1MQVA

Crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
ATDVIAQRKAILKQMGEATKPIAAMLKGEAKWDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIFEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Features of Cytochrome c' Folding Intermediates Revealed by Fluorescence Energy-Transfer Kinetics
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 47
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1mqvA00
2BC5A 4IAQA 3HNKA 3DE8A 1CPRA 4CDYA 5JP7A 2XLHA 1YZAA 4WGYA 1E85A 1QPUA 3HNIA 4CDVA 3L1MA 2YL1A 1E86A 1E83A 4ULVA 4CDAA 2XM0A 4JE9A 3IQ6A 5JS5A 2J9BA 2XLMA 2XLDA 3FOOA 1GQAA 1E84A 1RCPA 4CX9A 3ZTMA 3QVYA 5JRAA 1CGOA 3NMIA 2XLEA 2YL7A 3NMKA 1JAFA 1NBBA 2XM4A 3QW1A 5JSLA 5JVEA 4IB4A 2CCYA 4N4WA 3ZQVA 3ZQYA 1A7VA 3M4BA 1S05A 4JKVA 5AGFA 1BBHA 4D4NA 4U9DA 2YLGA 4WGZA 4IARA 3C63A 2YL0A 3M15A 4CJGA 3HNJA 4D4XA 5JUAA 1APCA 3ZTZA 3ZWIA 2XLVA 3C62A 5JT4A 2XL8A 1CPQA 3TOLA 3M79A 1EKYA 4CIPA 3IQ5A 2YL3A 4JEBA 2J8WA 3U8PA 4CJOA 4JEAA 3QW0A 3M4CA 3HNLA 4NC3A 1CGNA 2QLAA 2XL6A 2XLOA 5JLIA 1YYXA 3DE9A 3NMJA 5B3IA 3TOMA 1YYJA 2YKZA 4ER9A 1QQ3A 4L6RA 1LM3B 4EIYA 3QVZA 1YZCA 4U9EA 1M6TA 2YLDA 4N6HA 3VRCA 1MQVA 256BA 2YLIA 3FOPA 2XLWA
chains in the Genus database with same CATH superfamily
4EBKA 2KC3A 2BC5A 2BL2A 3DMDA 3EGXB 4IAQA 4K0DA 4YL1A 3TQOA 3NDBB 2NPUA 3E70C 3ATPA 3C8GB 1V74B 4JTAB 3KYJA 3U5SA 3UMHA 4U5BE 1FNTc 1NFOA 2AVKA 3DWWA 1YZAA 4WGYA 4WJ0A 3CZ6A 5L3QA 3B0UX 1D1AA 5COMA 4Z9HA 5TJ5E 2P0NA 1H9TA 4MVQA 5BQGA 2EPMX 2IXOA 3GANA 1QVXA 4Q7CA 1UFBA 1Q0GA 1Z63A 5E33A 3PMRA 1T6IA 1DOWA 3ZIBA 3CSKA 3W2WA 2LFDA 4U5GA 2CW0F 1K40A 1J8MF 4G7ZF 1SR2A 2GAQA 4KBLA 1OW6A 2YWAA 4JE9A 2V3CC 5JS5A 3VM6A 1HE1A 2XLMA 4DRJB 1VOMA 2D5RB 3EGDA 5BUOA 5DQZA 2WZFA 3AOUA 4JZAA 3WG7C 3SP1A 5HSWA 3UGOA 1B68A 4CS8A 3H2VA 3AG3C 1DOVA 3H2UA 3TULA 2J46A 3S29A 3NKDA 1JRAA 2NSFA 2DGJA 4RDAA 2JPUA 4LLEA 2VCCA 2ZXWC 1HW1A 1C17M 4MVZA 2CGEA 3NMKA 1ORJA 4OINF 1GM5A 4W8PA 1VLTA 3L0IA 1G4WR 1HW2A 2Q9AA 4HE8D 4LDKA 2R7QA 3C8GD 1ZHXA 1OW8A 2X0CA 1M57C 2WVQA 1A7VA 3M4BA 1S05A 4NTAA 1BBHA 3EGDB 4JTCB 3MYFA 3SXKA 2EIKC 1D1BA 2YL0A 2J7PD 2OCCC 3B71A 1K05A 2A0BA 2HV6A 4OD4A 3LLIA 5L3VA 3K7DA 3QMKA 4N06A 4JCZA 4J7TA 4CJGA 5IY5C 1VYKA 1OKKA 3DAGA 1AVOB 1HY5A 3GM1A 1RKCA 4MTGA 5F5HA 4RBNA 1H9GA 4MS2A 5AC5A 1GS9A 1FFHA 4EHPA 4JJGA 1R5ID 3KKBA 4FWVA 2P6VA 1ST6A 2Y3GA 1QKRA 3C8GA 3T6JA 4DXWA 4C3EA 1BR2A 3GWNA 3C62A 2QTVA 1H6GA 3LLKA 2XL8A 3UNGC 1I4YA 2MYSA 2PBEA 4U5EE 1EKYA 2DI3A 1YA7O 1G5ZA 2J9VA 2PNOA 2FAPB 3EHMA 3O6XA 4JEBA 2J8WA 1Y6DA 3HTKC 2J9UA 4JEAA 3QW0A 3HNLA 1QSPA 2LK4A 3SEOA 1CGNA 2HJMA 3RQEA 2KJGA 5F5FA 4DVZA 2QLAA 2XLOA 1NG1A 1XWJA 2Q9CA 3EG9A 4HEAJ 2R7VA 2OQMA 2WVOA 4KC9A 1U6HA 3HJCA 2OKUA 3KH2A 4BJ5C 1VTMP 5B3IA 4XLPF 5CI9A 4JURI 4CS9A 2L6FA 3T6GB 1YJGA 3EZIA 3AG2C 2HFIA 1HMDA 4ER9A 3BRJA 2LD6A 4YT5A 2L81A 4AE4B 5DQTA 4GYTA 4MVSA 1LM3B 2HMQA 1SF8A 5L0FA 5T3WA 3T9OA 1YZCA 4JRZA 2YHSA 1OCRC 4MVUA 5GPGB 1WATA 3RQGA 4G0HA 3Q6MA 3X2QC 1PD1A 4N6HA 3VRCA 2GFHA 4BJ6A 4EBBA 3K33A 4IGGA 4XEVA 3EH1A 1WGWA 2XL4A 3S0XA 1Z5ZA 1OCCC 1ZW2A 3AGTA 1ORSC 1OW7A 2W45A 2XS8A 4U5DE 4G7HF 3LJBA 3GORA 3SYNA 3RVYA 2G3KA 2ETSA 2Y69C 2FFHA 4KNWA 4ULWA 5A6BA 4C7OA 2NG1A 5JP7A 1T5OA 4LDQA 4O79A 1MNEA 4ZLDA 2EPNA 4N6CA 1E85A 1LS4A 1FR0A 3HNIA 3U3FA 1NZEA 1TFOB 1NSGB 2BE5F 4H54A 4CDVA 4E0HA 3G50A 2HKVA 1U89A 2RSEB 2Y3HA 1C03A 3H65A 4AL1A 2WZGA 1O5HA 3ECSA 1D0YA 3E9VA 2PP4A 3OA1A 3KL4A 2ZPAA 4YK5A 4CS7A 2R02A 2Z15A 2J0WA 4ULVA 4NY3A 4EKWA 4CSAC 3FXHA 1R4TA 2WVNA 2PFDA 4MTOA 5COGA 1PV3A 4ANJA 3S9OA 1LVKA 1V4AA 2ZXPA 3DXJF 3ITFA 3L34A 3R2PA 2XLDA 1NLXA 2IXPA 4K1OA 5L0HA 2PX0A 2OG2A 4NTBA 1RCPA 1WTYA 3V5XA 2XSEA 2V26A 3FHDA 1U0BB 3LS0A 3QVYA 2VC9A 1TWGA 1N1CA 1CGOA 1OXKA 1LE2A 2I8BA 2D4UA 2NSGA 3DAFA 3EFOA 3VF0A 3K1HA 1G8XA 4EUKB 2YL7A 2G62A 4M63A 1TWHA 3UMIA 4YN0B 1RMVA 1TWAA 2WZLA 2Q7RA 2J7PA 5COFA 5JSLA 2AWYA 1KTMA 2H7VC 4IB4A 4N4WA 3ZQVA 2EINC 3DM9B 5E3CA 1VLSA 2KYHA 1OQCA 3HKKA 3LNRA 4JKVA 1QZXA 3N2ZB 3A9CA 3FAPB 4U9DA 3J06A 3CEXA 4G78A 4CS9C 4O6YA 3C63A 1A0BA 3OEOA 4MVRA 3GEEA 3ZSUA 5EGYA 1A7EA 4HFFB 3HNJA 2LIGA 4LDRA 2WB7A 3ABKC 5L0GA 2OEVA 2QNLA 5L0JA 4U5CE 1LIHA 3DKAA 3FVYA 4YJWA 3RW0A 2L6GA 1RKEA 4W8KA 2R05A 2GWWA 5A6KA 5JUAA 3FDQA 4H4KC 2HS5A 4O7GA 5EK0A 1YVIA 2XLVA 4KI2A 5DS6A 1T6UA 1IW7F 4A4AA 3ABMC 3IEEA 3U3BA 5KYNA 4E17A 4F4BA 1YDIA 1ZHTA 2A1DD 3TOLA 3FMSA 3S90A 4U5HA 1RXQA 4JVSA 3X1OA 2XRHA 1LPEA 3G4ZA 3QZCA 5E3AA 2RD9A 4E7SA 5B3SC 2R7XA 4IRUA 2KQ9A 3M4CA 2P61A 3CQZA 5DLJA 5EHHA 3EPVA 3V5ZA 4XPYA 4LLCA 2LFFA 3IQCA 4X0RA 3NMJA 3DE9A 1ZW3A 4NQFA 3MX3A 4WABA 1YAUO 4HFKB 5D91A 1MNDA 5A6JA 3POVA 4XPWA 4MVMA 3RIPA 3S27A 1NFNA 1M56C 1NU9C 2J0XA 4YT2A 4L6RA 1OCZC 3GEIA 3TJ6A 3KMIA 5CI8A 4EIYA 3QVZA 2R7WA 4E0IA 3JYYA 2ZD9A 3AQBA 2YQYA 1LI5A 3JYHA 4U9EA 3B0VC 3O10A 2R03A 2JX0A 1MQVA 3FOPA 2J45A 4DRIB 1TR2A 3LAYA 4YL0A 5FZTA 3DM5A 5KYWA 4JW1A 3HNKA 2NUPA 2QE9A 2X51A 4I3MA 4K7BA 4CS8C 3EZHA 4BJ1A 1A41A 1Y4CA 5D92A 4Q4ZF 2R7RA 1GGQA 3VAYA 1AUEA 1MMAA 2XLHA 1TQGA 3U9JA 3PHF2 3W4YA 2M4EA 2M64A 3SXZA 4UDVA 2EPOA 3IPMO 3PCVA 3WAQA 5KYYA 3AQCA 3EFOB 2IM8A 2Y3DA 4ONSA 2KW3C 3AG1C 2NUTA 1QLEC 1ORYA 3I5PA 1MMGA 2ZXRA 5E2QA 4YT4A 1T9KA 4BJ5A 4CDAA 2ICWG 1EI7A 1SZIA 4OIPF 2H7BA 1BZ4A 1LE4A 1Z3IX 4BJTA 4BEMJ 1CGME 4FX5A 1V55C 2IYLD 3FOOA 1TKNA 3NYLA 1AEPA 2AU5A 2HSBA 2MHRA 2CNWA 5FCLA 1GQAA 5KYXB 2AP3A 3FAJA 2ASRA 3ZTMA 4O6MA 2YZSA 1YARO 4YWQA 2Y3BA 4OIOF 5JRAA 1V54C 3UR3C 3NMIA 2XLEA 4P6IC 2R7SA 3GM3A 2LP4A 2R7UA 1OR2A 1YLMA 3VYWA 1JAFA 2XM4A 3C8ZA 4GEHA 2P1AA 1IZMA 3NYMA 3DD7A 3QW1A 3BEHA 4QDLA 3SXYA 4DJ9A 2GA0A 5JVEA 3UGPA 3TK0A 4QI2A 3EQLF 4IAOA 2EPKX 4DOZA 2B0HA 3Q7GA 5AGFA 3B29A 3ZDLA 5DVWA 4D4NA 3T6BA 2H8AA 4PJLA 2A69F 1LS1A 2OJQA 3NKEA 3U2LA 2PX3A 3B9QA 2IBFA 4JTDB 2CYDA 2P7VA 3ZC4A 1BR1A 1JMWA 2NUTB 3IHUA 1WWPA 3U8VA 1HE9A 1VYIA 3I4UA 4LACB 2W4BA 5F28E 4D4XA 3MFNA 3QTHA 1TFKB 2Q3TA 1BR4A 4MW3A 4PACA 1PCXA 3ZTZA 3ZWIA 2VCAA 1JOGA 3K6BA 2TMVP 4RD9A 3ABLC 2NUPB 1SYQA 3ASNC 3GM2A 5JT4A 2KGOA 2HMZA 3KPHA 1CPQA 3JSZA 4QI0A 3JRTA 4XPXA 3RFYA 2VASA 4IJJA 3DJNB 3IQ5A 3IQTA 4DRHB 4DBQA 4CIPA 5A6AA 2YL3A 5DS5A 1VB5A 1M2OA 3K1IC 1LKXA 2KK1A 4AK9A 4P9FA 5BQIA 3S84A 4LERA 3RKOF 1J8YF 5BQHA 1LI7A 1ZU4A 1ZVZA 2A6EF 2OEXA 2XL6A 3NRHA 3TJ5A 5JLIA 1XZQA 1S7ZA 2CNWD 2KSFA 2HSQA 4DBRA 4NCQA 1O3UA 2A0UA 2Q00A 3RQFA 2YRFA 5L0IA 5KYUB 2R25A 1PD0A 3RH3A 1OCOC 1A7DA 1EQ1A 2J9WA 1C02A 2A68F 3U0CA 2B0JA 1ZU5A 3AGUA 2OU6A 1RJ9A 1I4ZA 4J30B 3N0TA 3SNHA 3L8IA 1FFTC 4PFPA 5KYYB 2XXAA 1D1CA 2AWCA 3Q6NA 1Q0DA 5L0CA 5HV9A 4IWBA 4MVOA 2VB6A 3ZG1A 1OKKD 1JR8A 2YLDA 2HZ8A 4U5FE 2R7TA 1OXBA 4AX2A 2I15A 1Z7Qc 2XXAB 2YLIA 2QY9A 2ZXOA 1D0ZA 2R9RB 2L7AA 3RYLA 2XLWA 2OJED 1WASA 1JPNA 1ZHYA 5KYWB 3DE8A 1FMWA 1XZPA 3LS1A 4MNDA 4XEKA 3ZVRA 3GWLA 3WODF 1CPRA 1RKEB 2W9YA 4Z9JA 3GEHA 4CDYA 2EIJC 1FMVA 3Q7LA 1QPUA 3G4XA 4O6NA 1NU7D 4PR9A 3W8HA 3MLGA 3U9MA 3EJNA 5CIVA 4GQHA 3L1MA 3C7JA 2FGYA 4BEJA 3AG4C 1K04A 2YL1A 3GODA 4B6IA 1YA9A 4I1MA 1EA8A 3I5QA 4PFOA 4DVYP 3CAXA 1MMDA 4XTKA 1G4US 1D0XA 1E86A 2JD3A 3LESA 2F22A 1VK5A 2MWQA 5KYUA 1E83A 2EILC 4MW8A 1BDJB 2XM0A 3K1IA 3C18A 4JCHA 3N24A 3IQ6A 4YL3A 2C04A 4C3DA 2J9BA 2VH3A 4JIOA 3JSEO 4E7ZA 2DYSC 3ASOC 3LNMB 3O39A 4XLNF 3JCUQ 2HV7A 2G3VA 1E84A 2WL8A 4CX9A 1E2XA 4C3BA 1TWCA 1Z23A 5K0IA 3LUTB 4BJ6C 1KNYA 3DZAA 4FESA 2DYRC 5B1AC 1RJ9B 3NG1A 2O9XA 4PK4A 1KU2A 3KYIA 1NBBA 2OOCA 3TD7A 4MTFA 2Q4FA 4A2NB 4PJNA 1FAPB 4I1OB 1SMYF 2CCYA 2IXNA 5B1BC 2R7OA 4ZLCA 3ZQYA 5L0DA 4AL0A 2C03A 4PJMA 2IOQA 2W4MA 1Z6AA 4P9TA 4AE4A 3W8IA 4J32B 3SXMA 5T3TA 2IXMA 4CIHA 2LSEA 3EGXA 2YLGA 4WGZA 4IARA 4JJFA 2Y39A 1M2VB 1O87A 3M15A 3WHNA 4OD5A 2GDCA 2YEVA 1H7IA 3F47A 3OWTA 3EG9B 1L7CA 4JC7A 3T4RA 4MQ9F 1L3PA 1ZHZA 2H7OA 4R32A 2A6HF 1APCA 5DS4A 4XQ1A 5KYXA 3L8JA 4OIRF 4E18A 3O55A 3RF3A 2YVKA 4C7OB 3U2MA 3MBGA 3JZ0A 4Z9IA 3PDMP 4G7OF 4PJJA 1T6QA 4I44A 3LEOA 3M79A 1ZYRF 4XWJA 2EPLX 3AJMA 3JTLO 1JPJA 3K66A 1Q0FA 2Q9BA 1Q0MA 1OR3A 2KNHA 3DJUB 3F46A 2EIMC 3U8PA 5A69A 4CJOA 1HMOA 5AC4A 3LEVA 3JRMO 3US6A 2XS1A 4J7YA 2E87A 2UUHA 4NC3A 3S28A 2VCBA 3SZRA 4EBJA 4OIQF 4FAPB 4CBEA 2PF4E 1YYXA 4NTFA 1UG7A 1MMNA 3RVZA 2LQGA 3JT1A 1FTSA 4CSAA 1VMAA 1W2WA 3V7OA 2L9JA 2LCHA 3EHNA 3MYIA 3TOMA 1F1MA 1YYJA 4KNVA 3R7CA 2HUJA 2YKZA 3HLZA 4BPMA 3A11A 1QQ3A 1Q0KA 1T01A 1WN0A 1ZHWA 3B0PA 3M1CB 3UMKA 4XEFA 3W2VA 4Q5SF 2DB4A 2HJ3A 1WOLA 3V5YA 2L6HA 2UUIA 5T1DB 2QUPA 4YT8A 4EWCA 3DI5A 3EH2A 1M6TA 4BG0A 5A6BD 1M2VA 1ZZPA 1I5NA 256BA 3NYJA 2CDQA
chains in the Genus database with same CATH topology
2BC5A 4IAQA 3HNKA 3DE8A 1CPRA 4CDYA 5JP7A 2XLHA 1YZAA 4WGYA 1E85A 1QPUA 3HNIA 4CDVA 3L1MA 2YL1A 1E86A 1E83A 4ULVA 4CDAA 2XM0A 4JE9A 3IQ6A 5JS5A 2J9BA 2XLMA 2XLDA 3FOOA 1GQAA 1E84A 1RCPA 4CX9A 3ZTMA 3QVYA 5JRAA 1CGOA 3NMIA 2XLEA 2YL7A 3NMKA 1JAFA 1NBBA 2XM4A 3QW1A 5JSLA 5JVEA 4IB4A 2CCYA 4N4WA 3ZQVA 3ZQYA 1A7VA 3M4BA 1S05A 4JKVA 5AGFA 1BBHA 4D4NA 4U9DA 2YLGA 4WGZA 4IARA 3C63A 2YL0A 3M15A 4CJGA 3HNJA 4D4XA 5JUAA 1APCA 3ZTZA 3ZWIA 2XLVA 3C62A 5JT4A 2XL8A 1CPQA 3TOLA 3M79A 1EKYA 4CIPA 3IQ5A 2YL3A 4JEBA 2J8WA 3U8PA 4CJOA 4JEAA 3QW0A 3M4CA 3HNLA 4NC3A 1CGNA 2QLAA 2XL6A 2XLOA 5JLIA 1YYXA 3DE9A 3NMJA 5B3IA 3TOMA 1YYJA 2YKZA 4ER9A 1QQ3A 4L6RA 1LM3B 4EIYA 3QVZA 1YZCA 4U9EA 1M6TA 2YLDA 4N6HA 3VRCA 1MQVA 256BA 2YLIA 3FOPA 2XLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BC5 A;  4IAQ A;  3HNK A;  3DE8 A;  1CPR A;  4CDY A;  5JP7 A;  2XLH A;  1YZA A;  4WGY A;  1E85 A;  1QPU A;  3HNI A;  4CDV A;  3L1M A;  2YL1 A;  1E86 A;  1E83 A;  4ULV A;  4CDA A;  2XM0 A;  4JE9 A;  3IQ6 A;  5JS5 A;  2J9B A;  2XLM A;  2XLD A;  3FOO A;  1GQA A;  1E84 A;  1RCP A;  4CX9 A;  3ZTM A;  3QVY A;  5JRA A;  1CGO A;  3NMI A;  2XLE A;  2YL7 A;  3NMK A;  1JAF A;  1NBB A;  2XM4 A;  3QW1 A;  5JSL A;  5JVE A;  4IB4 A;  2CCY A;  4N4W A;  3ZQV A;  3ZQY A;  1A7V A;  3M4B A;  1S05 A;  4JKV A;  5AGF A;  1BBH A;  4D4N A;  4U9D A;  2YLG A;  4WGZ A;  4IAR A;  3C63 A;  2YL0 A;  3M15 A;  4CJG A;  3HNJ A;  4D4X A;  5JUA A;  1APC A;  3ZTZ A;  3ZWI A;  2XLV A;  3C62 A;  5JT4 A;  2XL8 A;  1CPQ A;  3TOL A;  3M79 A;  1EKY A;  4CIP A;  3IQ5 A;  2YL3 A;  4JEB A;  2J8W A;  3U8P A;  4CJO A;  4JEA A;  3QW0 A;  3M4C A;  3HNL A;  4NC3 A;  1CGN A;  2QLA A;  2XL6 A;  2XLO A;  5JLI A;  1YYX A;  3DE9 A;  3NMJ A;  5B3I A;  3TOM A;  1YYJ A;  2YKZ A;  4ER9 A;  1QQ3 A;  4L6R A;  1LM3 B;  4EIY A;  3QVZ A;  1YZC A;  4U9E A;  1M6T A;  2YLD A;  4N6H A;  3VRC A;  1MQV A;  256B A;  2YLI A;  3FOP A;  2XLW A; 
#chains in the Genus database with same CATH topology
 4EBK A;  2KC3 A;  2BC5 A;  2BL2 A;  3DMD A;  3EGX B;  4IAQ A;  4K0D A;  4YL1 A;  3TQO A;  3NDB B;  2NPU A;  3E70 C;  3ATP A;  3C8G B;  1V74 B;  4JTA B;  3KYJ A;  3U5S A;  3UMH A;  4U5B E;  1FNT c;  1NFO A;  2AVK A;  3DWW A;  1YZA A;  4WGY A;  4WJ0 A;  3CZ6 A;  5L3Q A;  3B0U X;  1D1A A;  5COM A;  4Z9H A;  5TJ5 E;  2P0N A;  1H9T A;  4MVQ A;  5BQG A;  2EPM X;  2IXO A;  3GAN A;  1QVX A;  4Q7C A;  1UFB A;  1Q0G A;  1Z63 A;  5E33 A;  3PMR A;  1T6I A;  1DOW A;  3ZIB A;  3CSK A;  3W2W A;  2LFD A;  4U5G A;  2CW0 F;  1K40 A;  1J8M F;  4G7Z F;  1SR2 A;  2GAQ A;  4KBL A;  1OW6 A;  2YWA A;  4JE9 A;  2V3C C;  5JS5 A;  3VM6 A;  1HE1 A;  2XLM A;  4DRJ B;  1VOM A;  2D5R B;  3EGD A;  5BUO A;  5DQZ A;  2WZF A;  3AOU A;  4JZA A;  3WG7 C;  3SP1 A;  5HSW A;  3UGO A;  1B68 A;  4CS8 A;  3H2V A;  3AG3 C;  1DOV A;  3H2U A;  3TUL A;  2J46 A;  3S29 A;  3NKD A;  1JRA A;  2NSF A;  2DGJ A;  4RDA A;  2JPU A;  4LLE A;  2VCC A;  2ZXW C;  1HW1 A;  1C17 M;  4MVZ A;  2CGE A;  3NMK A;  1ORJ A;  4OIN F;  1GM5 A;  4W8P A;  1VLT A;  3L0I A;  1G4W R;  1HW2 A;  2Q9A A;  4HE8 D;  4LDK A;  2R7Q A;  3C8G D;  1ZHX A;  1OW8 A;  2X0C A;  1M57 C;  2WVQ A;  1A7V A;  3M4B A;  1S05 A;  4NTA A;  1BBH A;  3EGD B;  4JTC B;  3MYF A;  3SXK A;  2EIK C;  1D1B A;  2YL0 A;  2J7P D;  2OCC C;  3B71 A;  1K05 A;  2A0B A;  2HV6 A;  4OD4 A;  3LLI A;  5L3V A;  3K7D A;  3QMK A;  4N06 A;  4JCZ A;  4J7T A;  4CJG A;  5IY5 C;  1VYK A;  1OKK A;  3DAG A;  1AVO B;  1HY5 A;  3GM1 A;  1RKC A;  4MTG A;  5F5H A;  4RBN A;  1H9G A;  4MS2 A;  5AC5 A;  1GS9 A;  1FFH A;  4EHP A;  4JJG A;  1R5I D;  3KKB A;  4FWV A;  2P6V A;  1ST6 A;  2Y3G A;  1QKR A;  3C8G A;  3T6J A;  4DXW A;  4C3E A;  1BR2 A;  3GWN A;  3C62 A;  2QTV A;  1H6G A;  3LLK A;  2XL8 A;  3UNG C;  1I4Y A;  2MYS A;  2PBE A;  4U5E E;  1EKY A;  2DI3 A;  1YA7 O;  1G5Z A;  2J9V A;  2PNO A;  2FAP B;  3EHM A;  3O6X A;  4JEB A;  2J8W A;  1Y6D A;  3HTK C;  2J9U A;  4JEA A;  3QW0 A;  3HNL A;  1QSP A;  2LK4 A;  3SEO A;  1CGN A;  2HJM A;  3RQE A;  2KJG A;  5F5F A;  4DVZ A;  2QLA A;  2XLO A;  1NG1 A;  1XWJ A;  2Q9C A;  3EG9 A;  4HEA J;  2R7V A;  2OQM A;  2WVO A;  4KC9 A;  1U6H A;  3HJC A;  2OKU A;  3KH2 A;  4BJ5 C;  1VTM P;  5B3I A;  4XLP F;  5CI9 A;  4JUR I;  4CS9 A;  2L6F A;  3T6G B;  1YJG A;  3EZI A;  3AG2 C;  2HFI A;  1HMD A;  4ER9 A;  3BRJ A;  2LD6 A;  4YT5 A;  2L81 A;  4AE4 B;  5DQT A;  4GYT A;  4MVS A;  1LM3 B;  2HMQ A;  1SF8 A;  5L0F A;  5T3W A;  3T9O A;  1YZC A;  4JRZ A;  2YHS A;  1OCR C;  4MVU A;  5GPG B;  1WAT A;  3RQG A;  4G0H A;  3Q6M A;  3X2Q C;  1PD1 A;  4N6H A;  3VRC A;  2GFH A;  4BJ6 A;  4EBB A;  3K33 A;  4IGG A;  4XEV A;  3EH1 A;  1WGW A;  2XL4 A;  3S0X A;  1Z5Z A;  1OCC C;  1ZW2 A;  3AGT A;  1ORS C;  1OW7 A;  2W45 A;  2XS8 A;  4U5D E;  4G7H F;  3LJB A;  3GOR A;  3SYN A;  3RVY A;  2G3K A;  2ETS A;  2Y69 C;  2FFH A;  4KNW A;  4ULW A;  5A6B A;  4C7O A;  2NG1 A;  5JP7 A;  1T5O A;  4LDQ A;  4O79 A;  1MNE A;  4ZLD A;  2EPN A;  4N6C A;  1E85 A;  1LS4 A;  1FR0 A;  3HNI A;  3U3F A;  1NZE A;  1TFO B;  1NSG B;  2BE5 F;  4H54 A;  4CDV A;  4E0H A;  3G50 A;  2HKV A;  1U89 A;  2RSE B;  2Y3H A;  1C03 A;  3H65 A;  4AL1 A;  2WZG A;  1O5H A;  3ECS A;  1D0Y A;  3E9V A;  2PP4 A;  3OA1 A;  3KL4 A;  2ZPA A;  4YK5 A;  4CS7 A;  2R02 A;  2Z15 A;  2J0W A;  4ULV A;  4NY3 A;  4EKW A;  4CSA C;  3FXH A;  1R4T A;  2WVN A;  2PFD A;  4MTO A;  5COG A;  1PV3 A;  4ANJ A;  3S9O A;  1LVK A;  1V4A A;  2ZXP A;  3DXJ F;  3ITF A;  3L34 A;  3R2P A;  2XLD A;  1NLX A;  2IXP A;  4K1O A;  5L0H A;  2PX0 A;  2OG2 A;  4NTB A;  1RCP A;  1WTY A;  3V5X A;  2XSE A;  2V26 A;  3FHD A;  1U0B B;  3LS0 A;  3QVY A;  2VC9 A;  1TWG A;  1N1C A;  1CGO A;  1OXK A;  1LE2 A;  2I8B A;  2D4U A;  2NSG A;  3DAF A;  3EFO A;  3VF0 A;  3K1H A;  1G8X A;  4EUK B;  2YL7 A;  2G62 A;  4M63 A;  1TWH A;  3UMI A;  4YN0 B;  1RMV A;  1TWA A;  2WZL A;  2Q7R A;  2J7P A;  5COF A;  5JSL A;  2AWY A;  1KTM A;  2H7V C;  4IB4 A;  4N4W A;  3ZQV A;  2EIN C;  3DM9 B;  5E3C A;  1VLS A;  2KYH A;  1OQC A;  3HKK A;  3LNR A;  4JKV A;  1QZX A;  3N2Z B;  3A9C A;  3FAP B;  4U9D A;  3J06 A;  3CEX A;  4G78 A;  4CS9 C;  4O6Y A;  3C63 A;  1A0B A;  3OEO A;  4MVR A;  3GEE A;  3ZSU A;  5EGY A;  1A7E A;  4HFF B;  3HNJ A;  2LIG A;  4LDR A;  2WB7 A;  3ABK C;  5L0G A;  2OEV A;  2QNL A;  5L0J A;  4U5C E;  1LIH A;  3DKA A;  3FVY A;  4YJW A;  3RW0 A;  2L6G A;  1RKE A;  4W8K A;  2R05 A;  2GWW A;  5A6K A;  5JUA A;  3FDQ A;  4H4K C;  2HS5 A;  4O7G A;  5EK0 A;  1YVI A;  2XLV A;  4KI2 A;  5DS6 A;  1T6U A;  1IW7 F;  4A4A A;  3ABM C;  3IEE A;  3U3B A;  5KYN A;  4E17 A;  4F4B A;  1YDI A;  1ZHT A;  2A1D D;  3TOL A;  3FMS A;  3S90 A;  4U5H A;  1RXQ A;  4JVS A;  3X1O A;  2XRH A;  1LPE A;  3G4Z A;  3QZC A;  5E3A A;  2RD9 A;  4E7S A;  5B3S C;  2R7X A;  4IRU A;  2KQ9 A;  3M4C A;  2P61 A;  3CQZ A;  5DLJ A;  5EHH A;  3EPV A;  3V5Z A;  4XPY A;  4LLC A;  2LFF A;  3IQC A;  4X0R A;  3NMJ A;  3DE9 A;  1ZW3 A;  4NQF A;  3MX3 A;  4WAB A;  1YAU O;  4HFK B;  5D91 A;  1MND A;  5A6J A;  3POV A;  4XPW A;  4MVM A;  3RIP A;  3S27 A;  1NFN A;  1M56 C;  1NU9 C;  2J0X A;  4YT2 A;  4L6R A;  1OCZ C;  3GEI A;  3TJ6 A;  3KMI A;  5CI8 A;  4EIY A;  3QVZ A;  2R7W A;  4E0I A;  3JYY A;  2ZD9 A;  3AQB A;  2YQY A;  1LI5 A;  3JYH A;  4U9E A;  3B0V C;  3O10 A;  2R03 A;  2JX0 A;  1MQV A;  3FOP A;  2J45 A;  4DRI B;  1TR2 A;  3LAY A;  4YL0 A;  5FZT A;  3DM5 A;  5KYW A;  4JW1 A;  3HNK A;  2NUP A;  2QE9 A;  2X51 A;  4I3M A;  4K7B A;  4CS8 C;  3EZH A;  4BJ1 A;  1A41 A;  1Y4C A;  5D92 A;  4Q4Z F;  2R7R A;  1GGQ A;  3VAY A;  1AUE A;  1MMA A;  2XLH A;  1TQG A;  3U9J A;  3PHF 2;  3W4Y A;  2M4E A;  2M64 A;  3SXZ A;  4UDV A;  2EPO A;  3IPM O;  3PCV A;  3WAQ A;  5KYY A;  3AQC A;  3EFO B;  2IM8 A;  2Y3D A;  4ONS A;  2KW3 C;  3AG1 C;  2NUT A;  1QLE C;  1ORY A;  3I5P A;  1MMG A;  2ZXR A;  5E2Q A;  4YT4 A;  1T9K A;  4BJ5 A;  4CDA A;  2ICW G;  1EI7 A;  1SZI A;  4OIP F;  2H7B A;  1BZ4 A;  1LE4 A;  1Z3I X;  4BJT A;  4BEM J;  1CGM E;  4FX5 A;  1V55 C;  2IYL D;  3FOO A;  1TKN A;  3NYL A;  1AEP A;  2AU5 A;  2HSB A;  2MHR A;  2CNW A;  5FCL A;  1GQA A;  5KYX B;  2AP3 A;  3FAJ A;  2ASR A;  3ZTM A;  4O6M A;  2YZS A;  1YAR O;  4YWQ A;  2Y3B A;  4OIO F;  5JRA A;  1V54 C;  3UR3 C;  3NMI A;  2XLE A;  4P6I C;  2R7S A;  3GM3 A;  2LP4 A;  2R7U A;  1OR2 A;  1YLM A;  3VYW A;  1JAF A;  2XM4 A;  3C8Z A;  4GEH A;  2P1A A;  1IZM A;  3NYM A;  3DD7 A;  3QW1 A;  3BEH A;  4QDL A;  3SXY A;  4DJ9 A;  2GA0 A;  5JVE A;  3UGP A;  3TK0 A;  4QI2 A;  3EQL F;  4IAO A;  2EPK X;  4DOZ A;  2B0H A;  3Q7G A;  5AGF A;  3B29 A;  3ZDL A;  5DVW A;  4D4N A;  3T6B A;  2H8A A;  4PJL A;  2A69 F;  1LS1 A;  2OJQ A;  3NKE A;  3U2L A;  2PX3 A;  3B9Q A;  2IBF A;  4JTD B;  2CYD A;  2P7V A;  3ZC4 A;  1BR1 A;  1JMW A;  2NUT B;  3IHU A;  1WWP A;  3U8V A;  1HE9 A;  1VYI A;  3I4U A;  4LAC B;  2W4B A;  5F28 E;  4D4X A;  3MFN A;  3QTH A;  1TFK B;  2Q3T A;  1BR4 A;  4MW3 A;  4PAC A;  1PCX A;  3ZTZ A;  3ZWI A;  2VCA A;  1JOG A;  3K6B A;  2TMV P;  4RD9 A;  3ABL C;  2NUP B;  1SYQ A;  3ASN C;  3GM2 A;  5JT4 A;  2KGO A;  2HMZ A;  3KPH A;  1CPQ A;  3JSZ A;  4QI0 A;  3JRT A;  4XPX A;  3RFY A;  2VAS A;  4IJJ A;  3DJN B;  3IQ5 A;  3IQT A;  4DRH B;  4DBQ A;  4CIP A;  5A6A A;  2YL3 A;  5DS5 A;  1VB5 A;  1M2O A;  3K1I C;  1LKX A;  2KK1 A;  4AK9 A;  4P9F A;  5BQI A;  3S84 A;  4LER A;  3RKO F;  1J8Y F;  5BQH A;  1LI7 A;  1ZU4 A;  1ZVZ A;  2A6E F;  2OEX A;  2XL6 A;  3NRH A;  3TJ5 A;  5JLI A;  1XZQ A;  1S7Z A;  2CNW D;  2KSF A;  2HSQ A;  4DBR A;  4NCQ A;  1O3U A;  2A0U A;  2Q00 A;  3RQF A;  2YRF A;  5L0I A;  5KYU B;  2R25 A;  1PD0 A;  3RH3 A;  1OCO C;  1A7D A;  1EQ1 A;  2J9W A;  1C02 A;  2A68 F;  3U0C A;  2B0J A;  1ZU5 A;  3AGU A;  2OU6 A;  1RJ9 A;  1I4Z A;  4J30 B;  3N0T A;  3SNH A;  3L8I A;  1FFT C;  4PFP A;  5KYY B;  2XXA A;  1D1C A;  2AWC A;  3Q6N A;  1Q0D A;  5L0C A;  5HV9 A;  4IWB A;  4MVO A;  2VB6 A;  3ZG1 A;  1OKK D;  1JR8 A;  2YLD A;  2HZ8 A;  4U5F E;  2R7T A;  1OXB A;  4AX2 A;  2I15 A;  1Z7Q c;  2XXA B;  2YLI A;  2QY9 A;  2ZXO A;  1D0Z A;  2R9R B;  2L7A A;  3RYL A;  2XLW A;  2OJE D;  1WAS A;  1JPN A;  1ZHY A;  5KYW B;  3DE8 A;  1FMW A;  1XZP A;  3LS1 A;  4MND A;  4XEK A;  3ZVR A;  3GWL A;  3WOD F;  1CPR A;  1RKE B;  2W9Y A;  4Z9J A;  3GEH A;  4CDY A;  2EIJ C;  1FMV A;  3Q7L A;  1QPU A;  3G4X A;  4O6N A;  1NU7 D;  4PR9 A;  3W8H A;  3MLG A;  3U9M A;  3EJN A;  5CIV A;  4GQH A;  3L1M A;  3C7J A;  2FGY A;  4BEJ A;  3AG4 C;  1K04 A;  2YL1 A;  3GOD A;  4B6I A;  1YA9 A;  4I1M A;  1EA8 A;  3I5Q A;  4PFO A;  4DVY P;  3CAX A;  1MMD A;  4XTK A;  1G4U S;  1D0X A;  1E86 A;  2JD3 A;  3LES A;  2F22 A;  1VK5 A;  2MWQ A;  5KYU A;  1E83 A;  2EIL C;  4MW8 A;  1BDJ B;  2XM0 A;  3K1I A;  3C18 A;  4JCH A;  3N24 A;  3IQ6 A;  4YL3 A;  2C04 A;  4C3D A;  2J9B A;  2VH3 A;  4JIO A;  3JSE O;  4E7Z A;  2DYS C;  3ASO C;  3LNM B;  3O39 A;  4XLN F;  3JCU Q;  2HV7 A;  2G3V A;  1E84 A;  2WL8 A;  4CX9 A;  1E2X A;  4C3B A;  1TWC A;  1Z23 A;  5K0I A;  3LUT B;  4BJ6 C;  1KNY A;  3DZA A;  4FES A;  2DYR C;  5B1A C;  1RJ9 B;  3NG1 A;  2O9X A;  4PK4 A;  1KU2 A;  3KYI A;  1NBB A;  2OOC A;  3TD7 A;  4MTF A;  2Q4F A;  4A2N B;  4PJN A;  1FAP B;  4I1O B;  1SMY F;  2CCY A;  2IXN A;  5B1B C;  2R7O A;  4ZLC A;  3ZQY A;  5L0D A;  4AL0 A;  2C03 A;  4PJM A;  2IOQ A;  2W4M A;  1Z6A A;  4P9T A;  4AE4 A;  3W8I A;  4J32 B;  3SXM A;  5T3T A;  2IXM A;  4CIH A;  2LSE A;  3EGX A;  2YLG A;  4WGZ A;  4IAR A;  4JJF A;  2Y39 A;  1M2V B;  1O87 A;  3M15 A;  3WHN A;  4OD5 A;  2GDC A;  2YEV A;  1H7I A;  3F47 A;  3OWT A;  3EG9 B;  1L7C A;  4JC7 A;  3T4R A;  4MQ9 F;  1L3P A;  1ZHZ A;  2H7O A;  4R32 A;  2A6H F;  1APC A;  5DS4 A;  4XQ1 A;  5KYX A;  3L8J A;  4OIR F;  4E18 A;  3O55 A;  3RF3 A;  2YVK A;  4C7O B;  3U2M A;  3MBG A;  3JZ0 A;  4Z9I A;  3PDM P;  4G7O F;  4PJJ A;  1T6Q A;  4I44 A;  3LEO A;  3M79 A;  1ZYR F;  4XWJ A;  2EPL X;  3AJM A;  3JTL O;  1JPJ A;  3K66 A;  1Q0F A;  2Q9B A;  1Q0M A;  1OR3 A;  2KNH A;  3DJU B;  3F46 A;  2EIM C;  3U8P A;  5A69 A;  4CJO A;  1HMO A;  5AC4 A;  3LEV A;  3JRM O;  3US6 A;  2XS1 A;  4J7Y A;  2E87 A;  2UUH A;  4NC3 A;  3S28 A;  2VCB A;  3SZR A;  4EBJ A;  4OIQ F;  4FAP B;  4CBE A;  2PF4 E;  1YYX A;  4NTF A;  1UG7 A;  1MMN A;  3RVZ A;  2LQG A;  3JT1 A;  1FTS A;  4CSA A;  1VMA A;  1W2W A;  3V7O A;  2L9J A;  2LCH A;  3EHN A;  3MYI A;  3TOM A;  1F1M A;  1YYJ A;  4KNV A;  3R7C A;  2HUJ A;  2YKZ A;  3HLZ A;  4BPM A;  3A11 A;  1QQ3 A;  1Q0K A;  1T01 A;  1WN0 A;  1ZHW A;  3B0P A;  3M1C B;  3UMK A;  4XEF A;  3W2V A;  4Q5S F;  2DB4 A;  2HJ3 A;  1WOL A;  3V5Y A;  2L6H A;  2UUI A;  5T1D B;  2QUP A;  4YT8 A;  4EWC A;  3DI5 A;  3EH2 A;  1M6T A;  4BG0 A;  5A6B D;  1M2V A;  1ZZP A;  1I5N A;  256B A;  3NYJ A;  2CDQ A; 
#chains in the Genus database with same CATH homology
 2BC5 A;  4IAQ A;  3HNK A;  3DE8 A;  1CPR A;  4CDY A;  5JP7 A;  2XLH A;  1YZA A;  4WGY A;  1E85 A;  1QPU A;  3HNI A;  4CDV A;  3L1M A;  2YL1 A;  1E86 A;  1E83 A;  4ULV A;  4CDA A;  2XM0 A;  4JE9 A;  3IQ6 A;  5JS5 A;  2J9B A;  2XLM A;  2XLD A;  3FOO A;  1GQA A;  1E84 A;  1RCP A;  4CX9 A;  3ZTM A;  3QVY A;  5JRA A;  1CGO A;  3NMI A;  2XLE A;  2YL7 A;  3NMK A;  1JAF A;  1NBB A;  2XM4 A;  3QW1 A;  5JSL A;  5JVE A;  4IB4 A;  2CCY A;  4N4W A;  3ZQV A;  3ZQY A;  1A7V A;  3M4B A;  1S05 A;  4JKV A;  5AGF A;  1BBH A;  4D4N A;  4U9D A;  2YLG A;  4WGZ A;  4IAR A;  3C63 A;  2YL0 A;  3M15 A;  4CJG A;  3HNJ A;  4D4X A;  5JUA A;  1APC A;  3ZTZ A;  3ZWI A;  2XLV A;  3C62 A;  5JT4 A;  2XL8 A;  1CPQ A;  3TOL A;  3M79 A;  1EKY A;  4CIP A;  3IQ5 A;  2YL3 A;  4JEB A;  2J8W A;  3U8P A;  4CJO A;  4JEA A;  3QW0 A;  3M4C A;  3HNL A;  4NC3 A;  1CGN A;  2QLA A;  2XL6 A;  2XLO A;  5JLI A;  1YYX A;  3DE9 A;  3NMJ A;  5B3I A;  3TOM A;  1YYJ A;  2YKZ A;  4ER9 A;  1QQ3 A;  4L6R A;  1LM3 B;  4EIY A;  3QVZ A;  1YZC A;  4U9E A;  1M6T A;  2YLD A;  4N6H A;  3VRC A;  1MQV A;  256B A;  2YLI A;  3FOP A;  2XLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...