3G50A

Crystal structure of nisod d3a mutant at 1.9 a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCALPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g50A00
1Q0FA 1T6IA 1Q0MA 1T6QA 4NCQA 3G50A 1Q0DA 1Q0KA 1T6UA 3G4ZA 3G4XA 1Q0GA
chains in the Genus database with same CATH superfamily
4E7ZA 3U8PA 5FZTA 3NMIA 4U9EA 4JZAA 2LFDA 2EPMX 3EHMA 4CS9C 3G50A 3OEOA 4LDKA 4JTCB 1NLXA 4JJFA 2CCYA 4PK4A 2IXPA 2HUJA 1ZU5A 2J9UA 5F5HA 4G7OF 1OW7A 1A41A 4LDQA 3T4RA 3CSKA 5KYWA 1HE1A 2OKUA 3C8GB 1DOWA 2OEVA 1MMDA 1M2VA 4BEMJ 1QLEC 2R7QA 4Q7CA 1SR2A 3ZVRA 1LVKA 2ZXPA 5D92A 3RW0A 2OJED 4DJ9A 3EHNA 2ICWG 5AC4A 3RF3A 4JCHA 4ULVA 1T5OA 3I5QA 3AQCA 2IM8A 3RVZA 4IAQA 3DJUB 1M57C 3HTKC 1W2WA 3R2PA 1MMGA 2WVNA 3U9MA 2VCAA 4X0RA 3LAYA 5KYUA 3ASOC 3S27A 3SXYA 1V74B 3KKBA 4U5EE 1VTMP 4C7OA 4ZLCA 3NKDA 4FWVA 5E2QA 5L3QA 3U2MA 1JAFA 4IWBA 2PF4E 3Q7GA 5DVWA 3S84A 3K1IA 5DQTA 5COMA 4C3EA 1NU7D 4I1MA 4C3BA 3AG4C 3JRMO 4ZLDA 2Q7RA 1K05A 1XZPA 1HW2A 3BEHA 4GYTA 3WAQA 1T01A 2OEXA 4RDAA 3KYIA 1FR0A 2JPUA 1OCRC 3A9CA 3EGDB 1NFOA 2CNWA 4GQHA 4ER9A 3EGXA 1NU9C 3M79A 4MVOA 2DI3A 1JR8A 3NKEA 4YWQA 3TOLA 2NUPB 1VMAA 4HEAJ 4XEFA 1EQ1A 2FAPB 2UUHA 3DKAA 4E0HA 4DVZA 1GGQA 3FMSA 2AVKA 3NMJA 2C04A 3RYLA 4DOZA 1D0YA 2CW0F 5JT4A 2ZXRA 1EI7A 3K1HA 4CDYA 2D4UA 3RVYA 4YT8A 3KH2A 3GM3A 4WJ0A 2R7VA 3MYFA 2XL8A 3SP1A 2CNWD 3V5ZA 1AUEA 1E2XA 1K40A 2P6VA 1ZHZA 3ZQYA 4N06A 2BC5A 2R7TA 4U5GA 1A0BA 2H7BA 2XXAA 4XPYA 4P9FA 2J9BA 1M6TA 2IXOA 3L8JA 3TULA 3TK0A 2PBEA 1NG1A 3E70C 4JVSA 5D91A 1H6GA 3KYJA 3A11A 2KQ9A 1ZW3A 3LEOA 5T1DB 1T6QA 4OIQF 2VCCA 2KC3A 3CZ6A 1RCPA 5L0GA 1OR2A 2HZ8A 5HV9A 3PHF2 4EBKA 1U6HA 2IBFA 2XLHA 4XLNF 3NDBB 4CDAA 3C8GA 4O7GA 2Y3BA 3IQCA 4EIYA 3IPMO 4FX5A 1AVOB 1K04A 2YL3A 4HFFB 1IW7F 4CJGA 2XM0A 3L8IA 2R05A 3J06A 3Q6MA 2EIJC 2Q9AA 3NYLA 4E7SA 1LE2A 3GWLA 3SXZA 3KPHA 1D0XA 1G4US 1Q0KA 3QZCA 1ZVZA 4N6HA 1OW6A 3V5XA 2R7WA 2QY9A 2R7SA 1OCZC 3C18A 4MVUA 1FTSA 4MW3A 4YT4A 1ZW2A 2A6HF 1T6IA 4J30B 1ZU4A 2YWAA 4E18A 2RD9A 2L7AA 4BEJA 4EWCA 2NSGA 3S29A 3C8GD 3UMIA 2TMVP 3WHNA 1E83A 1MNEA 1TQGA 2G3VA 3EPVA 1WWPA 3LJBA 5EK0A 2H7OA 3FXHA 3N0TA 2KJGA 4MTGA 2GFHA 4J32B 1VLSA 1TWAA 2A0BA 2YQYA 5FCLA 4CIHA 3MYIA 3MFNA 3K66A 5JLIA 3FHDA 4JEBA 2Q3TA 4L6RA 1LI7A 1V4AA 5BQHA 3W8HA 1MQVA 3NRHA 3TJ5A 2Y3GA 1WGWA 4AK9A 1A7VA 1TWCA 1O3UA 2WZFA 3FOPA 3HKKA 2W4MA 4PJMA 3H2UA 3ZTZA 2AWYA 3DAFA 3ZG1A 3EZHA 2V3CC 1ORJA 3GEHA 3EFOB 3VAYA 3ZDLA 2NSFA 1OXKA 3PCVA 1Z23A 3EH2A 2PNOA 5A6JA 2LFFA 1OW8A 1WN0A 4AE4A 2CYDA 2X0CA 2J8WA 3FAPB 4PR9A 3QMKA 4N4WA 3MX3A 3RQFA 1OR3A 4DXWA 1TFOB 2D5RB 1TWHA 1Z63A 1ZHWA 3ABMC 3IEEA 2HMQA 2OOCA 1GQAA 3NMKA 3ECSA 3X2QC 1OQCA 2W9YA 3BRJA 4JTAB 3DMDA 4XLPF 1NSGB 5L0IA 4J7YA 2KYHA 4OIOF 4HFKB 1YDIA 2LCHA 1WATA 4WGZA 4BJTA 2M4EA 4JCZA 1F1MA 4NC3A 4NTFA 3UR3C 1NFNA 2BE5F 2LK4A 4EHPA 1J8YF 3RQEA 1ZYRF 1HW1A 1FMVA 1I4YA 2QLAA 3ASNC 3HNKA 1MNDA 3VRCA 4MVMA 1S05A 1RXQA 3DM9B 1Q0DA 1ZHYA 1ZHXA 3JYYA 3O6XA 3Q6NA 3O39A 1BR2A 4W8KA 2XL6A 1YZCA 4O6NA 4YL0A 2NUTA 4MTOA 3IQTA 3JRTA 2XL4A 1V54C 1D0ZA 5JRAA 1IZMA 2EIMC 1Z7Qc 4NQFA 4BG0A 1A7DA 4P6IC 2XLEA 3B9QA 5DS5A 1LI5A 1LS4A 3ABLC 4CBEA 3M1CB 5BUOA 3N2ZB 2XLDA 5IY5C 2A1DD 2R25A 1JOGA 3DM5A 5L0JA 5KYYB 1JRAA 1BR4A 2CGEA 3AG2C 1CGNA 1LIHA 2Q00A 2YEVA 4DRHB 5F28E 2YZSA 4JTDB 3F46A 2H8AA 4I1OB 2VB6A 3RKOF 1AEPA 2B0JA 2Y3DA 1PCXA 3JTLO 4JEAA 1C03A 1PV3A 2DGJA 2J46A 3W4YA 4U9DA 4A4AA 3PDMP 2ZPAA 5L0DA 1HE9A 5T3TA 1QQ3A 1BZ4A 1ST6A 2WZLA 3GEIA 4KC9A 5JSLA 1JMWA 1HY5A 2DYRC 4EBJA 5A69A 2ASRA 1NBBA 3K6BA 1YVIA 4MS2A 2F22A 4FAPB 4JKVA 3S9OA 1YA7O 1U89A 4I44A 4YK5A 4OINF 2QNLA 5CI8A 4QI0A 3S0XA 1DOVA 4JURI 4CS7A 1KTMA 3LS1A 1G5ZA 1TFKB 2C03A 4BJ5A 3UGPA 1VYKA 2WVQA 3TQOA 4PJLA 5TJ5E 1VLTA 2IYLD 2EPLX 4M63A 4YT2A 4MW8A 1SZIA 4U5BE 3W8IA 5L0CA 3FDQA 4CSAA 1EKYA 4YL1A 4U5DE 1C02A 4E0IA 5KYXA 3K7DA 1J8MF 3AG3C 3B29A 2VH3A 1GM5A 3TOMA 1HMOA 3C8ZA 4RBNA 3RFYA 1TKNA 2V26A 3UMHA 1L7CA 1RKEB 4JIOA 3ITFA 3CEXA 3JZ0A 3UMKA 3PMRA 1Q0MA 5KYWB 3X1OA 5CI9A 4CS8A 1YZAA 3EH1A 3SZRA 4YJWA 1H9GA 2KNHA 3AGUA 1MMAA 4KNWA 2I15A 1I4ZA 2DYSC 2JX0A 3LS0A 1VOMA 1LM3B 4O6MA 4XEVA 3U5SA 1FNTc 4Q4ZF 3L0IA 2KK1A 4IRUA 1YA9A 3VF0A 2Z15A 2Q9CA 1A7EA 3ZC4A 4XPWA 4QI2A 1VYIA 3LESA 2YKZA 2PX3A 2XM4A 3FAJA 3GEEA 3I5PA 2R9RB 3NG1A 4G0HA 4W8PA 3KL4A 3GM2A 2R7UA 3DE8A 3RH3A 1U0BB 5A6BA 2OU6A 4D4XA 3ZWIA 5KYUB 2A68F 4C7OB 1YLMA 1QVXA 3AOUA 3T6GB 5B3SC 2EPKX 5AGFA 2YL0A 4BJ5C 1NZEA 3AQBA 2EINC 3H65A 4K0DA 4P9TA 3S28A 1Y6DA 3T6JA 5L3VA 1D1BA 1TWGA 1BBHA 2VC9A 3EZIA 5GPGB 4XEKA 3GM1A 4CSAC 2YL7A 2HS5A 1O87A 5A6BD 3DAGA 2KGOA 4XTKA 5T3WA 2GA0A 3EGDA 2IXNA 2P61A 3M15A 3MLGA 2XLMA 1TR2A 3T6BA 2GWWA 2W4BA 3EGXB 4BJ1A 5B3IA 4G7HF 2LSEA 2L6GA 2NUPA 2MHRA 1XWJA 256BA 3SNHA 1YJGA 3G4XA 3DD7A 2X51A 1CPQA 3SXKA 2RSEB 3SEOA 4CS8C 2ZD9A 3WG7C 2VCBA 1E86A 5JVEA 3DWWA 1RKCA 1RJ9B 4U5CE 4YN0B 4O79A 3LLKA 3V5YA 3ZSUA 2J7PA 1V55C 1Z6AA 2XRHA 5CIVA 2QUPA 5JP7A 3LUTB 2EPNA 4NCQA 4ONSA 4JJGA 4IARA 4MVRA 4I3MA 2R7RA 3FOOA 3LNRA 1C17M 1FMWA 2A0UA 2AP3A 4FESA 2YRFA 4BJ6A 4LLEA 4K1OA 3GODA 1BDJB 1APCA 3N24A 4F4BA 4OIRF 1GS9A 2EPOA 1MMNA 3R7CA 5E3CA 2XLWA 3W2VA 3C7JA 3B0PA 2YHSA 2FGYA 2MYSA 2XS8A 1R4TA 1RKEA 3IQ6A 3VM6A 2ZXWC 2J7PD 2J9VA 3MBGA 4DVYP 2R02A 4H54A 3EG9B 2HJMA 2LQGA 3NYJA 4B6IA 5B1BC 1ZZPA 3RQGA 2QE9A 1CGOA 1SF8A 4MVSA 2XLOA 3IQ5A 3OWTA 5E3AA 5L0HA 4KI2A 1G4WR 4PJNA 3G4ZA 4CIPA 4OD5A 2I8BA 3GORA 3ZIBA 3B0VC 2XLVA 4MVZA 1Z3IX 2JD3A 2Q9BA 3LEVA 2HFIA 4JRZA 1YYJA 3O10A 1XZQA 4KBLA 5DQZA 1YARO 3K33A 4MNDA 2GDCA 1D1AA 3E9VA 3H2VA 2OG2A 3QW0A 2NPUA 4CJOA 3I4UA 5F5FA 4MQ9F 3JT1A 2UUIA 3IHUA 1WTYA 3U3FA 2G3KA 3ABKC 3QVYA 1R5ID 2O9XA 3HNIA 4NTBA 1E85A 2EIKC 2OJQA 2Y69C 4Z9JA 2L6HA 4AL1A 4G7ZF 3AJMA 1I5NA 4GEHA 4MTFA 4JW1A 1OKKA 3KMIA 4QDLA 1M56C 4DRIB 5L0FA 3F47A 1WOLA 4A2NB 1LPEA 2L9JA 2WL8A 4UDVA 3DE9A 2GAQA 1VK5A 3TJ6A 3U8VA 4KNVA 4PFOA 5HSWA 4OD4A 2P7VA 2PP4A 4PFPA 1WASA 4IJJA 4YT5A 3U2LA 1LKXA 2YLDA 4PJJA 4RD9A 2J0XA 3M4BA 4G78A 3U3BA 4N6CA 3DXJF 4Z9IA 3FVYA 3Q7LA 3EFOA 1FFTC 3T9OA 1OCCC 3U9JA 4BJ6C 4EUKB 1H7IA 5COFA 4WABA 2M64A 5DS6A 3HNJA 2AWCA 1QKRA 2HV7A 1OKKD 4LERA 4XWJA 4AE4B 1H9TA 2QTVA 5KYNA 1QSPA 3GANA 3C62A 5A6AA 4D4NA 3M4CA 4Q5SF 2L81A 4NY3A 2MWQA 3C63A 1UFBA 3AG1C 2Y3HA 1RJ9A 5K0IA 5COGA 2A6EF 2E87A 2KSFA 2HKVA 2LP4A 3RIPA 5AC5A 1B68A 3JSEO 2ETSA 2LD6A 2H7VC 5E33A 5DLJA 1M2VB 4IB4A 3EQLF 5BQIA 3NYMA 2L6FA 2DB4A 2WVOA 1QPUA 2J0WA 4PACA 5B1AC 1N1CA 4XPXA 4C3DA 1KNYA 4EKWA 3ATPA 3OA1A 1JPNA 2IXMA 2P0NA 1JPJA 1QZXA 1T9KA 2XS1A 3B71A 1KU2A 2KW3C 3AGTA 2PX0A 2IOQA 3TD7A 4BPMA 2HV6A 1YAUO 4LDRA 1YYXA 2J9WA 2NUTB 2P1AA 4H4KC 4YL3A 3SYNA 2J45A 1G8XA 3EG9A 3K1IC 4XQ1A 1HMDA 3VYWA 1SMYF 4R32A 4AX2A 4CS9A 4JE9A 4OIPF 2NG1A 4IGGA 4LLCA 2OCCC 1FAPB 5KYYA 1UG7A 2OQMA 4MVQA 3JYHA 4NTAA 4DBQA 2YLIA 4WGYA 1M2OA 2PFDA 3S90A 2Q4FA 2YVKA 2W45A 3DJNB 1E84A 3U0CA 1EA8A 5JUAA 1ORSC 1ORYA 3WODF 1OXBA 4HE8D 2B0HA 2HJ3A 4O6YA 3ZQVA 3LLIA 5JS5A 3W2WA 1L3PA 3CAXA 3HNLA 3L34A 3DI5A 3POVA 1FFHA 1Z5ZA 3UGOA 1Y4CA 2WB7A 1ZHTA 1BR1A 2YLGA 2BL2A 2FFHA 2HSBA 3CQZA 4K7BA 1CPRA 2CDQA 1OCOC 4U5FE 3US6A 5EHHA 2R7XA 5EGYA 2VASA 3EJNA 2HMZA 5BQGA 4E17A 5DS4A 3UNGC 1Q0GA 1D1CA 1CGME 3JSZA 3O55A 3ZTMA 3HLZA 3QVZA 3LNMB 4CDVA 2G62A 4EBBA 1LS1A 2R7OA 4ULWA 2ZXOA 4Z9HA 3SXMA 2A69F 2LIGA 3GWNA 4CX9A 1O5HA 4ANJA 2AU5A 1Q0FA 1PD0A 3HJCA 1VB5A 3QW1A 4J7TA 3QTHA 2WZGA 4AL0A 1S7ZA 4DBRA 2R03A 2XSEA 2HSQA 2EILC 3L1MA 2Y39A 4IAOA 4U5HA 4DRJB 1PD1A 3V7OA 4LACB 5A6KA 2XXAB 3B0UX 1T6UA 3DZAA 4JC7A 5KYXB 3JCUQ 1LE4A 1RMVA 2YL1A 1SYQA
chains in the Genus database with same CATH topology
1Q0FA 1T6IA 1Q0MA 1T6QA 4NCQA 3G50A 1Q0DA 1Q0KA 1T6UA 3G4ZA 3G4XA 1Q0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0F A;  1T6I A;  1Q0M A;  1T6Q A;  4NCQ A;  3G50 A;  1Q0D A;  1Q0K A;  1T6U A;  3G4Z A;  3G4X A;  1Q0G A; 
#chains in the Genus database with same CATH topology
 4E7Z A;  3U8P A;  5FZT A;  3NMI A;  4U9E A;  4JZA A;  2LFD A;  2EPM X;  3EHM A;  4CS9 C;  3G50 A;  3OEO A;  4LDK A;  4JTC B;  1NLX A;  4JJF A;  2CCY A;  4PK4 A;  2IXP A;  2HUJ A;  1ZU5 A;  2J9U A;  5F5H A;  4G7O F;  1OW7 A;  1A41 A;  4LDQ A;  3T4R A;  3CSK A;  5KYW A;  1HE1 A;  2OKU A;  3C8G B;  1DOW A;  2OEV A;  1MMD A;  1M2V A;  4BEM J;  1QLE C;  2R7Q A;  4Q7C A;  1SR2 A;  3ZVR A;  1LVK A;  2ZXP A;  5D92 A;  3RW0 A;  2OJE D;  4DJ9 A;  3EHN A;  2ICW G;  5AC4 A;  3RF3 A;  4JCH A;  4ULV A;  1T5O A;  3I5Q A;  3AQC A;  2IM8 A;  3RVZ A;  4IAQ A;  3DJU B;  1M57 C;  3HTK C;  1W2W A;  3R2P A;  1MMG A;  2WVN A;  3U9M A;  2VCA A;  4X0R A;  3LAY A;  5KYU A;  3ASO C;  3S27 A;  3SXY A;  1V74 B;  3KKB A;  4U5E E;  1VTM P;  4C7O A;  4ZLC A;  3NKD A;  4FWV A;  5E2Q A;  5L3Q A;  3U2M A;  1JAF A;  4IWB A;  2PF4 E;  3Q7G A;  5DVW A;  3S84 A;  3K1I A;  5DQT A;  5COM A;  4C3E A;  1NU7 D;  4I1M A;  4C3B A;  3AG4 C;  3JRM O;  4ZLD A;  2Q7R A;  1K05 A;  1XZP A;  1HW2 A;  3BEH A;  4GYT A;  3WAQ A;  1T01 A;  2OEX A;  4RDA A;  3KYI A;  1FR0 A;  2JPU A;  1OCR C;  3A9C A;  3EGD B;  1NFO A;  2CNW A;  4GQH A;  4ER9 A;  3EGX A;  1NU9 C;  3M79 A;  4MVO A;  2DI3 A;  1JR8 A;  3NKE A;  4YWQ A;  3TOL A;  2NUP B;  1VMA A;  4HEA J;  4XEF A;  1EQ1 A;  2FAP B;  2UUH A;  3DKA A;  4E0H A;  4DVZ A;  1GGQ A;  3FMS A;  2AVK A;  3NMJ A;  2C04 A;  3RYL A;  4DOZ A;  1D0Y A;  2CW0 F;  5JT4 A;  2ZXR A;  1EI7 A;  3K1H A;  4CDY A;  2D4U A;  3RVY A;  4YT8 A;  3KH2 A;  3GM3 A;  4WJ0 A;  2R7V A;  3MYF A;  2XL8 A;  3SP1 A;  2CNW D;  3V5Z A;  1AUE A;  1E2X A;  1K40 A;  2P6V A;  1ZHZ A;  3ZQY A;  4N06 A;  2BC5 A;  2R7T A;  4U5G A;  1A0B A;  2H7B A;  2XXA A;  4XPY A;  4P9F A;  2J9B A;  1M6T A;  2IXO A;  3L8J A;  3TUL A;  3TK0 A;  2PBE A;  1NG1 A;  3E70 C;  4JVS A;  5D91 A;  1H6G A;  3KYJ A;  3A11 A;  2KQ9 A;  1ZW3 A;  3LEO A;  5T1D B;  1T6Q A;  4OIQ F;  2VCC A;  2KC3 A;  3CZ6 A;  1RCP A;  5L0G A;  1OR2 A;  2HZ8 A;  5HV9 A;  3PHF 2;  4EBK A;  1U6H A;  2IBF A;  2XLH A;  4XLN F;  3NDB B;  4CDA A;  3C8G A;  4O7G A;  2Y3B A;  3IQC A;  4EIY A;  3IPM O;  4FX5 A;  1AVO B;  1K04 A;  2YL3 A;  4HFF B;  1IW7 F;  4CJG A;  2XM0 A;  3L8I A;  2R05 A;  3J06 A;  3Q6M A;  2EIJ C;  2Q9A A;  3NYL A;  4E7S A;  1LE2 A;  3GWL A;  3SXZ A;  3KPH A;  1D0X A;  1G4U S;  1Q0K A;  3QZC A;  1ZVZ A;  4N6H A;  1OW6 A;  3V5X A;  2R7W A;  2QY9 A;  2R7S A;  1OCZ C;  3C18 A;  4MVU A;  1FTS A;  4MW3 A;  4YT4 A;  1ZW2 A;  2A6H F;  1T6I A;  4J30 B;  1ZU4 A;  2YWA A;  4E18 A;  2RD9 A;  2L7A A;  4BEJ A;  4EWC A;  2NSG A;  3S29 A;  3C8G D;  3UMI A;  2TMV P;  3WHN A;  1E83 A;  1MNE A;  1TQG A;  2G3V A;  3EPV A;  1WWP A;  3LJB A;  5EK0 A;  2H7O A;  3FXH A;  3N0T A;  2KJG A;  4MTG A;  2GFH A;  4J32 B;  1VLS A;  1TWA A;  2A0B A;  2YQY A;  5FCL A;  4CIH A;  3MYI A;  3MFN A;  3K66 A;  5JLI A;  3FHD A;  4JEB A;  2Q3T A;  4L6R A;  1LI7 A;  1V4A A;  5BQH A;  3W8H A;  1MQV A;  3NRH A;  3TJ5 A;  2Y3G A;  1WGW A;  4AK9 A;  1A7V A;  1TWC A;  1O3U A;  2WZF A;  3FOP A;  3HKK A;  2W4M A;  4PJM A;  3H2U A;  3ZTZ A;  2AWY A;  3DAF A;  3ZG1 A;  3EZH A;  2V3C C;  1ORJ A;  3GEH A;  3EFO B;  3VAY A;  3ZDL A;  2NSF A;  1OXK A;  3PCV A;  1Z23 A;  3EH2 A;  2PNO A;  5A6J A;  2LFF A;  1OW8 A;  1WN0 A;  4AE4 A;  2CYD A;  2X0C A;  2J8W A;  3FAP B;  4PR9 A;  3QMK A;  4N4W A;  3MX3 A;  3RQF A;  1OR3 A;  4DXW A;  1TFO B;  2D5R B;  1TWH A;  1Z63 A;  1ZHW A;  3ABM C;  3IEE A;  2HMQ A;  2OOC A;  1GQA A;  3NMK A;  3ECS A;  3X2Q C;  1OQC A;  2W9Y A;  3BRJ A;  4JTA B;  3DMD A;  4XLP F;  1NSG B;  5L0I A;  4J7Y A;  2KYH A;  4OIO F;  4HFK B;  1YDI A;  2LCH A;  1WAT A;  4WGZ A;  4BJT A;  2M4E A;  4JCZ A;  1F1M A;  4NC3 A;  4NTF A;  3UR3 C;  1NFN A;  2BE5 F;  2LK4 A;  4EHP A;  1J8Y F;  3RQE A;  1ZYR F;  1HW1 A;  1FMV A;  1I4Y A;  2QLA A;  3ASN C;  3HNK A;  1MND A;  3VRC A;  4MVM A;  1S05 A;  1RXQ A;  3DM9 B;  1Q0D A;  1ZHY A;  1ZHX A;  3JYY A;  3O6X A;  3Q6N A;  3O39 A;  1BR2 A;  4W8K A;  2XL6 A;  1YZC A;  4O6N A;  4YL0 A;  2NUT A;  4MTO A;  3IQT A;  3JRT A;  2XL4 A;  1V54 C;  1D0Z A;  5JRA A;  1IZM A;  2EIM C;  1Z7Q c;  4NQF A;  4BG0 A;  1A7D A;  4P6I C;  2XLE A;  3B9Q A;  5DS5 A;  1LI5 A;  1LS4 A;  3ABL C;  4CBE A;  3M1C B;  5BUO A;  3N2Z B;  2XLD A;  5IY5 C;  2A1D D;  2R25 A;  1JOG A;  3DM5 A;  5L0J A;  5KYY B;  1JRA A;  1BR4 A;  2CGE A;  3AG2 C;  1CGN A;  1LIH A;  2Q00 A;  2YEV A;  4DRH B;  5F28 E;  2YZS A;  4JTD B;  3F46 A;  2H8A A;  4I1O B;  2VB6 A;  3RKO F;  1AEP A;  2B0J A;  2Y3D A;  1PCX A;  3JTL O;  4JEA A;  1C03 A;  1PV3 A;  2DGJ A;  2J46 A;  3W4Y A;  4U9D A;  4A4A A;  3PDM P;  2ZPA A;  5L0D A;  1HE9 A;  5T3T A;  1QQ3 A;  1BZ4 A;  1ST6 A;  2WZL A;  3GEI A;  4KC9 A;  5JSL A;  1JMW A;  1HY5 A;  2DYR C;  4EBJ A;  5A69 A;  2ASR A;  1NBB A;  3K6B A;  1YVI A;  4MS2 A;  2F22 A;  4FAP B;  4JKV A;  3S9O A;  1YA7 O;  1U89 A;  4I44 A;  4YK5 A;  4OIN F;  2QNL A;  5CI8 A;  4QI0 A;  3S0X A;  1DOV A;  4JUR I;  4CS7 A;  1KTM A;  3LS1 A;  1G5Z A;  1TFK B;  2C03 A;  4BJ5 A;  3UGP A;  1VYK A;  2WVQ A;  3TQO A;  4PJL A;  5TJ5 E;  1VLT A;  2IYL D;  2EPL X;  4M63 A;  4YT2 A;  4MW8 A;  1SZI A;  4U5B E;  3W8I A;  5L0C A;  3FDQ A;  4CSA A;  1EKY A;  4YL1 A;  4U5D E;  1C02 A;  4E0I A;  5KYX A;  3K7D A;  1J8M F;  3AG3 C;  3B29 A;  2VH3 A;  1GM5 A;  3TOM A;  1HMO A;  3C8Z A;  4RBN A;  3RFY A;  1TKN A;  2V26 A;  3UMH A;  1L7C A;  1RKE B;  4JIO A;  3ITF A;  3CEX A;  3JZ0 A;  3UMK A;  3PMR A;  1Q0M A;  5KYW B;  3X1O A;  5CI9 A;  4CS8 A;  1YZA A;  3EH1 A;  3SZR A;  4YJW A;  1H9G A;  2KNH A;  3AGU A;  1MMA A;  4KNW A;  2I15 A;  1I4Z A;  2DYS C;  2JX0 A;  3LS0 A;  1VOM A;  1LM3 B;  4O6M A;  4XEV A;  3U5S A;  1FNT c;  4Q4Z F;  3L0I A;  2KK1 A;  4IRU A;  1YA9 A;  3VF0 A;  2Z15 A;  2Q9C A;  1A7E A;  3ZC4 A;  4XPW A;  4QI2 A;  1VYI A;  3LES A;  2YKZ A;  2PX3 A;  2XM4 A;  3FAJ A;  3GEE A;  3I5P A;  2R9R B;  3NG1 A;  4G0H A;  4W8P A;  3KL4 A;  3GM2 A;  2R7U A;  3DE8 A;  3RH3 A;  1U0B B;  5A6B A;  2OU6 A;  4D4X A;  3ZWI A;  5KYU B;  2A68 F;  4C7O B;  1YLM A;  1QVX A;  3AOU A;  3T6G B;  5B3S C;  2EPK X;  5AGF A;  2YL0 A;  4BJ5 C;  1NZE A;  3AQB A;  2EIN C;  3H65 A;  4K0D A;  4P9T A;  3S28 A;  1Y6D A;  3T6J A;  5L3V A;  1D1B A;  1TWG A;  1BBH A;  2VC9 A;  3EZI A;  5GPG B;  4XEK A;  3GM1 A;  4CSA C;  2YL7 A;  2HS5 A;  1O87 A;  5A6B D;  3DAG A;  2KGO A;  4XTK A;  5T3W A;  2GA0 A;  3EGD A;  2IXN A;  2P61 A;  3M15 A;  3MLG A;  2XLM A;  1TR2 A;  3T6B A;  2GWW A;  2W4B A;  3EGX B;  4BJ1 A;  5B3I A;  4G7H F;  2LSE A;  2L6G A;  2NUP A;  2MHR A;  1XWJ A;  256B A;  3SNH A;  1YJG A;  3G4X A;  3DD7 A;  2X51 A;  1CPQ A;  3SXK A;  2RSE B;  3SEO A;  4CS8 C;  2ZD9 A;  3WG7 C;  2VCB A;  1E86 A;  5JVE A;  3DWW A;  1RKC A;  1RJ9 B;  4U5C E;  4YN0 B;  4O79 A;  3LLK A;  3V5Y A;  3ZSU A;  2J7P A;  1V55 C;  1Z6A A;  2XRH A;  5CIV A;  2QUP A;  5JP7 A;  3LUT B;  2EPN A;  4NCQ A;  4ONS A;  4JJG A;  4IAR A;  4MVR A;  4I3M A;  2R7R A;  3FOO A;  3LNR A;  1C17 M;  1FMW A;  2A0U A;  2AP3 A;  4FES A;  2YRF A;  4BJ6 A;  4LLE A;  4K1O A;  3GOD A;  1BDJ B;  1APC A;  3N24 A;  4F4B A;  4OIR F;  1GS9 A;  2EPO A;  1MMN A;  3R7C A;  5E3C A;  2XLW A;  3W2V A;  3C7J A;  3B0P A;  2YHS A;  2FGY A;  2MYS A;  2XS8 A;  1R4T A;  1RKE A;  3IQ6 A;  3VM6 A;  2ZXW C;  2J7P D;  2J9V A;  3MBG A;  4DVY P;  2R02 A;  4H54 A;  3EG9 B;  2HJM A;  2LQG A;  3NYJ A;  4B6I A;  5B1B C;  1ZZP A;  3RQG A;  2QE9 A;  1CGO A;  1SF8 A;  4MVS A;  2XLO A;  3IQ5 A;  3OWT A;  5E3A A;  5L0H A;  4KI2 A;  1G4W R;  4PJN A;  3G4Z A;  4CIP A;  4OD5 A;  2I8B A;  3GOR A;  3ZIB A;  3B0V C;  2XLV A;  4MVZ A;  1Z3I X;  2JD3 A;  2Q9B A;  3LEV A;  2HFI A;  4JRZ A;  1YYJ A;  3O10 A;  1XZQ A;  4KBL A;  5DQZ A;  1YAR O;  3K33 A;  4MND A;  2GDC A;  1D1A A;  3E9V A;  3H2V A;  2OG2 A;  3QW0 A;  2NPU A;  4CJO A;  3I4U A;  5F5F A;  4MQ9 F;  3JT1 A;  2UUI A;  3IHU A;  1WTY A;  3U3F A;  2G3K A;  3ABK C;  3QVY A;  1R5I D;  2O9X A;  3HNI A;  4NTB A;  1E85 A;  2EIK C;  2OJQ A;  2Y69 C;  4Z9J A;  2L6H A;  4AL1 A;  4G7Z F;  3AJM A;  1I5N A;  4GEH A;  4MTF A;  4JW1 A;  1OKK A;  3KMI A;  4QDL A;  1M56 C;  4DRI B;  5L0F A;  3F47 A;  1WOL A;  4A2N B;  1LPE A;  2L9J A;  2WL8 A;  4UDV A;  3DE9 A;  2GAQ A;  1VK5 A;  3TJ6 A;  3U8V A;  4KNV A;  4PFO A;  5HSW A;  4OD4 A;  2P7V A;  2PP4 A;  4PFP A;  1WAS A;  4IJJ A;  4YT5 A;  3U2L A;  1LKX A;  2YLD A;  4PJJ A;  4RD9 A;  2J0X A;  3M4B A;  4G78 A;  3U3B A;  4N6C A;  3DXJ F;  4Z9I A;  3FVY A;  3Q7L A;  3EFO A;  1FFT C;  3T9O A;  1OCC C;  3U9J A;  4BJ6 C;  4EUK B;  1H7I A;  5COF A;  4WAB A;  2M64 A;  5DS6 A;  3HNJ A;  2AWC A;  1QKR A;  2HV7 A;  1OKK D;  4LER A;  4XWJ A;  4AE4 B;  1H9T A;  2QTV A;  5KYN A;  1QSP A;  3GAN A;  3C62 A;  5A6A A;  4D4N A;  3M4C A;  4Q5S F;  2L81 A;  4NY3 A;  2MWQ A;  3C63 A;  1UFB A;  3AG1 C;  2Y3H A;  1RJ9 A;  5K0I A;  5COG A;  2A6E F;  2E87 A;  2KSF A;  2HKV A;  2LP4 A;  3RIP A;  5AC5 A;  1B68 A;  3JSE O;  2ETS A;  2LD6 A;  2H7V C;  5E33 A;  5DLJ A;  1M2V B;  4IB4 A;  3EQL F;  5BQI A;  3NYM A;  2L6F A;  2DB4 A;  2WVO A;  1QPU A;  2J0W A;  4PAC A;  5B1A C;  1N1C A;  4XPX A;  4C3D A;  1KNY A;  4EKW A;  3ATP A;  3OA1 A;  1JPN A;  2IXM A;  2P0N A;  1JPJ A;  1QZX A;  1T9K A;  2XS1 A;  3B71 A;  1KU2 A;  2KW3 C;  3AGT A;  2PX0 A;  2IOQ A;  3TD7 A;  4BPM A;  2HV6 A;  1YAU O;  4LDR A;  1YYX A;  2J9W A;  2NUT B;  2P1A A;  4H4K C;  4YL3 A;  3SYN A;  2J45 A;  1G8X A;  3EG9 A;  3K1I C;  4XQ1 A;  1HMD A;  3VYW A;  1SMY F;  4R32 A;  4AX2 A;  4CS9 A;  4JE9 A;  4OIP F;  2NG1 A;  4IGG A;  4LLC A;  2OCC C;  1FAP B;  5KYY A;  1UG7 A;  2OQM A;  4MVQ A;  3JYH A;  4NTA A;  4DBQ A;  2YLI A;  4WGY A;  1M2O A;  2PFD A;  3S90 A;  2Q4F A;  2YVK A;  2W45 A;  3DJN B;  1E84 A;  3U0C A;  1EA8 A;  5JUA A;  1ORS C;  1ORY A;  3WOD F;  1OXB A;  4HE8 D;  2B0H A;  2HJ3 A;  4O6Y A;  3ZQV A;  3LLI A;  5JS5 A;  3W2W A;  1L3P A;  3CAX A;  3HNL A;  3L34 A;  3DI5 A;  3POV A;  1FFH A;  1Z5Z A;  3UGO A;  1Y4C A;  2WB7 A;  1ZHT A;  1BR1 A;  2YLG A;  2BL2 A;  2FFH A;  2HSB A;  3CQZ A;  4K7B A;  1CPR A;  2CDQ A;  1OCO C;  4U5F E;  3US6 A;  5EHH A;  2R7X A;  5EGY A;  2VAS A;  3EJN A;  2HMZ A;  5BQG A;  4E17 A;  5DS4 A;  3UNG C;  1Q0G A;  1D1C A;  1CGM E;  3JSZ A;  3O55 A;  3ZTM A;  3HLZ A;  3QVZ A;  3LNM B;  4CDV A;  2G62 A;  4EBB A;  1LS1 A;  2R7O A;  4ULW A;  2ZXO A;  4Z9H A;  3SXM A;  2A69 F;  2LIG A;  3GWN A;  4CX9 A;  1O5H A;  4ANJ A;  2AU5 A;  1Q0F A;  1PD0 A;  3HJC A;  1VB5 A;  3QW1 A;  4J7T A;  3QTH A;  2WZG A;  4AL0 A;  1S7Z A;  4DBR A;  2R03 A;  2XSE A;  2HSQ A;  2EIL C;  3L1M A;  2Y39 A;  4IAO A;  4U5H A;  4DRJ B;  1PD1 A;  3V7O A;  4LAC B;  5A6K A;  2XXA B;  3B0U X;  1T6U A;  3DZA A;  4JC7 A;  5KYX B;  3JCU Q;  1LE4 A;  1RMV A;  2YL1 A;  1SYQ A; 
#chains in the Genus database with same CATH homology
 1Q0F A;  1T6I A;  1Q0M A;  1T6Q A;  4NCQ A;  3G50 A;  1Q0D A;  1Q0K A;  1T6U A;  3G4Z A;  3G4X A;  1Q0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...