L8IA 3FVYA 3NG1A 2Y3HA 4PACA 3K1IA 3MBGA 2GDCA 2P61A 3LS1A 4MTFA 3SNHA 4C3DA 4YL1A 3H65A 1AUEA 1WOLA 1MMAA 2HSQA 3S90A 2FGYA 1TWCA 5AGFA 1D0ZA 4YN0B 5B1BC 3FXHA 1PD1A 4IAOA 4YT5A 1MNDA 1LVKA 4DVZA 3JSEO 3M1CB 4CSAC 1ORSC 4P9FA 4A4AA 3ZQYA 1ZHZA 2VH3A 2M64A 1PD0A 2OEXA 3N24A 3NMIA 2QTVA 1VMAA 3ATPA 4JW1A 4MQ9F 4XTKA 5AC5A 3EHNA 4G0HA 4PFOA 3VF0A 2VCCA 1IZMA 1MMDA 2J0WA 3ABKC 4MVOA 3ASNC 2LQGA 1FR0A 4JZAA 3C62A 3JSZA 4FX5A 5L3QA 3W4YA 4AL1A 2R7UA 3M15A 5L0FA 3POVA 1G4WR 1QSPA 1OR3A 4HFFB 2OU6A 4BEMJ 1JPJA 1Y4CA 4XWJA 4CS8C 3ZC4A 3LESA 2XXAB 1YA7O 3UGPA 3KL4A 1FAPB 1Q0DA 3HNIA 2NUPB 4MNDA 4XEFA 3C8ZA 3IQCA 2A0BA 2IOQA 2XL6A 3FOOA 2L6FA 4JEBA 1CGME 4PJMA 4QI2A 1APCA 3KMIA 3DJNB 4C3EA 1OKKA 4O79A 2P1AA 4KNVA 4R32A 4WGYA 3ZWIA 2EIKC 2MWQA 2XL4A 2KNHA 2R7QA 4IRUA 4RD9A 2VCAA 2ETSA 3DE8A 3SP1A 4O7GA 5A6KA 3KYJA 3PMRA 4P9TA 4EWCA 1VLTA 2Z15A 2ZD9A 2J9VA 1BR2A 3B9QA 1L7CA 5GPGB 2WZGA 4OD4A 1OXBA 4I44A 2XSEA 2XLWA 3T6JA 1NFNA 1VK5A 2L7AA 2M4EA 2YWAA 3GEHA 3C63A 3EGDA 2C03A 4U5DE 4BJTA 2ICWG 2YLDA 2ASRA 1BR4A 1MNEA 2QLAA 4CJOA 3CSKA 1W2WA 1GGQA 1T6UA 3NMJA 1AVOB 2J7PA 3IEEA 3PCVA 4KNWA 4XPXA 3TOLA 1VB5A 3VAYA 2YQYA 4CBEA 3RIPA 4HFKB 2YLIA 4H4KC 1Z7Qc 2A6EF 1RJ9B 1NFOA 4ULVA 2EPKX 1A0BA 1U0BB 3TOMA 4CIHA 2OEVA 1OKKD 2YL7A 4NQFA 2WL8A 3B0PA 5HSWA 1ZW2A 1M2VB 4CDYA 4WABA 1RKCA 3DZAA 4MVZA 1FTSA 1D0XA 1KU2A 5CI9A 4N06A 1OCZC 2LK4A 3US6A 5KYWA 2VB6A 1ZHXA 1OCOC 3QVZA 4G7ZF 2R02A 3ZSUA 2YHSA 3TK0A 3E9VA 3LUTB 1ST6A 4WJ0A 4P6IC 3SXMA 2WVQA 1E84A 3EZHA 5L0DA 3C8GB 3ZDLA 3O6XA 4U5CE 1D1AA 1YAUO 4OIQF 1MMGA 4IGGA 5B3IA 4LACB 4QI0A 5DQZA 1L3PA 1CGNA 2KJGA 4U5GA 2YL0A 4C7OA 3W8IA 3DE9A 1RJ9A 2BC5A 2QNLA 1SF8A 2XL8A 1NSGB 2IBFA 5T3WA 5HV9A 4K0DA 1DOWA 2HJMA 3ZTZA 1K05A 1OW6A 2RSEB 2X51A 1M2VA 2ZXOA 4NY3A 1NU9C 4DBRA 1LE4A 2B0HA 3GEEA 4MTOA 2G3VA 1HW2A 4YT2A 1T9KA 2GWWA 3TJ5A 4JCHA 1S05A 3K33A 1OXKA 3E70C 3GODA 4JJGA 4A2NB 4EIYA 4PFPA 5L0IA 2PF4E 3Q7LA 3K1HA 4KC9A 1H6GA 5F5HA 4HE8D 2EPNA 4XPYA 2JD3A 2AVKA 2XLDA 3W2WA 4KI2A 5E3AA 3AGUA 2W9YA 3U2LA 4AK9A 1RXQA 3RYLA 3B0UX 2Q3TA 5BQGA 5JT4A 1BZ4A 2HSBA 2H7VC 4C7OB 3LAYA 2NG1A 3U9JA 3DD7A 3EJNA 3UR3C 2J46A 3MX3A 3SZRA 1JR8A 2WVOA 1Z5ZA 4LDQA 3DM9B 2J8WA 1M57C 3N0TA 4BJ1A 1UG7A 3LEVA 2NSFA 3ZTMA 4CS7A 2L9JA 1E2XA 1MMNA 3LS0A 4MTGA 1OCCC 1QPUA 3X1OA 2HS5A 2LD6A 3S28A 3FMSA 4QDLA 3NMKA 3OA1A 4YK5A 1T6IA 1Q0FA 3T4RA 3RKOF 2CNWA 4DRIB 4DRJB 1R4TA 2LSEA 5E3CA 1ORYA 1O87A 3PHF2 1JMWA 3NYMA 3EG9A 1CPQA 2Y3DA 2PX0A 3GM2A 1D1CA 4N6CA 4Q4ZF 2B0JA 3U3FA 2EINC 2D5RB 2DB4A 3U2MA 1V74B 5CIVA 4JRZA 1YARO 3IQTA 2DGJA 2EIMC 1FNTc 3L8JA 3HKKA 4OIPF 256BA 1M56C 2PFDA 1JRAA 2RD9A 3G4XA 3L0IA 5JVEA 2EIJC 2OG2A 3NKEA 1YJGA 3LJBA 1DOVA 4N6HA 2OOCA 1LS4A 2H7OA 3EQLF 3HNLA 4U9DA 5KYXB 3S27A 4YT4A 3SXYA 2PX3A 5EK0A 4I1OB 2YZSA 2BE5F 4JURI 2XLOA 3EG9B 5FZTA 2XS8A 3GANA 2G3KA 4E18A 1K04A 3UMHA 4E17A 3KH2A 4IJJA 2F22A 3R7CA 3AOUA 1TQGA 2OCCC 2CNWD 2EPOA 2XS1A 4J32B 2XLEA 4JTDB 1I5NA 3DI5A 4D4XA 3PDMP 1HY5A 3NKDA 4JIOA 3SEOA 2H7BA 1EQ1A 4BJ6A 1VTMP 1K40A 2KQ9A 3TJ6A 1ZYRF 5DLJA 2XRHA 4AL0A 3DKAA 5KYNA 3HTKC 1SR2A 2FAPB 3K7DA 4OD5A 5BQHA 2WB7A 2AWYA 2QY9A 3MFNA 5K0IA 3I5PA 4JC7A 2KGOA 3IHUA 1A7VA 2Q9CA 5E2QA 4G7OF 2WZLA 3OWTA 2AWCA 3RQFA 4CDAA 3DMDA 1YA9A 4F4BA 3JYHA 1J8MF 1TWAA 2E87A 3RVZA 2I15A 3H2VA 4B6IA 2HMZA 5KYUB 2JPUA 3HNJA 2YEVA 3VM6A 4YL0A 2HUJA 1LE2A 2O9XA 2R7OA 4LDRA 4U5FE 1BBHA 2IXNA 4BJ6C 1LI7A 2X0CA 2MYSA 2A1DD 2HZ8A 1C17M 2GA0A 3K6BA 3AG3C 4JVSA 5CI8A 2W45A 4J30B 4XEKA 3SXZA 5DS5A 1XWJA 3LNMB 1ZHTA 3IPMO 3ZG1A 1QQ3A 4BPMA 1TWGA 3GORA 1YVIA 3FOPA 3C18A 3N2ZB 4MS2A 4DBQA 1Z23A 1Z3IX 2YL1A 3U9MA 3ABMC 4NC3A 1CGOA 4O6MA 3GM3A 2MHRA 1QLEC 2XLHA 3CZ6A 3J06A 2NSGA 3LEOA 3AGTA 1HMOA 1D0YA 2PBEA 1JPNA 4RDAA 5E33A 3GM1A 1EA8A 1RKEA 3EGXA 1NLXA 2XXAA 1A7EA 3O55A 3RQEA 4U5EE 3A9CA 2OJQA 4X0RA 1FMVA 2IM8A 2QE9A 1H7IA 3C8GD 1SYQA 4YL3A 4FAPB 5TJ5E 3NYJA 2Q9BA 3B0VC 2KW3C 4GQHA 3TD7A 4CDVA 2P0NA 3NDBB 3RFYA 2R7SA 2XM0A 2IXPA 1GM5A 2CGEA 3AJMA 3M79A 4Z9JA 1LS1A 1ZU4A 2ZXRA 3C7JA 4EUKB 1A7DA 1YDIA 1I4YA 2L6HA 3JZ0A 2HV6A 1ZW3A 1XZQA 4EBBA 1S7ZA 2LIGA 2VC9A 2YL3A 4U9EA 1RKEB 3EGXB 3MYIA 5JS5A 2IXOA 4PJLA 4WGZA 3S84A 1LI5A 3V5XA 1BDJB 2YVKA 1MQVA 3EGDB 1Z6AA 3JTLO 3WG7C 4EKWA 1ZHWA 3M4CA 5EGYA 1OCRC 3RVYA 2V26A 3S9OA 3I4UA 5A6JA 2R7VA 1WTYA 2FFHA 2CCYA
chains in the Genus database with same CATH topology
4WGYA 3ZWIA 5JSLA 1YYXA 256BA 2XM4A 5JVEA 3DE8A 4N6HA 3HNLA 4U9DA 1RCPA 1GQAA 2XLWA 4IARA 3C63A 4ER9A 2XLOA 2YLDA 4CJGA 4CJOA 2QLAA 4JEAA 2XLEA 4D4XA 3NMJA 3TOLA 3VRCA 4IAQA 2YLIA 4D4NA 4ULVA 3IQ6A 3TOMA 2YL7A 3HNKA 2XLMA 4N4WA 4CX9A 4CDYA 1M6TA 4L6RA 4JKVA 1NBBA 1LM3B 1A7VA 3QVZA 4CDAA 1E86A 1E85A 1CPRA 3U8PA 3QW0A 4CIPA 1E84A 3QVYA 3HNJA 1E83A 2J9BA 5B3IA 1CGNA 1BBHA 5JP7A 5JLIA 2YL0A 3DE9A 1YZAA 1YYJA 2BC5A 2XL8A 3IQ5A 1JAFA 3ZTZA 3QW1A 2XLVA 1QQ3A 2YLGA 5JUAA 3FOPA 2YL1A 4NC3A 1CGOA 1S05A 4JE9A 4EIYA 2XLHA 3L1MA 2XLDA 1EKYA 5AGFA 5JT4A 1YZCA 3ZQYA 3ZQVA 3NMIA 4CDVA 5JRAA 2XM0A 2J8WA 3M4BA 3M79A 3ZTMA 3C62A 1QPUA 3M15A 3NMKA 2YL3A 4IB4A 4U9EA 5JS5A 3HNIA 4WGZA 1MQVA 2XL6A 3FOOA 1CPQA 3M4CA 4JEBA 2YKZA 1APCA 2CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGY A;  3ZWI A;  5JSL A;  1YYX A;  256B A;  2XM4 A;  5JVE A;  3DE8 A;  4N6H A;  3HNL A;  4U9D A;  1RCP A;  1GQA A;  2XLW A;  4IAR A;  3C63 A;  4ER9 A;  2XLO A;  2YLD A;  4CJG A;  4CJO A;  2QLA A;  4JEA A;  2XLE A;  4D4X A;  3NMJ A;  3TOL A;  3VRC A;  4IAQ A;  2YLI A;  4D4N A;  4ULV A;  3IQ6 A;  3TOM A;  2YL7 A;  3HNK A;  2XLM A;  4N4W A;  4CX9 A;  4CDY A;  1M6T A;  4L6R A;  4JKV A;  1NBB A;  1LM3 B;  1A7V A;  3QVZ A;  4CDA A;  1E86 A;  1E85 A;  1CPR A;  3U8P A;  3QW0 A;  4CIP A;  1E84 A;  3QVY A;  3HNJ A;  1E83 A;  2J9B A;  5B3I A;  1CGN A;  1BBH A;  5JP7 A;  5JLI A;  2YL0 A;  3DE9 A;  1YZA A;  1YYJ A;  2BC5 A;  2XL8 A;  3IQ5 A;  1JAF A;  3ZTZ A;  3QW1 A;  2XLV A;  1QQ3 A;  2YLG A;  5JUA A;  3FOP A;  2YL1 A;  4NC3 A;  1CGO A;  1S05 A;  4JE9 A;  4EIY A;  2XLH A;  3L1M A;  2XLD A;  1EKY A;  5AGF A;  5JT4 A;  1YZC A;  3ZQY A;  3ZQV A;  3NMI A;  4CDV A;  5JRA A;  2XM0 A;  2J8W A;  3M4B A;  3M79 A;  3ZTM A;  3C62 A;  1QPU A;  3M15 A;  3NMK A;  2YL3 A;  4IB4 A;  4U9E A;  5JS5 A;  3HNI A;  4WGZ A;  1MQV A;  2XL6 A;  3FOO A;  1CPQ A;  3M4C A;  4JEB A;  2YKZ A;  1APC A;  2CCY A; 
#chains in the Genus database with same CATH topology
 1OW8 A;  3RH3 A;  1T6Q A;  1QKR A;  2IXM A;  3I5Q A;  3KPH A;  4OIN F;  1O3U A;  4H54 A;  5FCL A;  1KNY A;  5L3V A;  3U0C A;  3GWL A;  3CAX A;  4JCZ A;  3H2U A;  3WAQ A;  2DYS C;  3JYY A;  1WAS A;  1WGW A;  2AU5 A;  2VAS A;  5DVW A;  2R7X A;  4CS8 A;  4W8K A;  1HMD A;  3L34 A;  3K66 A;  4ZLC A;  1GS9 A;  1N1C A;  2NUP A;  3MLG A;  4IAR A;  3QTH A;  5KYW B;  2JX0 A;  3UGO A;  4DXW A;  4ER9 A;  3RF3 A;  4ULW A;  4Z9I A;  4U5B E;  2J0X A;  3AG4 C;  1VLS A;  3U8V A;  3G4Z A;  4JJF A;  4Z9H A;  3UMI A;  3QMK A;  4PJJ A;  2CW0 F;  3JCU Q;  4O6Y A;  3W2V A;  4ZLD A;  2WZF A;  4Q7C A;  1R5I D;  4IAQ A;  3U3B A;  2Y69 C;  4YJW A;  1OR2 A;  3GEI A;  2J9U A;  1M2O A;  4OIO F;  2HV7 A;  1TFO B;  4FES A;  3JRT A;  4NTA A;  3IQ6 A;  4JTA B;  2W4M A;  1H9T A;  2AP3 A;  2VCB A;  3FAP B;  4I3M A;  2EIL C;  3HNK A;  2XLM A;  1QVX A;  4ONS A;  4N4W A;  3T6G B;  1M6T A;  2P6V A;  4JKV A;  4DJ9 A;  3W8H A;  1NBB A;  1LM3 B;  3ABL C;  3SXK A;  3Q6N A;  2R7W A;  3KYI A;  2UUI A;  3AQC A;  5IY5 C;  2Q7R A;  1Q0K A;  1QZX A;  4ANJ A;  2ZPA A;  1C02 A;  5DS6 A;  1E85 A;  3LLK A;  3BEH A;  1UFB A;  1U89 A;  4XQ1 A;  4E0I A;  4W8P A;  1SMY F;  3V5Y A;  5DS4 A;  3QVY A;  3EH2 A;  5BUO A;  1RMV A;  4KBL A;  4MVU A;  4XPW A;  2J9B A;  3CEX A;  2CYD A;  5JP7 A;  5EHH A;  3EFO B;  2P7V A;  1YZA A;  1YYJ A;  4EBK A;  3IQ5 A;  4DVY P;  3F46 A;  1HW1 A;  1JAF A;  2IYL D;  2L6G A;  3A11 A;  4LER A;  4RBN A;  3QW1 A;  1WN0 A;  2XLV A;  4MVQ A;  3U5S A;  2YLG A;  3GWN A;  4MVS A;  3ZIB A;  4E0H A;  4O6N A;  2R7T A;  3DXJ F;  3RW0 A;  3EH1 A;  3RQG A;  2LCH A;  2OJE D;  4JE9 A;  4NTB A;  2HKV A;  3DWW A;  2EPM X;  3L1M A;  1PV3 A;  1V55 C;  3ZVR A;  5DQT A;  2Y3G A;  3LLI A;  2A69 F;  1FFH A;  3C8G A;  5AC4 A;  2BL2 A;  2J7P D;  1A41 A;  1EKY A;  1TR2 A;  3UMK A;  5A6A A;  5JLI A;  4YWQ A;  1J8Y F;  1YZC A;  5COF A;  5COG A;  5T1D B;  3EFO A;  4BJ5 C;  2TMV P;  4NTF A;  2H8A A;  3V7O A;  3WHN A;  1C03 A;  2W4B A;  4DRH B;  3ZQV A;  1D1B A;  4AE4 B;  5JRA A;  3TQO A;  3ECS A;  3G50 A;  4AX2 A;  3M4B A;  3X2Q C;  3JT1 A;  2QUP A;  3V5Z A;  4LLE A;  1PCX A;  5L0C A;  1TKN A;  1ZU5 A;  5KYY B;  2J45 A;  1OQC A;  3B71 A;  1EI7 A;  1FFT C;  1Q0G A;  3DJU B;  3EPV A;  3R2P A;  1KTM A;  1G8X A;  2C04 A;  4Q5S F;  1WAT A;  2UUH A;  3OEO A;  4CSA A;  5F28 E;  4IB4 A;  4K1O A;  2A68 F;  2CDQ A;  1Z63 A;  4MW3 A;  3ASO C;  2PNO A;  1Q0M A;  3S29 A;  4M63 A;  2GFH A;  2R9R B;  4YT8 A;  4BG0 A;  2YRF A;  1BR1 A;  3EZI A;  4G7H F;  1T01 A;  2YKZ A;  3EHM A;  1VOM A;  1I4Z A;  5F5F A;  1LPE A;  1LKX A;  2R03 A;  1V54 C;  2EPL X;  4AE4 A;  2V3C C;  2G62 A;  4GYT A;  2A6H F;  3KKB A;  1G5Z A;  4GEH A;  5JSL A;  5B1A C;  4K7B A;  3NYL A;  1YYX A;  2HMQ A;  2KSF A;  4PK4 A;  4OIR F;  3WOD F;  3SYN A;  1IW7 F;  2XM4 A;  1JOG A;  1NZE A;  1G4U S;  1V4A A;  5KYY A;  1XZP A;  3TUL A;  5L0J A;  4LDK A;  1TWH A;  2D4U A;  2LFD A;  3MYF A;  1RCP A;  2J9W A;  5L0H A;  3T9O A;  2LFF A;  1GQA A;  1NU7 D;  4DOZ A;  4NCQ A;  1ZVZ A;  3AG1 C;  2WVN A;  2Y3B A;  4BEJ A;  1F1M A;  4MW8 A;  3K1I C;  1ORJ A;  3HJC A;  2HFI A;  3AQB A;  1YLM A;  1H9G A;  1ZHY A;  4LLC A;  2A0U A;  4U5H A;  2HJ3 A;  4E7S A;  5A6B A;  5D91 A;  4EBJ A;  4PJN A;  4CJG A;  4EHP A;  3FDQ A;  4JEA A;  5KYU A;  2NUT B;  4IWB A;  1VYK A;  3VRC A;  2I8B A;  3DAF A;  4CS9 C;  4PR9 A;  2DYR C;  1Y6D A;  2R25 A;  3AG2 C;  3BRJ A;  3FHD A;  2KC3 A;  2PP4 A;  1O5H A;  3UNG C;  4BJ5 A;  1HE1 A;  3B29 A;  4MVR A;  5A69 A;  3S0X A;  2GAQ A;  1B68 A;  4D4N A;  2LP4 A;  3NRH A;  2L81 A;  3O10 A;  3VYW A;  2Q00 A;  2Q9A A;  3CQZ A;  4CX9 A;  4XLP F;  3DM5 A;  2NPU A;  4L6R A;  1FMW A;  5KYX A;  1HE9 A;  4J7T A;  2KYH A;  1OW7 A;  1U6H A;  1ZZP A;  3O39 A;  2R7R A;  1VYI A;  1E86 A;  1CPR A;  5D92 A;  5B3S C;  1WWP A;  3ITF A;  4C3B A;  3U8P A;  3Q7G A;  3QW0 A;  3QZC A;  4CIP A;  2R05 A;  2Q4F A;  2DI3 A;  4XEV A;  3DAG A;  2NUT A;  5COM A;  2ZXW C;  1E83 A;  4UDV A;  2ZXP A;  3LNR A;  3FAJ A;  4XLN F;  1AEP A;  1NG1 A;  1T5O A;  3Q6M A;  4G78 A;  4JTC B;  4CS9 A;  4HEA J;  5BQI A;  5A6B D;  3HLZ A;  1LIH A;  4MVM A;  4J7Y A;  2KK1 A;  2Y39 A;  5L0G A;  1TFK B;  2OQM A;  2OKU A;  4I1M A;  4E7Z A;  3T6B A;  5JUA A;  3F47 A;  5T3T A;  4FWV A;  1SZI A;  3JRM O;  3L8I A;  3FVY A;  3NG1 A;  2Y3H A;  4PAC A;  3K1I A;  3MBG A;  2GDC A;  2P61 A;  3LS1 A;  4MTF A;  3SNH A;  4C3D A;  4YL1 A;  3H65 A;  1AUE A;  1WOL A;  1MMA A;  2HSQ A;  3S90 A;  2FGY A;  1TWC A;  5AGF A;  1D0Z A;  4YN0 B;  5B1B C;  3FXH A;  1PD1 A;  4IAO A;  4YT5 A;  1MND A;  1LVK A;  4DVZ A;  3JSE O;  3M1C B;  4CSA C;  1ORS C;  4P9F A;  4A4A A;  3ZQY A;  1ZHZ A;  2VH3 A;  2M64 A;  1PD0 A;  2OEX A;  3N24 A;  3NMI A;  2QTV A;  1VMA A;  3ATP A;  4JW1 A;  4MQ9 F;  4XTK A;  5AC5 A;  3EHN A;  4G0H A;  4PFO A;  3VF0 A;  2VCC A;  1IZM A;  1MMD A;  2J0W A;  3ABK C;  4MVO A;  3ASN C;  2LQG A;  1FR0 A;  4JZA A;  3C62 A;  3JSZ A;  4FX5 A;  5L3Q A;  3W4Y A;  4AL1 A;  2R7U A;  3M15 A;  5L0F A;  3POV A;  1G4W R;  1QSP A;  1OR3 A;  4HFF B;  2OU6 A;  4BEM J;  1JPJ A;  1Y4C A;  4XWJ A;  4CS8 C;  3ZC4 A;  3LES A;  2XXA B;  1YA7 O;  3UGP A;  3KL4 A;  1FAP B;  1Q0D A;  3HNI A;  2NUP B;  4MND A;  4XEF A;  3C8Z A;  3IQC A;  2A0B A;  2IOQ A;  2XL6 A;  3FOO A;  2L6F A;  4JEB A;  1CGM E;  4PJM A;  4QI2 A;  1APC A;  3KMI A;  3DJN B;  4C3E A;  1OKK A;  4O79 A;  2P1A A;  4KNV A;  4R32 A;  4WGY A;  3ZWI A;  2EIK C;  2MWQ A;  2XL4 A;  2KNH A;  2R7Q A;  4IRU A;  4RD9 A;  2VCA A;  2ETS A;  3DE8 A;  3SP1 A;  4O7G A;  5A6K A;  3KYJ A;  3PMR A;  4P9T A;  4EWC A;  1VLT A;  2Z15 A;  2ZD9 A;  2J9V A;  1BR2 A;  3B9Q A;  1L7C A;  5GPG B;  2WZG A;  4OD4 A;  1OXB A;  4I44 A;  2XSE A;  2XLW A;  3T6J A;  1NFN A;  1VK5 A;  2L7A A;  2M4E A;  2YWA A;  3GEH A;  3C63 A;  3EGD A;  2C03 A;  4U5D E;  4BJT A;  2ICW G;  2YLD A;  2ASR A;  1BR4 A;  1MNE A;  2QLA A;  4CJO A;  3CSK A;  1W2W A;  1GGQ A;  1T6U A;  3NMJ A;  1AVO B;  2J7P A;  3IEE A;  3PCV A;  4KNW A;  4XPX A;  3TOL A;  1VB5 A;  3VAY A;  2YQY A;  4CBE A;  3RIP A;  4HFK B;  2YLI A;  4H4K C;  1Z7Q c;  2A6E F;  1RJ9 B;  1NFO A;  4ULV A;  2EPK X;  1A0B A;  1U0B B;  3TOM A;  4CIH A;  2OEV A;  1OKK D;  2YL7 A;  4NQF A;  2WL8 A;  3B0P A;  5HSW A;  1ZW2 A;  1M2V B;  4CDY A;  4WAB A;  1RKC A;  3DZA A;  4MVZ A;  1FTS A;  1D0X A;  1KU2 A;  5CI9 A;  4N06 A;  1OCZ C;  2LK4 A;  3US6 A;  5KYW A;  2VB6 A;  1ZHX A;  1OCO C;  3QVZ A;  4G7Z F;  2R02 A;  3ZSU A;  2YHS A;  3TK0 A;  3E9V A;  3LUT B;  1ST6 A;  4WJ0 A;  4P6I C;  3SXM A;  2WVQ A;  1E84 A;  3EZH A;  5L0D A;  3C8G B;  3ZDL A;  3O6X A;  4U5C E;  1D1A A;  1YAU O;  4OIQ F;  1MMG A;  4IGG A;  5B3I A;  4LAC B;  4QI0 A;  5DQZ A;  1L3P A;  1CGN A;  2KJG A;  4U5G A;  2YL0 A;  4C7O A;  3W8I A;  3DE9 A;  1RJ9 A;  2BC5 A;  2QNL A;  1SF8 A;  2XL8 A;  1NSG B;  2IBF A;  5T3W A;  5HV9 A;  4K0D A;  1DOW A;  2HJM A;  3ZTZ A;  1K05 A;  1OW6 A;  2RSE B;  2X51 A;  1M2V A;  2ZXO A;  4NY3 A;  1NU9 C;  4DBR A;  1LE4 A;  2B0H A;  3GEE A;  4MTO A;  2G3V A;  1HW2 A;  4YT2 A;  1T9K A;  2GWW A;  3TJ5 A;  4JCH A;  1S05 A;  3K33 A;  1OXK A;  3E70 C;  3GOD A;  4JJG A;  4A2N B;  4EIY A;  4PFP A;  5L0I A;  2PF4 E;  3Q7L A;  3K1H A;  4KC9 A;  1H6G A;  5F5H A;  4HE8 D;  2EPN A;  4XPY A;  2JD3 A;  2AVK A;  2XLD A;  3W2W A;  4KI2 A;  5E3A A;  3AGU A;  2W9Y A;  3U2L A;  4AK9 A;  1RXQ A;  3RYL A;  3B0U X;  2Q3T A;  5BQG A;  5JT4 A;  1BZ4 A;  2HSB A;  2H7V C;  4C7O B;  3LAY A;  2NG1 A;  3U9J A;  3DD7 A;  3EJN A;  3UR3 C;  2J46 A;  3MX3 A;  3SZR A;  1JR8 A;  2WVO A;  1Z5Z A;  4LDQ A;  3DM9 B;  2J8W A;  1M57 C;  3N0T A;  4BJ1 A;  1UG7 A;  3LEV A;  2NSF A;  3ZTM A;  4CS7 A;  2L9J A;  1E2X A;  1MMN A;  3LS0 A;  4MTG A;  1OCC C;  1QPU A;  3X1O A;  2HS5 A;  2LD6 A;  3S28 A;  3FMS A;  4QDL A;  3NMK A;  3OA1 A;  4YK5 A;  1T6I A;  1Q0F A;  3T4R A;  3RKO F;  2CNW A;  4DRI B;  4DRJ B;  1R4T A;  2LSE A;  5E3C A;  1ORY A;  1O87 A;  3PHF 2;  1JMW A;  3NYM A;  3EG9 A;  1CPQ A;  2Y3D A;  2PX0 A;  3GM2 A;  1D1C A;  4N6C A;  4Q4Z F;  2B0J A;  3U3F A;  2EIN C;  2D5R B;  2DB4 A;  3U2M A;  1V74 B;  5CIV A;  4JRZ A;  1YAR O;  3IQT A;  2DGJ A;  2EIM C;  1FNT c;  3L8J A;  3HKK A;  4OIP F;  256B A;  1M56 C;  2PFD A;  1JRA A;  2RD9 A;  3G4X A;  3L0I A;  5JVE A;  2EIJ C;  2OG2 A;  3NKE A;  1YJG A;  3LJB A;  1DOV A;  4N6H A;  2OOC A;  1LS4 A;  2H7O A;  3EQL F;  3HNL A;  4U9D A;  5KYX B;  3S27 A;  4YT4 A;  3SXY A;  2PX3 A;  5EK0 A;  4I1O B;  2YZS A;  2BE5 F;  4JUR I;  2XLO A;  3EG9 B;  5FZT A;  2XS8 A;  3GAN A;  2G3K A;  4E18 A;  1K04 A;  3UMH A;  4E17 A;  3KH2 A;  4IJJ A;  2F22 A;  3R7C A;  3AOU A;  1TQG A;  2OCC C;  2CNW D;  2EPO A;  2XS1 A;  4J32 B;  2XLE A;  4JTD B;  1I5N A;  3DI5 A;  4D4X A;  3PDM P;  1HY5 A;  3NKD A;  4JIO A;  3SEO A;  2H7B A;  1EQ1 A;  4BJ6 A;  1VTM P;  1K40 A;  2KQ9 A;  3TJ6 A;  1ZYR F;  5DLJ A;  2XRH A;  4AL0 A;  3DKA A;  5KYN A;  3HTK C;  1SR2 A;  2FAP B;  3K7D A;  4OD5 A;  5BQH A;  2WB7 A;  2AWY A;  2QY9 A;  3MFN A;  5K0I A;  3I5P A;  4JC7 A;  2KGO A;  3IHU A;  1A7V A;  2Q9C A;  5E2Q A;  4G7O F;  2WZL A;  3OWT A;  2AWC A;  3RQF A;  4CDA A;  3DMD A;  1YA9 A;  4F4B A;  3JYH A;  1J8M F;  1TWA A;  2E87 A;  3RVZ A;  2I15 A;  3H2V A;  4B6I A;  2HMZ A;  5KYU B;  2JPU A;  3HNJ A;  2YEV A;  3VM6 A;  4YL0 A;  2HUJ A;  1LE2 A;  2O9X A;  2R7O A;  4LDR A;  4U5F E;  1BBH A;  2IXN A;  4BJ6 C;  1LI7 A;  2X0C A;  2MYS A;  2A1D D;  2HZ8 A;  1C17 M;  2GA0 A;  3K6B A;  3AG3 C;  4JVS A;  5CI8 A;  2W45 A;  4J30 B;  4XEK A;  3SXZ A;  5DS5 A;  1XWJ A;  3LNM B;  1ZHT A;  3IPM O;  3ZG1 A;  1QQ3 A;  4BPM A;  1TWG A;  3GOR A;  1YVI A;  3FOP A;  3C18 A;  3N2Z B;  4MS2 A;  4DBQ A;  1Z23 A;  1Z3I X;  2YL1 A;  3U9M A;  3ABM C;  4NC3 A;  1CGO A;  4O6M A;  3GM3 A;  2MHR A;  1QLE C;  2XLH A;  3CZ6 A;  3J06 A;  2NSG A;  3LEO A;  3AGT A;  1HMO A;  1D0Y A;  2PBE A;  1JPN A;  4RDA A;  5E33 A;  3GM1 A;  1EA8 A;  1RKE A;  3EGX A;  1NLX A;  2XXA A;  1A7E A;  3O55 A;  3RQE A;  4U5E E;  3A9C A;  2OJQ A;  4X0R A;  1FMV A;  2IM8 A;  2QE9 A;  1H7I A;  3C8G D;  1SYQ A;  4YL3 A;  4FAP B;  5TJ5 E;  3NYJ A;  2Q9B A;  3B0V C;  2KW3 C;  4GQH A;  3TD7 A;  4CDV A;  2P0N A;  3NDB B;  3RFY A;  2R7S A;  2XM0 A;  2IXP A;  1GM5 A;  2CGE A;  3AJM A;  3M79 A;  4Z9J A;  1LS1 A;  1ZU4 A;  2ZXR A;  3C7J A;  4EUK B;  1A7D A;  1YDI A;  1I4Y A;  2L6H A;  3JZ0 A;  2HV6 A;  1ZW3 A;  1XZQ A;  4EBB A;  1S7Z A;  2LIG A;  2VC9 A;  2YL3 A;  4U9E A;  1RKE B;  3EGX B;  3MYI A;  5JS5 A;  2IXO A;  4PJL A;  4WGZ A;  3S84 A;  1LI5 A;  3V5X A;  1BDJ B;  2YVK A;  1MQV A;  3EGD B;  1Z6A A;  3JTL O;  3WG7 C;  4EKW A;  1ZHW A;  3M4C A;  5EGY A;  1OCR C;  3RVY A;  2V26 A;  3S9O A;  3I4U A;  5A6J A;  2R7V A;  1WTY A;  2FFH A;  2CCY A; 
#chains in the Genus database with same CATH homology
 4WGY A;  3ZWI A;  5JSL A;  1YYX A;  256B A;  2XM4 A;  5JVE A;  3DE8 A;  4N6H A;  3HNL A;  4U9D A;  1RCP A;  1GQA A;  2XLW A;  4IAR A;  3C63 A;  4ER9 A;  2XLO A;  2YLD A;  4CJG A;  4CJO A;  2QLA A;  4JEA A;  2XLE A;  4D4X A;  3NMJ A;  3TOL A;  3VRC A;  4IAQ A;  2YLI A;  4D4N A;  4ULV A;  3IQ6 A;  3TOM A;  2YL7 A;  3HNK A;  2XLM A;  4N4W A;  4CX9 A;  4CDY A;  1M6T A;  4L6R A;  4JKV A;  1NBB A;  1LM3 B;  1A7V A;  3QVZ A;  4CDA A;  1E86 A;  1E85 A;  1CPR A;  3U8P A;  3QW0 A;  4CIP A;  1E84 A;  3QVY A;  3HNJ A;  1E83 A;  2J9B A;  5B3I A;  1CGN A;  1BBH A;  5JP7 A;  5JLI A;  2YL0 A;  3DE9 A;  1YZA A;  1YYJ A;  2BC5 A;  2XL8 A;  3IQ5 A;  1JAF A;  3ZTZ A;  3QW1 A;  2XLV A;  1QQ3 A;  2YLG A;  5JUA A;  3FOP A;  2YL1 A;  4NC3 A;  1CGO A;  1S05 A;  4JE9 A;  4EIY A;  2XLH A;  3L1M A;  2XLD A;  1EKY A;  5AGF A;  5JT4 A;  1YZC A;  3ZQY A;  3ZQV A;  3NMI A;  4CDV A;  5JRA A;  2XM0 A;  2J8W A;  3M4B A;  3M79 A;  3ZTM A;  3C62 A;  1QPU A;  3M15 A;  3NMK A;  2YL3 A;  4IB4 A;  4U9E A;  5JS5 A;  3HNI A;  4WGZ A;  1MQV A;  2XL6 A;  3FOO A;  1CPQ A;  3M4C A;  4JEB A;  2YKZ A;  1APC A;  2CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...