2HJ3A

Structure of the arabidopsis thaliana erv1 thiol oxidase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
101
structure length
101
Chain Sequence
PVTKEDLGRATWTFLHTLAAQYPEKPTRQQKKDVKELMTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVDARWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase Erv1p
publication title Gain of Function in an ERV/ALR Sulfhydryl Oxidase by Molecular Engineering of the Shuttle Disulfide.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 38
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 2hj3A00
3TD7A 3W4YA 3TK0A 3U5SA 3R7CA 3U2LA 3GWNA 4LDKA 4E0HA 4E0IA 1JRAA 3U2MA 3MBGA 3LLKA 1OQCA 1JR8A 2HJ3A 3LLIA 3GWLA 3O55A
chains in the Genus database with same CATH superfamily
3ABLC 4JEAA 4PFOA 1XZPA 3EH1A 2ASRA 4CJOA 4E7SA 4O6MA 1QPUA 1V55C 3QVZA 2CNWD 3R7CA 3S9OA 1RMVA 2WZLA 5AGFA 2NUPA 3QW0A 4G0HA 1JPNA 4XPYA 1EKYA 1M2VA 4RDAA 3SXZA 2HMQA 3DJUB 2Y39A 2WVQA 3NYLA 1VTMP 5F28E 4C7OA 4G78A 4KBLA 5L0CA 2KW3C 3HTKC 3C7JA 4NC3A 2CCYA 1Z7Qc 1MMNA 2W4BA 1J8YF 4MVMA 1NU7D 3PDMP 2IBFA 2H7VC 2CGEA 5L0FA 3GEEA 1LI5A 4OD5A 1E84A 4PR9A 1Q0GA 2L7AA 1KU2A 4I3MA 5DLJA 5KYXA 3E70C 4U5CE 3H2VA 5HV9A 3QZCA 5BUOA 4L6RA 4D4XA 4U5DE 5L0GA 2AVKA 3WAQA 3K33A 2CYDA 4H54A 5KYNA 5AC5A 4AL1A 1JOGA 4N06A 3F46A 3SEOA 4EUKB 4O6NA 1OCCC 1BR4A 2NUPB 2QTVA 1D1AA 1M2VB 3I5QA 4XQ1A 4G7OF 2DGJA 4C7OB 2Y3BA 3GEHA 3H65A 4ULVA 2KQ9A 2ZD9A 3IEEA 2I8BA 4YL3A 2JD3A 2R03A 2IM8A 3KYJA 1I4YA 4YN0B 2J0WA 2QLAA 3S28A 3C62A 2XS8A 4P6IC 4AL0A 3GM1A 3IQ5A 1AUEA 2EIMC 2XM0A 5T1DB 4ANJA 4CBEA 2QE9A 2WZGA 3E9VA 4O79A 4AK9A 1TWAA 3JRMO 4MVSA 4EBBA 5KYXB 1HW2A 2VASA 3RIPA 2P0NA 1BZ4A 3U3FA 3LAYA 3LESA 5A69A 1LE4A 3TULA 4YT2A 1LS4A 1HMOA 3BEHA 2OCCC 2YZSA 2HMZA 1MNDA 2M4EA 2HFIA 3N2ZB 5T3TA 1T6UA 1YLMA 2RD9A 2VCBA 3EPVA 3JYYA 3EGXA 3K7DA 2A0UA 2VCCA 3M1CB 1L3PA 4YL1A 3RF3A 4YT4A 3IPMO 2NSFA 1QLEC 1V4AA 4LERA 1VOMA 3DMDA 2W4MA 4PJLA 1GGQA 1JRAA 3HJCA 4BJ1A 3ZTZA 5A6BD 4JEBA 3SNHA 4DRIB 1WN0A 3KYIA 4U5EE 1LIHA 1ORSC 2F22A 3OA1A 3O55A 3AG4C 5AC4A 1LPEA 1M57C 2EINC 2G3KA 2NPUA 2PBEA 4ZLDA 2KSFA 3G4XA 4MVUA 2YL7A 5D91A 2JX0A 4HEAJ 2EPKX 4OINF 1WATA 1OW7A 2E87A 1WOLA 1CPRA 5JSLA 3U8PA 2IYLD 5K0IA 3WODF 4MTOA 3UGOA 1Z23A 3EGXB 3C8ZA 2W45A 1D1CA 3C8GA 3MX3A 4U9EA 3IHUA 5COGA 1JAFA 1ORYA 4JURI 5DQZA 4CIPA 1HE9A 5A6JA 1QVXA 2Y3HA 4MVZA 1EA8A 4I44A 4C3DA 2J45A 1Y4CA 1K04A 1T6IA 2HJ3A 3OEOA 3TJ6A 4K0DA 3NYJA 5COMA 4DVYP 1MNEA 4NCQA 4DOZA 1YAUO 2OJQA 2HSBA 4CDYA 3B0UX 1Y6DA 3K66A 5COFA 2LD6A 1AVOB 2DYSC 3KMIA 3ZC4A 3MFNA 2ZXWC 3RVYA 3TK0A 4MTFA 3U8VA 4C3EA 2LCHA 5CI8A 5F5HA 5JRAA 3G4ZA 4NQFA 2KC3A 5FCLA 3RVZA 3RFYA 4ZLCA 1BR2A 3F47A 3O39A 2VB6A 4U5HA 3ABKC 3C8GB 2OU6A 3IQ6A 1HY5A 2KK1A 4LLEA 5L0IA 4KC9A 1Q0FA 5A6BA 3CZ6A 3H2UA 4JIOA 4CIHA 3W8IA 2EIJC 4EKWA 3HLZA 3U3BA 2QNLA 3ASNC 1YJGA 3CEXA 3JCUQ 3FOOA 2LK4A 3M4BA 2G62A 5B3SC 3RQGA 1OR3A 1HW1A 2PFDA 1NZEA 2C03A 1E2XA 2J9WA 2YL1A 4IWBA 1G4US 3SYNA 4IAOA 1MMGA 5EHHA 1GQAA 2H7BA 4N6HA 4DBRA 2R7UA 2HV6A 4JC7A 3EHMA 1TQGA 2G3VA 1T5OA 3V7OA 3TD7A 3W4YA 2EPOA 5L0DA 4C3BA 1OW8A 4U5FE 2P1AA 2WZFA 5D92A 4UDVA 2C04A 4JCZA 4WGZA 3MLGA 3NMJA 5EK0A 3AOUA 1VMAA 1ZW2A 4E18A 3FXHA 3RKOF 1S7ZA 3HNJA 3ZG1A 2A68F 3DE8A 4FX5A 3MBGA 1N1CA 4DJ9A 4BJTA 1YDIA 4MQ9F 2DI3A 3I4UA 2A0BA 1OW6A 3LLIA 1XZQA 1IW7F 2LFFA 1PD1A 2R7OA 3T9OA 2YLGA 3TQOA 5JUAA 2WVNA 4JJFA 2DB4A 4IGGA 2R02A 2J9BA 3O10A 4XLNF 2AU5A 2UUHA 3PCVA 2Q9BA 5JT4A 4JW1A 3A11A 3AG2C 4JTAB 4XPWA 4HE8D 5BQHA 3CSKA 2WL8A 1LM3B 4JJGA 3US6A 1OR2A 3NKDA 3OWTA 2XLMA 5CIVA 1M6TA 2HSQA 1R4TA 1OKKA 1MQVA 4BJ5C 2L6GA 2XS1A 3DD7A 5T3WA 3FOPA 2L81A 1K40A 1Q0DA 5TJ5E 4LDKA 3UMIA 5GPGB 5L0HA 1TFOB 3EFOA 3U9JA 2R05A 3M4CA 3ZQYA 2YLIA 3K1HA 3QMKA 2R7SA 4AE4A 3V5XA 3EZIA 2XL4A 2GA0A 3ZSUA 2IXMA 3KL4A 1U0BB 1OXKA 2IXNA 1OCZC 5KYYA 1E85A 5A6KA 1ZW3A 5HSWA 1T01A 1GS9A 3AQBA 2R7VA 1O5HA 1I5NA 1G5ZA 2PX0A 3M79A 4U5BE 4WJ0A 1Z63A 3B29A 2R7XA 4CS9C 3LEOA 1CGOA 3ZWIA 1E83A 1FR0A 1HMDA 2CNWA 3T6BA 1T9KA 1RKCA 1V74B 3AJMA 2LP4A 2XLVA 3U2LA 2OG2A 3QW1A 2ZXPA 4EIYA 1I4ZA 3LS0A 4KNWA 3JSEO 1WASA 4NY3A 2PX3A 3MYFA 4E7ZA 4BJ5A 4P9FA 1OCOC 2BL2A 3EFOB 3KKBA 4OIQF 4Z9JA 2CDQA 3N0TA 2Q9AA 3QVYA 1FMWA 4AE4B 3C63A 1FTSA 3S0XA 4LACB 3SZRA 4FAPB 2W9YA 2NSGA 3FMSA 5B1AC 4A2NB 3V5ZA 4JCHA 2XL8A 5E33A 5KYYB 4ONSA 4W8KA 1UG7A 4IRUA 1VLSA 3W2VA 3X1OA 2XRHA 3SXKA 3R2PA 1K05A 2I15A 1EQ1A 5B3IA 1S05A 4PJJA 3L8IA 4DRHB 2KGOA 2P61A 2KYHA 1H6GA 1A7DA 3TJ5A 2YHSA 4YT8A 1VLTA 2XLHA 4M63A 4QI2A 1ZHXA 1IZMA 2L6HA 3B0PA 2YVKA 3GEIA 3L34A 4IAQA 4E0HA 2EPLX 3ECSA 2KNHA 3L0IA 2Y3DA 4GYTA 1O3UA 1SZIA 2ICWG 3W8HA 4WABA 3NRHA 1O87A 2R7RA 3BRJA 4CX9A 4RBNA 3V5YA 5L3QA 1DOWA 1PV3A 3POVA 2R7QA 2OKUA 4Z9IA 1J8MF 3UGPA 2PNOA 1UFBA 3K6BA 2AP3A 4CSAC 1ZHWA 3EG9A 2WVOA 4MW3A 1Q0KA 3QTHA 3VM6A 2YRFA 4I1MA 4MVQA 3ABMC 3FVYA 1YYXA 5F5FA 1VB5A 3AQCA 1YA7O 4LLCA 3RW0A 2H7OA 4BG0A 1DOVA 2B0HA 3T4RA 2HKVA 3FAPB 1BR1A 4J7TA 3NKEA 3VYWA 5A6AA 2R7TA 2YEVA 4O7GA 1LKXA 2P6VA 3RQFA 4B6IA 5DS5A 3AG1C 1CGME 3NYMA 1FAPB 2IXOA 1BDJB 1LI7A 2Y3GA 3DKAA 1BBHA 1U89A 3JTLO 4IJJA 3K1IC 2J9UA 3UR3C 1H9GA 3LLKA 2Q7RA 4CS7A 1ZHTA 4CS8C 4YWQA 3C18A 4PFPA 4YL0A 2IXPA 2WB7A 4LDRA 2YWAA 4DRJB 3GODA 2LIGA 4F4BA 1TKNA 1VYKA 4KI2A 4X0RA 1YARO 2GDCA 4Z9HA 1Z5ZA 1SYQA 4RD9A 3JZ0A 4A4AA 1EI7A 3EG9B 2R7WA 5E3AA 4CSAA 3GM3A 4JTDB 2Y69C 5JVEA 1FFTC 3FHDA 2EIKC 3A9CA 4JVSA 4U5GA 2IOQA 4EWCA 1LE2A 2GWWA 3UNGC 3GM2A 2VH3A 3T6GB 3NMIA 3EQLF 4MVRA 1ZVZA 2XLEA 3LNMB 4JZAA 1PD0A 4Q4ZF 3U2MA 1LVKA 3SXMA 2BC5A 2HJMA 4U9DA 4DBQA 1YVIA 1JR8A 4LDQA 1YZCA 3K1IA 4WGYA 1E86A 1W2WA 2V3CC 2UUIA 4CS8A 4N6CA 3L8JA 3LS1A 1OCRC 3LEVA 3Q6MA 1R5ID 3ZVRA 4NTAA 1QSPA 3S90A 4MNDA 1U6HA 4EBKA 3LJBA 3B71A 4XPXA 3Q7LA 5DVWA 1RKEA 2VC9A 4J32B 4YT5A 3U5SA 1VYIA 4G7HF 1RJ9A 4XLPF 1D0XA 3G50A 3VRCA 4BEMJ 4PJNA 3DXJF 2JPUA 3NMKA 3EGDA 3EJNA 1V54C 3U9MA 3VAYA 4DXWA 4OIOF 2GAQA 1TWCA 1F1MA 2A6EF 4CDAA 3JYHA 2J8WA 3WG7C 4YK5A 1SF8A 5EGYA 1NBBA 2J0XA 2YLDA 5BQGA 4PJMA 1OXBA 3GORA 1JPJA 2X0CA 1Z3IX 5IY5C 2D5RB 5L0JA 1TFKB 1PCXA 4HFFB 4K1OA 3EHNA 1ZU4A 2GFHA 1C17M 4QDLA 1AEPA 2J7PD 4ULWA 3VF0A 1ZYRF 5DS6A 5DQTA 2J46A 2LQGA 2ZXOA 1YA9A 2Z15A 1ZZPA 2HZ8A 4G7ZF 2H8AA 1RKEB 2V26A 4J7YA 3JSZA 4K7BA 4Q7CA 2DYRC 2A6HF 4GQHA 3DAGA 4CJGA 1KTMA 1RJ9B 5JP7A 2ETSA 3ZIBA 3U0CA 3I5PA 3EGDB 3GWNA 1D0YA 2QY9A 2XM4A 3C8GD 4MVOA 3ZQVA 1QKRA 1D0ZA 1YZAA 1QZXA 4GEHA 1H7IA 4NTFA 3SP1A 3B9QA 3EZHA 2O9XA 3WHNA 5JS5A 5KYWA 4QI0A 5CI9A 2VCAA 4FESA 2OOCA 3T6JA 1OQCA 1G8XA 3ATPA 3DJNB 1NFNA 3DE9A 5BQIA 3DWWA 2PP4A 1C02A 1Z6AA 2XLWA 1G4WR 2LFDA 4R32A 4OIRF 2OEXA 4HFKB 3DZAA 3W2WA 1TWGA 2MYSA 2L9JA 2BE5F 3HNKA 1A0BA 4PACA 1WWPA 1A41A 1D1BA 1RCPA 1XWJA 2HS5A 5FZTA 1HE1A 3ASOC 1FFHA 4FWVA 4XWJA 4IB4A 4CS9A 4OIPF 4Q5SF 4BJ6C 1MMAA 3CAXA 1M2OA 3DI5A 4AX2A 2EPMX 3N24A 1SR2A 5KYUA 3SXYA 2YKZA 1ZU5A 3LNRA 2NG1A 1VK5A 2OQMA 4N4WA 1APCA 2HUJA 2CW0F 2Q00A 2XLDA 2R9RB 3FAJA 2NUTA 1YYJA 2XSEA 4E0IA 2J9VA 4E17A 3PHF2 3RQEA 1QQ3A 2ZPAA 1ORJA 5KYWB 3J06A 2XLOA 2M64A 1FMVA 3AG3C 4MS2A 3DAFA 1T6QA 1SMYF 1TR2A 1TWHA 4XEKA 3RYLA 4IARA 3Q6NA 3NDBB 1WTYA 2MHRA 2J7PA 4J30B 4JTCB 4BPMA 1M56C 3UMHA 3CQZA 2R25A 1ZHZA 2QUPA 1JMWA 2MWQA 2A1DD 2ZXRA 3DM9B 5JLIA 2XXAA 2YL3A 4NTBA 4PK4A 2L6FA 2FFHA 3IQCA 3NG1A 3LUTB 4XEFA 5B1BC 2YL0A 1A7EA 3L1MA 2A69F 3S27A 3TOMA 2AWYA 4BJ6A 5KYUB 3UMKA 1GM5A 3HKKA 1A7VA 2X51A 4JE9A 1NSGB 3X2QC 3KH2A 3S29A 1L7CA 1B68A 5E2QA 1NFOA 4H4KC 4MW8A 2NUTB 4O6YA 1LS1A 1NU9C 2EPNA 4MTGA 2Q4FA 2Q3TA 2OEVA 3ZDLA 4D4NA 1H9TA 3GWLA 3MYIA 3M15A 2Q9CA 3JRTA 2HV7A 2AWCA 1CPQA 4CDVA 1MMDA 3HNIA 4W8PA 3PMRA 1KNYA 2P7VA 2OJED 4YJWA 3RH3A 4EBJA 5DS4A 1C03A 5E3CA 3S84A 1WGWA 4KNVA 2KJGA 1Q0MA 2XXAB 2FGYA 3AGTA 4I1OB 4EHPA 3IQTA 3Q7GA 2B0JA 2YQYA 4ER9A 2PF4E 3EH2A 3B0VC 1OKKD 3FDQA 4XEVA 3DM5A 1NG1A 3HNLA 2XL6A 3GANA 4BEJA 1ZHYA 3ITFA 3AGUA 4JKVA 1FNTc 1ST6A 4JRZA 3ZTMA 2EILC 2RSEB 1NLXA 256BA 3JT1A 1CGNA 4XTKA 3O6XA 2D4UA 2TMVP 3TOLA 3KPHA 4P9TA 4DVZA 5L3VA 4OD4A 1RXQA 2LSEA 2FAPB
chains in the Genus database with same CATH topology
3TD7A 3W4YA 3TK0A 3U5SA 3R7CA 3U2LA 3GWNA 4LDKA 4E0HA 4E0IA 1JRAA 3U2MA 3MBGA 3LLKA 1OQCA 1JR8A 2HJ3A 3LLIA 3GWLA 3O55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TD7 A;  3W4Y A;  3TK0 A;  3U5S A;  3R7C A;  3U2L A;  3GWN A;  4LDK A;  4E0H A;  4E0I A;  1JRA A;  3U2M A;  3MBG A;  3LLK A;  1OQC A;  1JR8 A;  2HJ3 A;  3LLI A;  3GWL A;  3O55 A; 
#chains in the Genus database with same CATH topology
 3ABL C;  4JEA A;  4PFO A;  1XZP A;  3EH1 A;  2ASR A;  4CJO A;  4E7S A;  4O6M A;  1QPU A;  1V55 C;  3QVZ A;  2CNW D;  3R7C A;  3S9O A;  1RMV A;  2WZL A;  5AGF A;  2NUP A;  3QW0 A;  4G0H A;  1JPN A;  4XPY A;  1EKY A;  1M2V A;  4RDA A;  3SXZ A;  2HMQ A;  3DJU B;  2Y39 A;  2WVQ A;  3NYL A;  1VTM P;  5F28 E;  4C7O A;  4G78 A;  4KBL A;  5L0C A;  2KW3 C;  3HTK C;  3C7J A;  4NC3 A;  2CCY A;  1Z7Q c;  1MMN A;  2W4B A;  1J8Y F;  4MVM A;  1NU7 D;  3PDM P;  2IBF A;  2H7V C;  2CGE A;  5L0F A;  3GEE A;  1LI5 A;  4OD5 A;  1E84 A;  4PR9 A;  1Q0G A;  2L7A A;  1KU2 A;  4I3M A;  5DLJ A;  5KYX A;  3E70 C;  4U5C E;  3H2V A;  5HV9 A;  3QZC A;  5BUO A;  4L6R A;  4D4X A;  4U5D E;  5L0G A;  2AVK A;  3WAQ A;  3K33 A;  2CYD A;  4H54 A;  5KYN A;  5AC5 A;  4AL1 A;  1JOG A;  4N06 A;  3F46 A;  3SEO A;  4EUK B;  4O6N A;  1OCC C;  1BR4 A;  2NUP B;  2QTV A;  1D1A A;  1M2V B;  3I5Q A;  4XQ1 A;  4G7O F;  2DGJ A;  4C7O B;  2Y3B A;  3GEH A;  3H65 A;  4ULV A;  2KQ9 A;  2ZD9 A;  3IEE A;  2I8B A;  4YL3 A;  2JD3 A;  2R03 A;  2IM8 A;  3KYJ A;  1I4Y A;  4YN0 B;  2J0W A;  2QLA A;  3S28 A;  3C62 A;  2XS8 A;  4P6I C;  4AL0 A;  3GM1 A;  3IQ5 A;  1AUE A;  2EIM C;  2XM0 A;  5T1D B;  4ANJ A;  4CBE A;  2QE9 A;  2WZG A;  3E9V A;  4O79 A;  4AK9 A;  1TWA A;  3JRM O;  4MVS A;  4EBB A;  5KYX B;  1HW2 A;  2VAS A;  3RIP A;  2P0N A;  1BZ4 A;  3U3F A;  3LAY A;  3LES A;  5A69 A;  1LE4 A;  3TUL A;  4YT2 A;  1LS4 A;  1HMO A;  3BEH A;  2OCC C;  2YZS A;  2HMZ A;  1MND A;  2M4E A;  2HFI A;  3N2Z B;  5T3T A;  1T6U A;  1YLM A;  2RD9 A;  2VCB A;  3EPV A;  3JYY A;  3EGX A;  3K7D A;  2A0U A;  2VCC A;  3M1C B;  1L3P A;  4YL1 A;  3RF3 A;  4YT4 A;  3IPM O;  2NSF A;  1QLE C;  1V4A A;  4LER A;  1VOM A;  3DMD A;  2W4M A;  4PJL A;  1GGQ A;  1JRA A;  3HJC A;  4BJ1 A;  3ZTZ A;  5A6B D;  4JEB A;  3SNH A;  4DRI B;  1WN0 A;  3KYI A;  4U5E E;  1LIH A;  1ORS C;  2F22 A;  3OA1 A;  3O55 A;  3AG4 C;  5AC4 A;  1LPE A;  1M57 C;  2EIN C;  2G3K A;  2NPU A;  2PBE A;  4ZLD A;  2KSF A;  3G4X A;  4MVU A;  2YL7 A;  5D91 A;  2JX0 A;  4HEA J;  2EPK X;  4OIN F;  1WAT A;  1OW7 A;  2E87 A;  1WOL A;  1CPR A;  5JSL A;  3U8P A;  2IYL D;  5K0I A;  3WOD F;  4MTO A;  3UGO A;  1Z23 A;  3EGX B;  3C8Z A;  2W45 A;  1D1C A;  3C8G A;  3MX3 A;  4U9E A;  3IHU A;  5COG A;  1JAF A;  1ORY A;  4JUR I;  5DQZ A;  4CIP A;  1HE9 A;  5A6J A;  1QVX A;  2Y3H A;  4MVZ A;  1EA8 A;  4I44 A;  4C3D A;  2J45 A;  1Y4C A;  1K04 A;  1T6I A;  2HJ3 A;  3OEO A;  3TJ6 A;  4K0D A;  3NYJ A;  5COM A;  4DVY P;  1MNE A;  4NCQ A;  4DOZ A;  1YAU O;  2OJQ A;  2HSB A;  4CDY A;  3B0U X;  1Y6D A;  3K66 A;  5COF A;  2LD6 A;  1AVO B;  2DYS C;  3KMI A;  3ZC4 A;  3MFN A;  2ZXW C;  3RVY A;  3TK0 A;  4MTF A;  3U8V A;  4C3E A;  2LCH A;  5CI8 A;  5F5H A;  5JRA A;  3G4Z A;  4NQF A;  2KC3 A;  5FCL A;  3RVZ A;  3RFY A;  4ZLC A;  1BR2 A;  3F47 A;  3O39 A;  2VB6 A;  4U5H A;  3ABK C;  3C8G B;  2OU6 A;  3IQ6 A;  1HY5 A;  2KK1 A;  4LLE A;  5L0I A;  4KC9 A;  1Q0F A;  5A6B A;  3CZ6 A;  3H2U A;  4JIO A;  4CIH A;  3W8I A;  2EIJ C;  4EKW A;  3HLZ A;  3U3B A;  2QNL A;  3ASN C;  1YJG A;  3CEX A;  3JCU Q;  3FOO A;  2LK4 A;  3M4B A;  2G62 A;  5B3S C;  3RQG A;  1OR3 A;  1HW1 A;  2PFD A;  1NZE A;  2C03 A;  1E2X A;  2J9W A;  2YL1 A;  4IWB A;  1G4U S;  3SYN A;  4IAO A;  1MMG A;  5EHH A;  1GQA A;  2H7B A;  4N6H A;  4DBR A;  2R7U A;  2HV6 A;  4JC7 A;  3EHM A;  1TQG A;  2G3V A;  1T5O A;  3V7O A;  3TD7 A;  3W4Y A;  2EPO A;  5L0D A;  4C3B A;  1OW8 A;  4U5F E;  2P1A A;  2WZF A;  5D92 A;  4UDV A;  2C04 A;  4JCZ A;  4WGZ A;  3MLG A;  3NMJ A;  5EK0 A;  3AOU A;  1VMA A;  1ZW2 A;  4E18 A;  3FXH A;  3RKO F;  1S7Z A;  3HNJ A;  3ZG1 A;  2A68 F;  3DE8 A;  4FX5 A;  3MBG A;  1N1C A;  4DJ9 A;  4BJT A;  1YDI A;  4MQ9 F;  2DI3 A;  3I4U A;  2A0B A;  1OW6 A;  3LLI A;  1XZQ A;  1IW7 F;  2LFF A;  1PD1 A;  2R7O A;  3T9O A;  2YLG A;  3TQO A;  5JUA A;  2WVN A;  4JJF A;  2DB4 A;  4IGG A;  2R02 A;  2J9B A;  3O10 A;  4XLN F;  2AU5 A;  2UUH A;  3PCV A;  2Q9B A;  5JT4 A;  4JW1 A;  3A11 A;  3AG2 C;  4JTA B;  4XPW A;  4HE8 D;  5BQH A;  3CSK A;  2WL8 A;  1LM3 B;  4JJG A;  3US6 A;  1OR2 A;  3NKD A;  3OWT A;  2XLM A;  5CIV A;  1M6T A;  2HSQ A;  1R4T A;  1OKK A;  1MQV A;  4BJ5 C;  2L6G A;  2XS1 A;  3DD7 A;  5T3W A;  3FOP A;  2L81 A;  1K40 A;  1Q0D A;  5TJ5 E;  4LDK A;  3UMI A;  5GPG B;  5L0H A;  1TFO B;  3EFO A;  3U9J A;  2R05 A;  3M4C A;  3ZQY A;  2YLI A;  3K1H A;  3QMK A;  2R7S A;  4AE4 A;  3V5X A;  3EZI A;  2XL4 A;  2GA0 A;  3ZSU A;  2IXM A;  3KL4 A;  1U0B B;  1OXK A;  2IXN A;  1OCZ C;  5KYY A;  1E85 A;  5A6K A;  1ZW3 A;  5HSW A;  1T01 A;  1GS9 A;  3AQB A;  2R7V A;  1O5H A;  1I5N A;  1G5Z A;  2PX0 A;  3M79 A;  4U5B E;  4WJ0 A;  1Z63 A;  3B29 A;  2R7X A;  4CS9 C;  3LEO A;  1CGO A;  3ZWI A;  1E83 A;  1FR0 A;  1HMD A;  2CNW A;  3T6B A;  1T9K A;  1RKC A;  1V74 B;  3AJM A;  2LP4 A;  2XLV A;  3U2L A;  2OG2 A;  3QW1 A;  2ZXP A;  4EIY A;  1I4Z A;  3LS0 A;  4KNW A;  3JSE O;  1WAS A;  4NY3 A;  2PX3 A;  3MYF A;  4E7Z A;  4BJ5 A;  4P9F A;  1OCO C;  2BL2 A;  3EFO B;  3KKB A;  4OIQ F;  4Z9J A;  2CDQ A;  3N0T A;  2Q9A A;  3QVY A;  1FMW A;  4AE4 B;  3C63 A;  1FTS A;  3S0X A;  4LAC B;  3SZR A;  4FAP B;  2W9Y A;  2NSG A;  3FMS A;  5B1A C;  4A2N B;  3V5Z A;  4JCH A;  2XL8 A;  5E33 A;  5KYY B;  4ONS A;  4W8K A;  1UG7 A;  4IRU A;  1VLS A;  3W2V A;  3X1O A;  2XRH A;  3SXK A;  3R2P A;  1K05 A;  2I15 A;  1EQ1 A;  5B3I A;  1S05 A;  4PJJ A;  3L8I A;  4DRH B;  2KGO A;  2P61 A;  2KYH A;  1H6G A;  1A7D A;  3TJ5 A;  2YHS A;  4YT8 A;  1VLT A;  2XLH A;  4M63 A;  4QI2 A;  1ZHX A;  1IZM A;  2L6H A;  3B0P A;  2YVK A;  3GEI A;  3L34 A;  4IAQ A;  4E0H A;  2EPL X;  3ECS A;  2KNH A;  3L0I A;  2Y3D A;  4GYT A;  1O3U A;  1SZI A;  2ICW G;  3W8H A;  4WAB A;  3NRH A;  1O87 A;  2R7R A;  3BRJ A;  4CX9 A;  4RBN A;  3V5Y A;  5L3Q A;  1DOW A;  1PV3 A;  3POV A;  2R7Q A;  2OKU A;  4Z9I A;  1J8M F;  3UGP A;  2PNO A;  1UFB A;  3K6B A;  2AP3 A;  4CSA C;  1ZHW A;  3EG9 A;  2WVO A;  4MW3 A;  1Q0K A;  3QTH A;  3VM6 A;  2YRF A;  4I1M A;  4MVQ A;  3ABM C;  3FVY A;  1YYX A;  5F5F A;  1VB5 A;  3AQC A;  1YA7 O;  4LLC A;  3RW0 A;  2H7O A;  4BG0 A;  1DOV A;  2B0H A;  3T4R A;  2HKV A;  3FAP B;  1BR1 A;  4J7T A;  3NKE A;  3VYW A;  5A6A A;  2R7T A;  2YEV A;  4O7G A;  1LKX A;  2P6V A;  3RQF A;  4B6I A;  5DS5 A;  3AG1 C;  1CGM E;  3NYM A;  1FAP B;  2IXO A;  1BDJ B;  1LI7 A;  2Y3G A;  3DKA A;  1BBH A;  1U89 A;  3JTL O;  4IJJ A;  3K1I C;  2J9U A;  3UR3 C;  1H9G A;  3LLK A;  2Q7R A;  4CS7 A;  1ZHT A;  4CS8 C;  4YWQ A;  3C18 A;  4PFP A;  4YL0 A;  2IXP A;  2WB7 A;  4LDR A;  2YWA A;  4DRJ B;  3GOD A;  2LIG A;  4F4B A;  1TKN A;  1VYK A;  4KI2 A;  4X0R A;  1YAR O;  2GDC A;  4Z9H A;  1Z5Z A;  1SYQ A;  4RD9 A;  3JZ0 A;  4A4A A;  1EI7 A;  3EG9 B;  2R7W A;  5E3A A;  4CSA A;  3GM3 A;  4JTD B;  2Y69 C;  5JVE A;  1FFT C;  3FHD A;  2EIK C;  3A9C A;  4JVS A;  4U5G A;  2IOQ A;  4EWC A;  1LE2 A;  2GWW A;  3UNG C;  3GM2 A;  2VH3 A;  3T6G B;  3NMI A;  3EQL F;  4MVR A;  1ZVZ A;  2XLE A;  3LNM B;  4JZA A;  1PD0 A;  4Q4Z F;  3U2M A;  1LVK A;  3SXM A;  2BC5 A;  2HJM A;  4U9D A;  4DBQ A;  1YVI A;  1JR8 A;  4LDQ A;  1YZC A;  3K1I A;  4WGY A;  1E86 A;  1W2W A;  2V3C C;  2UUI A;  4CS8 A;  4N6C A;  3L8J A;  3LS1 A;  1OCR C;  3LEV A;  3Q6M A;  1R5I D;  3ZVR A;  4NTA A;  1QSP A;  3S90 A;  4MND A;  1U6H A;  4EBK A;  3LJB A;  3B71 A;  4XPX A;  3Q7L A;  5DVW A;  1RKE A;  2VC9 A;  4J32 B;  4YT5 A;  3U5S A;  1VYI A;  4G7H F;  1RJ9 A;  4XLP F;  1D0X A;  3G50 A;  3VRC A;  4BEM J;  4PJN A;  3DXJ F;  2JPU A;  3NMK A;  3EGD A;  3EJN A;  1V54 C;  3U9M A;  3VAY A;  4DXW A;  4OIO F;  2GAQ A;  1TWC A;  1F1M A;  2A6E F;  4CDA A;  3JYH A;  2J8W A;  3WG7 C;  4YK5 A;  1SF8 A;  5EGY A;  1NBB A;  2J0X A;  2YLD A;  5BQG A;  4PJM A;  1OXB A;  3GOR A;  1JPJ A;  2X0C A;  1Z3I X;  5IY5 C;  2D5R B;  5L0J A;  1TFK B;  1PCX A;  4HFF B;  4K1O A;  3EHN A;  1ZU4 A;  2GFH A;  1C17 M;  4QDL A;  1AEP A;  2J7P D;  4ULW A;  3VF0 A;  1ZYR F;  5DS6 A;  5DQT A;  2J46 A;  2LQG A;  2ZXO A;  1YA9 A;  2Z15 A;  1ZZP A;  2HZ8 A;  4G7Z F;  2H8A A;  1RKE B;  2V26 A;  4J7Y A;  3JSZ A;  4K7B A;  4Q7C A;  2DYR C;  2A6H F;  4GQH A;  3DAG A;  4CJG A;  1KTM A;  1RJ9 B;  5JP7 A;  2ETS A;  3ZIB A;  3U0C A;  3I5P A;  3EGD B;  3GWN A;  1D0Y A;  2QY9 A;  2XM4 A;  3C8G D;  4MVO A;  3ZQV A;  1QKR A;  1D0Z A;  1YZA A;  1QZX A;  4GEH A;  1H7I A;  4NTF A;  3SP1 A;  3B9Q A;  3EZH A;  2O9X A;  3WHN A;  5JS5 A;  5KYW A;  4QI0 A;  5CI9 A;  2VCA A;  4FES A;  2OOC A;  3T6J A;  1OQC A;  1G8X A;  3ATP A;  3DJN B;  1NFN A;  3DE9 A;  5BQI A;  3DWW A;  2PP4 A;  1C02 A;  1Z6A A;  2XLW A;  1G4W R;  2LFD A;  4R32 A;  4OIR F;  2OEX A;  4HFK B;  3DZA A;  3W2W A;  1TWG A;  2MYS A;  2L9J A;  2BE5 F;  3HNK A;  1A0B A;  4PAC A;  1WWP A;  1A41 A;  1D1B A;  1RCP A;  1XWJ A;  2HS5 A;  5FZT A;  1HE1 A;  3ASO C;  1FFH A;  4FWV A;  4XWJ A;  4IB4 A;  4CS9 A;  4OIP F;  4Q5S F;  4BJ6 C;  1MMA A;  3CAX A;  1M2O A;  3DI5 A;  4AX2 A;  2EPM X;  3N24 A;  1SR2 A;  5KYU A;  3SXY A;  2YKZ A;  1ZU5 A;  3LNR A;  2NG1 A;  1VK5 A;  2OQM A;  4N4W A;  1APC A;  2HUJ A;  2CW0 F;  2Q00 A;  2XLD A;  2R9R B;  3FAJ A;  2NUT A;  1YYJ A;  2XSE A;  4E0I A;  2J9V A;  4E17 A;  3PHF 2;  3RQE A;  1QQ3 A;  2ZPA A;  1ORJ A;  5KYW B;  3J06 A;  2XLO A;  2M64 A;  1FMV A;  3AG3 C;  4MS2 A;  3DAF A;  1T6Q A;  1SMY F;  1TR2 A;  1TWH A;  4XEK A;  3RYL A;  4IAR A;  3Q6N A;  3NDB B;  1WTY A;  2MHR A;  2J7P A;  4J30 B;  4JTC B;  4BPM A;  1M56 C;  3UMH A;  3CQZ A;  2R25 A;  1ZHZ A;  2QUP A;  1JMW A;  2MWQ A;  2A1D D;  2ZXR A;  3DM9 B;  5JLI A;  2XXA A;  2YL3 A;  4NTB A;  4PK4 A;  2L6F A;  2FFH A;  3IQC A;  3NG1 A;  3LUT B;  4XEF A;  5B1B C;  2YL0 A;  1A7E A;  3L1M A;  2A69 F;  3S27 A;  3TOM A;  2AWY A;  4BJ6 A;  5KYU B;  3UMK A;  1GM5 A;  3HKK A;  1A7V A;  2X51 A;  4JE9 A;  1NSG B;  3X2Q C;  3KH2 A;  3S29 A;  1L7C A;  1B68 A;  5E2Q A;  1NFO A;  4H4K C;  4MW8 A;  2NUT B;  4O6Y A;  1LS1 A;  1NU9 C;  2EPN A;  4MTG A;  2Q4F A;  2Q3T A;  2OEV A;  3ZDL A;  4D4N A;  1H9T A;  3GWL A;  3MYI A;  3M15 A;  2Q9C A;  3JRT A;  2HV7 A;  2AWC A;  1CPQ A;  4CDV A;  1MMD A;  3HNI A;  4W8P A;  3PMR A;  1KNY A;  2P7V A;  2OJE D;  4YJW A;  3RH3 A;  4EBJ A;  5DS4 A;  1C03 A;  5E3C A;  3S84 A;  1WGW A;  4KNV A;  2KJG A;  1Q0M A;  2XXA B;  2FGY A;  3AGT A;  4I1O B;  4EHP A;  3IQT A;  3Q7G A;  2B0J A;  2YQY A;  4ER9 A;  2PF4 E;  3EH2 A;  3B0V C;  1OKK D;  3FDQ A;  4XEV A;  3DM5 A;  1NG1 A;  3HNL A;  2XL6 A;  3GAN A;  4BEJ A;  1ZHY A;  3ITF A;  3AGU A;  4JKV A;  1FNT c;  1ST6 A;  4JRZ A;  3ZTM A;  2EIL C;  2RSE B;  1NLX A;  256B A;  3JT1 A;  1CGN A;  4XTK A;  3O6X A;  2D4U A;  2TMV P;  3TOL A;  3KPH A;  4P9T A;  4DVZ A;  5L3V A;  4OD4 A;  1RXQ A;  2LSE A;  2FAP B; 
#chains in the Genus database with same CATH homology
 3TD7 A;  3W4Y A;  3TK0 A;  3U5S A;  3R7C A;  3U2L A;  3GWN A;  4LDK A;  4E0H A;  4E0I A;  1JRA A;  3U2M A;  3MBG A;  3LLK A;  1OQC A;  1JR8 A;  2HJ3 A;  3LLI A;  3GWL A;  3O55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...