2HJ3A

Structure of the arabidopsis thaliana erv1 thiol oxidase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
101
structure length
101
Chain Sequence
PVTKEDLGRATWTFLHTLAAQYPEKPTRQQKKDVKELMTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVDARWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfhydryl oxidase Erv1p
publication title Gain of Function in an ERV/ALR Sulfhydryl Oxidase by Molecular Engineering of the Shuttle Disulfide.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 38
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 2hj3A00
3GWLA 3U2MA 3GWNA 4E0IA 1JRAA 3O55A 4LDKA 3TK0A 3W4YA 3R7CA 3U2LA 3U5SA 4E0HA 3TD7A 3LLKA 3LLIA 1OQCA 1JR8A 2HJ3A 3MBGA
chains in the Genus database with same CATH superfamily
3V5XA 1MMNA 2FFHA 3S90A 4I44A 4A2NB 4CX9A 1M57C 2NPUA 2Q4FA 4G0HA 1NLXA 1TFKB 4MVOA 5TJ5E 2BE5F 3KYJA 3ZIBA 2YLGA 1VYIA 4MVQA 4DRJB 4EBJA 3WG7C 2NSFA 4U5FE 5CIVA 1JOGA 4YL0A 3B9QA 3M4CA 2KW3C 3ZQVA 1SR2A 1E84A 1Z23A 3S84A 3J06A 2R7TA 4ONSA 3TJ6A 2UUIA 3S9OA 1H7IA 1I5NA 2XRHA 4JC7A 5HSWA 4KBLA 4JJGA 3LUTB 2O9XA 5JP7A 3S28A 1ZU4A 4E7SA 2JD3A 2YL1A 1T5OA 5D91A 2H8AA 4YL3A 3PHF2 1CPRA 4JW1A 5EHHA 2Q00A 4R32A 2XSEA 1U89A 3KL4A 4RDAA 5DQTA 4CBEA 3I4UA 1VMAA 4NY3A 2P7VA 3F46A 3DE8A 4E0IA 2Y3HA 5CI8A 1K05A 1ZHTA 2YRFA 2VCAA 4LDQA 1AEPA 3RW0A 1O87A 3K1HA 2GWWA 2EINC 2Q9BA 3K7DA 2EPOA 3R7CA 2OKUA 1TR2A 4N6HA 2GAQA 1V4AA 4BJ1A 2CW0F 2H7OA 3W2WA 1F1MA 1CGME 4FESA 5A69A 3MBGA 1QPUA 1NZEA 2OEVA 3EHNA 3LLIA 3WODF 2HJ3A 3B71A 1LM3B 3HNIA 2YVKA 1RJ9A 2V26A 2ASRA 3ZTMA 2ZXWC 5DS4A 2LFDA 1LI7A 2R7WA 1MMDA 1YARO 1YA9A 1C02A 3QVYA 4W8PA 2OOCA 1GGQA 3RKOF 1TKNA 1GM5A 1XZPA 1RKEA 2CNWD 3GANA 4L6RA 1YJGA 5KYYB 1AVOB 4C3EA 3N0TA 5BQGA 2IOQA 3T4RA 2KC3A 1RJ9B 2HFIA 2JPUA 4LERA 5E3AA 3EQLF 5A6AA 2A6EF 4IAOA 3KKBA 3IQTA 3OWTA 4EBBA 3WHNA 2L81A 5E2QA 1Q0KA 2QY9A 4OINF 2J7PD 4E0HA 1Y4CA 3E70C 3AQBA 4G7HF 3AGUA 1RKEB 4CDAA 3EG9B 4PR9A 3W8IA 5JVEA 3FMSA 1HMOA 2MWQA 2LSEA 3SNHA 1NBBA 4WGZA 4DOZA 5DVWA 2P6VA 4CDVA 3NMJA 3A11A 4KI2A 2J45A 2Y69C 3RFYA 3GWLA 2KJGA 1ST6A 1HE9A 4PACA 5FCLA 5L0GA 4C3BA 2J8WA 1R5ID 2L9JA 3G4XA 3R2PA 1V54C 4WJ0A 2IBFA 2HMQA 3C8GD 256BA 3DWWA 5D92A 2EPMX 4Z9IA 3KH2A 3M1CB 4AL0A 2P61A 4NCQA 3L1MA 1L3PA 2A1DD 4HE8D 3VAYA 1NU7D 2P1AA 1WASA 2EPNA 1A0BA 2VB6A 3C63A 3EGXB 4XLPF 3B0UX 3X1OA 2LD6A 1ZVZA 3LEOA 1MMGA 3ZTZA 1TWGA 4IJJA 5DLJA 2DYRC 2KGOA 2C04A 2WZGA 5COMA 3O39A 4BJTA 2R7RA 2IXNA 2XLEA 5L0FA 3ABKC 1V74B 4MVRA 1SYQA 3JYHA 4JKVA 4LLCA 4XEKA 3SYNA 4GEHA 4U5GA 3M4BA 1U6HA 4ER9A 4PJJA 1YYXA 3SXKA 1LPEA 3DAFA 2XS1A 1VTMP 4C7OB 3LNRA 1T01A 3DJUB 2IYLD 4JCHA 4YL1A 1UG7A 4XEFA 1A41A 3EHMA 3DKAA 4YN0B 5JUAA 3L8JA 2LK4A 1FMVA 4K1OA 3TQOA 4DVYP 5F5FA 3EJNA 3GM3A 5L0HA 1IW7F 3DM9B 3UR3C 3W2VA 3IQCA 3U2LA 2YL3A 4OIRF 4CIHA 2R7VA 2YHSA 2DYSC 3DD7A 2PF4E 3EH2A 2WZFA 2W4MA 2PNOA 1C03A 1CGNA 2EILC 3QW1A 2G62A 3EH1A 2CYDA 2OCCC 2HKVA 3S29A 4JURI 1MMAA 1NFNA 5KYWA 3S0XA 4U5CE 5BUOA 1I4YA 2A68F 3LESA 4JTDB 2J0XA 4EHPA 5DS5A 4JE9A 1ZHYA 1XWJA 1R4TA 2Y3GA 1TWAA 2KK1A 4NTBA 3DI5A 1LE4A 1D0YA 3GM1A 4Q7CA 4DJ9A 3HLZA 3AG3C 2OU6A 3PDMP 3HJCA 3NG1A 1DOWA 2LIGA 5E3CA 5EGYA 1FMWA 3JZ0A 3SP1A 5KYXA 2NUPB 1KU2A 1OXKA 3O10A 2H7VC 2HS5A 1UFBA 2DGJA 3OA1A 2CDQA 3QZCA 1L7CA 1KTMA 1BDJB 1TWCA 1AUEA 1H9GA 2J9WA 2RSEB 4JTAB 3ITFA 3ZG1A 4ZLCA 1FTSA 3K6BA 2W45A 3U5SA 3UNGC 3ZQYA 2NUTA 5KYXB 3I5QA 2L6GA 2NG1A 3NKDA 4H4KC 4AE4A 3JTLO 5L3VA 3ZDLA 3LLKA 4Q4ZF 3ECSA 1LE2A 4PK4A 4YK5A 1VB5A 1Z3IX 1OKKD 1WGWA 1Z63A 3BRJA 1A7EA 2YQYA 3UMIA 1APCA 4LACB 4IB4A 2KNHA 1NFOA 3JRTA 1Q0FA 4MNDA 3RYLA 4MTGA 3NYJA 4CIPA 2YKZA 2J46A 2OJQA 4I1OB 1OW7A 4PFOA 1I4ZA 1OW6A 4BG0A 4U9EA 1FR0A 3ATPA 3MLGA 3NYMA 1HMDA 1K04A 4FWVA 4JEAA 4Z9HA 3US6A 4XPWA 1RKCA 4YT2A 4CJGA 1OCZC 3KYIA 1G5ZA 2XLDA 1XZQA 3MYFA 2EPKX 1HE1A 3GORA 2PX0A 3PCVA 2B0HA 4J7YA 3H2VA 3NDBB 2LCHA 2GFHA 3CSKA 3X2QC 1RCPA 4XPXA 3TULA 2EPLX 4CS8C 2XLMA 5L3QA 2OJED 2QTVA 1T6UA 5T3TA 1VOMA 3G4ZA 3KMIA 4BJ5C 1ZHZA 5F28E 2H7BA 4U5HA 1E85A 1MNDA 1LS4A 2BC5A 2YL0A 3H65A 2WB7A 4MTFA 1VLSA 2XM4A 1FNTc 4NTFA 1Z7Qc 4O6YA 1JRAA 2LQGA 1JPNA 1WOLA 3JT1A 2XXAA 2HUJA 1S7ZA 5B3IA 2R02A 3LEVA 3T9OA 1A7DA 4U5BE 2EIJC 3SZRA 2XM0A 3EGDA 1OXBA 4IWBA 3F47A 4CS9C 1C17M 2R03A 3Q7GA 2C03A 2QNLA 3CEXA 3MYIA 4MVZA 1E86A 2L6FA 4XTKA 1YLMA 3K1IA 2KQ9A 4OD4A 2IXPA 2WVQA 2FGYA 3WAQA 5JSLA 3C62A 2XLOA 2AWCA 1N1CA 1D1AA 1PCXA 1QSPA 2Q9CA 2RD9A 4MVUA 1EA8A 1V55C 1OQCA 4H54A 2QLAA 3NYLA 3EGDB 3CQZA 4QDLA 2R05A 4J7TA 3DAGA 1M6TA 2W9YA 1G4US 4J30B 3JYYA 3UMHA 2XL4A 3U2MA 2CNWA 4FAPB 4O6NA 3LAYA 1LS1A 3AG2C 1IZMA 4HFFB 2HSBA 2YZSA 4O79A 2IM8A 2KYHA 3K33A 5KYUA 4QI0A 3VM6A 1NU9C 1ZW3A 2CCYA 2DB4A 5JS5A 1OCCC 3IPMO 1WTYA 1JMWA 2J7PA 2PBEA 3TK0A 4CS8A 4EUKB 2QUPA 3QMKA 3MFNA 4DRIB 1T9KA 4BJ5A 3H2UA 4IRUA 3MX3A 4HFKB 4MTOA 2Y39A 3HNJA 2A69F 5KYUB 4CS7A 2J0WA 4CJOA 2AVKA 2VCCA 2NSGA 3NKEA 3U9JA 1H6GA 1E83A 1ZHWA 3RQGA 1D1CA 2ZXRA 1LVKA 2Y3DA 4E7ZA 3DXJF 3L0IA 4MW8A 1NG1A 5B1BC 3C8GA 3FOPA 1JPJA 2G3VA 4GQHA 4CS9A 2PFDA 2JX0A 2YEVA 3M79A 4I1MA 4YT8A 4YWQA 4G7OF 3AOUA 4PJMA 5A6BD 3ZSUA 1ZW2A 3GEIA 1SZIA 1MQVA 4P6IC 3TJ5A 1FFHA 1TWHA 4KNVA 3CZ6A 2J9UA 1Z6AA 3QW0A 4O7GA 1VYKA 3ZVRA 2ICWG 3C8GB 3FVYA 3GODA 4N6CA 5A6KA 2V3CC 2OQMA 4BJ6C 1FAPB 2X0CA 3QVZA 2J9VA 3JSZA 4XEVA 2M4EA 3EFOA 4U5DE 4ULWA 4G7ZF 1M2VA 5JT4A 3UMKA 1Q0DA 3B29A 2XLHA 4RBNA 2Q3TA 2HSQA 2I8BA 2R9RB 3AG1C 2WL8A 3GWNA 4XLNF 3T6GB 5JLIA 2R7OA 4Q5SF 2XL8A 2L6HA 3M15A 2BL2A 4U5EE 3V5ZA 1QLEC 3SXZA 2QE9A 5L0IA 2LFFA 1OR3A 2AP3A 2HZ8A 2R25A 1HY5A 3C7JA 4LLEA 4JJFA 4LDKA 3RF3A 3RVZA 3W4YA 1YVIA 5EK0A 4OIQF 5DS6A 3JRMO 4NQFA 4DBRA 4EWCA 1WN0A 1M56C 2AWYA 3L8IA 1G4WR 2B0JA 4JEBA 3U8VA 3L34A 3TOMA 1G8XA 4X0RA 2TMVP 5HV9A 3RQEA 1YAUO 3N2ZB 4CSAA 2ZD9A 1LI5A 1BR4A 3HTKC 1FFTC 2KSFA 2XLWA 3E9VA 3NMIA 3HNLA 3HKKA 4E18A 4E17A 3N24A 4OD5A 2D5RB 3K1IC 5A6JA 2YWAA 3DZAA 4JTCB 4YT4A 2MHRA 2NUTB 4BEJA 4IGGA 2YL7A 4AE4B 4BJ6A 3I5PA 3GM2A 4JZAA 2VC9A 3C8ZA 1ZHXA 2IXOA 3B0VC 1T6QA 1BR2A 3QTHA 2ZPAA 2Y3BA 3EZIA 5F5HA 4MS2A 1YZCA 3RIPA 4FX5A 4JIOA 3AJMA 5L0DA 1OKKA 1U0BB 3VYWA 1ORSC 4XPYA 3FAJA 1EI7A 2PP4A 5CI9A 3FOOA 4MQ9F 5BQIA 3SEOA 3EZHA 2M64A 4DVZA 1ZZPA 4I3MA 2IXMA 3U9MA 3LS1A 3U8PA 3T6JA 4A4AA 3G50A 4ULVA 5COGA 3U3BA 3TOLA 1LKXA 2A0BA 4MVMA 4QI2A 1D1BA 2ZXPA 4EBKA 4F4BA 5AC5A 1ORYA 1BZ4A 2HV7A 3O55A 1J8MF 4N06A 4XQ1A 3BEHA 5K0IA 3T6BA 2R7XA 2W4BA 1Q0GA 2ZXOA 3IQ6A 2ETSA 2YLDA 1WWPA 5IY5C 4NC3A 2YLIA 4LDRA 2FAPB 5DQZA 5T1DB 1BBHA 1O3UA 5E33A 4RD9A 1GS9A 2XXAB 5B3SC 2E87A 5KYYA 4D4NA 4K0DA 2PX3A 3AGTA 3KPHA 3UGPA 1GQAA 1Y6DA 4P9FA 4PJNA 5JRAA 3FDQA 1YDIA 3FAPB 1D0XA 2GA0A 4EIYA 2WVOA 4IAQA 1OCRC 3RH3A 2G3KA 3CAXA 4D4XA 3LNMB 2LP4A 2Q9AA 2D4UA 5KYWB 3GEEA 3AG4C 1H9TA 1E2XA 1SMYF 3EG9A 1MNEA 3NRHA 3OEOA 4O6MA 3RQFA 2P0NA 2I15A 3DMDA 4G78A 1QZXA 1YZAA 1OCOC 3ASNC 4KNWA 4W8KA 5B1AC 3VRCA 2DI3A 3Q6NA 4ANJA 3VF0A 4UDVA 1Q0MA 3ZWIA 3FHDA 4C3DA 4OIPF 3DE9A 4OIOF 1EQ1A 1BR1A 3HNKA 2XL6A 2AU5A 3V7OA 3DM5A 3Q7LA 5L0CA 3C18A 4MVSA 4CDYA 2J9BA 2VASA 4KC9A 3SXMA 3ZC4A 2OG2A 1O5HA 2WVNA 4XWJA 3O6XA 4ZLDA 1QQ3A 5FZTA 1VK5A 3V5YA 4JVSA 3EPVA 2XS8A 3EGXA 1YA7O 2GDCA 3RVYA 1B68A 3ABLC 1J8YF 1PD1A 1DOVA 4PFPA 1EKYA 3IHUA 1S05A 2HV6A 1CPQA 2Z15A 3POVA 5BQHA 1K40A 1VLTA 4JRZA 4CSAC 3Q6MA 2CGEA 5KYNA 4JCZA 2R7UA 5COFA 4WABA 5GPGB 1JAFA 3S27A 5AC4A 1RMVA 3AQCA 2VH3A 1PV3A 2F22A 4AL1A 4AX2A 1LIHA 3IQ5A 5AGFA 4C7OA 2EIKC 3K66A 4IARA 3ASOC 1KNYA 3JSEO 4GYTA 4WGYA 3TD7A 2MYSA 4BPMA 4EKWA 2VCBA 1D0ZA 3JCUQ 1PD0A 4M63A 2HMZA 4Z9JA 4DXWA 3LS0A 4NTAA 1T6IA 4DRHB 1Z5ZA 1RXQA 3ABMC 4K7BA 2L7AA 2XLVA 1OW8A 1TFOB 5T3WA 4BEMJ 1NSGB 1M2OA 2OEXA 5A6BA 5L0JA 1YYJA 3SXYA 1HW1A 2HJMA 4P9TA 3U0CA 1TQGA 1SF8A 4MW3A 1HW2A 3U3FA 3EFOB 1QKRA 4HEAJ 1M2VB 2R7SA 4YJWA 1A7VA 3PMRA 1ZYRF 4J32B 4B6IA 3A9CA 3IEEA 4YT5A 2WZLA 4PJLA 2X51A 3GEHA 2A6HF 1ORJA 4AK9A 3UGOA 1QVXA 3B0PA 1W2WA 3NMKA 4U9DA 2R7QA 1OR2A 4N4WA 1CGOA 3DJNB 1WATA 2NUPA 3FXHA 2UUHA 4DBQA 2EIMC 1JR8A 1ZU5A 2A0UA 3LJBA 2Q7RA 3W8HA
chains in the Genus database with same CATH topology
3GWLA 3U2MA 3GWNA 4E0IA 1JRAA 3O55A 4LDKA 3TK0A 3W4YA 3R7CA 3U2LA 3U5SA 4E0HA 3TD7A 3LLKA 3LLIA 1OQCA 1JR8A 2HJ3A 3MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWL A;  3U2M A;  3GWN A;  4E0I A;  1JRA A;  3O55 A;  4LDK A;  3TK0 A;  3W4Y A;  3R7C A;  3U2L A;  3U5S A;  4E0H A;  3TD7 A;  3LLK A;  3LLI A;  1OQC A;  1JR8 A;  2HJ3 A;  3MBG A; 
#chains in the Genus database with same CATH topology
 3V5X A;  1MMN A;  2FFH A;  3S90 A;  4I44 A;  4A2N B;  4CX9 A;  1M57 C;  2NPU A;  2Q4F A;  4G0H A;  1NLX A;  1TFK B;  4MVO A;  5TJ5 E;  2BE5 F;  3KYJ A;  3ZIB A;  2YLG A;  1VYI A;  4MVQ A;  4DRJ B;  4EBJ A;  3WG7 C;  2NSF A;  4U5F E;  5CIV A;  1JOG A;  4YL0 A;  3B9Q A;  3M4C A;  2KW3 C;  3ZQV A;  1SR2 A;  1E84 A;  1Z23 A;  3S84 A;  3J06 A;  2R7T A;  4ONS A;  3TJ6 A;  2UUI A;  3S9O A;  1H7I A;  1I5N A;  2XRH A;  4JC7 A;  5HSW A;  4KBL A;  4JJG A;  3LUT B;  2O9X A;  5JP7 A;  3S28 A;  1ZU4 A;  4E7S A;  2JD3 A;  2YL1 A;  1T5O A;  5D91 A;  2H8A A;  4YL3 A;  3PHF 2;  1CPR A;  4JW1 A;  5EHH A;  2Q00 A;  4R32 A;  2XSE A;  1U89 A;  3KL4 A;  4RDA A;  5DQT A;  4CBE A;  3I4U A;  1VMA A;  4NY3 A;  2P7V A;  3F46 A;  3DE8 A;  4E0I A;  2Y3H A;  5CI8 A;  1K05 A;  1ZHT A;  2YRF A;  2VCA A;  4LDQ A;  1AEP A;  3RW0 A;  1O87 A;  3K1H A;  2GWW A;  2EIN C;  2Q9B A;  3K7D A;  2EPO A;  3R7C A;  2OKU A;  1TR2 A;  4N6H A;  2GAQ A;  1V4A A;  4BJ1 A;  2CW0 F;  2H7O A;  3W2W A;  1F1M A;  1CGM E;  4FES A;  5A69 A;  3MBG A;  1QPU A;  1NZE A;  2OEV A;  3EHN A;  3LLI A;  3WOD F;  2HJ3 A;  3B71 A;  1LM3 B;  3HNI A;  2YVK A;  1RJ9 A;  2V26 A;  2ASR A;  3ZTM A;  2ZXW C;  5DS4 A;  2LFD A;  1LI7 A;  2R7W A;  1MMD A;  1YAR O;  1YA9 A;  1C02 A;  3QVY A;  4W8P A;  2OOC A;  1GGQ A;  3RKO F;  1TKN A;  1GM5 A;  1XZP A;  1RKE A;  2CNW D;  3GAN A;  4L6R A;  1YJG A;  5KYY B;  1AVO B;  4C3E A;  3N0T A;  5BQG A;  2IOQ A;  3T4R A;  2KC3 A;  1RJ9 B;  2HFI A;  2JPU A;  4LER A;  5E3A A;  3EQL F;  5A6A A;  2A6E F;  4IAO A;  3KKB A;  3IQT A;  3OWT A;  4EBB A;  3WHN A;  2L81 A;  5E2Q A;  1Q0K A;  2QY9 A;  4OIN F;  2J7P D;  4E0H A;  1Y4C A;  3E70 C;  3AQB A;  4G7H F;  3AGU A;  1RKE B;  4CDA A;  3EG9 B;  4PR9 A;  3W8I A;  5JVE A;  3FMS A;  1HMO A;  2MWQ A;  2LSE A;  3SNH A;  1NBB A;  4WGZ A;  4DOZ A;  5DVW A;  2P6V A;  4CDV A;  3NMJ A;  3A11 A;  4KI2 A;  2J45 A;  2Y69 C;  3RFY A;  3GWL A;  2KJG A;  1ST6 A;  1HE9 A;  4PAC A;  5FCL A;  5L0G A;  4C3B A;  2J8W A;  1R5I D;  2L9J A;  3G4X A;  3R2P A;  1V54 C;  4WJ0 A;  2IBF A;  2HMQ A;  3C8G D;  256B A;  3DWW A;  5D92 A;  2EPM X;  4Z9I A;  3KH2 A;  3M1C B;  4AL0 A;  2P61 A;  4NCQ A;  3L1M A;  1L3P A;  2A1D D;  4HE8 D;  3VAY A;  1NU7 D;  2P1A A;  1WAS A;  2EPN A;  1A0B A;  2VB6 A;  3C63 A;  3EGX B;  4XLP F;  3B0U X;  3X1O A;  2LD6 A;  1ZVZ A;  3LEO A;  1MMG A;  3ZTZ A;  1TWG A;  4IJJ A;  5DLJ A;  2DYR C;  2KGO A;  2C04 A;  2WZG A;  5COM A;  3O39 A;  4BJT A;  2R7R A;  2IXN A;  2XLE A;  5L0F A;  3ABK C;  1V74 B;  4MVR A;  1SYQ A;  3JYH A;  4JKV A;  4LLC A;  4XEK A;  3SYN A;  4GEH A;  4U5G A;  3M4B A;  1U6H A;  4ER9 A;  4PJJ A;  1YYX A;  3SXK A;  1LPE A;  3DAF A;  2XS1 A;  1VTM P;  4C7O B;  3LNR A;  1T01 A;  3DJU B;  2IYL D;  4JCH A;  4YL1 A;  1UG7 A;  4XEF A;  1A41 A;  3EHM A;  3DKA A;  4YN0 B;  5JUA A;  3L8J A;  2LK4 A;  1FMV A;  4K1O A;  3TQO A;  4DVY P;  5F5F A;  3EJN A;  3GM3 A;  5L0H A;  1IW7 F;  3DM9 B;  3UR3 C;  3W2V A;  3IQC A;  3U2L A;  2YL3 A;  4OIR F;  4CIH A;  2R7V A;  2YHS A;  2DYS C;  3DD7 A;  2PF4 E;  3EH2 A;  2WZF A;  2W4M A;  2PNO A;  1C03 A;  1CGN A;  2EIL C;  3QW1 A;  2G62 A;  3EH1 A;  2CYD A;  2OCC C;  2HKV A;  3S29 A;  4JUR I;  1MMA A;  1NFN A;  5KYW A;  3S0X A;  4U5C E;  5BUO A;  1I4Y A;  2A68 F;  3LES A;  4JTD B;  2J0X A;  4EHP A;  5DS5 A;  4JE9 A;  1ZHY A;  1XWJ A;  1R4T A;  2Y3G A;  1TWA A;  2KK1 A;  4NTB A;  3DI5 A;  1LE4 A;  1D0Y A;  3GM1 A;  4Q7C A;  4DJ9 A;  3HLZ A;  3AG3 C;  2OU6 A;  3PDM P;  3HJC A;  3NG1 A;  1DOW A;  2LIG A;  5E3C A;  5EGY A;  1FMW A;  3JZ0 A;  3SP1 A;  5KYX A;  2NUP B;  1KU2 A;  1OXK A;  3O10 A;  2H7V C;  2HS5 A;  1UFB A;  2DGJ A;  3OA1 A;  2CDQ A;  3QZC A;  1L7C A;  1KTM A;  1BDJ B;  1TWC A;  1AUE A;  1H9G A;  2J9W A;  2RSE B;  4JTA B;  3ITF A;  3ZG1 A;  4ZLC A;  1FTS A;  3K6B A;  2W45 A;  3U5S A;  3UNG C;  3ZQY A;  2NUT A;  5KYX B;  3I5Q A;  2L6G A;  2NG1 A;  3NKD A;  4H4K C;  4AE4 A;  3JTL O;  5L3V A;  3ZDL A;  3LLK A;  4Q4Z F;  3ECS A;  1LE2 A;  4PK4 A;  4YK5 A;  1VB5 A;  1Z3I X;  1OKK D;  1WGW A;  1Z63 A;  3BRJ A;  1A7E A;  2YQY A;  3UMI A;  1APC A;  4LAC B;  4IB4 A;  2KNH A;  1NFO A;  3JRT A;  1Q0F A;  4MND A;  3RYL A;  4MTG A;  3NYJ A;  4CIP A;  2YKZ A;  2J46 A;  2OJQ A;  4I1O B;  1OW7 A;  4PFO A;  1I4Z A;  1OW6 A;  4BG0 A;  4U9E A;  1FR0 A;  3ATP A;  3MLG A;  3NYM A;  1HMD A;  1K04 A;  4FWV A;  4JEA A;  4Z9H A;  3US6 A;  4XPW A;  1RKC A;  4YT2 A;  4CJG A;  1OCZ C;  3KYI A;  1G5Z A;  2XLD A;  1XZQ A;  3MYF A;  2EPK X;  1HE1 A;  3GOR A;  2PX0 A;  3PCV A;  2B0H A;  4J7Y A;  3H2V A;  3NDB B;  2LCH A;  2GFH A;  3CSK A;  3X2Q C;  1RCP A;  4XPX A;  3TUL A;  2EPL X;  4CS8 C;  2XLM A;  5L3Q A;  2OJE D;  2QTV A;  1T6U A;  5T3T A;  1VOM A;  3G4Z A;  3KMI A;  4BJ5 C;  1ZHZ A;  5F28 E;  2H7B A;  4U5H A;  1E85 A;  1MND A;  1LS4 A;  2BC5 A;  2YL0 A;  3H65 A;  2WB7 A;  4MTF A;  1VLS A;  2XM4 A;  1FNT c;  4NTF A;  1Z7Q c;  4O6Y A;  1JRA A;  2LQG A;  1JPN A;  1WOL A;  3JT1 A;  2XXA A;  2HUJ A;  1S7Z A;  5B3I A;  2R02 A;  3LEV A;  3T9O A;  1A7D A;  4U5B E;  2EIJ C;  3SZR A;  2XM0 A;  3EGD A;  1OXB A;  4IWB A;  3F47 A;  4CS9 C;  1C17 M;  2R03 A;  3Q7G A;  2C03 A;  2QNL A;  3CEX A;  3MYI A;  4MVZ A;  1E86 A;  2L6F A;  4XTK A;  1YLM A;  3K1I A;  2KQ9 A;  4OD4 A;  2IXP A;  2WVQ A;  2FGY A;  3WAQ A;  5JSL A;  3C62 A;  2XLO A;  2AWC A;  1N1C A;  1D1A A;  1PCX A;  1QSP A;  2Q9C A;  2RD9 A;  4MVU A;  1EA8 A;  1V55 C;  1OQC A;  4H54 A;  2QLA A;  3NYL A;  3EGD B;  3CQZ A;  4QDL A;  2R05 A;  4J7T A;  3DAG A;  1M6T A;  2W9Y A;  1G4U S;  4J30 B;  3JYY A;  3UMH A;  2XL4 A;  3U2M A;  2CNW A;  4FAP B;  4O6N A;  3LAY A;  1LS1 A;  3AG2 C;  1IZM A;  4HFF B;  2HSB A;  2YZS A;  4O79 A;  2IM8 A;  2KYH A;  3K33 A;  5KYU A;  4QI0 A;  3VM6 A;  1NU9 C;  1ZW3 A;  2CCY A;  2DB4 A;  5JS5 A;  1OCC C;  3IPM O;  1WTY A;  1JMW A;  2J7P A;  2PBE A;  3TK0 A;  4CS8 A;  4EUK B;  2QUP A;  3QMK A;  3MFN A;  4DRI B;  1T9K A;  4BJ5 A;  3H2U A;  4IRU A;  3MX3 A;  4HFK B;  4MTO A;  2Y39 A;  3HNJ A;  2A69 F;  5KYU B;  4CS7 A;  2J0W A;  4CJO A;  2AVK A;  2VCC A;  2NSG A;  3NKE A;  3U9J A;  1H6G A;  1E83 A;  1ZHW A;  3RQG A;  1D1C A;  2ZXR A;  1LVK A;  2Y3D A;  4E7Z A;  3DXJ F;  3L0I A;  4MW8 A;  1NG1 A;  5B1B C;  3C8G A;  3FOP A;  1JPJ A;  2G3V A;  4GQH A;  4CS9 A;  2PFD A;  2JX0 A;  2YEV A;  3M79 A;  4I1M A;  4YT8 A;  4YWQ A;  4G7O F;  3AOU A;  4PJM A;  5A6B D;  3ZSU A;  1ZW2 A;  3GEI A;  1SZI A;  1MQV A;  4P6I C;  3TJ5 A;  1FFH A;  1TWH A;  4KNV A;  3CZ6 A;  2J9U A;  1Z6A A;  3QW0 A;  4O7G A;  1VYK A;  3ZVR A;  2ICW G;  3C8G B;  3FVY A;  3GOD A;  4N6C A;  5A6K A;  2V3C C;  2OQM A;  4BJ6 C;  1FAP B;  2X0C A;  3QVZ A;  2J9V A;  3JSZ A;  4XEV A;  2M4E A;  3EFO A;  4U5D E;  4ULW A;  4G7Z F;  1M2V A;  5JT4 A;  3UMK A;  1Q0D A;  3B29 A;  2XLH A;  4RBN A;  2Q3T A;  2HSQ A;  2I8B A;  2R9R B;  3AG1 C;  2WL8 A;  3GWN A;  4XLN F;  3T6G B;  5JLI A;  2R7O A;  4Q5S F;  2XL8 A;  2L6H A;  3M15 A;  2BL2 A;  4U5E E;  3V5Z A;  1QLE C;  3SXZ A;  2QE9 A;  5L0I A;  2LFF A;  1OR3 A;  2AP3 A;  2HZ8 A;  2R25 A;  1HY5 A;  3C7J A;  4LLE A;  4JJF A;  4LDK A;  3RF3 A;  3RVZ A;  3W4Y A;  1YVI A;  5EK0 A;  4OIQ F;  5DS6 A;  3JRM O;  4NQF A;  4DBR A;  4EWC A;  1WN0 A;  1M56 C;  2AWY A;  3L8I A;  1G4W R;  2B0J A;  4JEB A;  3U8V A;  3L34 A;  3TOM A;  1G8X A;  4X0R A;  2TMV P;  5HV9 A;  3RQE A;  1YAU O;  3N2Z B;  4CSA A;  2ZD9 A;  1LI5 A;  1BR4 A;  3HTK C;  1FFT C;  2KSF A;  2XLW A;  3E9V A;  3NMI A;  3HNL A;  3HKK A;  4E18 A;  4E17 A;  3N24 A;  4OD5 A;  2D5R B;  3K1I C;  5A6J A;  2YWA A;  3DZA A;  4JTC B;  4YT4 A;  2MHR A;  2NUT B;  4BEJ A;  4IGG A;  2YL7 A;  4AE4 B;  4BJ6 A;  3I5P A;  3GM2 A;  4JZA A;  2VC9 A;  3C8Z A;  1ZHX A;  2IXO A;  3B0V C;  1T6Q A;  1BR2 A;  3QTH A;  2ZPA A;  2Y3B A;  3EZI A;  5F5H A;  4MS2 A;  1YZC A;  3RIP A;  4FX5 A;  4JIO A;  3AJM A;  5L0D A;  1OKK A;  1U0B B;  3VYW A;  1ORS C;  4XPY A;  3FAJ A;  1EI7 A;  2PP4 A;  5CI9 A;  3FOO A;  4MQ9 F;  5BQI A;  3SEO A;  3EZH A;  2M64 A;  4DVZ A;  1ZZP A;  4I3M A;  2IXM A;  3U9M A;  3LS1 A;  3U8P A;  3T6J A;  4A4A A;  3G50 A;  4ULV A;  5COG A;  3U3B A;  3TOL A;  1LKX A;  2A0B A;  4MVM A;  4QI2 A;  1D1B A;  2ZXP A;  4EBK A;  4F4B A;  5AC5 A;  1ORY A;  1BZ4 A;  2HV7 A;  3O55 A;  1J8M F;  4N06 A;  4XQ1 A;  3BEH A;  5K0I A;  3T6B A;  2R7X A;  2W4B A;  1Q0G A;  2ZXO A;  3IQ6 A;  2ETS A;  2YLD A;  1WWP A;  5IY5 C;  4NC3 A;  2YLI A;  4LDR A;  2FAP B;  5DQZ A;  5T1D B;  1BBH A;  1O3U A;  5E33 A;  4RD9 A;  1GS9 A;  2XXA B;  5B3S C;  2E87 A;  5KYY A;  4D4N A;  4K0D A;  2PX3 A;  3AGT A;  3KPH A;  3UGP A;  1GQA A;  1Y6D A;  4P9F A;  4PJN A;  5JRA A;  3FDQ A;  1YDI A;  3FAP B;  1D0X A;  2GA0 A;  4EIY A;  2WVO A;  4IAQ A;  1OCR C;  3RH3 A;  2G3K A;  3CAX A;  4D4X A;  3LNM B;  2LP4 A;  2Q9A A;  2D4U A;  5KYW B;  3GEE A;  3AG4 C;  1H9T A;  1E2X A;  1SMY F;  3EG9 A;  1MNE A;  3NRH A;  3OEO A;  4O6M A;  3RQF A;  2P0N A;  2I15 A;  3DMD A;  4G78 A;  1QZX A;  1YZA A;  1OCO C;  3ASN C;  4KNW A;  4W8K A;  5B1A C;  3VRC A;  2DI3 A;  3Q6N A;  4ANJ A;  3VF0 A;  4UDV A;  1Q0M A;  3ZWI A;  3FHD A;  4C3D A;  4OIP F;  3DE9 A;  4OIO F;  1EQ1 A;  1BR1 A;  3HNK A;  2XL6 A;  2AU5 A;  3V7O A;  3DM5 A;  3Q7L A;  5L0C A;  3C18 A;  4MVS A;  4CDY A;  2J9B A;  2VAS A;  4KC9 A;  3SXM A;  3ZC4 A;  2OG2 A;  1O5H A;  2WVN A;  4XWJ A;  3O6X A;  4ZLD A;  1QQ3 A;  5FZT A;  1VK5 A;  3V5Y A;  4JVS A;  3EPV A;  2XS8 A;  3EGX A;  1YA7 O;  2GDC A;  3RVY A;  1B68 A;  3ABL C;  1J8Y F;  1PD1 A;  1DOV A;  4PFP A;  1EKY A;  3IHU A;  1S05 A;  2HV6 A;  1CPQ A;  2Z15 A;  3POV A;  5BQH A;  1K40 A;  1VLT A;  4JRZ A;  4CSA C;  3Q6M A;  2CGE A;  5KYN A;  4JCZ A;  2R7U A;  5COF A;  4WAB A;  5GPG B;  1JAF A;  3S27 A;  5AC4 A;  1RMV A;  3AQC A;  2VH3 A;  1PV3 A;  2F22 A;  4AL1 A;  4AX2 A;  1LIH A;  3IQ5 A;  5AGF A;  4C7O A;  2EIK C;  3K66 A;  4IAR A;  3ASO C;  1KNY A;  3JSE O;  4GYT A;  4WGY A;  3TD7 A;  2MYS A;  4BPM A;  4EKW A;  2VCB A;  1D0Z A;  3JCU Q;  1PD0 A;  4M63 A;  2HMZ A;  4Z9J A;  4DXW A;  3LS0 A;  4NTA A;  1T6I A;  4DRH B;  1Z5Z A;  1RXQ A;  3ABM C;  4K7B A;  2L7A A;  2XLV A;  1OW8 A;  1TFO B;  5T3W A;  4BEM J;  1NSG B;  1M2O A;  2OEX A;  5A6B A;  5L0J A;  1YYJ A;  3SXY A;  1HW1 A;  2HJM A;  4P9T A;  3U0C A;  1TQG A;  1SF8 A;  4MW3 A;  1HW2 A;  3U3F A;  3EFO B;  1QKR A;  4HEA J;  1M2V B;  2R7S A;  4YJW A;  1A7V A;  3PMR A;  1ZYR F;  4J32 B;  4B6I A;  3A9C A;  3IEE A;  4YT5 A;  2WZL A;  4PJL A;  2X51 A;  3GEH A;  2A6H F;  1ORJ A;  4AK9 A;  3UGO A;  1QVX A;  3B0P A;  1W2W A;  3NMK A;  4U9D A;  2R7Q A;  1OR2 A;  4N4W A;  1CGO A;  3DJN B;  1WAT A;  2NUP A;  3FXH A;  2UUH A;  4DBQ A;  2EIM C;  1JR8 A;  1ZU5 A;  2A0U A;  3LJB A;  2Q7R A;  3W8H A; 
#chains in the Genus database with same CATH homology
 3GWL A;  3U2M A;  3GWN A;  4E0I A;  1JRA A;  3O55 A;  4LDK A;  3TK0 A;  3W4Y A;  3R7C A;  3U2L A;  3U5S A;  4E0H A;  3TD7 A;  3LLK A;  3LLI A;  1OQC A;  1JR8 A;  2HJ3 A;  3MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...