2QLAA

Crystal structure of a 16-helix bundle architecture produced by the zinc-mediated self assembly of four cytochrome cb562 molecules
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Controlling protein-protein interactions through metal coordination: assembly of a 16-helix bundle protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2qlaA00
5JP7A 2XLVA 1YYXA 3M15A 1MQVA 5JUAA 1YZAA 4EIYA 3VRCA 3ZQVA 2XLDA 1E86A 3ZTMA 2XLHA 2YLDA 1E83A 1EKYA 4U9EA 4CX9A 2YL0A 5JRAA 5B3IA 5AGFA 2YL1A 2XM0A 3HNKA 2XM4A 256BA 3FOOA 4NC3A 2XL6A 5JS5A 2YLIA 1A7VA 3IQ5A 4CDVA 4JEAA 2J8WA 3TOMA 4CJGA 2YKZA 3HNIA 5JT4A 2J9BA 1E85A 4IB4A 2YL3A 2XLOA 3IQ6A 3ZTZA 2BC5A 3M79A 3QVYA 1RCPA 1CPRA 3ZWIA 1E84A 4CJOA 4U9DA 2XLMA 2XLWA 1QQ3A 1CGOA 3TOLA 3U8PA 4ER9A 4N6HA 2XLEA 1YZCA 4JEBA 3DE9A 2YLGA 3NMKA 1BBHA 2YL7A 1M6TA 3HNLA 1APCA 5JSLA 3L1MA 4WGYA 3DE8A 3HNJA 4D4NA 4D4XA 1GQAA 4IARA 4L6RA 1S05A 4JKVA 2XL8A 4CDYA 4IAQA 1QPUA 3C63A 4N4WA 1LM3B 1CGNA 5JLIA 3QW0A 1YYJA 4CDAA 1NBBA 2CCYA 3QVZA 3NMIA 4CIPA 3QW1A 3NMJA 4ULVA 3M4BA 1JAFA 3FOPA 5JVEA 3M4CA 3C62A 2QLAA 4JE9A 4WGZA 1CPQA 3ZQYA
chains in the Genus database with same CATH superfamily
5L0IA 3V5ZA 3W4YA 1Q0FA 3NYMA 4DVYP 5CI9A 2M4EA 3T6BA 1YYXA 3NKDA 3DAFA 2G62A 2OQMA 4BJ5A 1QZXA 4NCQA 3MYFA 4GYTA 4PFOA 4EBJA 3R7CA 3SP1A 1KNYA 4EIYA 2E87A 3GEHA 3JRMO 3K33A 1K40A 2PF4E 1T6UA 4AL1A 3EPVA 1Z6AA 3L8JA 2TMVP 4B6IA 5KYYA 4EBBA 1LS4A 2D5RB 4U5EE 1E86A 2YLDA 4WJ0A 4XQ1A 2DI3A 1EKYA 3JYYA 5F5FA 2G3VA 1I4ZA 2RSEB 3GANA 3H65A 5B3IA 3SNHA 1M57C 3R2PA 1VYKA 3RH3A 2CYDA 2P6VA 3E9VA 4E17A 1KTMA 1JPJA 1OR3A 3SZRA 3T6GB 2NUTA 1H9TA 1MMAA 1TQGA 4NC3A 5EGYA 4PFPA 5JS5A 2VB6A 3AQBA 4MVSA 3FMSA 3LEOA 4NY3A 1VTMP 4CJGA 5L0GA 2P61A 3G50A 1G4US 2L81A 3HNIA 5D91A 2ZPAA 2J9BA 1D0YA 5KYYB 1T6IA 4IB4A 4J30B 1VK5A 2GAQA 2XLOA 3ZTZA 1HW1A 3VM6A 2BC5A 4R32A 3EQLF 3RQGA 3VYWA 2LD6A 4JVSA 1D0ZA 3IHUA 2V26A 4ZLCA 3TJ5A 2IM8A 4XPWA 1OCZC 1RKEA 2UUHA 1EQ1A 1E84A 3ZSUA 4A4AA 1LIHA 1ZHYA 2C04A 2L6FA 4O7GA 2H7BA 4K1OA 4HE8D 3EHMA 4MTFA 2ASRA 4U5DE 1K05A 2XLWA 5T1DB 4BJ5C 3U2LA 2YZSA 4LLEA 3S28A 2IXNA 1YZCA 4JEBA 2JX0A 4BJ1A 2I8BA 1Q0GA 5E3CA 3I5PA 1BBHA 1RXQA 2YL7A 1M6TA 3NMKA 4AX2A 4C7OA 4CIHA 4MVUA 3AGUA 2P1AA 4WGYA 1MNDA 1IW7F 3HNJA 4K7BA 4N06A 1XWJA 2Y69C 3DJUB 5T3TA 1RKEB 1YVIA 4JTAB 4D4NA 3Q6MA 4IWBA 3RIPA 1GQAA 4DRIB 1G5ZA 1UG7A 2A6EF 2Q9AA 3LAYA 4YJWA 4J7YA 2YVKA 2OU6A 2ZXRA 4CDYA 4RDAA 2AWYA 1OR2A 3NYJA 1QPUA 2X51A 3B71A 2Y39A 3C63A 2PBEA 4LACB 5BQGA 5L3VA 1CGNA 1AEPA 1H6GA 1OQCA 3KYJA 1HW2A 1O87A 3NDBB 2CCYA 3U8PA 4YT2A 2CNWD 4O6MA 4C7OB 2Y3DA 1U89A 1C03A 3L34A 1HE9A 2R7QA 1DOWA 1LI5A 3DJNB 4W8PA 4MW8A 4Z9HA 2YWAA 3POVA 2WB7A 3M4BA 3K6BA 4JJFA 2R03A 4ULWA 3NG1A 1TR2A 1JAFA 4DBRA 3DAGA 4F4BA 2IOQA 4JCZA 4XEVA 4EUKB 3EFOA 5DS6A 5JVEA 2XL4A 3WAQA 3M4CA 2EPMX 2P7VA 3RFYA 5L3QA 3C7JA 3SXMA 2L7AA 4O6YA 3C62A 3TD7A 3FAJA 4JE9A 4JCHA 3RW0A 3FHDA 2MHRA 4PJNA 2ETSA 1T01A 4G7HF 1BDJB 2PP4A 4YL3A 3UMIA 1J8YF 2DB4A 1ORJA 4X0RA 3GEIA 2LFDA 4G78A 1HMDA 1GM5A 1Z23A 3TK0A 2MYSA 3EZIA 4JZAA 4MVRA 1FTSA 1Q0DA 5GPGB 2HMQA 1D1CA 4KNVA 4XEKA 4P6IC 3A9CA 3RQFA 5JUAA 3EFOB 4OIQF 1JPNA 1W2WA 4E0IA 1NFNA 2WVQA 4YK5A 3PDMP 2XLDA 3N0TA 1LE4A 4PR9A 3S90A 3B0VC 2QE9A 2XLHA 3ZTMA 2R7OA 4MVZA 5L0CA 2JD3A 4LERA 4J7TA 2VCCA 5JRAA 1E2XA 5TJ5E 4MTGA 4QI2A 2HFIA 4M63A 4U5FE 3IQTA 2KJGA 2R7VA 5AGFA 2LP4A 1YA7O 4OIPF 3JTLO 2CGEA 2J45A 3DI5A 2EPKX 3EG9A 3F47A 4MNDA 3RVZA 2YLIA 3BRJA 1A7VA 1XZPA 2J9WA 3U3FA 1ZHZA 5CIVA 2YKZA 3RF3A 3M1CB 5JT4A 4N6CA 1TWCA 2IBFA 1NZEA 2BE5F 2EIJC 5KYWA 3SXYA 2PX3A 4G7OF 2R7UA 1I4YA 3IQ6A 2W45A 4AK9A 3WG7C 1ZHTA 4J32B 3GODA 2CNWA 1M2VA 2YRFA 2ZXOA 2R7RA 2NG1A 4CSAA 3SXKA 3U8VA 3DWWA 4PJMA 4YWQA 1LVKA 3LJBA 1WWPA 1BZ4A 3EJNA 3EG9B 4I1MA 1JMWA 2KK1A 1CPRA 3ZWIA 1ZU4A 3U3BA 4U5CE 1A7EA 1NLXA 5B1AC 1TFOB 1Y4CA 1LPEA 1ZHXA 3CQZA 3DKAA 3LUTB 2EPLX 5CI8A 2AWCA 3LEVA 2LQGA 3JCUQ 3TOLA 2VCBA 4NQFA 2I15A 2XSEA 2IXOA 4HEAJ 1QLEC 4EHPA 5KYWB 3ATPA 3KH2A 2KSFA 4E0HA 3C8GB 1OW8A 1VLTA 3GWLA 1H9GA 3RKOF 3KMIA 1APCA 1M2VB 3E70C 5JSLA 4A2NB 2J0WA 2A6HF 4OINF 3K1IA 1ZYRF 2WVNA 4MVOA 4CS8A 5A6AA 2G3KA 3W2VA 3V5YA 1WGWA 4JJGA 1PV3A 3Q6NA 4D4XA 5HSWA 3GWNA 4XWJA 2C03A 3JYHA 1LS1A 2A68F 2B0JA 2QUPA 1R5ID 4L6RA 5L0FA 5KYXB 4JKVA 3S29A 1JOGA 4N4WA 2FAPB 5JLIA 1NSGB 3EGDB 3MLGA 3QW0A 3FDQA 1NBBA 3QVZA 1IZMA 3NMIA 1WTYA 3LLKA 4CIPA 3DMDA 4QI0A 4O79A 3ZG1A 1VLSA 4PACA 4ULVA 2HV7A 3TULA 4FWVA 2M64A 4U5HA 1FNTc 3O55A 2EINC 2LK4A 5AC5A 3AGTA 4I3MA 1T9KA 1C02A 1A7DA 4CSAC 1Z5ZA 1ORYA 2A69F 4OIOF 2KC3A 4OD5A 3CSKA 4PJLA 3BEHA 1D1BA 3DM5A 3EGXB 4IJJA 4C3BA 4DRJB 2HJ3A 4K0DA 5E33A 1TWHA 2LIGA 1BR4A 2PNOA 1V74B 1AUEA 5JP7A 2WZFA 3S27A 4AL0A 2UUIA 1YA9A 2XLVA 3C8GD 5COFA 1JRAA 1NU9C 5E3AA 1YDIA 1MQVA 1MMNA 2NUPB 4XPYA 1YZAA 4HFFB 2D4UA 2Y3HA 4LDRA 3ZQVA 4YN0B 3K1IC 1OCRC 4CS8C 4C3EA 3AG1C 3ABLC 3C8ZA 1RJ9A 3GEEA 2GA0A 2GDCA 1E83A 1Q0KA 3S9OA 3UGPA 3U9JA 2CW0F 1SR2A 4G7ZF 1YLMA 1TWGA 3N24A 1Z7Qc 1CGME 1BR2A 4XLNF 2Q00A 1NFOA 3NKEA 2AP3A 4YL1A 2X0CA 3SYNA 2YQYA 3LS0A 2R7TA 3G4XA 2HJMA 1BR1A 4NTAA 2OJQA 3LNRA 5DS4A 5F28E 1XZQA 2DGJA 256BA 2XM4A 4FX5A 3FOOA 4H4KC 3UR3C 2H7VC 2XL6A 3US6A 3X2QC 4U5GA 1T6QA 2H7OA 2HKVA 2OJED 2J7PD 3IQ5A 4YL0A 2WVOA 4JEAA 4XEFA 3TOMA 3MFNA 1H7IA 2PFDA 3UGOA 1E85A 2R05A 1FFHA 1RJ9B 2YL3A 4CBEA 2EIMC 2Q4FA 2J9UA 3F46A 4C3DA 2VH3A 1RMVA 1I5NA 2A1DD 3CAXA 4AE4B 4MS2A 4XTKA 1N1CA 4BPMA 4Z9IA 3M79A 5COGA 1D1AA 4MVQA 4I1OB 2HSQA 2KW3C 3RVYA 3LESA 4FAPB 1ZZPA 1A0BA 2WL8A 1ZW3A 4BG0A 4MQ9F 3GM3A 5FCLA 1HMOA 2HS5A 1YJGA 4Q7CA 4U9DA 1HE1A 2B0HA 2Y3GA 4W8KA 1WN0A 1QQ3A 1CGOA 1OW7A 3AJMA 3KYIA 1NU7D 1U6HA 3MBGA 5A6KA 2Q9CA 3LS1A 1LE2A 2XLEA 3L0IA 1GS9A 5HV9A 2EIKC 1EI7A 3DE9A 2YLGA 3HLZA 2R7WA 3EH2A 3HNLA 1G8XA 2LFFA 1ST6A 4LDKA 1QKRA 3L1MA 4JTDB 4IAOA 1MNEA 1UFBA 3C8GA 4P9FA 5L0DA 1VYIA 2IXMA 3JRTA 1SF8A 1QVXA 1LKXA 2MWQA 1VB5A 4IARA 4BEMJ 5DLJA 1OKKD 1S05A 2F22A 2XL8A 3T9OA 2R7SA 5BQHA 5DVWA 2FFHA 2QNLA 1LM3B 1R4TA 3CZ6A 3KL4A 4QDLA 5KYXA 1Z63A 3DXJF 3IPMO 3L8IA 4RBNA 4YT5A 5KYUA 2Q9BA 3K1HA 3ABMC 2IXPA 1FMWA 2VCAA 1VOMA 1WOLA 2VASA 4PJJA 1KU2A 2OEVA 2P0NA 3EGDA 2R9RB 1OW6A 3JZ0A 4G0HA 2HUJA 4JIOA 3X1OA 2EPOA 3B0PA 1EA8A 4JTCB 1MMDA 3U9MA 4E7ZA 5EHHA 1NG1A 1O3UA 3W2WA 3AG2C 3Q7LA 4BJ6A 2QTVA 5DQTA 2HV6A 1ZW2A 2J7PA 3ABKC 3ASNC 4CS7A 3EH1A 2OG2A 3SEOA 2QLAA 3DZAA 1T5OA 1G4WR 3SXZA 3O10A 5A6BD 2YEVA 3B9QA 3K66A 4JC7A 5KYUB 4XLPF 3T4RA 3J06A 2ZXWC 3ZQYA 4OIRF 3PHF2 4UDVA 1TWAA 5DS5A 1HY5A 1YARO 3EGXA 5L0HA 3AQCA 4DBQA 4IRUA 1VMAA 1FAPB 3M15A 2IYLD 2GWWA 3JSEO 4DJ9A 2W4BA 2V3CC 1OXKA 2QY9A 3VRCA 2KQ9A 5IY5C 3DM9B 3B0UX 2A0BA 3ZC4A 1PCXA 1GGQA 2W9YA 2J46A 1AVOB 4OD4A 3MX3A 3DD7A 3JT1A 2NUPA 4RD9A 4DXWA 1U0BB 2XXAA 1Z3IX 2DYSC 1OCCC 1TKNA 1Y6DA 2Q3TA 2ZD9A 3PMRA 5DQZA 4E7SA 4KI2A 1K04A 4U9EA 1DOVA 2AVKA 2YL0A 4CX9A 2NUTB 3JSZA 3WHNA 1O5HA 1ZVZA 4FESA 1F1MA 2NSFA 3GM1A 3HJCA 1ORSC 2HMZA 2XS1A 1ZHWA 2YL1A 3AOUA 3EZHA 1L7CA 3I5QA 2XM0A 4O6NA 3HNKA 4EKWA 4EWCA 1QSPA 5BUOA 3IQCA 4NTFA 2BL2A 3HTKC 2JPUA 3S0XA 3N2ZB 1TFKB 4CDVA 2OCCC 3Q7GA 2LSEA 2J8WA 4LLCA 1OKKA 1ZU5A 1FFTC 3EHNA 2CDQA 3V5XA 3QZCA 4HFKB 2XXAB 3ECSA 3C18A 2R25A 3ASOC 3ITFA 1L3PA 5COMA 4BJ6C 5AC4A 2R02A 4JURI 3QTHA 2PX0A 4Q4ZF 2XS8A 1J8MF 3UNGC 5T3WA 2R7XA 2J9VA 3RYLA 3LLIA 4KNWA 5D92A 1FR0A 1SYQA 1S7ZA 2KNHA 1PD0A 4KC9A 4BEJA 1Q0MA 3QVYA 2J0XA 4AE4A 4DOZA 1RCPA 4XPXA 2WZGA 4MVMA 3FXHA 3I4UA 3A11A 5B3SC 1FMVA 4WABA 3TJ6A 3VF0A 2LCHA 4CJOA 1OCOC 3KKBA 2XLMA 5BQIA 2KGOA 4ANJA 4CS9A 1PD1A 2NSGA 4KBLA 4LDQA 3TQOA 2FGYA 4ER9A 4GQHA 4N6HA 1OXBA 3MYIA 3IEEA 5FZTA 5B1BC 4E18A 2ZXPA 3GM2A 4EBKA 3K7DA 3ZIBA 5A6BA 3OA1A 3AG3C 2A0UA 2L9JA 1V55C 2O9XA 5K0IA 1M56C 3VAYA 2OEXA 2VC9A 3O39A 4YT8A 2AU5A 2ICWG 3WODF 3AG4C 4IGGA 1V54C 3DE8A 3QMKA 4JRZA 1YAUO 2Z15A 2L6HA 3FVYA 3W8HA 4DVZA 4JW1A 3B29A 3OEOA 5A69A 3NRHA 1SZIA 5KYNA 3FAPB 3GORA 4IAQA 3T6JA 1MMGA 4H54A 4Q5SF 2RD9A 2OOCA 2HZ8A 3O6XA 4BJTA 2L6GA 2Y3BA 3ZDLA 3UMKA 2W4MA 2WZLA 4ONSA 3S84A 1YYJA 4CDAA 2XRHA 3NYLA 5E2QA 1WASA 4U5BE 5F5HA 3U2MA 1D0XA 3QW1A 1M2OA 2OKUA 3NMJA 3UMHA 4YT4A 3U0CA 4GEHA 2YHSA 1B68A 2KYHA 3LNMB 4P9TA 2DYRC 3RQEA 2NPUA 4PK4A 3W8IA 3G4ZA 2GFHA 2H8AA 3FOPA 4MTOA 3HKKA 1C17M 1LI7A 2EPNA 2Q7RA 2EILC 2HSBA 3H2UA 3KPHA 4NTBA 1SMYF 1V4AA 3ZVRA 1WATA 3CEXA 5L0JA 4ZLDA 3PCVA 3V7OA 3U5SA 5A6JA 1RKCA 5EK0A 3OWTA 4I44A 1CPQA 1JR8A 4WGZA 4DRHB 3H2VA 4Z9JA 4CS9C 1A41A 4MW3A
chains in the Genus database with same CATH topology
5JP7A 2XLVA 1YYXA 3M15A 1MQVA 5JUAA 1YZAA 4EIYA 3VRCA 3ZQVA 2XLDA 1E86A 3ZTMA 2XLHA 2YLDA 1E83A 1EKYA 4U9EA 4CX9A 2YL0A 5JRAA 5B3IA 5AGFA 2YL1A 2XM0A 3HNKA 2XM4A 256BA 3FOOA 4NC3A 2XL6A 5JS5A 2YLIA 1A7VA 3IQ5A 4CDVA 4JEAA 2J8WA 3TOMA 4CJGA 2YKZA 3HNIA 5JT4A 2J9BA 1E85A 4IB4A 2YL3A 2XLOA 3IQ6A 3ZTZA 2BC5A 3M79A 3QVYA 1RCPA 1CPRA 3ZWIA 1E84A 4CJOA 4U9DA 2XLMA 2XLWA 1QQ3A 1CGOA 3TOLA 3U8PA 4ER9A 4N6HA 2XLEA 1YZCA 4JEBA 3DE9A 2YLGA 3NMKA 1BBHA 2YL7A 1M6TA 3HNLA 1APCA 5JSLA 3L1MA 4WGYA 3DE8A 3HNJA 4D4NA 4D4XA 1GQAA 4IARA 4L6RA 1S05A 4JKVA 2XL8A 4CDYA 4IAQA 1QPUA 3C63A 4N4WA 1LM3B 1CGNA 5JLIA 3QW0A 1YYJA 4CDAA 1NBBA 2CCYA 3QVZA 3NMIA 4CIPA 3QW1A 3NMJA 4ULVA 3M4BA 1JAFA 3FOPA 5JVEA 3M4CA 3C62A 2QLAA 4JE9A 4WGZA 1CPQA 3ZQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JP7 A;  2XLV A;  1YYX A;  3M15 A;  1MQV A;  5JUA A;  1YZA A;  4EIY A;  3VRC A;  3ZQV A;  2XLD A;  1E86 A;  3ZTM A;  2XLH A;  2YLD A;  1E83 A;  1EKY A;  4U9E A;  4CX9 A;  2YL0 A;  5JRA A;  5B3I A;  5AGF A;  2YL1 A;  2XM0 A;  3HNK A;  2XM4 A;  256B A;  3FOO A;  4NC3 A;  2XL6 A;  5JS5 A;  2YLI A;  1A7V A;  3IQ5 A;  4CDV A;  4JEA A;  2J8W A;  3TOM A;  4CJG A;  2YKZ A;  3HNI A;  5JT4 A;  2J9B A;  1E85 A;  4IB4 A;  2YL3 A;  2XLO A;  3IQ6 A;  3ZTZ A;  2BC5 A;  3M79 A;  3QVY A;  1RCP A;  1CPR A;  3ZWI A;  1E84 A;  4CJO A;  4U9D A;  2XLM A;  2XLW A;  1QQ3 A;  1CGO A;  3TOL A;  3U8P A;  4ER9 A;  4N6H A;  2XLE A;  1YZC A;  4JEB A;  3DE9 A;  2YLG A;  3NMK A;  1BBH A;  2YL7 A;  1M6T A;  3HNL A;  1APC A;  5JSL A;  3L1M A;  4WGY A;  3DE8 A;  3HNJ A;  4D4N A;  4D4X A;  1GQA A;  4IAR A;  4L6R A;  1S05 A;  4JKV A;  2XL8 A;  4CDY A;  4IAQ A;  1QPU A;  3C63 A;  4N4W A;  1LM3 B;  1CGN A;  5JLI A;  3QW0 A;  1YYJ A;  4CDA A;  1NBB A;  2CCY A;  3QVZ A;  3NMI A;  4CIP A;  3QW1 A;  3NMJ A;  4ULV A;  3M4B A;  1JAF A;  3FOP A;  5JVE A;  3M4C A;  3C62 A;  2QLA A;  4JE9 A;  4WGZ A;  1CPQ A;  3ZQY A; 
#chains in the Genus database with same CATH topology
 5L0I A;  3V5Z A;  3W4Y A;  1Q0F A;  3NYM A;  4DVY P;  5CI9 A;  2M4E A;  3T6B A;  1YYX A;  3NKD A;  3DAF A;  2G62 A;  2OQM A;  4BJ5 A;  1QZX A;  4NCQ A;  3MYF A;  4GYT A;  4PFO A;  4EBJ A;  3R7C A;  3SP1 A;  1KNY A;  4EIY A;  2E87 A;  3GEH A;  3JRM O;  3K33 A;  1K40 A;  2PF4 E;  1T6U A;  4AL1 A;  3EPV A;  1Z6A A;  3L8J A;  2TMV P;  4B6I A;  5KYY A;  4EBB A;  1LS4 A;  2D5R B;  4U5E E;  1E86 A;  2YLD A;  4WJ0 A;  4XQ1 A;  2DI3 A;  1EKY A;  3JYY A;  5F5F A;  2G3V A;  1I4Z A;  2RSE B;  3GAN A;  3H65 A;  5B3I A;  3SNH A;  1M57 C;  3R2P A;  1VYK A;  3RH3 A;  2CYD A;  2P6V A;  3E9V A;  4E17 A;  1KTM A;  1JPJ A;  1OR3 A;  3SZR A;  3T6G B;  2NUT A;  1H9T A;  1MMA A;  1TQG A;  4NC3 A;  5EGY A;  4PFP A;  5JS5 A;  2VB6 A;  3AQB A;  4MVS A;  3FMS A;  3LEO A;  4NY3 A;  1VTM P;  4CJG A;  5L0G A;  2P61 A;  3G50 A;  1G4U S;  2L81 A;  3HNI A;  5D91 A;  2ZPA A;  2J9B A;  1D0Y A;  5KYY B;  1T6I A;  4IB4 A;  4J30 B;  1VK5 A;  2GAQ A;  2XLO A;  3ZTZ A;  1HW1 A;  3VM6 A;  2BC5 A;  4R32 A;  3EQL F;  3RQG A;  3VYW A;  2LD6 A;  4JVS A;  1D0Z A;  3IHU A;  2V26 A;  4ZLC A;  3TJ5 A;  2IM8 A;  4XPW A;  1OCZ C;  1RKE A;  2UUH A;  1EQ1 A;  1E84 A;  3ZSU A;  4A4A A;  1LIH A;  1ZHY A;  2C04 A;  2L6F A;  4O7G A;  2H7B A;  4K1O A;  4HE8 D;  3EHM A;  4MTF A;  2ASR A;  4U5D E;  1K05 A;  2XLW A;  5T1D B;  4BJ5 C;  3U2L A;  2YZS A;  4LLE A;  3S28 A;  2IXN A;  1YZC A;  4JEB A;  2JX0 A;  4BJ1 A;  2I8B A;  1Q0G A;  5E3C A;  3I5P A;  1BBH A;  1RXQ A;  2YL7 A;  1M6T A;  3NMK A;  4AX2 A;  4C7O A;  4CIH A;  4MVU A;  3AGU A;  2P1A A;  4WGY A;  1MND A;  1IW7 F;  3HNJ A;  4K7B A;  4N06 A;  1XWJ A;  2Y69 C;  3DJU B;  5T3T A;  1RKE B;  1YVI A;  4JTA B;  4D4N A;  3Q6M A;  4IWB A;  3RIP A;  1GQA A;  4DRI B;  1G5Z A;  1UG7 A;  2A6E F;  2Q9A A;  3LAY A;  4YJW A;  4J7Y A;  2YVK A;  2OU6 A;  2ZXR A;  4CDY A;  4RDA A;  2AWY A;  1OR2 A;  3NYJ A;  1QPU A;  2X51 A;  3B71 A;  2Y39 A;  3C63 A;  2PBE A;  4LAC B;  5BQG A;  5L3V A;  1CGN A;  1AEP A;  1H6G A;  1OQC A;  3KYJ A;  1HW2 A;  1O87 A;  3NDB B;  2CCY A;  3U8P A;  4YT2 A;  2CNW D;  4O6M A;  4C7O B;  2Y3D A;  1U89 A;  1C03 A;  3L34 A;  1HE9 A;  2R7Q A;  1DOW A;  1LI5 A;  3DJN B;  4W8P A;  4MW8 A;  4Z9H A;  2YWA A;  3POV A;  2WB7 A;  3M4B A;  3K6B A;  4JJF A;  2R03 A;  4ULW A;  3NG1 A;  1TR2 A;  1JAF A;  4DBR A;  3DAG A;  4F4B A;  2IOQ A;  4JCZ A;  4XEV A;  4EUK B;  3EFO A;  5DS6 A;  5JVE A;  2XL4 A;  3WAQ A;  3M4C A;  2EPM X;  2P7V A;  3RFY A;  5L3Q A;  3C7J A;  3SXM A;  2L7A A;  4O6Y A;  3C62 A;  3TD7 A;  3FAJ A;  4JE9 A;  4JCH A;  3RW0 A;  3FHD A;  2MHR A;  4PJN A;  2ETS A;  1T01 A;  4G7H F;  1BDJ B;  2PP4 A;  4YL3 A;  3UMI A;  1J8Y F;  2DB4 A;  1ORJ A;  4X0R A;  3GEI A;  2LFD A;  4G78 A;  1HMD A;  1GM5 A;  1Z23 A;  3TK0 A;  2MYS A;  3EZI A;  4JZA A;  4MVR A;  1FTS A;  1Q0D A;  5GPG B;  2HMQ A;  1D1C A;  4KNV A;  4XEK A;  4P6I C;  3A9C A;  3RQF A;  5JUA A;  3EFO B;  4OIQ F;  1JPN A;  1W2W A;  4E0I A;  1NFN A;  2WVQ A;  4YK5 A;  3PDM P;  2XLD A;  3N0T A;  1LE4 A;  4PR9 A;  3S90 A;  3B0V C;  2QE9 A;  2XLH A;  3ZTM A;  2R7O A;  4MVZ A;  5L0C A;  2JD3 A;  4LER A;  4J7T A;  2VCC A;  5JRA A;  1E2X A;  5TJ5 E;  4MTG A;  4QI2 A;  2HFI A;  4M63 A;  4U5F E;  3IQT A;  2KJG A;  2R7V A;  5AGF A;  2LP4 A;  1YA7 O;  4OIP F;  3JTL O;  2CGE A;  2J45 A;  3DI5 A;  2EPK X;  3EG9 A;  3F47 A;  4MND A;  3RVZ A;  2YLI A;  3BRJ A;  1A7V A;  1XZP A;  2J9W A;  3U3F A;  1ZHZ A;  5CIV A;  2YKZ A;  3RF3 A;  3M1C B;  5JT4 A;  4N6C A;  1TWC A;  2IBF A;  1NZE A;  2BE5 F;  2EIJ C;  5KYW A;  3SXY A;  2PX3 A;  4G7O F;  2R7U A;  1I4Y A;  3IQ6 A;  2W45 A;  4AK9 A;  3WG7 C;  1ZHT A;  4J32 B;  3GOD A;  2CNW A;  1M2V A;  2YRF A;  2ZXO A;  2R7R A;  2NG1 A;  4CSA A;  3SXK A;  3U8V A;  3DWW A;  4PJM A;  4YWQ A;  1LVK A;  3LJB A;  1WWP A;  1BZ4 A;  3EJN A;  3EG9 B;  4I1M A;  1JMW A;  2KK1 A;  1CPR A;  3ZWI A;  1ZU4 A;  3U3B A;  4U5C E;  1A7E A;  1NLX A;  5B1A C;  1TFO B;  1Y4C A;  1LPE A;  1ZHX A;  3CQZ A;  3DKA A;  3LUT B;  2EPL X;  5CI8 A;  2AWC A;  3LEV A;  2LQG A;  3JCU Q;  3TOL A;  2VCB A;  4NQF A;  2I15 A;  2XSE A;  2IXO A;  4HEA J;  1QLE C;  4EHP A;  5KYW B;  3ATP A;  3KH2 A;  2KSF A;  4E0H A;  3C8G B;  1OW8 A;  1VLT A;  3GWL A;  1H9G A;  3RKO F;  3KMI A;  1APC A;  1M2V B;  3E70 C;  5JSL A;  4A2N B;  2J0W A;  2A6H F;  4OIN F;  3K1I A;  1ZYR F;  2WVN A;  4MVO A;  4CS8 A;  5A6A A;  2G3K A;  3W2V A;  3V5Y A;  1WGW A;  4JJG A;  1PV3 A;  3Q6N A;  4D4X A;  5HSW A;  3GWN A;  4XWJ A;  2C03 A;  3JYH A;  1LS1 A;  2A68 F;  2B0J A;  2QUP A;  1R5I D;  4L6R A;  5L0F A;  5KYX B;  4JKV A;  3S29 A;  1JOG A;  4N4W A;  2FAP B;  5JLI A;  1NSG B;  3EGD B;  3MLG A;  3QW0 A;  3FDQ A;  1NBB A;  3QVZ A;  1IZM A;  3NMI A;  1WTY A;  3LLK A;  4CIP A;  3DMD A;  4QI0 A;  4O79 A;  3ZG1 A;  1VLS A;  4PAC A;  4ULV A;  2HV7 A;  3TUL A;  4FWV A;  2M64 A;  4U5H A;  1FNT c;  3O55 A;  2EIN C;  2LK4 A;  5AC5 A;  3AGT A;  4I3M A;  1T9K A;  1C02 A;  1A7D A;  4CSA C;  1Z5Z A;  1ORY A;  2A69 F;  4OIO F;  2KC3 A;  4OD5 A;  3CSK A;  4PJL A;  3BEH A;  1D1B A;  3DM5 A;  3EGX B;  4IJJ A;  4C3B A;  4DRJ B;  2HJ3 A;  4K0D A;  5E33 A;  1TWH A;  2LIG A;  1BR4 A;  2PNO A;  1V74 B;  1AUE A;  5JP7 A;  2WZF A;  3S27 A;  4AL0 A;  2UUI A;  1YA9 A;  2XLV A;  3C8G D;  5COF A;  1JRA A;  1NU9 C;  5E3A A;  1YDI A;  1MQV A;  1MMN A;  2NUP B;  4XPY A;  1YZA A;  4HFF B;  2D4U A;  2Y3H A;  4LDR A;  3ZQV A;  4YN0 B;  3K1I C;  1OCR C;  4CS8 C;  4C3E A;  3AG1 C;  3ABL C;  3C8Z A;  1RJ9 A;  3GEE A;  2GA0 A;  2GDC A;  1E83 A;  1Q0K A;  3S9O A;  3UGP A;  3U9J A;  2CW0 F;  1SR2 A;  4G7Z F;  1YLM A;  1TWG A;  3N24 A;  1Z7Q c;  1CGM E;  1BR2 A;  4XLN F;  2Q00 A;  1NFO A;  3NKE A;  2AP3 A;  4YL1 A;  2X0C A;  3SYN A;  2YQY A;  3LS0 A;  2R7T A;  3G4X A;  2HJM A;  1BR1 A;  4NTA A;  2OJQ A;  3LNR A;  5DS4 A;  5F28 E;  1XZQ A;  2DGJ A;  256B A;  2XM4 A;  4FX5 A;  3FOO A;  4H4K C;  3UR3 C;  2H7V C;  2XL6 A;  3US6 A;  3X2Q C;  4U5G A;  1T6Q A;  2H7O A;  2HKV A;  2OJE D;  2J7P D;  3IQ5 A;  4YL0 A;  2WVO A;  4JEA A;  4XEF A;  3TOM A;  3MFN A;  1H7I A;  2PFD A;  3UGO A;  1E85 A;  2R05 A;  1FFH A;  1RJ9 B;  2YL3 A;  4CBE A;  2EIM C;  2Q4F A;  2J9U A;  3F46 A;  4C3D A;  2VH3 A;  1RMV A;  1I5N A;  2A1D D;  3CAX A;  4AE4 B;  4MS2 A;  4XTK A;  1N1C A;  4BPM A;  4Z9I A;  3M79 A;  5COG A;  1D1A A;  4MVQ A;  4I1O B;  2HSQ A;  2KW3 C;  3RVY A;  3LES A;  4FAP B;  1ZZP A;  1A0B A;  2WL8 A;  1ZW3 A;  4BG0 A;  4MQ9 F;  3GM3 A;  5FCL A;  1HMO A;  2HS5 A;  1YJG A;  4Q7C A;  4U9D A;  1HE1 A;  2B0H A;  2Y3G A;  4W8K A;  1WN0 A;  1QQ3 A;  1CGO A;  1OW7 A;  3AJM A;  3KYI A;  1NU7 D;  1U6H A;  3MBG A;  5A6K A;  2Q9C A;  3LS1 A;  1LE2 A;  2XLE A;  3L0I A;  1GS9 A;  5HV9 A;  2EIK C;  1EI7 A;  3DE9 A;  2YLG A;  3HLZ A;  2R7W A;  3EH2 A;  3HNL A;  1G8X A;  2LFF A;  1ST6 A;  4LDK A;  1QKR A;  3L1M A;  4JTD B;  4IAO A;  1MNE A;  1UFB A;  3C8G A;  4P9F A;  5L0D A;  1VYI A;  2IXM A;  3JRT A;  1SF8 A;  1QVX A;  1LKX A;  2MWQ A;  1VB5 A;  4IAR A;  4BEM J;  5DLJ A;  1OKK D;  1S05 A;  2F22 A;  2XL8 A;  3T9O A;  2R7S A;  5BQH A;  5DVW A;  2FFH A;  2QNL A;  1LM3 B;  1R4T A;  3CZ6 A;  3KL4 A;  4QDL A;  5KYX A;  1Z63 A;  3DXJ F;  3IPM O;  3L8I A;  4RBN A;  4YT5 A;  5KYU A;  2Q9B A;  3K1H A;  3ABM C;  2IXP A;  1FMW A;  2VCA A;  1VOM A;  1WOL A;  2VAS A;  4PJJ A;  1KU2 A;  2OEV A;  2P0N A;  3EGD A;  2R9R B;  1OW6 A;  3JZ0 A;  4G0H A;  2HUJ A;  4JIO A;  3X1O A;  2EPO A;  3B0P A;  1EA8 A;  4JTC B;  1MMD A;  3U9M A;  4E7Z A;  5EHH A;  1NG1 A;  1O3U A;  3W2W A;  3AG2 C;  3Q7L A;  4BJ6 A;  2QTV A;  5DQT A;  2HV6 A;  1ZW2 A;  2J7P A;  3ABK C;  3ASN C;  4CS7 A;  3EH1 A;  2OG2 A;  3SEO A;  2QLA A;  3DZA A;  1T5O A;  1G4W R;  3SXZ A;  3O10 A;  5A6B D;  2YEV A;  3B9Q A;  3K66 A;  4JC7 A;  5KYU B;  4XLP F;  3T4R A;  3J06 A;  2ZXW C;  3ZQY A;  4OIR F;  3PHF 2;  4UDV A;  1TWA A;  5DS5 A;  1HY5 A;  1YAR O;  3EGX A;  5L0H A;  3AQC A;  4DBQ A;  4IRU A;  1VMA A;  1FAP B;  3M15 A;  2IYL D;  2GWW A;  3JSE O;  4DJ9 A;  2W4B A;  2V3C C;  1OXK A;  2QY9 A;  3VRC A;  2KQ9 A;  5IY5 C;  3DM9 B;  3B0U X;  2A0B A;  3ZC4 A;  1PCX A;  1GGQ A;  2W9Y A;  2J46 A;  1AVO B;  4OD4 A;  3MX3 A;  3DD7 A;  3JT1 A;  2NUP A;  4RD9 A;  4DXW A;  1U0B B;  2XXA A;  1Z3I X;  2DYS C;  1OCC C;  1TKN A;  1Y6D A;  2Q3T A;  2ZD9 A;  3PMR A;  5DQZ A;  4E7S A;  4KI2 A;  1K04 A;  4U9E A;  1DOV A;  2AVK A;  2YL0 A;  4CX9 A;  2NUT B;  3JSZ A;  3WHN A;  1O5H A;  1ZVZ A;  4FES A;  1F1M A;  2NSF A;  3GM1 A;  3HJC A;  1ORS C;  2HMZ A;  2XS1 A;  1ZHW A;  2YL1 A;  3AOU A;  3EZH A;  1L7C A;  3I5Q A;  2XM0 A;  4O6N A;  3HNK A;  4EKW A;  4EWC A;  1QSP A;  5BUO A;  3IQC A;  4NTF A;  2BL2 A;  3HTK C;  2JPU A;  3S0X A;  3N2Z B;  1TFK B;  4CDV A;  2OCC C;  3Q7G A;  2LSE A;  2J8W A;  4LLC A;  1OKK A;  1ZU5 A;  1FFT C;  3EHN A;  2CDQ A;  3V5X A;  3QZC A;  4HFK B;  2XXA B;  3ECS A;  3C18 A;  2R25 A;  3ASO C;  3ITF A;  1L3P A;  5COM A;  4BJ6 C;  5AC4 A;  2R02 A;  4JUR I;  3QTH A;  2PX0 A;  4Q4Z F;  2XS8 A;  1J8M F;  3UNG C;  5T3W A;  2R7X A;  2J9V A;  3RYL A;  3LLI A;  4KNW A;  5D92 A;  1FR0 A;  1SYQ A;  1S7Z A;  2KNH A;  1PD0 A;  4KC9 A;  4BEJ A;  1Q0M A;  3QVY A;  2J0X A;  4AE4 A;  4DOZ A;  1RCP A;  4XPX A;  2WZG A;  4MVM A;  3FXH A;  3I4U A;  3A11 A;  5B3S C;  1FMV A;  4WAB A;  3TJ6 A;  3VF0 A;  2LCH A;  4CJO A;  1OCO C;  3KKB A;  2XLM A;  5BQI A;  2KGO A;  4ANJ A;  4CS9 A;  1PD1 A;  2NSG A;  4KBL A;  4LDQ A;  3TQO A;  2FGY A;  4ER9 A;  4GQH A;  4N6H A;  1OXB A;  3MYI A;  3IEE A;  5FZT A;  5B1B C;  4E18 A;  2ZXP A;  3GM2 A;  4EBK A;  3K7D A;  3ZIB A;  5A6B A;  3OA1 A;  3AG3 C;  2A0U A;  2L9J A;  1V55 C;  2O9X A;  5K0I A;  1M56 C;  3VAY A;  2OEX A;  2VC9 A;  3O39 A;  4YT8 A;  2AU5 A;  2ICW G;  3WOD F;  3AG4 C;  4IGG A;  1V54 C;  3DE8 A;  3QMK A;  4JRZ A;  1YAU O;  2Z15 A;  2L6H A;  3FVY A;  3W8H A;  4DVZ A;  4JW1 A;  3B29 A;  3OEO A;  5A69 A;  3NRH A;  1SZI A;  5KYN A;  3FAP B;  3GOR A;  4IAQ A;  3T6J A;  1MMG A;  4H54 A;  4Q5S F;  2RD9 A;  2OOC A;  2HZ8 A;  3O6X A;  4BJT A;  2L6G A;  2Y3B A;  3ZDL A;  3UMK A;  2W4M A;  2WZL A;  4ONS A;  3S84 A;  1YYJ A;  4CDA A;  2XRH A;  3NYL A;  5E2Q A;  1WAS A;  4U5B E;  5F5H A;  3U2M A;  1D0X A;  3QW1 A;  1M2O A;  2OKU A;  3NMJ A;  3UMH A;  4YT4 A;  3U0C A;  4GEH A;  2YHS A;  1B68 A;  2KYH A;  3LNM B;  4P9T A;  2DYR C;  3RQE A;  2NPU A;  4PK4 A;  3W8I A;  3G4Z A;  2GFH A;  2H8A A;  3FOP A;  4MTO A;  3HKK A;  1C17 M;  1LI7 A;  2EPN A;  2Q7R A;  2EIL C;  2HSB A;  3H2U A;  3KPH A;  4NTB A;  1SMY F;  1V4A A;  3ZVR A;  1WAT A;  3CEX A;  5L0J A;  4ZLD A;  3PCV A;  3V7O A;  3U5S A;  5A6J A;  1RKC A;  5EK0 A;  3OWT A;  4I44 A;  1CPQ A;  1JR8 A;  4WGZ A;  4DRH B;  3H2V A;  4Z9J A;  4CS9 C;  1A41 A;  4MW3 A; 
#chains in the Genus database with same CATH homology
 5JP7 A;  2XLV A;  1YYX A;  3M15 A;  1MQV A;  5JUA A;  1YZA A;  4EIY A;  3VRC A;  3ZQV A;  2XLD A;  1E86 A;  3ZTM A;  2XLH A;  2YLD A;  1E83 A;  1EKY A;  4U9E A;  4CX9 A;  2YL0 A;  5JRA A;  5B3I A;  5AGF A;  2YL1 A;  2XM0 A;  3HNK A;  2XM4 A;  256B A;  3FOO A;  4NC3 A;  2XL6 A;  5JS5 A;  2YLI A;  1A7V A;  3IQ5 A;  4CDV A;  4JEA A;  2J8W A;  3TOM A;  4CJG A;  2YKZ A;  3HNI A;  5JT4 A;  2J9B A;  1E85 A;  4IB4 A;  2YL3 A;  2XLO A;  3IQ6 A;  3ZTZ A;  2BC5 A;  3M79 A;  3QVY A;  1RCP A;  1CPR A;  3ZWI A;  1E84 A;  4CJO A;  4U9D A;  2XLM A;  2XLW A;  1QQ3 A;  1CGO A;  3TOL A;  3U8P A;  4ER9 A;  4N6H A;  2XLE A;  1YZC A;  4JEB A;  3DE9 A;  2YLG A;  3NMK A;  1BBH A;  2YL7 A;  1M6T A;  3HNL A;  1APC A;  5JSL A;  3L1M A;  4WGY A;  3DE8 A;  3HNJ A;  4D4N A;  4D4X A;  1GQA A;  4IAR A;  4L6R A;  1S05 A;  4JKV A;  2XL8 A;  4CDY A;  4IAQ A;  1QPU A;  3C63 A;  4N4W A;  1LM3 B;  1CGN A;  5JLI A;  3QW0 A;  1YYJ A;  4CDA A;  1NBB A;  2CCY A;  3QVZ A;  3NMI A;  4CIP A;  3QW1 A;  3NMJ A;  4ULV A;  3M4B A;  1JAF A;  3FOP A;  5JVE A;  3M4C A;  3C62 A;  2QLA A;  4JE9 A;  4WGZ A;  1CPQ A;  3ZQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...