3G50A

Crystal structure of nisod d3a mutant at 1.9 a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCALPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g50A00
1Q0MA 1Q0KA 1T6IA 3G4XA 4NCQA 3G4ZA 1Q0GA 1Q0DA 1Q0FA 1T6UA 3G50A 1T6QA
chains in the Genus database with same CATH superfamily
1V54C 1PD1A 2A1DD 3OA1A 4CJGA 3DM9B 4Q5SF 4P6IC 4JVSA 3UMIA 1Z3IX 3U9JA 2XM0A 4GYTA 5E3CA 5A6JA 3RKOF 4BJ5A 2L7AA 2J9UA 1ZHZA 1ZHXA 2P61A 2PBEA 1QKRA 3EZHA 3MX3A 4AL0A 1O3UA 1OW7A 5DLJA 3H2UA 3SXYA 2XS1A 2LD6A 3DMDA 4PK4A 1T6QA 1K04A 3CAXA 4PFPA 1T9KA 5B1BC 4G7ZF 4I3MA 4WGZA 4XPXA 2WZGA 3ZTZA 4IJJA 2J0XA 4O79A 3B0UX 3KL4A 2P7VA 4AL1A 4CDVA 3TULA 4PFOA 2DGJA 3AG3C 3QVYA 5COMA 1AVOB 1OKKA 3J06A 4MW8A 2ICWG 1TWHA 1FAPB 2D4UA 2YVKA 3H65A 2QE9A 3JRMO 4YL1A 4MVQA 2MWQA 4EBBA 1BR2A 5L0JA 4Q4ZF 2V3CC 2XXAB 5TJ5E 1Z23A 2GAQA 1OCZC 4CSAA 1LVKA 3TD7A 4U5HA 1J8MF 2JPUA 3UGPA 2R7VA 3O10A 1S7ZA 3R7CA 2YQYA 5L0CA 5FCLA 1NU7D 2EILC 4U5BE 4O6NA 1UFBA 3ZQVA 2PX0A 3RQEA 1S05A 1SF8A 3AOUA 1YAUO 3C63A 3W8IA 3LEVA 3JSEO 4AE4A 2PFDA 1D0XA 4N06A 4U9EA 3PMRA 4JTAB 4PJNA 3JYHA 2YL1A 2R7TA 4U5GA 1TR2A 1TFOB 3O55A 2AP3A 3A9CA 3GM3A 3Q6MA 4WGYA 2A0BA 1FMWA 5L0IA 2AU5A 1J8YF 4XPYA 3WG7C 4U5DE 1L7CA 4OD5A 1ZVZA 3QW1A 1W2WA 2EIMC 3GANA 3HKKA 4JEAA 4XWJA 5CI9A 1RJ9A 2OOCA 4BEMJ 4CS8C 2LP4A 2OJQA 1V55C 3ASNC 3GM2A 3HNKA 3JYYA 3R2PA 4OINF 3V5ZA 5KYXB 1JOGA 2ZXOA 5D92A 1NU9C 3E70C 3M4CA 1RKCA 3IQ6A 4E17A 1YYJA 3E9VA 1YA7O 5D91A 4R32A 4OIRF 2WVOA 4YT2A 5JVEA 4CSAC 3O39A 1Q0FA 3C8GA 1BBHA 5CIVA 4J7YA 3ZSUA 3AJMA 3EPVA 3HJCA 3QW0A 1C03A 1Y6DA 2KC3A 4XEFA 5KYNA 3NG1A 2CNWA 3EFOA 3NYLA 1U6HA 1SZIA 3VF0A 2R7UA 5K0IA 3MBGA 2EPNA 2B0JA 1KTMA 5BQHA 4PJMA 1HE1A 3DXJF 2KQ9A 2Q9AA 4IAOA 4BG0A 3U2MA 1WWPA 4C7OB 5IY5C 3OEOA 1AEPA 2XL6A 4EBKA 1LS4A 1XZPA 1LIHA 1Q0KA 4HEAJ 1E84A 1DOVA 4H4KC 4PJJA 3OWTA 5DS6A 2LFFA 2J45A 4RDAA 3QTHA 5KYUA 1Z7Qc 1BR1A 4H54A 4C3EA 1HMOA 1BZ4A 1T6IA 1IZMA 4CX9A 2XLDA 2XLOA 4Z9IA 3JTLO 4WABA 5AGFA 1D0ZA 2WVNA 4PJLA 4XQ1A 4RD9A 3MYFA 2H8AA 1TWGA 1ORYA 2OJED 4J32B 4KI2A 4MVSA 4O6YA 1KU2A 1WOLA 3DI5A 4C3DA 3ZIBA 3WAQA 1ST6A 3U3FA 3NMKA 4JW1A 4QI2A 4ANJA 3ECSA 4ULWA 2O9XA 3K1HA 1CPRA 3K33A 4BJ1A 2IXOA 3LJBA 2ZXPA 4HE8D 4PR9A 1O87A 1ZW3A 5COGA 2OQMA 2I8BA 3F46A 3IQCA 2Y39A 1TWAA 3RYLA 3T9OA 1FFHA 4JURI 4ZLDA 4C3BA 2H7OA 2J0WA 4MTFA 2W9YA 3JCUQ 1Q0MA 2YWAA 2CW0F 3SEOA 3M4BA 2H7VC 3S27A 1SYQA 1ZU5A 3CSKA 1OKKD 3Q7GA 3KMIA 1OCCC 4JTDB 4BJ6C 2KW3C 2P0NA 2RD9A 3CEXA 3JZ0A 3V5YA 3NMJA 4IARA 3ZG1A 1Q0DA 4ULVA 4D4NA 1LI7A 3L8JA 1LKXA 1H9GA 2WL8A 4EUKB 1M57C 2Y3GA 4E0HA 5BUOA 4KC9A 2PNOA 2NSGA 4JJGA 3RIPA 1TKNA 5L3VA 4GQHA 3RF3A 3JT1A 2EINC 3BRJA 1JRAA 2NPUA 2XL4A 4CS7A 2LQGA 4YJWA 1I4ZA 1HMDA 4L6RA 5B3IA 5A6BA 3LS1A 3WODF 3MFNA 3G4ZA 2OU6A 3NYMA 2R25A 4O7GA 3RVZA 4CS8A 3C62A 1CPQA 5F28E 4CDYA 1T6UA 1M6TA 1DOWA 4MTGA 2KSFA 4OIPF 4DBRA 4I1OB 1VYIA 5L0FA 1NSGB 2HFIA 2UUIA 2WVQA 4UDVA 3LESA 1FR0A 1NG1A 4CS9C 2YZSA 1NFOA 2G3KA 4NTAA 3SNHA 2A69F 2L81A 4DVYP 4YT8A 256BA 3ABLC 3Q7LA 1JMWA 3VM6A 3ZDLA 1YA9A 4P9FA 1JPJA 1A7VA 1WGWA 1V4AA 4MW3A 3U8VA 1K05A 5JP7A 2XSEA 3EH2A 4IB4A 4K7BA 2YEVA 3U9MA 1QZXA 2VB6A 3EJNA 1E2XA 3PDMP 3ITFA 2NUPB 4Z9JA 2FGYA 3SP1A 1FTSA 2GWWA 1JPNA 3U2LA 4IGGA 1FFTC 4YL0A 5JT4A 3AQCA 1QVXA 5CI8A 5HV9A 1XWJA 2CGEA 4N6CA 2GFHA 1R4TA 2HS5A 2WZFA 3IQTA 4M63A 3QMKA 2IM8A 3C8GD 3DD7A 3GORA 4BEJA 5KYYB 4C7OA 1E86A 3ATPA 3W8HA 4CIHA 3UNGC 1K40A 4LERA 2BC5A 1KNYA 1NBBA 2OEXA 3ABKC 2AWYA 2J9WA 3KH2A 3MYIA 4JKVA 4W8KA 2QNLA 3IEEA 2L6GA 1C02A 1EI7A 3SZRA 3K1IA 1VOMA 2R7QA 4XTKA 1ZHWA 2IXPA 2Q4FA 1ZU4A 2NG1A 3NRHA 2Q00A 1YVIA 3U0CA 1VTMP 4PACA 4U5CE 4FAPB 3DAFA 3G4XA 1VMAA 1L3PA 1FMVA 3RQGA 2QY9A 3HTKC 4RBNA 3TOMA 3W2VA 2XLMA 2Q7RA 4K1OA 5JLIA 4YWQA 3B29A 2L9JA 4MS2A 1LI5A 2PF4E 2X0CA 5KYWB 1ZHTA 4ZLCA 3TQOA 5L0HA 1IW7F 2XM4A 3DAGA 4EKWA 1OW6A 4MQ9F 1PD0A 4E7SA 1A0BA 3I5QA 4F4BA 3S0XA 3W2WA 2BE5F 5T3WA 2A6HF 1BR4A 2LIGA 3N2ZB 3GEIA 5JS5A 3EQLF 1YZCA 2GA0A 4LLCA 2C03A 2W4MA 4U9DA 2GDCA 3GWNA 1OW8A 1YLMA 4FWVA 4J7TA 1EKYA 2VCBA 3NKEA 2YL0A 3LS0A 1I5NA 1TQGA 2Y3HA 4BJ6A 3IQ5A 3EGDB 4DOZA 3FOOA 3LAYA 5HSWA 1NFNA 2PP4A 4G7OF 2HJ3A 3DKAA 3EHNA 3DM5A 4KNWA 3FOPA 4IWBA 5JRAA 1U89A 2KJGA 2PX3A 4B6IA 3FDQA 3K1IC 4DRJB 1NLXA 1YZAA 3RFYA 1QLEC 3DJUB 4YK5A 2Y3BA 2A0UA 2X51A 4N4WA 4JCZA 1A41A 2J46A 4MVMA 1OXKA 3HNJA 1MMDA 1OR3A 2J7PD 2WZLA 4I1MA 3EGXB 1SMYF 1MNEA 5F5FA 1H7IA 4OD4A 4BPMA 3H2VA 2HMQA 1F1MA 3CZ6A 3K66A 1YDIA 2F22A 2G62A 2R03A 4ONSA 4ER9A 4CS9A 1Z5ZA 3O6XA 2VCCA 2XXAA 4KNVA 2VCAA 4IRUA 3U5SA 3M1CB 4U5EE 2NUTB 3GEHA 2A6EF 5AC4A 3SXZA 2KK1A 1D0YA 2P1AA 4W8PA 4X0RA 3T6BA 1ZYRF 4BJTA 2R7XA 2J7PA 2Q9CA 1GS9A 3TK0A 2CDQA 2AWCA 1M2VB 2YLDA 1MMGA 4OIQF 1Z6AA 4IAQA 1HE9A 4N6HA 4XEVA 1MNDA 3TJ5A 3V5XA 2YLIA 5E2QA 1VK5A 2Q3TA 5EK0A 3WHNA 4AK9A 1OCRC 1QQ3A 4D4XA 3IPMO 1SR2A 2HUJA 2ZPAA 4MVZA 5EGYA 4AX2A 2LK4A 3DE9A 1Z63A 2Q9BA 2MHRA 1PV3A 5DS5A 3FHDA 2J9BA 3GODA 3ABMC 2KGOA 5KYYA 1G4WR 2YLGA 1M56C 1D1CA 4CDAA 1HW1A 1HY5A 3HNIA 3QVZA 4HFKB 4YL3A 1VB5A 4CIPA 2QTVA 1GGQA 3T6GB 2B0HA 3EZIA 5B3SC 3AG4C 3S90A 3B0PA 2YHSA 2OEVA 3C7JA 3AGTA 1N1CA 2C04A 3B0VC 1HW2A 3NYJA 5AC5A 2E87A 1WN0A 3FMSA 1Q0GA 4MNDA 1VLTA 2J8WA 3L0IA 1YJGA 1APCA 5KYXA 3SXMA 2NSFA 4FESA 3VRCA 1TFKB 4MVOA 4NTFA 3GWLA 4MVUA 1FNTc 2EPOA 1YYXA 5FZTA 5L0GA 5KYUB 2H7BA 2W45A 4QI0A 1JAFA 5KYWA 2RSEB 2ZD9A 4KBLA 4DJ9A 2CYDA 1G5ZA 2EIJC 2V26A 1RKEB 2VC9A 2R9RB 1XZQA 2YL3A 2VASA 3AGUA 2YL7A 3JRTA 1NZEA 3LNMB 1D1AA 2OCCC 2ZXWC 3T4RA 2M64A 1OXBA 3KKBA 3UGOA 1RMVA 3KPHA 1T01A 1ZHYA 4CJOA 3HNLA 3GEEA 2HKVA 3K7DA 2M4EA 3EH1A 4JC7A 3V7OA 3EG9B 4A4AA 2R7RA 2XLWA 1PCXA 2DYRC 5E33A 3UR3C 5E3AA 1LE2A 4XEKA 1E83A 2KYHA 3EGDA 3RW0A 3W4YA 2MYSA 2Z15A 5GPGB 3UMHA 3M79A 1JR8A 2EPKX 2EPLX 1VLSA 1Y4CA 3L1MA 3DE8A 1R5ID 2CNWD 3RH3A 3GM1A 5DQZA 3AG2C 2HV7A 1B68A 3MLGA 4K0DA 5DS4A 5A6KA 4YN0B 3S84A 1UG7A 1BDJB 4FX5A 3LLIA 4O6MA 4XLNF 4P9TA 1G8XA 4MVRA 3SXKA 1MQVA 4E7ZA 2IXNA 4EIYA 1E85A 2HMZA 2IBFA 3Q6NA 1V74B 1ORJA 2YKZA 4NCQA 4U5FE 1VYKA 2CCYA 5JSLA 1LE4A 3A11A 3EGXA 4OIOF 4BJ5C 2IXMA 3DZAA 2DYSC 5L3QA 1ZZPA 3RQFA 4EWCA 4WJ0A 3BEHA 1D1BA 3FAPB 1A7DA 1H6GA 2XL8A 4NC3A 1OR2A 2QUPA 2NUTA 2IYLD 2Y3DA 2HSBA 4YT4A 2JX0A 3TOLA 1EQ1A 4EBJA 3I5PA 1M2VA 4DRHB 3DJNB 4YT5A 3K6BA 3VAYA 5A6AA 5T1DB 1LPEA 3KYJA 3NMIA 4DXWA 4G7HF 2UUHA 1U0BB 3PCVA 2R7SA 3NKDA 1O5HA 5COFA 4XLPF 2L6FA 5F5HA 5L0DA 4DBQA 2VH3A 5BQGA 3POVA 2ASRA 2DI3A 1CGOA 2OG2A 2R7OA 1T5OA 1C17M 2R05A 3IHUA 4LDQA 3ZC4A 1WATA 2A68F 4MTOA 2R02A 4NY3A 2HJMA 3RVYA 2LCHA 5A69A 4QDLA 4CBEA 4DRIB 4JZAA 4G78A 3L34A 2XLVA 4NTBA 4AE4B 4LDKA 3US6A 1I4YA 1OCOC 2ZXRA 1WTYA 3C18A 1CGNA 1TWCA 3X2QC 4E18A 3ZQYA 3LEOA 3AG1C 2HZ8A 4JE9A 4JIOA 3EHMA 2LSEA 3FXHA 4GEHA 2YRFA 3TJ6A 5JUAA 2R7WA 1LM3B 4NQFA 2QLAA 4JTCB 3SYNA 1QPUA 1GM5A 3L8IA 2WB7A 1ZW2A 3B71A 4G0HA 4HFFB 3VYWA 1LS1A 1RXQA 2I15A 2KNHA 2P6VA 3S9OA 2OKUA 4XPWA 4E0IA 1CGME 1RJ9B 2D5RB 2EPMX 2G3VA 3C8ZA 2JD3A 3I4UA 3ZVRA 4DVZA 5A6BD 3X1OA 2XLEA 4JRZA 4LDRA 3S28A 4A2NB 1RKEA 1OQCA 4JEBA 3B9QA 2LFDA 3U3BA 2ETSA 4J30B 5EHHA 3T6JA 4I44A 2NUPA 3G50A 2BL2A 3JSZA 3LUTB 1M2OA 2XRHA 2XLHA 2XS8A 3DWWA 2W4BA 3UMKA 1GQAA 2HV6A 1H9TA 4LACB 1G4US 3LNRA 3C8GB 3S29A 1QSPA 1MMNA 2AVKA 3EG9A 4LLEA 4JCHA 1WASA 4Z9HA 5B1AC 4EHPA 5DQTA 3N24A 3N0TA 4JJFA 1A7EA 2J9VA 3F47A 3EFOB 3FVYA 5T3TA 3U8PA 3AQBA 2Y69C 3ZTMA 1EA8A 2L6HA 1MMAA 2EIKC 2FAPB 3FAJA 3M15A 2DB4A 3CQZA 3PHF2 3LLKA 5DVWA 3KYIA 4Q7CA 2TMVP 1ORSC 3ASOC 2FFHA 5BQIA 2IOQA 2HSQA 3ZWIA 1RCPA 3QZCA 1AUEA 3HLZA 3NDBB 1YARO
chains in the Genus database with same CATH topology
1Q0MA 1Q0KA 1T6IA 3G4XA 4NCQA 3G4ZA 1Q0GA 1Q0DA 1Q0FA 1T6UA 3G50A 1T6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0M A;  1Q0K A;  1T6I A;  3G4X A;  4NCQ A;  3G4Z A;  1Q0G A;  1Q0D A;  1Q0F A;  1T6U A;  3G50 A;  1T6Q A; 
#chains in the Genus database with same CATH topology
 1V54 C;  1PD1 A;  2A1D D;  3OA1 A;  4CJG A;  3DM9 B;  4Q5S F;  4P6I C;  4JVS A;  3UMI A;  1Z3I X;  3U9J A;  2XM0 A;  4GYT A;  5E3C A;  5A6J A;  3RKO F;  4BJ5 A;  2L7A A;  2J9U A;  1ZHZ A;  1ZHX A;  2P61 A;  2PBE A;  1QKR A;  3EZH A;  3MX3 A;  4AL0 A;  1O3U A;  1OW7 A;  5DLJ A;  3H2U A;  3SXY A;  2XS1 A;  2LD6 A;  3DMD A;  4PK4 A;  1T6Q A;  1K04 A;  3CAX A;  4PFP A;  1T9K A;  5B1B C;  4G7Z F;  4I3M A;  4WGZ A;  4XPX A;  2WZG A;  3ZTZ A;  4IJJ A;  2J0X A;  4O79 A;  3B0U X;  3KL4 A;  2P7V A;  4AL1 A;  4CDV A;  3TUL A;  4PFO A;  2DGJ A;  3AG3 C;  3QVY A;  5COM A;  1AVO B;  1OKK A;  3J06 A;  4MW8 A;  2ICW G;  1TWH A;  1FAP B;  2D4U A;  2YVK A;  3H65 A;  2QE9 A;  3JRM O;  4YL1 A;  4MVQ A;  2MWQ A;  4EBB A;  1BR2 A;  5L0J A;  4Q4Z F;  2V3C C;  2XXA B;  5TJ5 E;  1Z23 A;  2GAQ A;  1OCZ C;  4CSA A;  1LVK A;  3TD7 A;  4U5H A;  1J8M F;  2JPU A;  3UGP A;  2R7V A;  3O10 A;  1S7Z A;  3R7C A;  2YQY A;  5L0C A;  5FCL A;  1NU7 D;  2EIL C;  4U5B E;  4O6N A;  1UFB A;  3ZQV A;  2PX0 A;  3RQE A;  1S05 A;  1SF8 A;  3AOU A;  1YAU O;  3C63 A;  3W8I A;  3LEV A;  3JSE O;  4AE4 A;  2PFD A;  1D0X A;  4N06 A;  4U9E A;  3PMR A;  4JTA B;  4PJN A;  3JYH A;  2YL1 A;  2R7T A;  4U5G A;  1TR2 A;  1TFO B;  3O55 A;  2AP3 A;  3A9C A;  3GM3 A;  3Q6M A;  4WGY A;  2A0B A;  1FMW A;  5L0I A;  2AU5 A;  1J8Y F;  4XPY A;  3WG7 C;  4U5D E;  1L7C A;  4OD5 A;  1ZVZ A;  3QW1 A;  1W2W A;  2EIM C;  3GAN A;  3HKK A;  4JEA A;  4XWJ A;  5CI9 A;  1RJ9 A;  2OOC A;  4BEM J;  4CS8 C;  2LP4 A;  2OJQ A;  1V55 C;  3ASN C;  3GM2 A;  3HNK A;  3JYY A;  3R2P A;  4OIN F;  3V5Z A;  5KYX B;  1JOG A;  2ZXO A;  5D92 A;  1NU9 C;  3E70 C;  3M4C A;  1RKC A;  3IQ6 A;  4E17 A;  1YYJ A;  3E9V A;  1YA7 O;  5D91 A;  4R32 A;  4OIR F;  2WVO A;  4YT2 A;  5JVE A;  4CSA C;  3O39 A;  1Q0F A;  3C8G A;  1BBH A;  5CIV A;  4J7Y A;  3ZSU A;  3AJM A;  3EPV A;  3HJC A;  3QW0 A;  1C03 A;  1Y6D A;  2KC3 A;  4XEF A;  5KYN A;  3NG1 A;  2CNW A;  3EFO A;  3NYL A;  1U6H A;  1SZI A;  3VF0 A;  2R7U A;  5K0I A;  3MBG A;  2EPN A;  2B0J A;  1KTM A;  5BQH A;  4PJM A;  1HE1 A;  3DXJ F;  2KQ9 A;  2Q9A A;  4IAO A;  4BG0 A;  3U2M A;  1WWP A;  4C7O B;  5IY5 C;  3OEO A;  1AEP A;  2XL6 A;  4EBK A;  1LS4 A;  1XZP A;  1LIH A;  1Q0K A;  4HEA J;  1E84 A;  1DOV A;  4H4K C;  4PJJ A;  3OWT A;  5DS6 A;  2LFF A;  2J45 A;  4RDA A;  3QTH A;  5KYU A;  1Z7Q c;  1BR1 A;  4H54 A;  4C3E A;  1HMO A;  1BZ4 A;  1T6I A;  1IZM A;  4CX9 A;  2XLD A;  2XLO A;  4Z9I A;  3JTL O;  4WAB A;  5AGF A;  1D0Z A;  2WVN A;  4PJL A;  4XQ1 A;  4RD9 A;  3MYF A;  2H8A A;  1TWG A;  1ORY A;  2OJE D;  4J32 B;  4KI2 A;  4MVS A;  4O6Y A;  1KU2 A;  1WOL A;  3DI5 A;  4C3D A;  3ZIB A;  3WAQ A;  1ST6 A;  3U3F A;  3NMK A;  4JW1 A;  4QI2 A;  4ANJ A;  3ECS A;  4ULW A;  2O9X A;  3K1H A;  1CPR A;  3K33 A;  4BJ1 A;  2IXO A;  3LJB A;  2ZXP A;  4HE8 D;  4PR9 A;  1O87 A;  1ZW3 A;  5COG A;  2OQM A;  2I8B A;  3F46 A;  3IQC A;  2Y39 A;  1TWA A;  3RYL A;  3T9O A;  1FFH A;  4JUR I;  4ZLD A;  4C3B A;  2H7O A;  2J0W A;  4MTF A;  2W9Y A;  3JCU Q;  1Q0M A;  2YWA A;  2CW0 F;  3SEO A;  3M4B A;  2H7V C;  3S27 A;  1SYQ A;  1ZU5 A;  3CSK A;  1OKK D;  3Q7G A;  3KMI A;  1OCC C;  4JTD B;  4BJ6 C;  2KW3 C;  2P0N A;  2RD9 A;  3CEX A;  3JZ0 A;  3V5Y A;  3NMJ A;  4IAR A;  3ZG1 A;  1Q0D A;  4ULV A;  4D4N A;  1LI7 A;  3L8J A;  1LKX A;  1H9G A;  2WL8 A;  4EUK B;  1M57 C;  2Y3G A;  4E0H A;  5BUO A;  4KC9 A;  2PNO A;  2NSG A;  4JJG A;  3RIP A;  1TKN A;  5L3V A;  4GQH A;  3RF3 A;  3JT1 A;  2EIN C;  3BRJ A;  1JRA A;  2NPU A;  2XL4 A;  4CS7 A;  2LQG A;  4YJW A;  1I4Z A;  1HMD A;  4L6R A;  5B3I A;  5A6B A;  3LS1 A;  3WOD F;  3MFN A;  3G4Z A;  2OU6 A;  3NYM A;  2R25 A;  4O7G A;  3RVZ A;  4CS8 A;  3C62 A;  1CPQ A;  5F28 E;  4CDY A;  1T6U A;  1M6T A;  1DOW A;  4MTG A;  2KSF A;  4OIP F;  4DBR A;  4I1O B;  1VYI A;  5L0F A;  1NSG B;  2HFI A;  2UUI A;  2WVQ A;  4UDV A;  3LES A;  1FR0 A;  1NG1 A;  4CS9 C;  2YZS A;  1NFO A;  2G3K A;  4NTA A;  3SNH A;  2A69 F;  2L81 A;  4DVY P;  4YT8 A;  256B A;  3ABL C;  3Q7L A;  1JMW A;  3VM6 A;  3ZDL A;  1YA9 A;  4P9F A;  1JPJ A;  1A7V A;  1WGW A;  1V4A A;  4MW3 A;  3U8V A;  1K05 A;  5JP7 A;  2XSE A;  3EH2 A;  4IB4 A;  4K7B A;  2YEV A;  3U9M A;  1QZX A;  2VB6 A;  3EJN A;  1E2X A;  3PDM P;  3ITF A;  2NUP B;  4Z9J A;  2FGY A;  3SP1 A;  1FTS A;  2GWW A;  1JPN A;  3U2L A;  4IGG A;  1FFT C;  4YL0 A;  5JT4 A;  3AQC A;  1QVX A;  5CI8 A;  5HV9 A;  1XWJ A;  2CGE A;  4N6C A;  2GFH A;  1R4T A;  2HS5 A;  2WZF A;  3IQT A;  4M63 A;  3QMK A;  2IM8 A;  3C8G D;  3DD7 A;  3GOR A;  4BEJ A;  5KYY B;  4C7O A;  1E86 A;  3ATP A;  3W8H A;  4CIH A;  3UNG C;  1K40 A;  4LER A;  2BC5 A;  1KNY A;  1NBB A;  2OEX A;  3ABK C;  2AWY A;  2J9W A;  3KH2 A;  3MYI A;  4JKV A;  4W8K A;  2QNL A;  3IEE A;  2L6G A;  1C02 A;  1EI7 A;  3SZR A;  3K1I A;  1VOM A;  2R7Q A;  4XTK A;  1ZHW A;  2IXP A;  2Q4F A;  1ZU4 A;  2NG1 A;  3NRH A;  2Q00 A;  1YVI A;  3U0C A;  1VTM P;  4PAC A;  4U5C E;  4FAP B;  3DAF A;  3G4X A;  1VMA A;  1L3P A;  1FMV A;  3RQG A;  2QY9 A;  3HTK C;  4RBN A;  3TOM A;  3W2V A;  2XLM A;  2Q7R A;  4K1O A;  5JLI A;  4YWQ A;  3B29 A;  2L9J A;  4MS2 A;  1LI5 A;  2PF4 E;  2X0C A;  5KYW B;  1ZHT A;  4ZLC A;  3TQO A;  5L0H A;  1IW7 F;  2XM4 A;  3DAG A;  4EKW A;  1OW6 A;  4MQ9 F;  1PD0 A;  4E7S A;  1A0B A;  3I5Q A;  4F4B A;  3S0X A;  3W2W A;  2BE5 F;  5T3W A;  2A6H F;  1BR4 A;  2LIG A;  3N2Z B;  3GEI A;  5JS5 A;  3EQL F;  1YZC A;  2GA0 A;  4LLC A;  2C03 A;  2W4M A;  4U9D A;  2GDC A;  3GWN A;  1OW8 A;  1YLM A;  4FWV A;  4J7T A;  1EKY A;  2VCB A;  3NKE A;  2YL0 A;  3LS0 A;  1I5N A;  1TQG A;  2Y3H A;  4BJ6 A;  3IQ5 A;  3EGD B;  4DOZ A;  3FOO A;  3LAY A;  5HSW A;  1NFN A;  2PP4 A;  4G7O F;  2HJ3 A;  3DKA A;  3EHN A;  3DM5 A;  4KNW A;  3FOP A;  4IWB A;  5JRA A;  1U89 A;  2KJG A;  2PX3 A;  4B6I A;  3FDQ A;  3K1I C;  4DRJ B;  1NLX A;  1YZA A;  3RFY A;  1QLE C;  3DJU B;  4YK5 A;  2Y3B A;  2A0U A;  2X51 A;  4N4W A;  4JCZ A;  1A41 A;  2J46 A;  4MVM A;  1OXK A;  3HNJ A;  1MMD A;  1OR3 A;  2J7P D;  2WZL A;  4I1M A;  3EGX B;  1SMY F;  1MNE A;  5F5F A;  1H7I A;  4OD4 A;  4BPM A;  3H2V A;  2HMQ A;  1F1M A;  3CZ6 A;  3K66 A;  1YDI A;  2F22 A;  2G62 A;  2R03 A;  4ONS A;  4ER9 A;  4CS9 A;  1Z5Z A;  3O6X A;  2VCC A;  2XXA A;  4KNV A;  2VCA A;  4IRU A;  3U5S A;  3M1C B;  4U5E E;  2NUT B;  3GEH A;  2A6E F;  5AC4 A;  3SXZ A;  2KK1 A;  1D0Y A;  2P1A A;  4W8P A;  4X0R A;  3T6B A;  1ZYR F;  4BJT A;  2R7X A;  2J7P A;  2Q9C A;  1GS9 A;  3TK0 A;  2CDQ A;  2AWC A;  1M2V B;  2YLD A;  1MMG A;  4OIQ F;  1Z6A A;  4IAQ A;  1HE9 A;  4N6H A;  4XEV A;  1MND A;  3TJ5 A;  3V5X A;  2YLI A;  5E2Q A;  1VK5 A;  2Q3T A;  5EK0 A;  3WHN A;  4AK9 A;  1OCR C;  1QQ3 A;  4D4X A;  3IPM O;  1SR2 A;  2HUJ A;  2ZPA A;  4MVZ A;  5EGY A;  4AX2 A;  2LK4 A;  3DE9 A;  1Z63 A;  2Q9B A;  2MHR A;  1PV3 A;  5DS5 A;  3FHD A;  2J9B A;  3GOD A;  3ABM C;  2KGO A;  5KYY A;  1G4W R;  2YLG A;  1M56 C;  1D1C A;  4CDA A;  1HW1 A;  1HY5 A;  3HNI A;  3QVZ A;  4HFK B;  4YL3 A;  1VB5 A;  4CIP A;  2QTV A;  1GGQ A;  3T6G B;  2B0H A;  3EZI A;  5B3S C;  3AG4 C;  3S90 A;  3B0P A;  2YHS A;  2OEV A;  3C7J A;  3AGT A;  1N1C A;  2C04 A;  3B0V C;  1HW2 A;  3NYJ A;  5AC5 A;  2E87 A;  1WN0 A;  3FMS A;  1Q0G A;  4MND A;  1VLT A;  2J8W A;  3L0I A;  1YJG A;  1APC A;  5KYX A;  3SXM A;  2NSF A;  4FES A;  3VRC A;  1TFK B;  4MVO A;  4NTF A;  3GWL A;  4MVU A;  1FNT c;  2EPO A;  1YYX A;  5FZT A;  5L0G A;  5KYU B;  2H7B A;  2W45 A;  4QI0 A;  1JAF A;  5KYW A;  2RSE B;  2ZD9 A;  4KBL A;  4DJ9 A;  2CYD A;  1G5Z A;  2EIJ C;  2V26 A;  1RKE B;  2VC9 A;  2R9R B;  1XZQ A;  2YL3 A;  2VAS A;  3AGU A;  2YL7 A;  3JRT A;  1NZE A;  3LNM B;  1D1A A;  2OCC C;  2ZXW C;  3T4R A;  2M64 A;  1OXB A;  3KKB A;  3UGO A;  1RMV A;  3KPH A;  1T01 A;  1ZHY A;  4CJO A;  3HNL A;  3GEE A;  2HKV A;  3K7D A;  2M4E A;  3EH1 A;  4JC7 A;  3V7O A;  3EG9 B;  4A4A A;  2R7R A;  2XLW A;  1PCX A;  2DYR C;  5E33 A;  3UR3 C;  5E3A A;  1LE2 A;  4XEK A;  1E83 A;  2KYH A;  3EGD A;  3RW0 A;  3W4Y A;  2MYS A;  2Z15 A;  5GPG B;  3UMH A;  3M79 A;  1JR8 A;  2EPK X;  2EPL X;  1VLS A;  1Y4C A;  3L1M A;  3DE8 A;  1R5I D;  2CNW D;  3RH3 A;  3GM1 A;  5DQZ A;  3AG2 C;  2HV7 A;  1B68 A;  3MLG A;  4K0D A;  5DS4 A;  5A6K A;  4YN0 B;  3S84 A;  1UG7 A;  1BDJ B;  4FX5 A;  3LLI A;  4O6M A;  4XLN F;  4P9T A;  1G8X A;  4MVR A;  3SXK A;  1MQV A;  4E7Z A;  2IXN A;  4EIY A;  1E85 A;  2HMZ A;  2IBF A;  3Q6N A;  1V74 B;  1ORJ A;  2YKZ A;  4NCQ A;  4U5F E;  1VYK A;  2CCY A;  5JSL A;  1LE4 A;  3A11 A;  3EGX A;  4OIO F;  4BJ5 C;  2IXM A;  3DZA A;  2DYS C;  5L3Q A;  1ZZP A;  3RQF A;  4EWC A;  4WJ0 A;  3BEH A;  1D1B A;  3FAP B;  1A7D A;  1H6G A;  2XL8 A;  4NC3 A;  1OR2 A;  2QUP A;  2NUT A;  2IYL D;  2Y3D A;  2HSB A;  4YT4 A;  2JX0 A;  3TOL A;  1EQ1 A;  4EBJ A;  3I5P A;  1M2V A;  4DRH B;  3DJN B;  4YT5 A;  3K6B A;  3VAY A;  5A6A A;  5T1D B;  1LPE A;  3KYJ A;  3NMI A;  4DXW A;  4G7H F;  2UUH A;  1U0B B;  3PCV A;  2R7S A;  3NKD A;  1O5H A;  5COF A;  4XLP F;  2L6F A;  5F5H A;  5L0D A;  4DBQ A;  2VH3 A;  5BQG A;  3POV A;  2ASR A;  2DI3 A;  1CGO A;  2OG2 A;  2R7O A;  1T5O A;  1C17 M;  2R05 A;  3IHU A;  4LDQ A;  3ZC4 A;  1WAT A;  2A68 F;  4MTO A;  2R02 A;  4NY3 A;  2HJM A;  3RVY A;  2LCH A;  5A69 A;  4QDL A;  4CBE A;  4DRI B;  4JZA A;  4G78 A;  3L34 A;  2XLV A;  4NTB A;  4AE4 B;  4LDK A;  3US6 A;  1I4Y A;  1OCO C;  2ZXR A;  1WTY A;  3C18 A;  1CGN A;  1TWC A;  3X2Q C;  4E18 A;  3ZQY A;  3LEO A;  3AG1 C;  2HZ8 A;  4JE9 A;  4JIO A;  3EHM A;  2LSE A;  3FXH A;  4GEH A;  2YRF A;  3TJ6 A;  5JUA A;  2R7W A;  1LM3 B;  4NQF A;  2QLA A;  4JTC B;  3SYN A;  1QPU A;  1GM5 A;  3L8I A;  2WB7 A;  1ZW2 A;  3B71 A;  4G0H A;  4HFF B;  3VYW A;  1LS1 A;  1RXQ A;  2I15 A;  2KNH A;  2P6V A;  3S9O A;  2OKU A;  4XPW A;  4E0I A;  1CGM E;  1RJ9 B;  2D5R B;  2EPM X;  2G3V A;  3C8Z A;  2JD3 A;  3I4U A;  3ZVR A;  4DVZ A;  5A6B D;  3X1O A;  2XLE A;  4JRZ A;  4LDR A;  3S28 A;  4A2N B;  1RKE A;  1OQC A;  4JEB A;  3B9Q A;  2LFD A;  3U3B A;  2ETS A;  4J30 B;  5EHH A;  3T6J A;  4I44 A;  2NUP A;  3G50 A;  2BL2 A;  3JSZ A;  3LUT B;  1M2O A;  2XRH A;  2XLH A;  2XS8 A;  3DWW A;  2W4B A;  3UMK A;  1GQA A;  2HV6 A;  1H9T A;  4LAC B;  1G4U S;  3LNR A;  3C8G B;  3S29 A;  1QSP A;  1MMN A;  2AVK A;  3EG9 A;  4LLE A;  4JCH A;  1WAS A;  4Z9H A;  5B1A C;  4EHP A;  5DQT A;  3N24 A;  3N0T A;  4JJF A;  1A7E A;  2J9V A;  3F47 A;  3EFO B;  3FVY A;  5T3T A;  3U8P A;  3AQB A;  2Y69 C;  3ZTM A;  1EA8 A;  2L6H A;  1MMA A;  2EIK C;  2FAP B;  3FAJ A;  3M15 A;  2DB4 A;  3CQZ A;  3PHF 2;  3LLK A;  5DVW A;  3KYI A;  4Q7C A;  2TMV P;  1ORS C;  3ASO C;  2FFH A;  5BQI A;  2IOQ A;  2HSQ A;  3ZWI A;  1RCP A;  3QZC A;  1AUE A;  3HLZ A;  3NDB B;  1YAR O; 
#chains in the Genus database with same CATH homology
 1Q0M A;  1Q0K A;  1T6I A;  3G4X A;  4NCQ A;  3G4Z A;  1Q0G A;  1Q0D A;  1Q0F A;  1T6U A;  3G50 A;  1T6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...