1MQVA

Crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
ATDVIAQRKAILKQMGEATKPIAAMLKGEAKWDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIFEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Structural Features of Cytochrome c' Folding Intermediates Revealed by Fluorescence Energy-Transfer Kinetics
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
total genus 47
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1mqvA00
1YYJA 1YZAA 1APCA 2XLMA 2XL6A 2XM4A 2XLDA 3NMIA 3QVYA 3ZTZA 3IQ6A 4JEBA 3QVZA 5JSLA 3QW0A 4JKVA 2YL0A 1M6TA 1MQVA 2YLIA 3M79A 2XLHA 3L1MA 1BBHA 4CJGA 4CDAA 4CJOA 4D4NA 2BC5A 4WGYA 1YYXA 3HNLA 1E85A 1LM3B 3FOOA 1S05A 4NC3A 4JEAA 2YKZA 2XM0A 3HNJA 3C63A 5JS5A 1EKYA 4WGZA 3DE9A 4IARA 3ZQVA 4CIPA 4ER9A 2XLEA 3TOMA 2XLOA 5JRAA 1JAFA 1CGOA 3NMJA 3DE8A 3M15A 5B3IA 3U8PA 5JVEA 2YL3A 2YLDA 4IAQA 4IB4A 5AGFA 4ULVA 2YL1A 1QPUA 3TOLA 3ZQYA 4CX9A 3M4BA 2YLGA 3VRCA 1YZCA 2XLWA 1GQAA 3QW1A 1E86A 2CCYA 1E84A 2XLVA 4EIYA 4CDVA 3HNIA 4D4XA 3C62A 3ZTMA 5JT4A 4N6HA 4L6RA 5JP7A 2QLAA 3NMKA 1CPQA 3ZWIA 1QQ3A 2J9BA 1CGNA 1NBBA 4U9EA 4CDYA 5JLIA 3FOPA 3IQ5A 4JE9A 5JUAA 1CPRA 2J8WA 2XL8A 4U9DA 3HNKA 4N4WA 256BA 2YL7A 1E83A 1A7VA 3M4CA 1RCPA
chains in the Genus database with same CATH superfamily
4KBLA 3EGXA 1RKEB 2J7PD 3K1IA 3NKEA 1SYQA 4O7GA 2WVQA 3Q6MA 1NFOA 4CS7A 1H6GA 2C03A 4WJ0A 2ASRA 4MVSA 3K66A 1LE4A 4XLPF 1OKKD 2YWAA 2XSEA 4XPWA 4JEBA 3QVZA 3GWNA 3QW0A 3FVYA 2DYRC 1RMVA 1Q0GA 2YL0A 5KYXB 1MQVA 1T9KA 3I5PA 5COGA 3M79A 2XLHA 1BBHA 4BJ1A 4CJOA 2J46A 3FAJA 1G4US 2BC5A 4LLCA 4C7OA 1D0ZA 5T3TA 1MNEA 5F5HA 4PJJA 2L6FA 4CS9A 2HS5A 1E85A 2ZXOA 3GM3A 1S05A 2P1AA 1EA8A 5T3WA 1Z63A 2NSFA 1T6IA 1J8YF 2H7VC 3JYYA 1UG7A 1T01A 2Y3GA 4AE4B 3T9OA 1PV3A 1ZZPA 1MMDA 4YL3A 2ETSA 1SF8A 4UDVA 1Y4CA 3ZG1A 1C03A 2CW0F 2EIKC 1OQCA 4GQHA 4WGZA 5FZTA 2OEXA 1K05A 3M1CB 1ZHTA 3ABKC 2OEVA 4YN0B 2VH3A 5IY5C 2YZSA 2AP3A 5L3QA 4A2NB 1U6HA 4CS8C 4JJFA 3AQCA 3JRMO 4BJ5A 2XLEA 2EPNA 4FAPB 4G7OF 3TOMA 3KL4A 1FFHA 2P61A 1LI5A 4DRIB 4EBJA 1DOVA 4JCZA 1T5OA 2NUPB 4BJ6A 1H7IA 1NLXA 3DE8A 4EWCA 1HE1A 1HY5A 3AQBA 4QI0A 2YRFA 3C8GA 3V5XA 4JURI 2PNOA 4ANJA 5BUOA 1WASA 3R7CA 2HMZA 2KGOA 2L6HA 3HKKA 3NYMA 3RH3A 3B9QA 3VF0A 4MTFA 4J30B 2VCCA 4N06A 4XQ1A 4HEAJ 5A6JA 4IJJA 1KNYA 3B0PA 2G62A 5A69A 1GGQA 1D0XA 3M4BA 1XZPA 3SEOA 2YLGA 3VRCA 3SXMA 2YVKA 2GFHA 1GQAA 1FMWA 1L7CA 1V4AA 1KU2A 4OD4A 4PJMA 3U9MA 1WN0A 3DAFA 1BR4A 1D1BA 5DLJA 1E86A 1TWHA 2CGEA 2V3CC 1WWPA 3JRTA 1E84A 2AWYA 2QTVA 1VYKA 2Y69C 3LJBA 3BRJA 3MBGA 3HNIA 3H2UA 4PR9A 2XRHA 3R2PA 2PF4E 3O55A 3S27A 5JT4A 4W8KA 3DD7A 4N6HA 4G7ZF 3JTLO 4EBKA 2QLAA 3TD7A 2HFIA 2DI3A 1ZU4A 2J7PA 4RDAA 1Q0DA 3J06A 4DRJB 4JTDB 3MYIA 3PCVA 1OCCC 4DJ9A 1GM5A 1N1CA 1TR2A 2OJED 4DOZA 1QQ3A 1TFKB 1ZHXA 3KYJA 4MNDA 4MVZA 5KYNA 4E7SA 2F22A 1CGNA 2HV7A 4GEHA 1NBBA 4J7YA 1OKKA 3CQZA 4XTKA 4Z9IA 3SNHA 3RYLA 2ZPAA 2M64A 5JLIA 3POVA 3KMIA 4HFKB 3IEEA 4PACA 3E9VA 2W45A 1G4WR 5D92A 1A41A 3MLGA 5COFA 1HW1A 2LCHA 4FWVA 4DXWA 5DS6A 4KI2A 1RXQA 2WB7A 3S90A 3M4CA 1VLSA 1RCPA 5L0IA 4NTBA 1Z3IX 3AGTA 2WVNA 3L8JA 1APCA 1JR8A 1OW7A 2XL6A 2IXMA 1Q0KA 2XLDA 2XM4A 3NMIA 4J32B 3ZTZA 3ZSUA 3V5ZA 2AVKA 2P6VA 2Z15A 3RQEA 1RKCA 2GDCA 3RFYA 3GEHA 3UGPA 5JSLA 4YWQA 3FXHA 1VK5A 3U9JA 4JKVA 4YL0A 1A0BA 1T6QA 3LS0A 3U2LA 4CJGA 4G7HF 4D4NA 2GA0A 2IXPA 2VB6A 3JCUQ 4P9TA 4MS2A 4AK9A 5KYWB 1BDJB 1LS4A 2HJMA 3TQOA 3U3FA 2CDQA 3FOOA 1ZYRF 3L8IA 3O6XA 4U5FE 1YARO 4NC3A 3GM2A 1I4ZA 1I5NA 1NZEA 3L0IA 2P0NA 1C17M 5CIVA 1M2VB 3F46A 4E18A 3I4UA 5EK0A 3ASOC 2GAQA 3RQGA 2LFFA 4BPMA 1ORSC 2J9VA 3DE9A 2KNHA 3FAPB 3LLIA 4DBQA 4XPYA 4C3BA 3ABMC 2PX0A 2PBEA 4BEMJ 3EG9A 2IM8A 1ZU5A 3B0VC 2FGYA 1HMDA 4CSAC 1VB5A 4O6MA 3AOUA 3W8HA 3RVZA 3EFOB 5B1AC 2A0UA 5JRAA 1JAFA 2FAPB 2LQGA 1D1AA 3EZHA 3NYJA 2Y3DA 3S28A 1CGOA 2HUJA 1Z5ZA 3MX3A 3NMJA 2EINC 1QVXA 5B3IA 3ZC4A 2Q00A 4I3MA 5L0DA 1H9GA 3CAXA 3EGDB 3EH1A 1R4TA 4XEKA 1QZXA 3ZIBA 2J9UA 4BJTA 3V7OA 2CNWD 1PCXA 3K6BA 1ZVZA 1MMNA 2OCCC 5E3AA 3VM6A 3GWLA 2R7SA 1NU7D 4O79A 4DBRA 2YL3A 4YT2A 2R7OA 1A7EA 1U0BB 2XXAB 1G8XA 4BJ5C 1QPUA 3X1OA 3ZQYA 2QY9A 4Q4ZF 1EI7A 1F1MA 3LEVA 3LUTB 4YJWA 4IGGA 4W8PA 2RD9A 1ZHWA 3RIPA 3ZDLA 3FMSA 2C04A 4EKWA 3WHNA 1W2WA 3QW1A 1OCRC 3VAYA 1WOLA 1AEPA 3DJUB 3EPVA 4MVRA 1FFTC 3E70C 4NQFA 3RVYA 3LNMB 4CDVA 2ZXPA 5B3SC 4H4KC 3TULA 3QZCA 1J8MF 3WG7C 2GWWA 3HJCA 3ZTMA 1FTSA 1NU9C 1PD0A 4L6RA 1RJ9A 4JIOA 2KSFA 2XS1A 4ULWA 5KYYA 4B6IA 5KYUA 1I4YA 1LE2A 4O6NA 3ZWIA 1WTYA 3Q7GA 1TQGA 4JC7A 5GPGB 2Q3TA 3EGXB 4I1MA 2I8BA 1TWAA 1Z23A 2J9BA 3GORA 1OW8A 4JW1A 1GS9A 1OCOC 4MVOA 2Q7RA 1AVOB 2X0CA 5EGYA 4CDYA 1Q0MA 3FOPA 4Q7CA 5DQTA 2IXNA 5KYWA 5E33A 1PD1A 3IQTA 5L3VA 5HSWA 3OEOA 3DZAA 2M4EA 4JE9A 3AG1C 2Y3BA 4AL1A 5JUAA 4OIQF 5F28E 4K7BA 2XL8A 4AL0A 1KTMA 2JX0A 3GODA 2HJ3A 4MTOA 1FAPB 1G5ZA 1VYIA 4P6IC 3W2WA 2YL7A 2ZXRA 2R7UA 3U3BA 2R03A 5FCLA 2A0BA 2Q9AA 2R7VA 1QLEC 4LDKA 4MW8A 4C7OB 3PMRA 2MHRA 2W9YA 3QVYA 2EPKX 5CI8A 4IRUA 5L0CA 4CSAA 3N24A 3GM1A 4J7TA 4NY3A 3OA1A 3QTHA 4DVZA 2P7VA 4G78A 4XLNF 4MTGA 3W2VA 5A6BD 5L0JA 2R02A 4N6CA 4XPXA 1O87A 1YLMA 1V54C 3EZIA 4K0DA 1RKEA 4H54A 2G3KA 4WGYA 2HV6A 3KYIA 2JPUA 2R7QA 4BG0A 1LM3B 4AX2A 3JT1A 4GYTA 3A9CA 4NTAA 2PX3A 3ITFA 1HW2A 5BQIA 3JZ0A 2EIJC 2B0JA 3LNRA 2Y3HA 4JEAA 4U5BE 5DQZA 1FMVA 3AJMA 5DS4A 2YKZA 2XM0A 2IXOA 3DMDA 5JS5A 4QDLA 5KYXA 4XEVA 1V74B 4JVSA 4CS8A 2CNWA 1Q0FA 2DGJA 2EILC 3LESA 2V26A 4U5DE 3C8GB 4JTCB 4Z9HA 4KNVA 2OQMA 3CZ6A 3NYLA 4CIPA 4ER9A 2AU5A 2J9WA 3HTKC 5COMA 2KQ9A 1JMWA 3T6GB 3S29A 1YA9A 2A1DD 3I5QA 4MVQA 2VC9A 4JTAB 2LP4A 4HE8D 4AE4A 2XLOA 3WODF 2LK4A 2J45A 2X51A 1K04A 2OKUA 4U5HA 2RSEB 2VASA 4M63A 3M15A 3C8ZA 1OXKA 3U8PA 2R7WA 1T6UA 3ASNC 2Y39A 2KW3C 2LSEA 1WATA 3RKOF 1DOWA 3ZVRA 1D0YA 2R7TA 4A4AA 3UMIA 1NG1A 5TJ5E 4IAQA 1OR3A 4IB4A 4XEFA 4YT8A 5AGFA 3TOLA 3B29A 3AG4C 2LIGA 4WABA 5E3CA 3TJ6A 4CX9A 2NUPA 1TKNA 1ZW3A 4YL1A 2WZLA 5BQGA 2XLWA 3UMHA 2DB4A 1YVIA 3ABLC 2PFDA 4Q5SF 2HKVA 1NFNA 3H65A 3JYHA 3KKBA 3U5SA 2CCYA 1CGME 2A68F 4EUKB 3LAYA 3DJNB 4E17A 1MNDA 3HLZA 4D4XA 2YQYA 3C62A 1XZQA 2L6GA 2QNLA 1R5ID 2OG2A 2LD6A 2H7BA 4RBNA 1ZHYA 2A6HF 2R9RB 4JCHA 4XWJA 4MW3A 2YEVA 2A69F 1M56C 1CPQA 1VTMP 3GEIA 2WL8A 3CSKA 4KNWA 1Z7Qc 4BEJA 2VCAA 4IAOA 4FESA 3EJNA 3B71A 4U9EA 3S9OA 2HSBA 1OR2A 1SR2A 1ZHZA 1FNTc 3IQ5A 4ZLDA 1VMAA 1QSPA 4OD5A 4E7ZA 3AGUA 3EHNA 5A6BA 2HMQA 4NCQA 1CPRA 2EIMC 2UUIA 3N2ZB 3U8VA 1YJGA 5AC5A 4U9DA 3HNKA 3A11A 3FHDA 4PK4A 4N4WA 3DM5A 3JSZA 1BR1A 256BA 4ONSA 4PJNA 3ECSA 4U5GA 3Q7LA 4Z9JA 3L34A 4DRHB 4U5EE 5A6KA 1YYJA 3SZRA 1YAUO 1YZAA 1MMAA 2KYHA 2QUPA 2ZXWC 4K1OA 2IBFA 3SP1A 2XLMA 3SYNA 1BR2A 1A7DA 3DWWA 4LERA 4OIPF 4MQ9F 3IQ6A 3UGOA 2L7AA 3MFNA 1L3PA 3T6BA 1JPJA 3GEEA 2L81A 1YDIA 3FDQA 1B68A 4CIHA 2D4UA 5CI9A 1M6TA 3V5YA 2YLIA 4YT5A 3IQCA 5B1BC 5EHHA 3GANA 3L1MA 4O6YA 4CDAA 3DI5A 5T1DB 4LACB 5DVWA 4X0RA 2Q9BA 1YYXA 3HNLA 1ORJA 3U2MA 2BE5F 1WGWA 3NG1A 4I44A 2QE9A 1LVKA 1H9TA 2XS8A 3EG9B 3RQFA 1SZIA 1BZ4A 1TWGA 1OXBA 2G3VA 3CEXA 1JRAA 2NG1A 2H7OA 4P9FA 1K40A 1ORYA 1TWCA 3F47A 2MYSA 2W4BA 4U5CE 1FR0A 3HNJA 3C63A 1EKYA 2BL2A 3MYFA 4YK5A 5D91A 3U0CA 4PJLA 1HE9A 1LS1A 1JPNA 2DYSC 1LKXA 2IOQA 4I1OB 5L0GA 4QI2A 2HZ8A 3KPHA 2OU6A 2R25A 1O3UA 2VCBA 4IARA 4ZLCA 1VOMA 2UUHA 3LEOA 1JOGA 4LLEA 4IWBA 4R32A 3RF3A 3ZQVA 3K1IC 2FFHA 5E2QA 2XL4A 1LI7A 3N0TA 3G4XA 4E0HA 3UMKA 2H8AA 3QMKA 3S0XA 3UNGC 3ATPA 2WVOA 1LIHA 3UR3C 3W8IA 3DKAA 1M57C 2YHSA 3DXJF 3H2VA 2OOCA 3G4ZA 4KC9A 5AC4A 2NSGA 1M2VA 2PP4A 3W4YA 3C7JA 2WZFA 4OINF 2R7RA 1HMOA 5L0FA 1ST6A 4FX5A 5JVEA 2JD3A 4PFOA 4JJGA 5A6AA 1D1CA 3K33A 4F4BA 3TJ5A 3BEHA 4CS9C 2I15A 3T4RA 3G50A 2YLDA 3SXKA 1LPEA 4ULVA 2YL1A 1TFOB 1V55C 1RJ9B 2L9JA 2W4MA 2J0WA 3EFOA 4NTFA 4OIRF 5KYYB 1MMGA 5KYUB 3DM9B 4JZAA 2NUTA 3PHF2 1E2XA 1IZMA 1YZCA 4PFPA 2IYLD 2D5RB 2NUTB 5K0IA 3EGDA 1AUEA 3EQLF 2EPMX 2E87A 3US6A 4YT4A 1M2OA 2WZGA 1Y6DA 4LDQA 3VYWA 1UFBA 2CYDA 2XLVA 3AG2C 2AWCA 3KH2A 4EIYA 3C8GD 3LS1A 5HV9A 5F5FA 2Q9CA 2XXAA 4MVMA 2ICWG 2R05A 4RD9A 4HFFB 5DS5A 2KJGA 3EH2A 1OCZC 3NRHA 5JP7A 4CBEA 4C3EA 4DVYP 1XWJA 3NMKA 3Q6NA 2EPOA 4JRZA 2MWQA 3OWTA 3SXZA 2B0HA 3RW0A 3T6JA 3IPMO 3LLKA 4BJ6C 2KC3A 2LFDA 3JSEO 3SXYA 4OIOF 1IW7F 2NPUA 2A6EF 3K1HA 3PDMP 1OW6A 3NDBB 1SMYF 4EBBA 3S84A 2ZD9A 1ZW2A 5L0HA 5BQHA 1C02A 3DAGA 1S7ZA 1EQ1A 1O5HA 3O10A 3AG3C 2J0XA 4LDRA 1Z6AA 4E0IA 3B0UX 1U89A 3K7DA 3EHMA 3TK0A 1VLTA 2KK1A 3C18A 4EHPA 2J8WA 3X2QC 2OJQA 1YA7O 3WAQA 3IHUA 2R7XA 4G0HA 1QKRA 2Q4FA 3NKDA 2TMVP 2O9XA 1NSGB 2HSQA 2EPLX 4MVUA 4C3DA 1E83A 1A7VA 3O39A
chains in the Genus database with same CATH topology
1YYJA 1YZAA 1APCA 2XLMA 2XL6A 2XM4A 2XLDA 3NMIA 3QVYA 3ZTZA 3IQ6A 4JEBA 3QVZA 5JSLA 3QW0A 4JKVA 2YL0A 1M6TA 1MQVA 2YLIA 3M79A 2XLHA 3L1MA 1BBHA 4CJGA 4CDAA 4CJOA 4D4NA 2BC5A 4WGYA 1YYXA 3HNLA 1E85A 1LM3B 3FOOA 1S05A 4NC3A 4JEAA 2YKZA 2XM0A 3HNJA 3C63A 5JS5A 1EKYA 4WGZA 3DE9A 4IARA 3ZQVA 4CIPA 4ER9A 2XLEA 3TOMA 2XLOA 5JRAA 1JAFA 1CGOA 3NMJA 3DE8A 3M15A 5B3IA 3U8PA 5JVEA 2YL3A 2YLDA 4IAQA 4IB4A 5AGFA 4ULVA 2YL1A 1QPUA 3TOLA 3ZQYA 4CX9A 3M4BA 2YLGA 3VRCA 1YZCA 2XLWA 1GQAA 3QW1A 1E86A 2CCYA 1E84A 2XLVA 4EIYA 4CDVA 3HNIA 4D4XA 3C62A 3ZTMA 5JT4A 4N6HA 4L6RA 5JP7A 2QLAA 3NMKA 1CPQA 3ZWIA 1QQ3A 2J9BA 1CGNA 1NBBA 4U9EA 4CDYA 5JLIA 3FOPA 3IQ5A 4JE9A 5JUAA 1CPRA 2J8WA 2XL8A 4U9DA 3HNKA 4N4WA 256BA 2YL7A 1E83A 1A7VA 3M4CA 1RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  1YZA A;  1APC A;  2XLM A;  2XL6 A;  2XM4 A;  2XLD A;  3NMI A;  3QVY A;  3ZTZ A;  3IQ6 A;  4JEB A;  3QVZ A;  5JSL A;  3QW0 A;  4JKV A;  2YL0 A;  1M6T A;  1MQV A;  2YLI A;  3M79 A;  2XLH A;  3L1M A;  1BBH A;  4CJG A;  4CDA A;  4CJO A;  4D4N A;  2BC5 A;  4WGY A;  1YYX A;  3HNL A;  1E85 A;  1LM3 B;  3FOO A;  1S05 A;  4NC3 A;  4JEA A;  2YKZ A;  2XM0 A;  3HNJ A;  3C63 A;  5JS5 A;  1EKY A;  4WGZ A;  3DE9 A;  4IAR A;  3ZQV A;  4CIP A;  4ER9 A;  2XLE A;  3TOM A;  2XLO A;  5JRA A;  1JAF A;  1CGO A;  3NMJ A;  3DE8 A;  3M15 A;  5B3I A;  3U8P A;  5JVE A;  2YL3 A;  2YLD A;  4IAQ A;  4IB4 A;  5AGF A;  4ULV A;  2YL1 A;  1QPU A;  3TOL A;  3ZQY A;  4CX9 A;  3M4B A;  2YLG A;  3VRC A;  1YZC A;  2XLW A;  1GQA A;  3QW1 A;  1E86 A;  2CCY A;  1E84 A;  2XLV A;  4EIY A;  4CDV A;  3HNI A;  4D4X A;  3C62 A;  3ZTM A;  5JT4 A;  4N6H A;  4L6R A;  5JP7 A;  2QLA A;  3NMK A;  1CPQ A;  3ZWI A;  1QQ3 A;  2J9B A;  1CGN A;  1NBB A;  4U9E A;  4CDY A;  5JLI A;  3FOP A;  3IQ5 A;  4JE9 A;  5JUA A;  1CPR A;  2J8W A;  2XL8 A;  4U9D A;  3HNK A;  4N4W A;  256B A;  2YL7 A;  1E83 A;  1A7V A;  3M4C A;  1RCP A; 
#chains in the Genus database with same CATH topology
 4KBL A;  3EGX A;  1RKE B;  2J7P D;  3K1I A;  3NKE A;  1SYQ A;  4O7G A;  2WVQ A;  3Q6M A;  1NFO A;  4CS7 A;  1H6G A;  2C03 A;  4WJ0 A;  2ASR A;  4MVS A;  3K66 A;  1LE4 A;  4XLP F;  1OKK D;  2YWA A;  2XSE A;  4XPW A;  4JEB A;  3QVZ A;  3GWN A;  3QW0 A;  3FVY A;  2DYR C;  1RMV A;  1Q0G A;  2YL0 A;  5KYX B;  1MQV A;  1T9K A;  3I5P A;  5COG A;  3M79 A;  2XLH A;  1BBH A;  4BJ1 A;  4CJO A;  2J46 A;  3FAJ A;  1G4U S;  2BC5 A;  4LLC A;  4C7O A;  1D0Z A;  5T3T A;  1MNE A;  5F5H A;  4PJJ A;  2L6F A;  4CS9 A;  2HS5 A;  1E85 A;  2ZXO A;  3GM3 A;  1S05 A;  2P1A A;  1EA8 A;  5T3W A;  1Z63 A;  2NSF A;  1T6I A;  1J8Y F;  2H7V C;  3JYY A;  1UG7 A;  1T01 A;  2Y3G A;  4AE4 B;  3T9O A;  1PV3 A;  1ZZP A;  1MMD A;  4YL3 A;  2ETS A;  1SF8 A;  4UDV A;  1Y4C A;  3ZG1 A;  1C03 A;  2CW0 F;  2EIK C;  1OQC A;  4GQH A;  4WGZ A;  5FZT A;  2OEX A;  1K05 A;  3M1C B;  1ZHT A;  3ABK C;  2OEV A;  4YN0 B;  2VH3 A;  5IY5 C;  2YZS A;  2AP3 A;  5L3Q A;  4A2N B;  1U6H A;  4CS8 C;  4JJF A;  3AQC A;  3JRM O;  4BJ5 A;  2XLE A;  2EPN A;  4FAP B;  4G7O F;  3TOM A;  3KL4 A;  1FFH A;  2P61 A;  1LI5 A;  4DRI B;  4EBJ A;  1DOV A;  4JCZ A;  1T5O A;  2NUP B;  4BJ6 A;  1H7I A;  1NLX A;  3DE8 A;  4EWC A;  1HE1 A;  1HY5 A;  3AQB A;  4QI0 A;  2YRF A;  3C8G A;  3V5X A;  4JUR I;  2PNO A;  4ANJ A;  5BUO A;  1WAS A;  3R7C A;  2HMZ A;  2KGO A;  2L6H A;  3HKK A;  3NYM A;  3RH3 A;  3B9Q A;  3VF0 A;  4MTF A;  4J30 B;  2VCC A;  4N06 A;  4XQ1 A;  4HEA J;  5A6J A;  4IJJ A;  1KNY A;  3B0P A;  2G62 A;  5A69 A;  1GGQ A;  1D0X A;  3M4B A;  1XZP A;  3SEO A;  2YLG A;  3VRC A;  3SXM A;  2YVK A;  2GFH A;  1GQA A;  1FMW A;  1L7C A;  1V4A A;  1KU2 A;  4OD4 A;  4PJM A;  3U9M A;  1WN0 A;  3DAF A;  1BR4 A;  1D1B A;  5DLJ A;  1E86 A;  1TWH A;  2CGE A;  2V3C C;  1WWP A;  3JRT A;  1E84 A;  2AWY A;  2QTV A;  1VYK A;  2Y69 C;  3LJB A;  3BRJ A;  3MBG A;  3HNI A;  3H2U A;  4PR9 A;  2XRH A;  3R2P A;  2PF4 E;  3O55 A;  3S27 A;  5JT4 A;  4W8K A;  3DD7 A;  4N6H A;  4G7Z F;  3JTL O;  4EBK A;  2QLA A;  3TD7 A;  2HFI A;  2DI3 A;  1ZU4 A;  2J7P A;  4RDA A;  1Q0D A;  3J06 A;  4DRJ B;  4JTD B;  3MYI A;  3PCV A;  1OCC C;  4DJ9 A;  1GM5 A;  1N1C A;  1TR2 A;  2OJE D;  4DOZ A;  1QQ3 A;  1TFK B;  1ZHX A;  3KYJ A;  4MND A;  4MVZ A;  5KYN A;  4E7S A;  2F22 A;  1CGN A;  2HV7 A;  4GEH A;  1NBB A;  4J7Y A;  1OKK A;  3CQZ A;  4XTK A;  4Z9I A;  3SNH A;  3RYL A;  2ZPA A;  2M64 A;  5JLI A;  3POV A;  3KMI A;  4HFK B;  3IEE A;  4PAC A;  3E9V A;  2W45 A;  1G4W R;  5D92 A;  1A41 A;  3MLG A;  5COF A;  1HW1 A;  2LCH A;  4FWV A;  4DXW A;  5DS6 A;  4KI2 A;  1RXQ A;  2WB7 A;  3S90 A;  3M4C A;  1VLS A;  1RCP A;  5L0I A;  4NTB A;  1Z3I X;  3AGT A;  2WVN A;  3L8J A;  1APC A;  1JR8 A;  1OW7 A;  2XL6 A;  2IXM A;  1Q0K A;  2XLD A;  2XM4 A;  3NMI A;  4J32 B;  3ZTZ A;  3ZSU A;  3V5Z A;  2AVK A;  2P6V A;  2Z15 A;  3RQE A;  1RKC A;  2GDC A;  3RFY A;  3GEH A;  3UGP A;  5JSL A;  4YWQ A;  3FXH A;  1VK5 A;  3U9J A;  4JKV A;  4YL0 A;  1A0B A;  1T6Q A;  3LS0 A;  3U2L A;  4CJG A;  4G7H F;  4D4N A;  2GA0 A;  2IXP A;  2VB6 A;  3JCU Q;  4P9T A;  4MS2 A;  4AK9 A;  5KYW B;  1BDJ B;  1LS4 A;  2HJM A;  3TQO A;  3U3F A;  2CDQ A;  3FOO A;  1ZYR F;  3L8I A;  3O6X A;  4U5F E;  1YAR O;  4NC3 A;  3GM2 A;  1I4Z A;  1I5N A;  1NZE A;  3L0I A;  2P0N A;  1C17 M;  5CIV A;  1M2V B;  3F46 A;  4E18 A;  3I4U A;  5EK0 A;  3ASO C;  2GAQ A;  3RQG A;  2LFF A;  4BPM A;  1ORS C;  2J9V A;  3DE9 A;  2KNH A;  3FAP B;  3LLI A;  4DBQ A;  4XPY A;  4C3B A;  3ABM C;  2PX0 A;  2PBE A;  4BEM J;  3EG9 A;  2IM8 A;  1ZU5 A;  3B0V C;  2FGY A;  1HMD A;  4CSA C;  1VB5 A;  4O6M A;  3AOU A;  3W8H A;  3RVZ A;  3EFO B;  5B1A C;  2A0U A;  5JRA A;  1JAF A;  2FAP B;  2LQG A;  1D1A A;  3EZH A;  3NYJ A;  2Y3D A;  3S28 A;  1CGO A;  2HUJ A;  1Z5Z A;  3MX3 A;  3NMJ A;  2EIN C;  1QVX A;  5B3I A;  3ZC4 A;  2Q00 A;  4I3M A;  5L0D A;  1H9G A;  3CAX A;  3EGD B;  3EH1 A;  1R4T A;  4XEK A;  1QZX A;  3ZIB A;  2J9U A;  4BJT A;  3V7O A;  2CNW D;  1PCX A;  3K6B A;  1ZVZ A;  1MMN A;  2OCC C;  5E3A A;  3VM6 A;  3GWL A;  2R7S A;  1NU7 D;  4O79 A;  4DBR A;  2YL3 A;  4YT2 A;  2R7O A;  1A7E A;  1U0B B;  2XXA B;  1G8X A;  4BJ5 C;  1QPU A;  3X1O A;  3ZQY A;  2QY9 A;  4Q4Z F;  1EI7 A;  1F1M A;  3LEV A;  3LUT B;  4YJW A;  4IGG A;  4W8P A;  2RD9 A;  1ZHW A;  3RIP A;  3ZDL A;  3FMS A;  2C04 A;  4EKW A;  3WHN A;  1W2W A;  3QW1 A;  1OCR C;  3VAY A;  1WOL A;  1AEP A;  3DJU B;  3EPV A;  4MVR A;  1FFT C;  3E70 C;  4NQF A;  3RVY A;  3LNM B;  4CDV A;  2ZXP A;  5B3S C;  4H4K C;  3TUL A;  3QZC A;  1J8M F;  3WG7 C;  2GWW A;  3HJC A;  3ZTM A;  1FTS A;  1NU9 C;  1PD0 A;  4L6R A;  1RJ9 A;  4JIO A;  2KSF A;  2XS1 A;  4ULW A;  5KYY A;  4B6I A;  5KYU A;  1I4Y A;  1LE2 A;  4O6N A;  3ZWI A;  1WTY A;  3Q7G A;  1TQG A;  4JC7 A;  5GPG B;  2Q3T A;  3EGX B;  4I1M A;  2I8B A;  1TWA A;  1Z23 A;  2J9B A;  3GOR A;  1OW8 A;  4JW1 A;  1GS9 A;  1OCO C;  4MVO A;  2Q7R A;  1AVO B;  2X0C A;  5EGY A;  4CDY A;  1Q0M A;  3FOP A;  4Q7C A;  5DQT A;  2IXN A;  5KYW A;  5E33 A;  1PD1 A;  3IQT A;  5L3V A;  5HSW A;  3OEO A;  3DZA A;  2M4E A;  4JE9 A;  3AG1 C;  2Y3B A;  4AL1 A;  5JUA A;  4OIQ F;  5F28 E;  4K7B A;  2XL8 A;  4AL0 A;  1KTM A;  2JX0 A;  3GOD A;  2HJ3 A;  4MTO A;  1FAP B;  1G5Z A;  1VYI A;  4P6I C;  3W2W A;  2YL7 A;  2ZXR A;  2R7U A;  3U3B A;  2R03 A;  5FCL A;  2A0B A;  2Q9A A;  2R7V A;  1QLE C;  4LDK A;  4MW8 A;  4C7O B;  3PMR A;  2MHR A;  2W9Y A;  3QVY A;  2EPK X;  5CI8 A;  4IRU A;  5L0C A;  4CSA A;  3N24 A;  3GM1 A;  4J7T A;  4NY3 A;  3OA1 A;  3QTH A;  4DVZ A;  2P7V A;  4G78 A;  4XLN F;  4MTG A;  3W2V A;  5A6B D;  5L0J A;  2R02 A;  4N6C A;  4XPX A;  1O87 A;  1YLM A;  1V54 C;  3EZI A;  4K0D A;  1RKE A;  4H54 A;  2G3K A;  4WGY A;  2HV6 A;  3KYI A;  2JPU A;  2R7Q A;  4BG0 A;  1LM3 B;  4AX2 A;  3JT1 A;  4GYT A;  3A9C A;  4NTA A;  2PX3 A;  3ITF A;  1HW2 A;  5BQI A;  3JZ0 A;  2EIJ C;  2B0J A;  3LNR A;  2Y3H A;  4JEA A;  4U5B E;  5DQZ A;  1FMV A;  3AJM A;  5DS4 A;  2YKZ A;  2XM0 A;  2IXO A;  3DMD A;  5JS5 A;  4QDL A;  5KYX A;  4XEV A;  1V74 B;  4JVS A;  4CS8 A;  2CNW A;  1Q0F A;  2DGJ A;  2EIL C;  3LES A;  2V26 A;  4U5D E;  3C8G B;  4JTC B;  4Z9H A;  4KNV A;  2OQM A;  3CZ6 A;  3NYL A;  4CIP A;  4ER9 A;  2AU5 A;  2J9W A;  3HTK C;  5COM A;  2KQ9 A;  1JMW A;  3T6G B;  3S29 A;  1YA9 A;  2A1D D;  3I5Q A;  4MVQ A;  2VC9 A;  4JTA B;  2LP4 A;  4HE8 D;  4AE4 A;  2XLO A;  3WOD F;  2LK4 A;  2J45 A;  2X51 A;  1K04 A;  2OKU A;  4U5H A;  2RSE B;  2VAS A;  4M63 A;  3M15 A;  3C8Z A;  1OXK A;  3U8P A;  2R7W A;  1T6U A;  3ASN C;  2Y39 A;  2KW3 C;  2LSE A;  1WAT A;  3RKO F;  1DOW A;  3ZVR A;  1D0Y A;  2R7T A;  4A4A A;  3UMI A;  1NG1 A;  5TJ5 E;  4IAQ A;  1OR3 A;  4IB4 A;  4XEF A;  4YT8 A;  5AGF A;  3TOL A;  3B29 A;  3AG4 C;  2LIG A;  4WAB A;  5E3C A;  3TJ6 A;  4CX9 A;  2NUP A;  1TKN A;  1ZW3 A;  4YL1 A;  2WZL A;  5BQG A;  2XLW A;  3UMH A;  2DB4 A;  1YVI A;  3ABL C;  2PFD A;  4Q5S F;  2HKV A;  1NFN A;  3H65 A;  3JYH A;  3KKB A;  3U5S A;  2CCY A;  1CGM E;  2A68 F;  4EUK B;  3LAY A;  3DJN B;  4E17 A;  1MND A;  3HLZ A;  4D4X A;  2YQY A;  3C62 A;  1XZQ A;  2L6G A;  2QNL A;  1R5I D;  2OG2 A;  2LD6 A;  2H7B A;  4RBN A;  1ZHY A;  2A6H F;  2R9R B;  4JCH A;  4XWJ A;  4MW3 A;  2YEV A;  2A69 F;  1M56 C;  1CPQ A;  1VTM P;  3GEI A;  2WL8 A;  3CSK A;  4KNW A;  1Z7Q c;  4BEJ A;  2VCA A;  4IAO A;  4FES A;  3EJN A;  3B71 A;  4U9E A;  3S9O A;  2HSB A;  1OR2 A;  1SR2 A;  1ZHZ A;  1FNT c;  3IQ5 A;  4ZLD A;  1VMA A;  1QSP A;  4OD5 A;  4E7Z A;  3AGU A;  3EHN A;  5A6B A;  2HMQ A;  4NCQ A;  1CPR A;  2EIM C;  2UUI A;  3N2Z B;  3U8V A;  1YJG A;  5AC5 A;  4U9D A;  3HNK A;  3A11 A;  3FHD A;  4PK4 A;  4N4W A;  3DM5 A;  3JSZ A;  1BR1 A;  256B A;  4ONS A;  4PJN A;  3ECS A;  4U5G A;  3Q7L A;  4Z9J A;  3L34 A;  4DRH B;  4U5E E;  5A6K A;  1YYJ A;  3SZR A;  1YAU O;  1YZA A;  1MMA A;  2KYH A;  2QUP A;  2ZXW C;  4K1O A;  2IBF A;  3SP1 A;  2XLM A;  3SYN A;  1BR2 A;  1A7D A;  3DWW A;  4LER A;  4OIP F;  4MQ9 F;  3IQ6 A;  3UGO A;  2L7A A;  3MFN A;  1L3P A;  3T6B A;  1JPJ A;  3GEE A;  2L81 A;  1YDI A;  3FDQ A;  1B68 A;  4CIH A;  2D4U A;  5CI9 A;  1M6T A;  3V5Y A;  2YLI A;  4YT5 A;  3IQC A;  5B1B C;  5EHH A;  3GAN A;  3L1M A;  4O6Y A;  4CDA A;  3DI5 A;  5T1D B;  4LAC B;  5DVW A;  4X0R A;  2Q9B A;  1YYX A;  3HNL A;  1ORJ A;  3U2M A;  2BE5 F;  1WGW A;  3NG1 A;  4I44 A;  2QE9 A;  1LVK A;  1H9T A;  2XS8 A;  3EG9 B;  3RQF A;  1SZI A;  1BZ4 A;  1TWG A;  1OXB A;  2G3V A;  3CEX A;  1JRA A;  2NG1 A;  2H7O A;  4P9F A;  1K40 A;  1ORY A;  1TWC A;  3F47 A;  2MYS A;  2W4B A;  4U5C E;  1FR0 A;  3HNJ A;  3C63 A;  1EKY A;  2BL2 A;  3MYF A;  4YK5 A;  5D91 A;  3U0C A;  4PJL A;  1HE9 A;  1LS1 A;  1JPN A;  2DYS C;  1LKX A;  2IOQ A;  4I1O B;  5L0G A;  4QI2 A;  2HZ8 A;  3KPH A;  2OU6 A;  2R25 A;  1O3U A;  2VCB A;  4IAR A;  4ZLC A;  1VOM A;  2UUH A;  3LEO A;  1JOG A;  4LLE A;  4IWB A;  4R32 A;  3RF3 A;  3ZQV A;  3K1I C;  2FFH A;  5E2Q A;  2XL4 A;  1LI7 A;  3N0T A;  3G4X A;  4E0H A;  3UMK A;  2H8A A;  3QMK A;  3S0X A;  3UNG C;  3ATP A;  2WVO A;  1LIH A;  3UR3 C;  3W8I A;  3DKA A;  1M57 C;  2YHS A;  3DXJ F;  3H2V A;  2OOC A;  3G4Z A;  4KC9 A;  5AC4 A;  2NSG A;  1M2V A;  2PP4 A;  3W4Y A;  3C7J A;  2WZF A;  4OIN F;  2R7R A;  1HMO A;  5L0F A;  1ST6 A;  4FX5 A;  5JVE A;  2JD3 A;  4PFO A;  4JJG A;  5A6A A;  1D1C A;  3K33 A;  4F4B A;  3TJ5 A;  3BEH A;  4CS9 C;  2I15 A;  3T4R A;  3G50 A;  2YLD A;  3SXK A;  1LPE A;  4ULV A;  2YL1 A;  1TFO B;  1V55 C;  1RJ9 B;  2L9J A;  2W4M A;  2J0W A;  3EFO A;  4NTF A;  4OIR F;  5KYY B;  1MMG A;  5KYU B;  3DM9 B;  4JZA A;  2NUT A;  3PHF 2;  1E2X A;  1IZM A;  1YZC A;  4PFP A;  2IYL D;  2D5R B;  2NUT B;  5K0I A;  3EGD A;  1AUE A;  3EQL F;  2EPM X;  2E87 A;  3US6 A;  4YT4 A;  1M2O A;  2WZG A;  1Y6D A;  4LDQ A;  3VYW A;  1UFB A;  2CYD A;  2XLV A;  3AG2 C;  2AWC A;  3KH2 A;  4EIY A;  3C8G D;  3LS1 A;  5HV9 A;  5F5F A;  2Q9C A;  2XXA A;  4MVM A;  2ICW G;  2R05 A;  4RD9 A;  4HFF B;  5DS5 A;  2KJG A;  3EH2 A;  1OCZ C;  3NRH A;  5JP7 A;  4CBE A;  4C3E A;  4DVY P;  1XWJ A;  3NMK A;  3Q6N A;  2EPO A;  4JRZ A;  2MWQ A;  3OWT A;  3SXZ A;  2B0H A;  3RW0 A;  3T6J A;  3IPM O;  3LLK A;  4BJ6 C;  2KC3 A;  2LFD A;  3JSE O;  3SXY A;  4OIO F;  1IW7 F;  2NPU A;  2A6E F;  3K1H A;  3PDM P;  1OW6 A;  3NDB B;  1SMY F;  4EBB A;  3S84 A;  2ZD9 A;  1ZW2 A;  5L0H A;  5BQH A;  1C02 A;  3DAG A;  1S7Z A;  1EQ1 A;  1O5H A;  3O10 A;  3AG3 C;  2J0X A;  4LDR A;  1Z6A A;  4E0I A;  3B0U X;  1U89 A;  3K7D A;  3EHM A;  3TK0 A;  1VLT A;  2KK1 A;  3C18 A;  4EHP A;  2J8W A;  3X2Q C;  2OJQ A;  1YA7 O;  3WAQ A;  3IHU A;  2R7X A;  4G0H A;  1QKR A;  2Q4F A;  3NKD A;  2TMV P;  2O9X A;  1NSG B;  2HSQ A;  2EPL X;  4MVU A;  4C3D A;  1E83 A;  1A7V A;  3O39 A; 
#chains in the Genus database with same CATH homology
 1YYJ A;  1YZA A;  1APC A;  2XLM A;  2XL6 A;  2XM4 A;  2XLD A;  3NMI A;  3QVY A;  3ZTZ A;  3IQ6 A;  4JEB A;  3QVZ A;  5JSL A;  3QW0 A;  4JKV A;  2YL0 A;  1M6T A;  1MQV A;  2YLI A;  3M79 A;  2XLH A;  3L1M A;  1BBH A;  4CJG A;  4CDA A;  4CJO A;  4D4N A;  2BC5 A;  4WGY A;  1YYX A;  3HNL A;  1E85 A;  1LM3 B;  3FOO A;  1S05 A;  4NC3 A;  4JEA A;  2YKZ A;  2XM0 A;  3HNJ A;  3C63 A;  5JS5 A;  1EKY A;  4WGZ A;  3DE9 A;  4IAR A;  3ZQV A;  4CIP A;  4ER9 A;  2XLE A;  3TOM A;  2XLO A;  5JRA A;  1JAF A;  1CGO A;  3NMJ A;  3DE8 A;  3M15 A;  5B3I A;  3U8P A;  5JVE A;  2YL3 A;  2YLD A;  4IAQ A;  4IB4 A;  5AGF A;  4ULV A;  2YL1 A;  1QPU A;  3TOL A;  3ZQY A;  4CX9 A;  3M4B A;  2YLG A;  3VRC A;  1YZC A;  2XLW A;  1GQA A;  3QW1 A;  1E86 A;  2CCY A;  1E84 A;  2XLV A;  4EIY A;  4CDV A;  3HNI A;  4D4X A;  3C62 A;  3ZTM A;  5JT4 A;  4N6H A;  4L6R A;  5JP7 A;  2QLA A;  3NMK A;  1CPQ A;  3ZWI A;  1QQ3 A;  2J9B A;  1CGN A;  1NBB A;  4U9E A;  4CDY A;  5JLI A;  3FOP A;  3IQ5 A;  4JE9 A;  5JUA A;  1CPR A;  2J8W A;  2XL8 A;  4U9D A;  3HNK A;  4N4W A;  256B A;  2YL7 A;  1E83 A;  1A7V A;  3M4C A;  1RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...