2HJ3A

Structure of the arabidopsis thaliana erv1 thiol oxidase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
101
structure length
101
Chain Sequence
PVTKEDLGRATWTFLHTLAAQYPEKPTRQQKKDVKELMTILSRMYPCRECADHFKEILRSNPAQAGSQEEFSQWLCHVHNTVNRSLGKLVFPCERVDARWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfhydryl oxidase Erv1p
publication title Gain of Function in an ERV/ALR Sulfhydryl Oxidase by Molecular Engineering of the Shuttle Disulfide.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 38
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 2hj3A00
3U5SA 3GWNA 3LLIA 4E0IA 1OQCA 3TD7A 1JRAA 3U2LA 3LLKA 3U2MA 3O55A 3R7CA 3TK0A 1JR8A 4E0HA 3W4YA 3GWLA 4LDKA 3MBGA 2HJ3A
chains in the Genus database with same CATH superfamily
3DE8A 3AQCA 4JEBA 2Y69C 3NKDA 3EHNA 3T6JA 4CSAC 2R7TA 4GYTA 3A9CA 3AGTA 3I5QA 2XLOA 4FAPB 2B0HA 4E17A 1T5OA 4JVSA 1JMWA 1H9GA 4R32A 2IOQA 4Z9JA 1QLEC 5EK0A 4EBJA 3H65A 5L0HA 1ZHTA 1YA9A 3T4RA 1OXKA 2WL8A 3HNJA 2LD6A 3NDBB 4U9EA 3KL4A 1SF8A 1RMVA 3RQGA 4M63A 1A0BA 1YYJA 4I44A 1ZZPA 3AGUA 3OWTA 3QVYA 4N6CA 3QTHA 3U9JA 3KH2A 1HW2A 2HJMA 1KTMA 1L3PA 2WZLA 3UGOA 4D4XA 2XM0A 2AVKA 5A6JA 2OG2A 1VYKA 2XLMA 2HFIA 3FAPB 3TULA 1C17M 4PJLA 4CDYA 4OIPF 2KGOA 4I1OB 2R7VA 2MHRA 2YL3A 2GFHA 1JRAA 1NZEA 2J9BA 3TD7A 3S27A 4DVYP 3DAGA 4G78A 4ONSA 5A6AA 2LCHA 1B68A 2Y3DA 3UR3C 1H7IA 1PD0A 5B3SC 4ANJA 3M15A 1QZXA 1JOGA 2J46A 1NU9C 3BRJA 2Y3GA 1DOWA 1VTMP 3K1HA 3RQFA 4C3BA 4G7ZF 3DM9B 4XWJA 2J0WA 3ECSA 3IPMO 2W4BA 3FOPA 1T6UA 5K0IA 3HLZA 4PJMA 2CNWD 4LDRA 5COMA 3MYFA 3EZHA 3SZRA 1FR0A 1HE9A 1G4WR 3GANA 3JYYA 5L3QA 1Y6DA 3AOUA 4MVZA 3DZAA 3Q6MA 1RXQA 1BZ4A 2R7UA 1VLTA 2AWCA 4J7YA 1OKKD 1OCCC 3IQTA 3R2PA 1W2WA 3RKOF 5A6BD 5DS6A 1BR4A 5CI9A 5BQIA 1GS9A 4BEJA 1G4US 2Q9CA 2ZXOA 2CW0F 5EGYA 2I15A 3LUTB 3KPHA 3E9VA 5KYUA 3K6BA 1I5NA 5KYYA 5KYUB 1D0YA 4MVUA 3DKAA 1YLMA 5JRAA 1A7EA 1Q0DA 1ZHXA 1V55C 3GEIA 2NUTA 2YRFA 3FAJA 1WGWA 3ASOC 3WODF 4JTCB 3JZ0A 2C03A 2XLVA 2AWYA 3DE9A 2XSEA 3B0VC 2AP3A 2HMZA 2R7QA 3NYJA 4RD9A 2CGEA 2GA0A 1CGNA 3B71A 3N0TA 4NY3A 4G7HF 3LS0A 3LNMB 3VAYA 1H6GA 2EIKC 2B0JA 1WWPA 2IXOA 2YWAA 4J32B 2LFDA 5COFA 1BR2A 1VK5A 2MWQA 4YL0A 2JPUA 1H9TA 3T9OA 2KK1A 1UFBA 2HZ8A 2KYHA 2Y3HA 3L1MA 3IHUA 4UDVA 1A41A 1V54C 3AJMA 3TJ6A 4MNDA 5CIVA 2ETSA 3CZ6A 4NTFA 4EKWA 1MNDA 2LFFA 2OKUA 5T3TA 4LDKA 4AL0A 1M56C 1ZHYA 2YKZA 1G5ZA 1FMVA 3AG1C 4W8KA 1OKKA 4LERA 4XQ1A 1C03A 3ZSUA 4CX9A 3IQ6A 4Q4ZF 4KBLA 1SYQA 3PMRA 3S9OA 3EPVA 1JPJA 2LIGA 4YT2A 2KW3C 2QTVA 3DAFA 4J7TA 2WZGA 1RJ9B 1OQCA 3H2VA 3LEVA 4PFPA 4U5FE 5JP7A 3S28A 3U2MA 2W9YA 2J9VA 2UUIA 5L0FA 3G4ZA 3OEOA 1M2OA 3DD7A 3NG1A 2EPKX 1SMYF 3B0UX 3HNKA 2XLWA 2LK4A 4WGYA 4BJ6A 2R7WA 4IB4A 3WG7C 2A0UA 4IRUA 4MTFA 5AC5A 3LESA 1NG1A 4DRIB 2BC5A 1QQ3A 5BQGA 1ZU4A 2G62A 1OW6A 4U5BE 4GEHA 4JIOA 4G0HA 3HJCA 4U9DA 3V5YA 1U89A 1MMGA 1Z3IX 4CIPA 1GQAA 3C8ZA 5GPGB 4N6HA 5F5FA 3CSKA 1D0ZA 1LI5A 1VYIA 1ZU5A 2QUPA 2R02A 2V26A 3AG2C 3L8IA 1I4YA 3RVYA 4CJGA 4K7BA 2VH3A 3FVYA 4OIQF 1D1AA 1CPQA 1NFOA 4WABA 4QI2A 1V4AA 2HKVA 4JEAA 4K0DA 3EQLF 3LAYA 3X2QC 3ZTMA 3Q7GA 3ZTZA 2QE9A 4QI0A 1G8XA 4A4AA 2EINC 2R9RB 1D1BA 2DB4A 4O7GA 2OOCA 2WVQA 1K04A 1ZVZA 3DMDA 3H2UA 4DVZA 4ZLCA 4PR9A 2PX3A 1VOMA 3T6BA 3TQOA 2VCBA 2ZXRA 5B1AC 4YT4A 3WHNA 1ZYRF 2XXAA 1HMOA 2IXMA 2PFDA 2ZXWC 4OD4A 1Y4CA 2HV6A 4JE9A 4EUKB 1A7VA 3K1IC 4XLPF 1RKEA 4DBRA 2PX0A 1QPUA 2AU5A 1LKXA 1RKEB 3SXYA 4Q5SF 2XL4A 4JC7A 4CS9C 5TJ5E 3ZG1A 5COGA 3POVA 3U8VA 1LE4A 2NPUA 3U3FA 3EHMA 4A2NB 3C8GB 1XWJA 3FMSA 3QW0A 3GEEA 4MVRA 4OIOF 1JAFA 1O5HA 3NYLA 3RQEA 2HMQA 4FWVA 1MMDA 2FAPB 4YL3A 1A7DA 2A68F 2XLEA 2PBEA 2YVKA 1TFKB 1R5ID 5BQHA 3V5ZA 3E70C 1BR1A 2VCAA 1LM3B 1ORYA 2KSFA 3UMKA 2IXPA 2WVOA 2YL0A 4C3DA 4EBBA 4DOZA 5CI8A 1NBBA 5L0CA 3SNHA 3U0CA 2YL1A 3K66A 5F5HA 1IW7F 2OJED 3K33A 4PJNA 4XLNF 3S90A 4CSAA 3GEHA 4OIRF 3PDMP 2P61A 5AGFA 1MMAA 1Z7Qc 4IJJA 4U5GA 4KNWA 2P1AA 4B6IA 4LACB 3RF3A 1T6QA 4CS8C 4LLCA 2W45A 3GM2A 5L0DA 4EBKA 1WTYA 1T9KA 2J45A 4AL1A 1AUEA 2HV7A 3O39A 1CPRA 1DOVA 1ZW2A 2H7OA 3O6XA 3ZIBA 4BJTA 5B3IA 1CGME 5A6KA 5A69A 4BJ5C 2OU6A 3HKKA 5L0JA 4U5CE 4MVSA 3NMIA 2O9XA 4NC3A 3RVZA 2R7XA 1ZHWA 5KYWB 1M6TA 4MQ9F 3ATPA 3DM5A 2KNHA 1LVKA 2HSQA 3GM3A 5DS4A 2P7VA 4KI2A 2OEVA 5E3CA 2BL2A 4Q7CA 1K40A 1Z6AA 3EGDA 1IZMA 2EIMC 3HNLA 4JTAB 1E2XA 3LS1A 5KYXB 1NFNA 4JURI 2EPLX 1ST6A 2J8WA 1BDJB 2HSBA 2JX0A 3C62A 3EGDB 4IAOA 1VLSA 1JPNA 1Z63A 4LLEA 2WB7A 4JJGA 1UG7A 3ZVRA 4E18A 5KYYB 2LSEA 4KNVA 2J7PA 4K1OA 2RD9A 1QVXA 1MMNA 5DQTA 2J9UA 1Z23A 1T01A 2KC3A 5E33A 4YK5A 3KKBA 1WATA 3LJBA 3N2ZB 2ZPAA 3JSEO 3R7CA 1GGQA 2XL8A 5E2QA 1TWAA 4ZLDA 5DVWA 5AC4A 4U5HA 1WOLA 4IGGA 2XLDA 3EJNA 1HMDA 1D0XA 4H4KC 3ZDLA 4DRHB 1N1CA 2J0XA 3US6A 4DXWA 3EZIA 4E7ZA 1FMWA 3EGXA 2Q9AA 3J06A 2DGJA 3EGXB 3U5SA 2A1DD 2L6HA 4U5EE 2V3CC 2BE5F 1R4TA 4IARA 1SZIA 1LI7A 4MVOA 2PF4E 1RJ9A 4MTGA 4AE4B 1YYXA 3M1CB 1PV3A 2IM8A 3DI5A 3NMJA 3V5XA 5DLJA 4C7OB 2A6HF 2XXAB 1WASA 3G50A 4O79A 4Z9HA 3NRHA 4H54A 4XPWA 3U3BA 2DI3A 1TR2A 2WZFA 1Q0GA 3NKEA 2R25A 1FNTc 3C8GD 2VB6A 3ABLC 3AG4C 2Q3TA 3SXMA 4XEFA 4CDVA 2UUHA 2PP4A 4YT8A 3N24A 5DS5A 4DRJB 1E84A 3DJUB 5B1BC 2HS5A 4NTAA 3F46A 1HY5A 1LPEA 2Q00A 3JTLO 4LDQA 2CCYA 3VYWA 4CJOA 3C18A 4O6YA 5F28E 1I4ZA 2HJ3A 4BJ1A 2G3VA 4F4BA 2R03A 4CIHA 1TWHA 2CDQA 2OQMA 4MTOA 1J8YF 1TWGA 5KYNA 2LQGA 4CS7A 3HTKC 2J9WA 1YDIA 1GM5A 4L6RA 4WGZA 2Q4FA 4P6IC 4DBQA 3W2WA 2JD3A 2ZD9A 3EG9B 3LLKA 3JT1A 1AVOB 3M79A 2Q7RA 2D5RB 4JTDB 1Q0FA 2I8BA 3G4XA 5D92A 4YJWA 4RBNA 3DXJF 2FFHA 2L7AA 1D1CA 3PCVA 3C63A 4X0RA 4BEMJ 4XPXA 3ITFA 1XZQA 5JSLA 3TK0A 4YL1A 3B29A 3L34A 2XL6A 4MW8A 1L7CA 3SXKA 3DWWA 1Z5ZA 1OW8A 2EILC 3QVZA 3EH1A 4FESA 2IBFA 3L0IA 3SXZA 1KNYA 2QNLA 4JKVA 1OCRC 1RKCA 1FAPB 3ABMC 3FDQA 3W2VA 2P0NA 3U9MA 1M2VB 1K05A 4E7SA 2Y39A 3F47A 3RYLA 4WJ0A 3A11A 4O6MA 3OA1A 5D91A 3JCUQ 3LLIA 5JS5A 4D4NA 4HFKB 3RH3A 1YJGA 3BEHA 3C8GA 4DJ9A 4MW3A 3SEOA 4ER9A 1Q0KA 2YLDA 3FOOA 3U8PA 1EI7A 3JRMO 1TQGA 3IQ5A 3FXHA 3EH2A 2EPOA 2IYLD 2X51A 5JLIA 2J7PD 2YL7A 1LS1A 1NLXA 2C04A 2KQ9A 3LEOA 4JRZA 3GM1A 1JR8A 4E0HA 2A6EF 3QW1A 3Q6NA 3WAQA 4J30B 1YZAA 4MS2A 2YLIA 3VRCA 4C3EA 3KYJA 3ZQVA 3C7JA 2RSEB 1HE1A 4I3MA 4NQFA 3RFYA 3L8JA 4BG0A 4Z9IA 3GWLA 1LS4A 4JJFA 4XTKA 3W8HA 2A0BA 2XS1A 4O6NA 1FTSA 2D4UA 3GWNA 2R7RA 3AG3C 5HV9A 3IEEA 1PCXA 4I1MA 4JCHA 4N4WA 2GDCA 5E3AA 3KYIA 4FX5A 3ZWIA 4GQHA 4BPMA 3LNRA 4XEKA 2H7BA 4JW1A 3U2LA 2L81A 3S84A 5BUOA 3B0PA 3W8IA 3S0XA 1E86A 2EPNA 2ICWG 2E87A 3O55A 2Y3BA 4HFFB 1OW7A 4U5DE 2DYSC 2TMVP 1HW1A 1U0BB 4N06A 5KYWA 4OINF 1V74B 5JT4A 4MVQA 2M64A 2GAQA 3K1IA 4YN0B 5JVEA 2XLHA 3MX3A 4AK9A 2R05A 3SYNA 3B9QA 4PFOA 5KYXA 1YAUO 3UMIA 1AEPA 4CS9A 2R7OA 4PJJA 3VM6A 1CGOA 2XM4A 1RCPA 1OR2A 3JSZA 1WN0A 3O10A 3FHDA 2ASRA 256BA 3I4UA 1MNEA 1TKNA 2L6FA 3CEXA 3MFNA 5T3WA 3RW0A 1APCA 2P6VA 1FFTC 3RIPA 1TWCA 4ULWA 2YLGA 2Q9BA 4IAQA 3T6GB 1XZPA 1ORJA 2L9JA 2KJGA 1M57C 2A69F 2VC9A 3JRTA 3MYIA 4ULVA 4XEVA 4PACA 3V7OA 3ABKC 3NYMA 2VASA 2W4MA 4HEAJ 1E85A 3K7DA 5EHHA 2XS8A 4EWCA 1NU7D 4NCQA 3ZC4A 3GODA 3UMHA 4BJ6C 1T6IA 4CS8A 2VCCA 2YZSA 2NUTB 3JYHA 1NSGB 2DYRC 3MBGA 5T1DB 3TOMA 2X0CA 3ASNC 1PD1A 2IXNA 4EIYA 2R7SA 4AE4A 1EQ1A 3UNGC 4C7OA 4BJ5A 3UGPA 2QY9A 2OEXA 3GORA 1BBHA 2NSGA 1S05A 4PK4A 2ZXPA 5HSWA 3VF0A 4IWBA 1VB5A 1O3UA 1VMAA 2H7VC 3DJNB 2Z15A 1OXBA 2PNOA 4EHPA 1U6HA 2G3KA 2WVNA 4NTBA 3TJ5A 4AX2A 1YVIA 2CNWA 1C02A 5IY5C 4QDLA 5FCLA 3CQZA 4CDAA 1SR2A 5L3VA 3PHF2 3KMIA 4KC9A 3ZQYA 1J8MF 1OR3A 1ZW3A 1TFOB 1YZCA 4G7OF 1ZHZA 1FFHA 1YARO 1O87A 3HNIA 5A6BA 3EFOA 3CAXA 2YEVA 3QMKA 4W8PA 4XPYA 4E0IA 5L0GA 3Q7LA 3M4BA 2NG1A 2NUPA 1EA8A 3EG9A 3EFOB 1E83A 2MYSA 2XRHA 3MLGA 2FGYA 4RDAA 1F1MA 2OJQA 5JUAA 5DQZA 1ORSC 2NUPB 2OCCC 1QKRA 3S29A 1OCOC 2EPMX 2F22A 2YQYA 3IQCA 2QLAA 2YHSA 1S7ZA 2NSFA 1LIHA 1QSPA 4JCZA 5FZTA 1OCZC 4MVMA 2EIJC 4P9TA 4CBEA 4OD5A 1MQVA 3I5PA 1YA7O 3SP1A 4HE8D 4JZAA 3NMKA 1Q0MA 3W4YA 3AQBA 2CYDA 2H8AA 2HUJA 3M4CA 3QZCA 3X1OA 5L0IA 1EKYA 4P9FA 4YT5A 1M2VA 2M4EA 1KU2A 2LP4A 2L6GA 2GWWA 4YWQA 3TOLA 1LE2A
chains in the Genus database with same CATH topology
3U5SA 3GWNA 3LLIA 4E0IA 1OQCA 3TD7A 1JRAA 3U2LA 3LLKA 3U2MA 3O55A 3R7CA 3TK0A 1JR8A 4E0HA 3W4YA 3GWLA 4LDKA 3MBGA 2HJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5S A;  3GWN A;  3LLI A;  4E0I A;  1OQC A;  3TD7 A;  1JRA A;  3U2L A;  3LLK A;  3U2M A;  3O55 A;  3R7C A;  3TK0 A;  1JR8 A;  4E0H A;  3W4Y A;  3GWL A;  4LDK A;  3MBG A;  2HJ3 A; 
#chains in the Genus database with same CATH topology
 3DE8 A;  3AQC A;  4JEB A;  2Y69 C;  3NKD A;  3EHN A;  3T6J A;  4CSA C;  2R7T A;  4GYT A;  3A9C A;  3AGT A;  3I5Q A;  2XLO A;  4FAP B;  2B0H A;  4E17 A;  1T5O A;  4JVS A;  1JMW A;  1H9G A;  4R32 A;  2IOQ A;  4Z9J A;  1QLE C;  5EK0 A;  4EBJ A;  3H65 A;  5L0H A;  1ZHT A;  1YA9 A;  3T4R A;  1OXK A;  2WL8 A;  3HNJ A;  2LD6 A;  3NDB B;  4U9E A;  3KL4 A;  1SF8 A;  1RMV A;  3RQG A;  4M63 A;  1A0B A;  1YYJ A;  4I44 A;  1ZZP A;  3AGU A;  3OWT A;  3QVY A;  4N6C A;  3QTH A;  3U9J A;  3KH2 A;  1HW2 A;  2HJM A;  1KTM A;  1L3P A;  2WZL A;  3UGO A;  4D4X A;  2XM0 A;  2AVK A;  5A6J A;  2OG2 A;  1VYK A;  2XLM A;  2HFI A;  3FAP B;  3TUL A;  1C17 M;  4PJL A;  4CDY A;  4OIP F;  2KGO A;  4I1O B;  2R7V A;  2MHR A;  2YL3 A;  2GFH A;  1JRA A;  1NZE A;  2J9B A;  3TD7 A;  3S27 A;  4DVY P;  3DAG A;  4G78 A;  4ONS A;  5A6A A;  2LCH A;  1B68 A;  2Y3D A;  3UR3 C;  1H7I A;  1PD0 A;  5B3S C;  4ANJ A;  3M15 A;  1QZX A;  1JOG A;  2J46 A;  1NU9 C;  3BRJ A;  2Y3G A;  1DOW A;  1VTM P;  3K1H A;  3RQF A;  4C3B A;  4G7Z F;  3DM9 B;  4XWJ A;  2J0W A;  3ECS A;  3IPM O;  2W4B A;  3FOP A;  1T6U A;  5K0I A;  3HLZ A;  4PJM A;  2CNW D;  4LDR A;  5COM A;  3MYF A;  3EZH A;  3SZR A;  1FR0 A;  1HE9 A;  1G4W R;  3GAN A;  3JYY A;  5L3Q A;  1Y6D A;  3AOU A;  4MVZ A;  3DZA A;  3Q6M A;  1RXQ A;  1BZ4 A;  2R7U A;  1VLT A;  2AWC A;  4J7Y A;  1OKK D;  1OCC C;  3IQT A;  3R2P A;  1W2W A;  3RKO F;  5A6B D;  5DS6 A;  1BR4 A;  5CI9 A;  5BQI A;  1GS9 A;  4BEJ A;  1G4U S;  2Q9C A;  2ZXO A;  2CW0 F;  5EGY A;  2I15 A;  3LUT B;  3KPH A;  3E9V A;  5KYU A;  3K6B A;  1I5N A;  5KYY A;  5KYU B;  1D0Y A;  4MVU A;  3DKA A;  1YLM A;  5JRA A;  1A7E A;  1Q0D A;  1ZHX A;  1V55 C;  3GEI A;  2NUT A;  2YRF A;  3FAJ A;  1WGW A;  3ASO C;  3WOD F;  4JTC B;  3JZ0 A;  2C03 A;  2XLV A;  2AWY A;  3DE9 A;  2XSE A;  3B0V C;  2AP3 A;  2HMZ A;  2R7Q A;  3NYJ A;  4RD9 A;  2CGE A;  2GA0 A;  1CGN A;  3B71 A;  3N0T A;  4NY3 A;  4G7H F;  3LS0 A;  3LNM B;  3VAY A;  1H6G A;  2EIK C;  2B0J A;  1WWP A;  2IXO A;  2YWA A;  4J32 B;  2LFD A;  5COF A;  1BR2 A;  1VK5 A;  2MWQ A;  4YL0 A;  2JPU A;  1H9T A;  3T9O A;  2KK1 A;  1UFB A;  2HZ8 A;  2KYH A;  2Y3H A;  3L1M A;  3IHU A;  4UDV A;  1A41 A;  1V54 C;  3AJM A;  3TJ6 A;  4MND A;  5CIV A;  2ETS A;  3CZ6 A;  4NTF A;  4EKW A;  1MND A;  2LFF A;  2OKU A;  5T3T A;  4LDK A;  4AL0 A;  1M56 C;  1ZHY A;  2YKZ A;  1G5Z A;  1FMV A;  3AG1 C;  4W8K A;  1OKK A;  4LER A;  4XQ1 A;  1C03 A;  3ZSU A;  4CX9 A;  3IQ6 A;  4Q4Z F;  4KBL A;  1SYQ A;  3PMR A;  3S9O A;  3EPV A;  1JPJ A;  2LIG A;  4YT2 A;  2KW3 C;  2QTV A;  3DAF A;  4J7T A;  2WZG A;  1RJ9 B;  1OQC A;  3H2V A;  3LEV A;  4PFP A;  4U5F E;  5JP7 A;  3S28 A;  3U2M A;  2W9Y A;  2J9V A;  2UUI A;  5L0F A;  3G4Z A;  3OEO A;  1M2O A;  3DD7 A;  3NG1 A;  2EPK X;  1SMY F;  3B0U X;  3HNK A;  2XLW A;  2LK4 A;  4WGY A;  4BJ6 A;  2R7W A;  4IB4 A;  3WG7 C;  2A0U A;  4IRU A;  4MTF A;  5AC5 A;  3LES A;  1NG1 A;  4DRI B;  2BC5 A;  1QQ3 A;  5BQG A;  1ZU4 A;  2G62 A;  1OW6 A;  4U5B E;  4GEH A;  4JIO A;  4G0H A;  3HJC A;  4U9D A;  3V5Y A;  1U89 A;  1MMG A;  1Z3I X;  4CIP A;  1GQA A;  3C8Z A;  5GPG B;  4N6H A;  5F5F A;  3CSK A;  1D0Z A;  1LI5 A;  1VYI A;  1ZU5 A;  2QUP A;  2R02 A;  2V26 A;  3AG2 C;  3L8I A;  1I4Y A;  3RVY A;  4CJG A;  4K7B A;  2VH3 A;  3FVY A;  4OIQ F;  1D1A A;  1CPQ A;  1NFO A;  4WAB A;  4QI2 A;  1V4A A;  2HKV A;  4JEA A;  4K0D A;  3EQL F;  3LAY A;  3X2Q C;  3ZTM A;  3Q7G A;  3ZTZ A;  2QE9 A;  4QI0 A;  1G8X A;  4A4A A;  2EIN C;  2R9R B;  1D1B A;  2DB4 A;  4O7G A;  2OOC A;  2WVQ A;  1K04 A;  1ZVZ A;  3DMD A;  3H2U A;  4DVZ A;  4ZLC A;  4PR9 A;  2PX3 A;  1VOM A;  3T6B A;  3TQO A;  2VCB A;  2ZXR A;  5B1A C;  4YT4 A;  3WHN A;  1ZYR F;  2XXA A;  1HMO A;  2IXM A;  2PFD A;  2ZXW C;  4OD4 A;  1Y4C A;  2HV6 A;  4JE9 A;  4EUK B;  1A7V A;  3K1I C;  4XLP F;  1RKE A;  4DBR A;  2PX0 A;  1QPU A;  2AU5 A;  1LKX A;  1RKE B;  3SXY A;  4Q5S F;  2XL4 A;  4JC7 A;  4CS9 C;  5TJ5 E;  3ZG1 A;  5COG A;  3POV A;  3U8V A;  1LE4 A;  2NPU A;  3U3F A;  3EHM A;  4A2N B;  3C8G B;  1XWJ A;  3FMS A;  3QW0 A;  3GEE A;  4MVR A;  4OIO F;  1JAF A;  1O5H A;  3NYL A;  3RQE A;  2HMQ A;  4FWV A;  1MMD A;  2FAP B;  4YL3 A;  1A7D A;  2A68 F;  2XLE A;  2PBE A;  2YVK A;  1TFK B;  1R5I D;  5BQH A;  3V5Z A;  3E70 C;  1BR1 A;  2VCA A;  1LM3 B;  1ORY A;  2KSF A;  3UMK A;  2IXP A;  2WVO A;  2YL0 A;  4C3D A;  4EBB A;  4DOZ A;  5CI8 A;  1NBB A;  5L0C A;  3SNH A;  3U0C A;  2YL1 A;  3K66 A;  5F5H A;  1IW7 F;  2OJE D;  3K33 A;  4PJN A;  4XLN F;  3S90 A;  4CSA A;  3GEH A;  4OIR F;  3PDM P;  2P61 A;  5AGF A;  1MMA A;  1Z7Q c;  4IJJ A;  4U5G A;  4KNW A;  2P1A A;  4B6I A;  4LAC B;  3RF3 A;  1T6Q A;  4CS8 C;  4LLC A;  2W45 A;  3GM2 A;  5L0D A;  4EBK A;  1WTY A;  1T9K A;  2J45 A;  4AL1 A;  1AUE A;  2HV7 A;  3O39 A;  1CPR A;  1DOV A;  1ZW2 A;  2H7O A;  3O6X A;  3ZIB A;  4BJT A;  5B3I A;  1CGM E;  5A6K A;  5A69 A;  4BJ5 C;  2OU6 A;  3HKK A;  5L0J A;  4U5C E;  4MVS A;  3NMI A;  2O9X A;  4NC3 A;  3RVZ A;  2R7X A;  1ZHW A;  5KYW B;  1M6T A;  4MQ9 F;  3ATP A;  3DM5 A;  2KNH A;  1LVK A;  2HSQ A;  3GM3 A;  5DS4 A;  2P7V A;  4KI2 A;  2OEV A;  5E3C A;  2BL2 A;  4Q7C A;  1K40 A;  1Z6A A;  3EGD A;  1IZM A;  2EIM C;  3HNL A;  4JTA B;  1E2X A;  3LS1 A;  5KYX B;  1NFN A;  4JUR I;  2EPL X;  1ST6 A;  2J8W A;  1BDJ B;  2HSB A;  2JX0 A;  3C62 A;  3EGD B;  4IAO A;  1VLS A;  1JPN A;  1Z63 A;  4LLE A;  2WB7 A;  4JJG A;  1UG7 A;  3ZVR A;  4E18 A;  5KYY B;  2LSE A;  4KNV A;  2J7P A;  4K1O A;  2RD9 A;  1QVX A;  1MMN A;  5DQT A;  2J9U A;  1Z23 A;  1T01 A;  2KC3 A;  5E33 A;  4YK5 A;  3KKB A;  1WAT A;  3LJB A;  3N2Z B;  2ZPA A;  3JSE O;  3R7C A;  1GGQ A;  2XL8 A;  5E2Q A;  1TWA A;  4ZLD A;  5DVW A;  5AC4 A;  4U5H A;  1WOL A;  4IGG A;  2XLD A;  3EJN A;  1HMD A;  1D0X A;  4H4K C;  3ZDL A;  4DRH B;  1N1C A;  2J0X A;  3US6 A;  4DXW A;  3EZI A;  4E7Z A;  1FMW A;  3EGX A;  2Q9A A;  3J06 A;  2DGJ A;  3EGX B;  3U5S A;  2A1D D;  2L6H A;  4U5E E;  2V3C C;  2BE5 F;  1R4T A;  4IAR A;  1SZI A;  1LI7 A;  4MVO A;  2PF4 E;  1RJ9 A;  4MTG A;  4AE4 B;  1YYX A;  3M1C B;  1PV3 A;  2IM8 A;  3DI5 A;  3NMJ A;  3V5X A;  5DLJ A;  4C7O B;  2A6H F;  2XXA B;  1WAS A;  3G50 A;  4O79 A;  4Z9H A;  3NRH A;  4H54 A;  4XPW A;  3U3B A;  2DI3 A;  1TR2 A;  2WZF A;  1Q0G A;  3NKE A;  2R25 A;  1FNT c;  3C8G D;  2VB6 A;  3ABL C;  3AG4 C;  2Q3T A;  3SXM A;  4XEF A;  4CDV A;  2UUH A;  2PP4 A;  4YT8 A;  3N24 A;  5DS5 A;  4DRJ B;  1E84 A;  3DJU B;  5B1B C;  2HS5 A;  4NTA A;  3F46 A;  1HY5 A;  1LPE A;  2Q00 A;  3JTL O;  4LDQ A;  2CCY A;  3VYW A;  4CJO A;  3C18 A;  4O6Y A;  5F28 E;  1I4Z A;  2HJ3 A;  4BJ1 A;  2G3V A;  4F4B A;  2R03 A;  4CIH A;  1TWH A;  2CDQ A;  2OQM A;  4MTO A;  1J8Y F;  1TWG A;  5KYN A;  2LQG A;  4CS7 A;  3HTK C;  2J9W A;  1YDI A;  1GM5 A;  4L6R A;  4WGZ A;  2Q4F A;  4P6I C;  4DBQ A;  3W2W A;  2JD3 A;  2ZD9 A;  3EG9 B;  3LLK A;  3JT1 A;  1AVO B;  3M79 A;  2Q7R A;  2D5R B;  4JTD B;  1Q0F A;  2I8B A;  3G4X A;  5D92 A;  4YJW A;  4RBN A;  3DXJ F;  2FFH A;  2L7A A;  1D1C A;  3PCV A;  3C63 A;  4X0R A;  4BEM J;  4XPX A;  3ITF A;  1XZQ A;  5JSL A;  3TK0 A;  4YL1 A;  3B29 A;  3L34 A;  2XL6 A;  4MW8 A;  1L7C A;  3SXK A;  3DWW A;  1Z5Z A;  1OW8 A;  2EIL C;  3QVZ A;  3EH1 A;  4FES A;  2IBF A;  3L0I A;  3SXZ A;  1KNY A;  2QNL A;  4JKV A;  1OCR C;  1RKC A;  1FAP B;  3ABM C;  3FDQ A;  3W2V A;  2P0N A;  3U9M A;  1M2V B;  1K05 A;  4E7S A;  2Y39 A;  3F47 A;  3RYL A;  4WJ0 A;  3A11 A;  4O6M A;  3OA1 A;  5D91 A;  3JCU Q;  3LLI A;  5JS5 A;  4D4N A;  4HFK B;  3RH3 A;  1YJG A;  3BEH A;  3C8G A;  4DJ9 A;  4MW3 A;  3SEO A;  4ER9 A;  1Q0K A;  2YLD A;  3FOO A;  3U8P A;  1EI7 A;  3JRM O;  1TQG A;  3IQ5 A;  3FXH A;  3EH2 A;  2EPO A;  2IYL D;  2X51 A;  5JLI A;  2J7P D;  2YL7 A;  1LS1 A;  1NLX A;  2C04 A;  2KQ9 A;  3LEO A;  4JRZ A;  3GM1 A;  1JR8 A;  4E0H A;  2A6E F;  3QW1 A;  3Q6N A;  3WAQ A;  4J30 B;  1YZA A;  4MS2 A;  2YLI A;  3VRC A;  4C3E A;  3KYJ A;  3ZQV A;  3C7J A;  2RSE B;  1HE1 A;  4I3M A;  4NQF A;  3RFY A;  3L8J A;  4BG0 A;  4Z9I A;  3GWL A;  1LS4 A;  4JJF A;  4XTK A;  3W8H A;  2A0B A;  2XS1 A;  4O6N A;  1FTS A;  2D4U A;  3GWN A;  2R7R A;  3AG3 C;  5HV9 A;  3IEE A;  1PCX A;  4I1M A;  4JCH A;  4N4W A;  2GDC A;  5E3A A;  3KYI A;  4FX5 A;  3ZWI A;  4GQH A;  4BPM A;  3LNR A;  4XEK A;  2H7B A;  4JW1 A;  3U2L A;  2L81 A;  3S84 A;  5BUO A;  3B0P A;  3W8I A;  3S0X A;  1E86 A;  2EPN A;  2ICW G;  2E87 A;  3O55 A;  2Y3B A;  4HFF B;  1OW7 A;  4U5D E;  2DYS C;  2TMV P;  1HW1 A;  1U0B B;  4N06 A;  5KYW A;  4OIN F;  1V74 B;  5JT4 A;  4MVQ A;  2M64 A;  2GAQ A;  3K1I A;  4YN0 B;  5JVE A;  2XLH A;  3MX3 A;  4AK9 A;  2R05 A;  3SYN A;  3B9Q A;  4PFO A;  5KYX A;  1YAU O;  3UMI A;  1AEP A;  4CS9 A;  2R7O A;  4PJJ A;  3VM6 A;  1CGO A;  2XM4 A;  1RCP A;  1OR2 A;  3JSZ A;  1WN0 A;  3O10 A;  3FHD A;  2ASR A;  256B A;  3I4U A;  1MNE A;  1TKN A;  2L6F A;  3CEX A;  3MFN A;  5T3W A;  3RW0 A;  1APC A;  2P6V A;  1FFT C;  3RIP A;  1TWC A;  4ULW A;  2YLG A;  2Q9B A;  4IAQ A;  3T6G B;  1XZP A;  1ORJ A;  2L9J A;  2KJG A;  1M57 C;  2A69 F;  2VC9 A;  3JRT A;  3MYI A;  4ULV A;  4XEV A;  4PAC A;  3V7O A;  3ABK C;  3NYM A;  2VAS A;  2W4M A;  4HEA J;  1E85 A;  3K7D A;  5EHH A;  2XS8 A;  4EWC A;  1NU7 D;  4NCQ A;  3ZC4 A;  3GOD A;  3UMH A;  4BJ6 C;  1T6I A;  4CS8 A;  2VCC A;  2YZS A;  2NUT B;  3JYH A;  1NSG B;  2DYR C;  3MBG A;  5T1D B;  3TOM A;  2X0C A;  3ASN C;  1PD1 A;  2IXN A;  4EIY A;  2R7S A;  4AE4 A;  1EQ1 A;  3UNG C;  4C7O A;  4BJ5 A;  3UGP A;  2QY9 A;  2OEX A;  3GOR A;  1BBH A;  2NSG A;  1S05 A;  4PK4 A;  2ZXP A;  5HSW A;  3VF0 A;  4IWB A;  1VB5 A;  1O3U A;  1VMA A;  2H7V C;  3DJN B;  2Z15 A;  1OXB A;  2PNO A;  4EHP A;  1U6H A;  2G3K A;  2WVN A;  4NTB A;  3TJ5 A;  4AX2 A;  1YVI A;  2CNW A;  1C02 A;  5IY5 C;  4QDL A;  5FCL A;  3CQZ A;  4CDA A;  1SR2 A;  5L3V A;  3PHF 2;  3KMI A;  4KC9 A;  3ZQY A;  1J8M F;  1OR3 A;  1ZW3 A;  1TFO B;  1YZC A;  4G7O F;  1ZHZ A;  1FFH A;  1YAR O;  1O87 A;  3HNI A;  5A6B A;  3EFO A;  3CAX A;  2YEV A;  3QMK A;  4W8P A;  4XPY A;  4E0I A;  5L0G A;  3Q7L A;  3M4B A;  2NG1 A;  2NUP A;  1EA8 A;  3EG9 A;  3EFO B;  1E83 A;  2MYS A;  2XRH A;  3MLG A;  2FGY A;  4RDA A;  1F1M A;  2OJQ A;  5JUA A;  5DQZ A;  1ORS C;  2NUP B;  2OCC C;  1QKR A;  3S29 A;  1OCO C;  2EPM X;  2F22 A;  2YQY A;  3IQC A;  2QLA A;  2YHS A;  1S7Z A;  2NSF A;  1LIH A;  1QSP A;  4JCZ A;  5FZT A;  1OCZ C;  4MVM A;  2EIJ C;  4P9T A;  4CBE A;  4OD5 A;  1MQV A;  3I5P A;  1YA7 O;  3SP1 A;  4HE8 D;  4JZA A;  3NMK A;  1Q0M A;  3W4Y A;  3AQB A;  2CYD A;  2H8A A;  2HUJ A;  3M4C A;  3QZC A;  3X1O A;  5L0I A;  1EKY A;  4P9F A;  4YT5 A;  1M2V A;  2M4E A;  1KU2 A;  2LP4 A;  2L6G A;  2GWW A;  4YWQ A;  3TOL A;  1LE2 A; 
#chains in the Genus database with same CATH homology
 3U5S A;  3GWN A;  3LLI A;  4E0I A;  1OQC A;  3TD7 A;  1JRA A;  3U2L A;  3LLK A;  3U2M A;  3O55 A;  3R7C A;  3TK0 A;  1JR8 A;  4E0H A;  3W4Y A;  3GWL A;  4LDK A;  3MBG A;  2HJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...