2QLAA

Crystal structure of a 16-helix bundle architecture produced by the zinc-mediated self assembly of four cytochrome cb562 molecules
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Controlling protein-protein interactions through metal coordination: assembly of a 16-helix bundle protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2qlaA00
3TOMA 1E86A 5AGFA 3HNKA 2XL8A 3M79A 5JRAA 256BA 4CIPA 1QQ3A 1CGNA 2XM0A 2YL3A 4IAQA 1E83A 2XLMA 3ZTMA 4ER9A 4WGYA 4ULVA 3QW1A 3NMIA 1NBBA 3QVZA 1YYJA 3HNLA 3NMJA 2XM4A 2QLAA 4L6RA 3FOOA 5JUAA 1EKYA 4NC3A 1CGOA 4N4WA 2XL6A 1CPRA 3HNIA 4U9EA 3ZWIA 5JS5A 3M4CA 4IB4A 4CDAA 2YLIA 3QVYA 2CCYA 3DE9A 2YL7A 3ZTZA 4CX9A 4JEBA 3DE8A 4D4NA 4N6HA 2BC5A 5JP7A 3NMKA 2XLWA 2YLGA 1YYXA 2XLVA 1S05A 3HNJA 4EIYA 5JSLA 2YKZA 3U8PA 3TOLA 2XLOA 1E85A 2J8WA 1QPUA 2XLDA 3ZQYA 4CDYA 1A7VA 1MQVA 5JVEA 1RCPA 4WGZA 2XLHA 3ZQVA 4U9DA 1YZAA 3M15A 3IQ5A 4JKVA 4IARA 3QW0A 1M6TA 1E84A 2YL0A 4D4XA 1GQAA 1BBHA 2XLEA 1YZCA 3C62A 5B3IA 3FOPA 4CDVA 1JAFA 5JLIA 4JEAA 3IQ6A 1CPQA 5JT4A 1LM3B 2J9BA 4CJGA 3C63A 1APCA 4JE9A 2YLDA 4CJOA 2YL1A 3VRCA 3M4BA 3L1MA
chains in the Genus database with same CATH superfamily
4G7OF 5AGFA 3LEOA 4NY3A 2XL8A 1B68A 1C17M 3FVYA 4XLNF 1HE1A 1XZPA 3M79A 5E3CA 3N2ZB 2ETSA 5L0IA 1U6HA 2A6EF 1LE2A 3CZ6A 5B3SC 4CIPA 3OA1A 3LLIA 1OCOC 5CI9A 4BG0A 1KTMA 5E33A 1T6IA 4PJJA 2YL3A 4XEVA 5DLJA 4OINF 4Z9JA 4IAQA 1E83A 5A6JA 3C8GD 3ZIBA 3B29A 3FXHA 4I1MA 2XLMA 3GWLA 4ZLDA 1TFOB 5KYWA 2CYDA 2KQ9A 1EQ1A 3ABMC 3U8VA 4U5CE 4XEFA 3ITFA 2W45A 2J0XA 2EPMX 3QW1A 4P9FA 4YL0A 3B71A 3SXKA 3ZDLA 1M57C 1NBBA 1ZHXA 1L7CA 2EIJC 3B9QA 3DJUB 3ABLC 2EILC 4CS8C 2QLAA 2W9YA 2IXNA 3SP1A 1PD0A 1LS1A 4L6RA 3ECSA 3W4YA 2GA0A 4CS9A 3T6BA 4DJ9A 2VB6A 2IYLD 4N4WA 1CPRA 4PJNA 4N6CA 4ULWA 3ZWIA 2YWAA 3LS0A 4JURI 4K7BA 4PK4A 1I5NA 2J9WA 2HKVA 2ZPAA 2EPKX 3LEVA 4G78A 4U5HA 4JC7A 4AK9A 3RYLA 4HE8D 4QI2A 3F46A 3V5XA 2ZXPA 3DJNB 1R4TA 3CEXA 3ZTZA 2L6FA 1YA7O 2Z15A 5AC4A 5L3QA 2AWYA 1YA9A 1OW8A 2Y39A 3S84A 2GWWA 1SZIA 2E87A 1ORYA 2DI3A 3DE8A 3EGXB 2VASA 4U5FE 5FZTA 4D4NA 3TQOA 4HEAJ 1LIHA 2DYSC 5L3VA 2O9XA 2Y3DA 3AGTA 1HE9A 1VLTA 1HY5A 1OXKA 2EIMC 3DM9B 4QDLA 5JP7A 4O79A 3Q6MA 4AX2A 5BQIA 1H9TA 1U0BB 2MHRA 1Q0KA 4QI0A 1LE4A 1FR0A 4YT4A 1S05A 4RD9A 2P7VA 3HNJA 3SXYA 3W8IA 4DVYP 1J8MF 5JSLA 2GDCA 3NDBB 2VCAA 3EGXA 3ZC4A 1A7EA 1OR2A 3GANA 1L3PA 3LNMB 2R7TA 2XLDA 3S0XA 1T01A 3CSKA 3GM1A 2XSEA 3O55A 1V55C 2Q4FA 1GS9A 1RCPA 3EHMA 3S27A 2C03A 2J0WA 3TJ5A 4YWQA 3RH3A 2WB7A 2G62A 3K1IA 2WL8A 2L7AA 4MVUA 4CBEA 4EHPA 1VMAA 1ZW3A 3W2VA 3O10A 3S28A 4EBKA 4DBRA 2OU6A 2HSBA 1W2WA 1C02A 1LVKA 1SF8A 3L8IA 1G5ZA 4YL3A 1TQGA 3KMIA 5BUOA 3AQCA 2XXAB 4GYTA 3C18A 3LAYA 2PF4E 3TK0A 3NKDA 2GFHA 4WABA 2PX0A 2W4MA 2RSEB 3AG1C 3S9OA 4CDVA 1I4YA 4OIPF 2IXOA 4BJTA 1OCZC 1ZW2A 5JLIA 3JYYA 2IOQA 2KNHA 4IAOA 1D0YA 5F5FA 3DXJF 1ZHZA 3K1HA 2HV7A 2P1AA 1MMDA 4O6MA 4YN0B 4BJ6C 3B0UX 4UDVA 4XTKA 2HMQA 3L8JA 1ZU4A 1O3UA 1ZZPA 4AE4B 1OKKD 1WTYA 4MQ9F 1NU7D 4JE9A 4F4BA 2QUPA 3GM2A 4YJWA 2YZSA 1OCCC 1MNDA 1GM5A 1OW6A 4WJ0A 4PFOA 2LQGA 3SEOA 1TKNA 1AVOB 1UFBA 4CJOA 1WOLA 2IBFA 4PACA 4PJLA 3TULA 3VRCA 4PR9A 1VLSA 4CX9A 3U3BA 1ZYRF 2OG2A 5L0HA 3LESA 5JRAA 4JIOA 1HMOA 4AE4A 1Y6DA 3ATPA 3BRJA 4BPMA 1F1MA 4E7ZA 2AWCA 4XWJA 3G50A 2J45A 3WHNA 1VB5A 2LD6A 3DZAA 3KKBA 2R25A 3TJ6A 1ZU5A 2D5RB 2P61A 3TD7A 2P0NA 1XWJA 3FMSA 3RQFA 3SZRA 3ZTMA 4WGYA 4ER9A 4A4AA 3E9VA 1BR1A 3FAJA 3R7CA 1HW1A 2LIGA 3AQBA 4ULVA 3KH2A 4E0HA 3NMIA 4PFPA 4HFFB 1XZQA 1JPNA 1YYJA 2KYHA 3HNLA 2XL4A 3VF0A 4C3EA 5DS4A 1OXBA 3M1CB 4E18A 4MNDA 2R7UA 1K05A 4X0RA 3MYIA 2YVKA 3FOOA 4LACB 5DVWA 3R2PA 3UGOA 4EWCA 3U2LA 1JPJA 3JTLO 4U9EA 2EINC 1MMAA 4BEMJ 5JS5A 3GODA 2G3VA 5TJ5E 4CDAA 2YLIA 5T1DB 1ZHYA 3LUTB 5A6BD 5KYYA 3DE9A 4JTCB 4MTOA 1R5ID 3EQLF 2R7QA 4O7GA 3N24A 4YT2A 3LJBA 3RQEA 2HMZA 3NG1A 2H7BA 4Q7CA 1I4ZA 3JZ0A 3MX3A 4E7SA 3NKEA 4Q5SF 1WN0A 3WODF 5EHHA 4R32A 1VOMA 3JRTA 2LFFA 1V4AA 2YEVA 1C03A 4OIRF 2IXMA 2UUIA 4CSAC 4I1OB 3NMKA 3RKOF 1IZMA 1RXQA 2HV6A 5T3WA 4RBNA 2YLGA 3EHNA 1YYXA 2CW0F 2LSEA 3H2VA 1OCRC 2R02A 3SXZA 2NG1A 4EUKB 3US6A 2YKZA 1LS4A 4EBJA 1EI7A 5COMA 1LPEA 1N1CA 3TOLA 3HJCA 3U8PA 2NSFA 1V54C 3C7JA 5DS6A 2J8WA 1JOGA 1OQCA 4JVSA 3UGPA 4OIOF 1BR2A 1YVIA 2DYRC 2NUPB 1D1AA 1MQVA 2PP4A 4DOZA 5JVEA 1ST6A 3POVA 2DGJA 3A11A 2XS8A 2XLHA 3U2MA 1MMGA 1D0ZA 3O39A 4FX5A 1T5OA 4GQHA 3W8HA 3JYHA 1OKKA 2M64A 3M15A 3VM6A 5COFA 4LDKA 3IQ5A 2JD3A 3RQGA 4XLPF 4H54A 3U0CA 3DAGA 2D4UA 4J32B 1Z7Qc 4D4XA 2V3CC 1QSPA 3I5QA 3DKAA 4P6IC 3UMHA 2NUPA 5B3IA 3L0IA 1WGWA 4OIQF 2EPOA 4C7OB 1M2VA 1DOWA 3AJMA 1JAFA 3B0PA 4H4KC 5EK0A 2H7OA 2PX3A 2NPUA 1T6UA 1SYQA 3IQ6A 2ZXRA 1LI5A 4MVSA 3RFYA 2YQYA 1K04A 4BJ5C 1LM3B 1D1CA 4CJGA 2PNOA 3C63A 3NYLA 2L6GA 5E3AA 2QTVA 2C04A 5L0DA 4C7OA 2W4BA 3AG2C 3DM5A 3K6BA 2Q9AA 2CNWD 4OD5A 3AGUA 4CS8A 3AG4C 3FAPB 3LLKA 1TR2A 3C8GB 3EFOB 3O6XA 5D92A 3TOMA 2M4EA 2VCCA 3HNKA 4M63A 4MVOA 2KSFA 1EA8A 1Z3IX 1IW7F 2Y3HA 4N06A 5BQHA 4U5EE 1FTSA 256BA 3GEEA 3ABKC 5CIVA 2TMVP 2YRFA 4JJFA 2CDQA 3VAYA 1VTMP 4FAPB 2R7OA 1QQ3A 4IWBA 4KBLA 2Y3BA 5GPGB 1CGNA 2XM0A 4FWVA 5A6BA 1ZVZA 3MYFA 1YLMA 3G4XA 3OEOA 4JTAB 3MLGA 2FAPB 3PHF2 4MW3A 3EFOA 3C8GA 5A6AA 5F5HA 1ZHTA 2OJED 5KYUB 2HUJA 3DWWA 4K0DA 1T9KA 2KJGA 3OWTA 3HKKA 3ASOC 3NYJA 3ZG1A 3MBGA 3NMJA 4J7YA 1NSGB 3C8ZA 2XM4A 4YT8A 2VC9A 1SMYF 2J46A 2OQMA 4BEJA 5DQZA 3RW0A 1D0XA 1BR4A 2I8BA 1EKYA 3K66A 1LI7A 3E70C 4NC3A 5A69A 3EJNA 3T4RA 2QNLA 2A6HF 5KYUA 3U5SA 2HSQA 2NSGA 4P9TA 4MVQA 4YT5A 1DOVA 1ORSC 3AG3C 3QVYA 3W2WA 2VH3A 1NLXA 4C3BA 1Q0DA 2EPNA 1NZEA 1GGQA 4IJJA 2ICWG 2A1DD 2B0JA 4G7HF 3V5YA 2GAQA 4RDAA 4KI2A 3IPMO 2WVNA 2WZGA 5A6KA 2JPUA 4NCQA 3JSZA 4MS2A 4BJ1A 2OOCA 5KYYB 2WVQA 4GEHA 3JSEO 4J30B 3GORA 4FESA 1JMWA 2BC5A 4DRJB 4Q4ZF 2H8AA 1NU9C 4CS9C 2QY9A 3KYIA 2XLWA 3X1OA 3IQCA 2R05A 2WZLA 3EPVA 1PD1A 2LP4A 2OEVA 2XLVA 4XPWA 2L9JA 4A2NB 3PDMP 3V7OA 3EGDB 4EIYA 4CIHA 2Q7RA 3Q7LA 2A0BA 1U89A 2R7XA 3IQTA 2XLOA 1E85A 5BQGA 1G4WR 3UR3C 3SNHA 3ZQYA 2BL2A 1E86A 4BJ6A 3ZQVA 2LK4A 3NRHA 2ZXOA 1TWHA 4U5DE 4JRZA 1YZAA 1VYIA 2Y3GA 4PJMA 3S29A 2UUHA 5D91A 4DBQA 4E17A 1BDJB 2CGEA 2XS1A 1H7IA 4K1OA 3EGDA 4Z9IA 1M6TA 4JCZA 4DXWA 1E84A 2EPLX 2CNWA 3RVZA 1FFHA 2R7VA 3C62A 2DB4A 3H2UA 5DQTA 1ORJA 3DAFA 2P6VA 4E0IA 5L0CA 1H9GA 3I5PA 4XPXA 3ASNC 4JEAA 4IRUA 2BE5F 3LNRA 1V74B 2YHSA 3H65A 4IGGA 4JW1A 3K33A 2PFDA 2V26A 4O6NA 5KYXB 1MNEA 1NFOA 3HTKC 2RD9A 4I3MA 2ZD9A 3B0VC 1TWCA 4XEKA 1M2VB 3K1IC 2F22A 4JTDB 3DMDA 3U9MA 1E2XA 3T6JA 2OJQA 3KYJA 2X51A 3I4UA 3JT1A 1A0BA 1NG1A 4DVZA 2HZ8A 2FFHA 3CQZA 4EBBA 3RVYA 2B0HA 1UG7A 3IHUA 2OEXA 1TFKB 3JRMO 4JCHA 3GM3A 3L1MA 4MW8A 5KYXA 2VCBA 3FHDA 1KU2A 1QLEC 4O6YA 1Y4CA 2ZXWC 3PMRA 2LFDA 4G7ZF 4KC9A 5EGYA 1Z23A 3AOUA 2IM8A 2AP3A 3ZVRA 2ASRA 5L0FA 2KK1A 2Q3TA 1Q0GA 1YAUO 5L0JA 3X2QC 4HFKB 4U5GA 1T6QA 1TWGA 3LS1A 2HS5A 4LERA 1TWAA 3PCVA 4MTGA 3ZSUA 1PV3A 5B1BC 5L0GA 1QKRA 1HW2A 1WASA 4AL1A 4NTAA 3CAXA 1LKXA 4LLCA 4ZLCA 3QVZA 3GEIA 2HJMA 4YK5A 1FNTc 2J7PD 3S90A 1NFNA 3M4BA 3U3FA 1FAPB 4MVRA 2WZFA 4ONSA 1D1BA 2A69F 1ZHWA 2R03A 1M2OA 1KNYA 4CSAA 5JUAA 2AU5A 1CGOA 2XL6A 3HNIA 3RIPA 4LDRA 4OD4A 4B6IA 5KYNA 3M4CA 4IB4A 1Q0MA 1Q0FA 2X0CA 1WWPA 1RJ9B 3DD7A 1CGME 2Q00A 3G4ZA 5HSWA 1OW7A 1YDIA 2G3KA 1Z6AA 2OCCC 2YL7A 1BZ4A 1JRAA 1JR8A 3QZCA 3MFNA 5CI8A 3WAQA 3EG9B 4U5BE 2KW3C 2A0UA 4JEBA 1O87A 4CS7A 5FCLA 2PBEA 4MVZA 4I44A 4DRIB 1RKEB 2J9VA 3EH2A 4LLEA 3VYWA 4XPYA 4NTBA 1A7DA 3JCUQ 2KGOA 4NQFA 1FFTC 2LCHA 4N6HA 3FDQA 1S7ZA 1WATA 5DS5A 2R7RA 1G4US 4C3DA 3HLZA 3QTHA 1RJ9A 1H6GA 4KNWA 3Q6NA 3KPHA 3WG7C 1MMNA 2Y69C 3GEHA 1PCXA 2H7VC 2NUTB 3EG9A 1Z5ZA 4XQ1A 1VK5A 1Z63A 1K40A 1YARO 2JX0A 4LDQA 2QE9A 1RKEA 3Q7GA 4NTFA 1O5HA 3F47A 1QPUA 3NYMA 2IXPA 4W8KA 2XXAA 4CDYA 1A7VA 3EZIA 4WGZA 4BJ5A 4U9DA 2A68F 3EH1A 1VYKA 4G0HA 1YJGA 1A41A 2Q9CA 2R7WA 2AVKA 2HJ3A 4JKVA 4YL1A 1M56C 2KC3A 4IARA 2NUTA 1HMDA 2I15A 3QW0A 1QVXA 4W8PA 3DI5A 2YL0A 2MYSA 3EZHA 3U9JA 1GQAA 1AEPA 3L34A 2Q9BA 1BBHA 2L81A 1YZCA 2XLEA 5T3TA 3SXMA 1QZXA 3FOPA 3N0TA 4MTFA 3T6GB 3T9OA 3IEEA 4J7TA 4KNVA 1SR2A 3A9CA 2J9UA 2HFIA 3QMKA 2R9RB 1AUEA 3BEHA 4JZAA 1FMWA 3UNGC 4EKWA 1OR3A 1RKCA 5AC5A 5HV9A 3K7DA 4JJGA 2XRHA 1J8YF 4DRHB 1FMVA 5IY5C 1CPQA 5JT4A 2OKUA 2EIKC 2J9BA 3J06A 3KL4A 4ANJA 1APCA 3V5ZA 3SYNA 4AL0A 4Z9HA 3RF3A 2L6HA 5E2QA 5K0IA 3UMKA 3UMIA 2YLDA 5COGA 2WVOA 2FGYA 5F28E 1RMVA 2MWQA 3GWNA 1G8XA 2R7SA 2J7PA 2YL1A 4MVMA 5KYWB 2CCYA 5B1AC
chains in the Genus database with same CATH topology
3TOMA 1E86A 5AGFA 3HNKA 2XL8A 3M79A 5JRAA 256BA 4CIPA 1QQ3A 1CGNA 2XM0A 2YL3A 4IAQA 1E83A 2XLMA 3ZTMA 4ER9A 4WGYA 4ULVA 3QW1A 3NMIA 1NBBA 3QVZA 1YYJA 3HNLA 3NMJA 2XM4A 2QLAA 4L6RA 3FOOA 5JUAA 1EKYA 4NC3A 1CGOA 4N4WA 2XL6A 1CPRA 3HNIA 4U9EA 3ZWIA 5JS5A 3M4CA 4IB4A 4CDAA 2YLIA 3QVYA 2CCYA 3DE9A 2YL7A 3ZTZA 4CX9A 4JEBA 3DE8A 4D4NA 4N6HA 2BC5A 5JP7A 3NMKA 2XLWA 2YLGA 1YYXA 2XLVA 1S05A 3HNJA 4EIYA 5JSLA 2YKZA 3U8PA 3TOLA 2XLOA 1E85A 2J8WA 1QPUA 2XLDA 3ZQYA 4CDYA 1A7VA 1MQVA 5JVEA 1RCPA 4WGZA 2XLHA 3ZQVA 4U9DA 1YZAA 3M15A 3IQ5A 4JKVA 4IARA 3QW0A 1M6TA 1E84A 2YL0A 4D4XA 1GQAA 1BBHA 2XLEA 1YZCA 3C62A 5B3IA 3FOPA 4CDVA 1JAFA 5JLIA 4JEAA 3IQ6A 1CPQA 5JT4A 1LM3B 2J9BA 4CJGA 3C63A 1APCA 4JE9A 2YLDA 4CJOA 2YL1A 3VRCA 3M4BA 3L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOM A;  1E86 A;  5AGF A;  3HNK A;  2XL8 A;  3M79 A;  5JRA A;  256B A;  4CIP A;  1QQ3 A;  1CGN A;  2XM0 A;  2YL3 A;  4IAQ A;  1E83 A;  2XLM A;  3ZTM A;  4ER9 A;  4WGY A;  4ULV A;  3QW1 A;  3NMI A;  1NBB A;  3QVZ A;  1YYJ A;  3HNL A;  3NMJ A;  2XM4 A;  2QLA A;  4L6R A;  3FOO A;  5JUA A;  1EKY A;  4NC3 A;  1CGO A;  4N4W A;  2XL6 A;  1CPR A;  3HNI A;  4U9E A;  3ZWI A;  5JS5 A;  3M4C A;  4IB4 A;  4CDA A;  2YLI A;  3QVY A;  2CCY A;  3DE9 A;  2YL7 A;  3ZTZ A;  4CX9 A;  4JEB A;  3DE8 A;  4D4N A;  4N6H A;  2BC5 A;  5JP7 A;  3NMK A;  2XLW A;  2YLG A;  1YYX A;  2XLV A;  1S05 A;  3HNJ A;  4EIY A;  5JSL A;  2YKZ A;  3U8P A;  3TOL A;  2XLO A;  1E85 A;  2J8W A;  1QPU A;  2XLD A;  3ZQY A;  4CDY A;  1A7V A;  1MQV A;  5JVE A;  1RCP A;  4WGZ A;  2XLH A;  3ZQV A;  4U9D A;  1YZA A;  3M15 A;  3IQ5 A;  4JKV A;  4IAR A;  3QW0 A;  1M6T A;  1E84 A;  2YL0 A;  4D4X A;  1GQA A;  1BBH A;  2XLE A;  1YZC A;  3C62 A;  5B3I A;  3FOP A;  4CDV A;  1JAF A;  5JLI A;  4JEA A;  3IQ6 A;  1CPQ A;  5JT4 A;  1LM3 B;  2J9B A;  4CJG A;  3C63 A;  1APC A;  4JE9 A;  2YLD A;  4CJO A;  2YL1 A;  3VRC A;  3M4B A;  3L1M A; 
#chains in the Genus database with same CATH topology
 4G7O F;  5AGF A;  3LEO A;  4NY3 A;  2XL8 A;  1B68 A;  1C17 M;  3FVY A;  4XLN F;  1HE1 A;  1XZP A;  3M79 A;  5E3C A;  3N2Z B;  2ETS A;  5L0I A;  1U6H A;  2A6E F;  1LE2 A;  3CZ6 A;  5B3S C;  4CIP A;  3OA1 A;  3LLI A;  1OCO C;  5CI9 A;  4BG0 A;  1KTM A;  5E33 A;  1T6I A;  4PJJ A;  2YL3 A;  4XEV A;  5DLJ A;  4OIN F;  4Z9J A;  4IAQ A;  1E83 A;  5A6J A;  3C8G D;  3ZIB A;  3B29 A;  3FXH A;  4I1M A;  2XLM A;  3GWL A;  4ZLD A;  1TFO B;  5KYW A;  2CYD A;  2KQ9 A;  1EQ1 A;  3ABM C;  3U8V A;  4U5C E;  4XEF A;  3ITF A;  2W45 A;  2J0X A;  2EPM X;  3QW1 A;  4P9F A;  4YL0 A;  3B71 A;  3SXK A;  3ZDL A;  1M57 C;  1NBB A;  1ZHX A;  1L7C A;  2EIJ C;  3B9Q A;  3DJU B;  3ABL C;  2EIL C;  4CS8 C;  2QLA A;  2W9Y A;  2IXN A;  3SP1 A;  1PD0 A;  1LS1 A;  4L6R A;  3ECS A;  3W4Y A;  2GA0 A;  4CS9 A;  3T6B A;  4DJ9 A;  2VB6 A;  2IYL D;  4N4W A;  1CPR A;  4PJN A;  4N6C A;  4ULW A;  3ZWI A;  2YWA A;  3LS0 A;  4JUR I;  4K7B A;  4PK4 A;  1I5N A;  2J9W A;  2HKV A;  2ZPA A;  2EPK X;  3LEV A;  4G78 A;  4U5H A;  4JC7 A;  4AK9 A;  3RYL A;  4HE8 D;  4QI2 A;  3F46 A;  3V5X A;  2ZXP A;  3DJN B;  1R4T A;  3CEX A;  3ZTZ A;  2L6F A;  1YA7 O;  2Z15 A;  5AC4 A;  5L3Q A;  2AWY A;  1YA9 A;  1OW8 A;  2Y39 A;  3S84 A;  2GWW A;  1SZI A;  2E87 A;  1ORY A;  2DI3 A;  3DE8 A;  3EGX B;  2VAS A;  4U5F E;  5FZT A;  4D4N A;  3TQO A;  4HEA J;  1LIH A;  2DYS C;  5L3V A;  2O9X A;  2Y3D A;  3AGT A;  1HE9 A;  1VLT A;  1HY5 A;  1OXK A;  2EIM C;  3DM9 B;  4QDL A;  5JP7 A;  4O79 A;  3Q6M A;  4AX2 A;  5BQI A;  1H9T A;  1U0B B;  2MHR A;  1Q0K A;  4QI0 A;  1LE4 A;  1FR0 A;  4YT4 A;  1S05 A;  4RD9 A;  2P7V A;  3HNJ A;  3SXY A;  3W8I A;  4DVY P;  1J8M F;  5JSL A;  2GDC A;  3NDB B;  2VCA A;  3EGX A;  3ZC4 A;  1A7E A;  1OR2 A;  3GAN A;  1L3P A;  3LNM B;  2R7T A;  2XLD A;  3S0X A;  1T01 A;  3CSK A;  3GM1 A;  2XSE A;  3O55 A;  1V55 C;  2Q4F A;  1GS9 A;  1RCP A;  3EHM A;  3S27 A;  2C03 A;  2J0W A;  3TJ5 A;  4YWQ A;  3RH3 A;  2WB7 A;  2G62 A;  3K1I A;  2WL8 A;  2L7A A;  4MVU A;  4CBE A;  4EHP A;  1VMA A;  1ZW3 A;  3W2V A;  3O10 A;  3S28 A;  4EBK A;  4DBR A;  2OU6 A;  2HSB A;  1W2W A;  1C02 A;  1LVK A;  1SF8 A;  3L8I A;  1G5Z A;  4YL3 A;  1TQG A;  3KMI A;  5BUO A;  3AQC A;  2XXA B;  4GYT A;  3C18 A;  3LAY A;  2PF4 E;  3TK0 A;  3NKD A;  2GFH A;  4WAB A;  2PX0 A;  2W4M A;  2RSE B;  3AG1 C;  3S9O A;  4CDV A;  1I4Y A;  4OIP F;  2IXO A;  4BJT A;  1OCZ C;  1ZW2 A;  5JLI A;  3JYY A;  2IOQ A;  2KNH A;  4IAO A;  1D0Y A;  5F5F A;  3DXJ F;  1ZHZ A;  3K1H A;  2HV7 A;  2P1A A;  1MMD A;  4O6M A;  4YN0 B;  4BJ6 C;  3B0U X;  4UDV A;  4XTK A;  2HMQ A;  3L8J A;  1ZU4 A;  1O3U A;  1ZZP A;  4AE4 B;  1OKK D;  1WTY A;  4MQ9 F;  1NU7 D;  4JE9 A;  4F4B A;  2QUP A;  3GM2 A;  4YJW A;  2YZS A;  1OCC C;  1MND A;  1GM5 A;  1OW6 A;  4WJ0 A;  4PFO A;  2LQG A;  3SEO A;  1TKN A;  1AVO B;  1UFB A;  4CJO A;  1WOL A;  2IBF A;  4PAC A;  4PJL A;  3TUL A;  3VRC A;  4PR9 A;  1VLS A;  4CX9 A;  3U3B A;  1ZYR F;  2OG2 A;  5L0H A;  3LES A;  5JRA A;  4JIO A;  1HMO A;  4AE4 A;  1Y6D A;  3ATP A;  3BRJ A;  4BPM A;  1F1M A;  4E7Z A;  2AWC A;  4XWJ A;  3G50 A;  2J45 A;  3WHN A;  1VB5 A;  2LD6 A;  3DZA A;  3KKB A;  2R25 A;  3TJ6 A;  1ZU5 A;  2D5R B;  2P61 A;  3TD7 A;  2P0N A;  1XWJ A;  3FMS A;  3RQF A;  3SZR A;  3ZTM A;  4WGY A;  4ER9 A;  4A4A A;  3E9V A;  1BR1 A;  3FAJ A;  3R7C A;  1HW1 A;  2LIG A;  3AQB A;  4ULV A;  3KH2 A;  4E0H A;  3NMI A;  4PFP A;  4HFF B;  1XZQ A;  1JPN A;  1YYJ A;  2KYH A;  3HNL A;  2XL4 A;  3VF0 A;  4C3E A;  5DS4 A;  1OXB A;  3M1C B;  4E18 A;  4MND A;  2R7U A;  1K05 A;  4X0R A;  3MYI A;  2YVK A;  3FOO A;  4LAC B;  5DVW A;  3R2P A;  3UGO A;  4EWC A;  3U2L A;  1JPJ A;  3JTL O;  4U9E A;  2EIN C;  1MMA A;  4BEM J;  5JS5 A;  3GOD A;  2G3V A;  5TJ5 E;  4CDA A;  2YLI A;  5T1D B;  1ZHY A;  3LUT B;  5A6B D;  5KYY A;  3DE9 A;  4JTC B;  4MTO A;  1R5I D;  3EQL F;  2R7Q A;  4O7G A;  3N24 A;  4YT2 A;  3LJB A;  3RQE A;  2HMZ A;  3NG1 A;  2H7B A;  4Q7C A;  1I4Z A;  3JZ0 A;  3MX3 A;  4E7S A;  3NKE A;  4Q5S F;  1WN0 A;  3WOD F;  5EHH A;  4R32 A;  1VOM A;  3JRT A;  2LFF A;  1V4A A;  2YEV A;  1C03 A;  4OIR F;  2IXM A;  2UUI A;  4CSA C;  4I1O B;  3NMK A;  3RKO F;  1IZM A;  1RXQ A;  2HV6 A;  5T3W A;  4RBN A;  2YLG A;  3EHN A;  1YYX A;  2CW0 F;  2LSE A;  3H2V A;  1OCR C;  2R02 A;  3SXZ A;  2NG1 A;  4EUK B;  3US6 A;  2YKZ A;  1LS4 A;  4EBJ A;  1EI7 A;  5COM A;  1LPE A;  1N1C A;  3TOL A;  3HJC A;  3U8P A;  2NSF A;  1V54 C;  3C7J A;  5DS6 A;  2J8W A;  1JOG A;  1OQC A;  4JVS A;  3UGP A;  4OIO F;  1BR2 A;  1YVI A;  2DYR C;  2NUP B;  1D1A A;  1MQV A;  2PP4 A;  4DOZ A;  5JVE A;  1ST6 A;  3POV A;  2DGJ A;  3A11 A;  2XS8 A;  2XLH A;  3U2M A;  1MMG A;  1D0Z A;  3O39 A;  4FX5 A;  1T5O A;  4GQH A;  3W8H A;  3JYH A;  1OKK A;  2M64 A;  3M15 A;  3VM6 A;  5COF A;  4LDK A;  3IQ5 A;  2JD3 A;  3RQG A;  4XLP F;  4H54 A;  3U0C A;  3DAG A;  2D4U A;  4J32 B;  1Z7Q c;  4D4X A;  2V3C C;  1QSP A;  3I5Q A;  3DKA A;  4P6I C;  3UMH A;  2NUP A;  5B3I A;  3L0I A;  1WGW A;  4OIQ F;  2EPO A;  4C7O B;  1M2V A;  1DOW A;  3AJM A;  1JAF A;  3B0P A;  4H4K C;  5EK0 A;  2H7O A;  2PX3 A;  2NPU A;  1T6U A;  1SYQ A;  3IQ6 A;  2ZXR A;  1LI5 A;  4MVS A;  3RFY A;  2YQY A;  1K04 A;  4BJ5 C;  1LM3 B;  1D1C A;  4CJG A;  2PNO A;  3C63 A;  3NYL A;  2L6G A;  5E3A A;  2QTV A;  2C04 A;  5L0D A;  4C7O A;  2W4B A;  3AG2 C;  3DM5 A;  3K6B A;  2Q9A A;  2CNW D;  4OD5 A;  3AGU A;  4CS8 A;  3AG4 C;  3FAP B;  3LLK A;  1TR2 A;  3C8G B;  3EFO B;  3O6X A;  5D92 A;  3TOM A;  2M4E A;  2VCC A;  3HNK A;  4M63 A;  4MVO A;  2KSF A;  1EA8 A;  1Z3I X;  1IW7 F;  2Y3H A;  4N06 A;  5BQH A;  4U5E E;  1FTS A;  256B A;  3GEE A;  3ABK C;  5CIV A;  2TMV P;  2YRF A;  4JJF A;  2CDQ A;  3VAY A;  1VTM P;  4FAP B;  2R7O A;  1QQ3 A;  4IWB A;  4KBL A;  2Y3B A;  5GPG B;  1CGN A;  2XM0 A;  4FWV A;  5A6B A;  1ZVZ A;  3MYF A;  1YLM A;  3G4X A;  3OEO A;  4JTA B;  3MLG A;  2FAP B;  3PHF 2;  4MW3 A;  3EFO A;  3C8G A;  5A6A A;  5F5H A;  1ZHT A;  2OJE D;  5KYU B;  2HUJ A;  3DWW A;  4K0D A;  1T9K A;  2KJG A;  3OWT A;  3HKK A;  3ASO C;  3NYJ A;  3ZG1 A;  3MBG A;  3NMJ A;  4J7Y A;  1NSG B;  3C8Z A;  2XM4 A;  4YT8 A;  2VC9 A;  1SMY F;  2J46 A;  2OQM A;  4BEJ A;  5DQZ A;  3RW0 A;  1D0X A;  1BR4 A;  2I8B A;  1EKY A;  3K66 A;  1LI7 A;  3E70 C;  4NC3 A;  5A69 A;  3EJN A;  3T4R A;  2QNL A;  2A6H F;  5KYU A;  3U5S A;  2HSQ A;  2NSG A;  4P9T A;  4MVQ A;  4YT5 A;  1DOV A;  1ORS C;  3AG3 C;  3QVY A;  3W2W A;  2VH3 A;  1NLX A;  4C3B A;  1Q0D A;  2EPN A;  1NZE A;  1GGQ A;  4IJJ A;  2ICW G;  2A1D D;  2B0J A;  4G7H F;  3V5Y A;  2GAQ A;  4RDA A;  4KI2 A;  3IPM O;  2WVN A;  2WZG A;  5A6K A;  2JPU A;  4NCQ A;  3JSZ A;  4MS2 A;  4BJ1 A;  2OOC A;  5KYY B;  2WVQ A;  4GEH A;  3JSE O;  4J30 B;  3GOR A;  4FES A;  1JMW A;  2BC5 A;  4DRJ B;  4Q4Z F;  2H8A A;  1NU9 C;  4CS9 C;  2QY9 A;  3KYI A;  2XLW A;  3X1O A;  3IQC A;  2R05 A;  2WZL A;  3EPV A;  1PD1 A;  2LP4 A;  2OEV A;  2XLV A;  4XPW A;  2L9J A;  4A2N B;  3PDM P;  3V7O A;  3EGD B;  4EIY A;  4CIH A;  2Q7R A;  3Q7L A;  2A0B A;  1U89 A;  2R7X A;  3IQT A;  2XLO A;  1E85 A;  5BQG A;  1G4W R;  3UR3 C;  3SNH A;  3ZQY A;  2BL2 A;  1E86 A;  4BJ6 A;  3ZQV A;  2LK4 A;  3NRH A;  2ZXO A;  1TWH A;  4U5D E;  4JRZ A;  1YZA A;  1VYI A;  2Y3G A;  4PJM A;  3S29 A;  2UUH A;  5D91 A;  4DBQ A;  4E17 A;  1BDJ B;  2CGE A;  2XS1 A;  1H7I A;  4K1O A;  3EGD A;  4Z9I A;  1M6T A;  4JCZ A;  4DXW A;  1E84 A;  2EPL X;  2CNW A;  3RVZ A;  1FFH A;  2R7V A;  3C62 A;  2DB4 A;  3H2U A;  5DQT A;  1ORJ A;  3DAF A;  2P6V A;  4E0I A;  5L0C A;  1H9G A;  3I5P A;  4XPX A;  3ASN C;  4JEA A;  4IRU A;  2BE5 F;  3LNR A;  1V74 B;  2YHS A;  3H65 A;  4IGG A;  4JW1 A;  3K33 A;  2PFD A;  2V26 A;  4O6N A;  5KYX B;  1MNE A;  1NFO A;  3HTK C;  2RD9 A;  4I3M A;  2ZD9 A;  3B0V C;  1TWC A;  4XEK A;  1M2V B;  3K1I C;  2F22 A;  4JTD B;  3DMD A;  3U9M A;  1E2X A;  3T6J A;  2OJQ A;  3KYJ A;  2X51 A;  3I4U A;  3JT1 A;  1A0B A;  1NG1 A;  4DVZ A;  2HZ8 A;  2FFH A;  3CQZ A;  4EBB A;  3RVY A;  2B0H A;  1UG7 A;  3IHU A;  2OEX A;  1TFK B;  3JRM O;  4JCH A;  3GM3 A;  3L1M A;  4MW8 A;  5KYX A;  2VCB A;  3FHD A;  1KU2 A;  1QLE C;  4O6Y A;  1Y4C A;  2ZXW C;  3PMR A;  2LFD A;  4G7Z F;  4KC9 A;  5EGY A;  1Z23 A;  3AOU A;  2IM8 A;  2AP3 A;  3ZVR A;  2ASR A;  5L0F A;  2KK1 A;  2Q3T A;  1Q0G A;  1YAU O;  5L0J A;  3X2Q C;  4HFK B;  4U5G A;  1T6Q A;  1TWG A;  3LS1 A;  2HS5 A;  4LER A;  1TWA A;  3PCV A;  4MTG A;  3ZSU A;  1PV3 A;  5B1B C;  5L0G A;  1QKR A;  1HW2 A;  1WAS A;  4AL1 A;  4NTA A;  3CAX A;  1LKX A;  4LLC A;  4ZLC A;  3QVZ A;  3GEI A;  2HJM A;  4YK5 A;  1FNT c;  2J7P D;  3S90 A;  1NFN A;  3M4B A;  3U3F A;  1FAP B;  4MVR A;  2WZF A;  4ONS A;  1D1B A;  2A69 F;  1ZHW A;  2R03 A;  1M2O A;  1KNY A;  4CSA A;  5JUA A;  2AU5 A;  1CGO A;  2XL6 A;  3HNI A;  3RIP A;  4LDR A;  4OD4 A;  4B6I A;  5KYN A;  3M4C A;  4IB4 A;  1Q0M A;  1Q0F A;  2X0C A;  1WWP A;  1RJ9 B;  3DD7 A;  1CGM E;  2Q00 A;  3G4Z A;  5HSW A;  1OW7 A;  1YDI A;  2G3K A;  1Z6A A;  2OCC C;  2YL7 A;  1BZ4 A;  1JRA A;  1JR8 A;  3QZC A;  3MFN A;  5CI8 A;  3WAQ A;  3EG9 B;  4U5B E;  2KW3 C;  2A0U A;  4JEB A;  1O87 A;  4CS7 A;  5FCL A;  2PBE A;  4MVZ A;  4I44 A;  4DRI B;  1RKE B;  2J9V A;  3EH2 A;  4LLE A;  3VYW A;  4XPY A;  4NTB A;  1A7D A;  3JCU Q;  2KGO A;  4NQF A;  1FFT C;  2LCH A;  4N6H A;  3FDQ A;  1S7Z A;  1WAT A;  5DS5 A;  2R7R A;  1G4U S;  4C3D A;  3HLZ A;  3QTH A;  1RJ9 A;  1H6G A;  4KNW A;  3Q6N A;  3KPH A;  3WG7 C;  1MMN A;  2Y69 C;  3GEH A;  1PCX A;  2H7V C;  2NUT B;  3EG9 A;  1Z5Z A;  4XQ1 A;  1VK5 A;  1Z63 A;  1K40 A;  1YAR O;  2JX0 A;  4LDQ A;  2QE9 A;  1RKE A;  3Q7G A;  4NTF A;  1O5H A;  3F47 A;  1QPU A;  3NYM A;  2IXP A;  4W8K A;  2XXA A;  4CDY A;  1A7V A;  3EZI A;  4WGZ A;  4BJ5 A;  4U9D A;  2A68 F;  3EH1 A;  1VYK A;  4G0H A;  1YJG A;  1A41 A;  2Q9C A;  2R7W A;  2AVK A;  2HJ3 A;  4JKV A;  4YL1 A;  1M56 C;  2KC3 A;  4IAR A;  2NUT A;  1HMD A;  2I15 A;  3QW0 A;  1QVX A;  4W8P A;  3DI5 A;  2YL0 A;  2MYS A;  3EZH A;  3U9J A;  1GQA A;  1AEP A;  3L34 A;  2Q9B A;  1BBH A;  2L81 A;  1YZC A;  2XLE A;  5T3T A;  3SXM A;  1QZX A;  3FOP A;  3N0T A;  4MTF A;  3T6G B;  3T9O A;  3IEE A;  4J7T A;  4KNV A;  1SR2 A;  3A9C A;  2J9U A;  2HFI A;  3QMK A;  2R9R B;  1AUE A;  3BEH A;  4JZA A;  1FMW A;  3UNG C;  4EKW A;  1OR3 A;  1RKC A;  5AC5 A;  5HV9 A;  3K7D A;  4JJG A;  2XRH A;  1J8Y F;  4DRH B;  1FMV A;  5IY5 C;  1CPQ A;  5JT4 A;  2OKU A;  2EIK C;  2J9B A;  3J06 A;  3KL4 A;  4ANJ A;  1APC A;  3V5Z A;  3SYN A;  4AL0 A;  4Z9H A;  3RF3 A;  2L6H A;  5E2Q A;  5K0I A;  3UMK A;  3UMI A;  2YLD A;  5COG A;  2WVO A;  2FGY A;  5F28 E;  1RMV A;  2MWQ A;  3GWN A;  1G8X A;  2R7S A;  2J7P A;  2YL1 A;  4MVM A;  5KYW B;  2CCY A;  5B1A C; 
#chains in the Genus database with same CATH homology
 3TOM A;  1E86 A;  5AGF A;  3HNK A;  2XL8 A;  3M79 A;  5JRA A;  256B A;  4CIP A;  1QQ3 A;  1CGN A;  2XM0 A;  2YL3 A;  4IAQ A;  1E83 A;  2XLM A;  3ZTM A;  4ER9 A;  4WGY A;  4ULV A;  3QW1 A;  3NMI A;  1NBB A;  3QVZ A;  1YYJ A;  3HNL A;  3NMJ A;  2XM4 A;  2QLA A;  4L6R A;  3FOO A;  5JUA A;  1EKY A;  4NC3 A;  1CGO A;  4N4W A;  2XL6 A;  1CPR A;  3HNI A;  4U9E A;  3ZWI A;  5JS5 A;  3M4C A;  4IB4 A;  4CDA A;  2YLI A;  3QVY A;  2CCY A;  3DE9 A;  2YL7 A;  3ZTZ A;  4CX9 A;  4JEB A;  3DE8 A;  4D4N A;  4N6H A;  2BC5 A;  5JP7 A;  3NMK A;  2XLW A;  2YLG A;  1YYX A;  2XLV A;  1S05 A;  3HNJ A;  4EIY A;  5JSL A;  2YKZ A;  3U8P A;  3TOL A;  2XLO A;  1E85 A;  2J8W A;  1QPU A;  2XLD A;  3ZQY A;  4CDY A;  1A7V A;  1MQV A;  5JVE A;  1RCP A;  4WGZ A;  2XLH A;  3ZQV A;  4U9D A;  1YZA A;  3M15 A;  3IQ5 A;  4JKV A;  4IAR A;  3QW0 A;  1M6T A;  1E84 A;  2YL0 A;  4D4X A;  1GQA A;  1BBH A;  2XLE A;  1YZC A;  3C62 A;  5B3I A;  3FOP A;  4CDV A;  1JAF A;  5JLI A;  4JEA A;  3IQ6 A;  1CPQ A;  5JT4 A;  1LM3 B;  2J9B A;  4CJG A;  3C63 A;  1APC A;  4JE9 A;  2YLD A;  4CJO A;  2YL1 A;  3VRC A;  3M4B A;  3L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...