2QLAA

Crystal structure of a 16-helix bundle architecture produced by the zinc-mediated self assembly of four cytochrome cb562 molecules
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Controlling protein-protein interactions through metal coordination: assembly of a 16-helix bundle protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2qlaA00
3TOMA 3ZQYA 3DE8A 3U8PA 2XL6A 4CDVA 3HNJA 3HNKA 2CCYA 1CGNA 2XLVA 2XM4A 3C62A 2J9BA 2YLGA 4CDAA 3QW0A 3C63A 2YLIA 2XL8A 1M6TA 5JUAA 3DE9A 1QQ3A 5JS5A 4WGZA 1EKYA 3M79A 1LM3B 3ZTMA 5JRAA 3NMKA 3M4BA 1GQAA 3HNIA 4N4WA 1E85A 1S05A 3FOOA 3ZTZA 3NMIA 4IARA 1YYJA 4CJOA 1YZCA 5B3IA 3FOPA 4IB4A 1YZAA 4JEBA 1JAFA 4ER9A 4L6RA 2YL7A 2YL0A 3ZWIA 2BC5A 4NC3A 2J8WA 1QPUA 3HNLA 4U9DA 1E83A 3TOLA 3M15A 2XLOA 5AGFA 4D4XA 1NBBA 5JLIA 3ZQVA 2YLDA 1RCPA 2XM0A 1E86A 1A7VA 2QLAA 3VRCA 4JE9A 4CJGA 2YL3A 3QVZA 3IQ5A 1E84A 3QW1A 1APCA 4D4NA 1CGOA 1MQVA 4IAQA 2YKZA 5JSLA 2XLWA 5JP7A 4CDYA 4CX9A 5JVEA 3QVYA 3L1MA 5JT4A 4JEAA 2YL1A 1BBHA 2XLHA 4N6HA 1CPRA 4EIYA 4JKVA 2XLDA 256BA 4CIPA 2XLEA 3IQ6A 4ULVA 3M4CA 3NMJA 4U9EA 4WGYA 1CPQA 2XLMA 1YYXA
chains in the Genus database with same CATH superfamily
3TOMA 3ZQYA 3BEHA 3IEEA 3GEIA 2EPMX 3KYJA 3K33A 4U5FE 4CS8A 4DBRA 4QI0A 2A0UA 4HEAJ 4U5GA 4DRJB 3B29A 1A41A 1MMGA 1Y4CA 3LEVA 1JMWA 2EILC 4QI2A 3O10A 4NQFA 5A6AA 1UFBA 1ZZPA 4BJ1A 1M2VB 4MTGA 1LE4A 1KU2A 4BPMA 2YLGA 2UUHA 3DD7A 4CDAA 1TQGA 3C63A 2J45A 3HLZA 5EGYA 2R7SA 4CS9C 4LDKA 4U5CE 2VCAA 2Q3TA 3AG4C 1PCXA 5L0IA 4YL3A 3ZC4A 3AQBA 1Q0KA 3B71A 3HKKA 1Q0MA 2LIGA 2R03A 3DE9A 1FAPB 4A4AA 1OXKA 2W4MA 3AG3C 5L0HA 1RKCA 1K05A 4EWCA 5F28E 1EKYA 1PD0A 3M79A 1LM3B 3H2VA 4GEHA 3ZTMA 4NTBA 5A69A 3EHNA 2L81A 2JD3A 3R2PA 1VOMA 2MHRA 2R7XA 2ZXWC 3I4UA 3NRHA 3UGPA 1S05A 3SZRA 1UG7A 4CSAC 2IOQA 2PF4E 3AJMA 4CBEA 5KYYA 3TULA 2L6HA 3LAYA 4MTFA 3OA1A 1YA7O 2XXAB 4YN0B 2ZXPA 4JRZA 3FOPA 4C7OA 3KKBA 3L8IA 4C3BA 2B0JA 4OD5A 3N2ZB 2HUJA 2LD6A 3L8JA 1QSPA 4XPWA 2KK1A 1ZW3A 2OCCC 4L6RA 4IWBA 4AL0A 3LJBA 1JRAA 1WWPA 3ZWIA 2KGOA 2J9WA 1PD1A 3IQCA 2R7TA 1M56C 3NG1A 1JOGA 1VLSA 2BC5A 2NUPA 4NC3A 3HTKC 2J8WA 3SP1A 3LESA 1E83A 3T9OA 3RVYA 5F5HA 3U2MA 3TOLA 2QY9A 1OR3A 3UNGC 2IBFA 2XLOA 1G5ZA 1C02A 4HFFB 2W4BA 3RKOF 2LSEA 3LUTB 4KNVA 2YLDA 1NFNA 5BQGA 3F46A 4AE4A 1HMOA 3AG2C 2XM0A 1OCCC 4I3MA 4MS2A 1ZHTA 3ASNC 3FAPB 1CGME 4Z9IA 1VK5A 3VRCA 4JE9A 3K66A 1LI7A 5A6BA 3KMIA 2EIKC 1R5ID 1GGQA 2OQMA 4JC7A 2R7QA 2A1DD 3Q7LA 4N06A 3JSZA 5KYUA 4MW8A 3I5PA 3SXYA 3EGDA 1HE1A 1QVXA 2XSEA 3PCVA 4IRUA 1CGOA 1S7ZA 4HFKB 4IAQA 5JSLA 1V4AA 1D0ZA 2XLWA 2OEXA 4H54A 2HV7A 1OR2A 4XEKA 2HKVA 4MNDA 4F4BA 2R7OA 3UMHA 4EKWA 4Z9JA 4YL0A 4OIOF 2EINC 3ITFA 3PDMP 3GWNA 2YQYA 1L7CA 2C03A 3K1HA 4RDAA 3RW0A 1TWAA 4YT4A 3AGUA 1RJ9A 3B0PA 2CW0F 2WZFA 4O6MA 2FAPB 3IHUA 1W2WA 1D1BA 1Z23A 2MYSA 2UUIA 3EG9A 1TKNA 4CIPA 1T01A 1SMYF 3ABKC 3EGXA 4WABA 3JT1A 1T6QA 1ZYRF 4ULVA 5DQTA 2OG2A 3WHNA 4YT2A 3MBGA 1BR2A 2A69F 2OJED 5BQIA 2I15A 2J0XA 1IZMA 2VB6A 3DZAA 2QTVA 3K1IC 4PJJA 4MVUA 2D5RB 1H6GA 4AK9A 1ZHZA 3AQCA 3CAXA 4CDVA 5A6JA 3HNJA 1T5OA 4HE8D 3HNKA 4EBJA 3DAGA 3NYJA 2R25A 2XM4A 3AGTA 1M2OA 2AWCA 4I44A 1R4TA 2CNWA 4CIHA 4KI2A 3C62A 5E3CA 3JYYA 2DGJA 1MMNA 1M2VA 3U0CA 1ST6A 4LERA 4DXWA 5KYXB 5COGA 1NG1A 2YLIA 2GAQA 3Q7GA 1TWHA 2WL8A 2Q00A 4BJ6C 5JUAA 1HW1A 1MMDA 2VC9A 3HJCA 2J7PA 3GM1A 1MMAA 4E18A 1QQ3A 5JS5A 4PJNA 2J9VA 2NUTB 4DVYP 2F22A 1TFOB 4JCHA 4DRIB 5JRAA 3LLIA 1AEPA 1MNEA 3M4BA 4K1OA 2IYLD 3HNIA 4MVRA 4NTFA 2EPNA 3UR3C 3S29A 4KNWA 1I4YA 1JPJA 1NLXA 1KTMA 2ASRA 2YRFA 3C8GD 3CQZA 4IARA 4Z9HA 1ORYA 1VLTA 3DM9B 2QNLA 2EIJC 2QE9A 2HJ3A 4O79A 1HW2A 2HMQA 3W8IA 5B3IA 2XXAA 3H65A 4C3DA 3RH3A 2PP4A 1LKXA 1YZAA 2KYHA 1E2XA 4JEBA 4X0RA 4JZAA 4XQ1A 3VAYA 3J06A 3OWTA 4Q4ZF 3KPHA 4ER9A 3GANA 1ZVZA 1YARO 1LS1A 3H2UA 2YL0A 3IQTA 1MNDA 2EPKX 1QKRA 2X51A 3G4XA 4G0HA 4U5EE 4YK5A 4A2NB 5KYWA 4CS9A 3B0UX 4MW3A 3SNHA 4MVOA 4MVMA 2GFHA 3PHF2 3EFOB 3ABMC 3G50A 3DI5A 3M15A 4BEMJ 2W45A 4P6IC 4FAPB 1XZPA 1Z3IX 3ZQVA 3MFNA 2XL4A 4IAOA 4J32B 2VCBA 1ZW2A 2OKUA 2H7BA 3JZ0A 3EZHA 3NYMA 1RCPA 2RD9A 3JTLO 3MYIA 1A7VA 2RSEB 4PFOA 3TD7A 2YZSA 4EBBA 1TR2A 3DAFA 3EH1A 4CSAA 4O7GA 2W9YA 1U6HA 4J7TA 3US6A 1TFKB 3DJUB 1VTMP 1G4US 3U3FA 2WVQA 2YL3A 2ICWG 2EIMC 5B3SC 4W8PA 1AUEA 1WGWA 2M4EA 4ANJA 2LFDA 2KQ9A 3POVA 3RFYA 1J8MF 3FVYA 4H4KC 4QDLA 1OKKD 3ASOC 1OXBA 5JT4A 1ZHYA 2EPOA 1BZ4A 5TJ5E 2XS1A 1G8XA 2KC3A 3X1OA 4MVQA 2HMZA 3A11A 2XLHA 3KH2A 4ULWA 4IJJA 1CPRA 1VYIA 3PMRA 2GA0A 4FESA 3FHDA 4AX2A 2G3VA 4E7SA 2R9RB 1NU7D 4E17A 3LS0A 3IPMO 2Y3HA 256BA 2GWWA 4BJ5C 4DVZA 1YJGA 4NTAA 2WB7A 1JR8A 3W2WA 1FNTc 3CZ6A 3NMJA 4WJ0A 2GDCA 4E0HA 2Y3GA 4WGYA 4BEJA 1CPQA 2DYSC 1YYXA 1LS4A 2PBEA 1FMVA 2XLMA 3A9CA 1XZQA 3C7JA 3F47A 4JURI 1Y6DA 4XPYA 2C04A 3DE8A 3U8PA 3C8ZA 2J46A 3RF3A 2KJGA 4LACB 3EJNA 4EBKA 5A6KA 2HZ8A 4KC9A 1ZU5A 1CGNA 2IXNA 2XLVA 1PV3A 3GODA 2Q9AA 3RVZA 2HV6A 2XRHA 2H7OA 5D92A 4DJ9A 4MVZA 1H9TA 3NKEA 4MVSA 2J9BA 1D1AA 2WVOA 3S28A 1YDIA 1OW7A 3DXJF 2R7WA 5L0GA 4I1MA 3Q6MA 5KYXA 2YWAA 1BR4A 3LS1A 4YL1A 2PX3A 2B0HA 1ZU4A 1G4WR 5HV9A 1Q0FA 1K40A 3LNRA 4RD9A 1DOVA 4WGZA 1N1CA 3UMKA 5BUOA 2OU6A 2ETSA 2Y3BA 5L3VA 2NUTA 1Z63A 3NMKA 2PFDA 1EI7A 1GQAA 1L3PA 2CYDA 4MTOA 4N4WA 4YJWA 4LDRA 1NSGB 2LP4A 2MWQA 5D91A 1Z5ZA 5L0DA 1V54C 3ZTZA 1YA9A 2Q4FA 1B68A 3JRMO 3NMIA 1WATA 1YYJA 2HSQA 1OQCA 1SF8A 2Z15A 1YZCA 3K1IA 4JTAB 4CJOA 1D1CA 2DYRC 1U0BB 3Q6NA 1OCOC 2NSGA 3C8GB 3FXHA 2V26A 3JYHA 3JSEO 1JAFA 2E87A 3O39A 1FTSA 1WN0A 1M57C 4NCQA 3RIPA 5L0CA 1VMAA 2AU5A 4O6NA 2ZXRA 3KL4A 1FFTC 2Y3DA 3GEHA 4JJFA 4PACA 1WTYA 5DQZA 1GM5A 2L9JA 3DWWA 5T1DB 4DOZA 3DJNB 5K0IA 3V7OA 4DRHB 1QPUA 3HNLA 3OEOA 4U9DA 2AWYA 4BJ6A 4UDVA 2R05A 3E70C 1LI5A 3EZIA 1U89A 1OCRC 3SXKA 3NDBB 3LNMB 2L7AA 2AVKA 5AC5A 1RXQA 2VCCA 4ONSA 5E2QA 2P0NA 4K7BA 2XS8A 4M63A 3TK0A 2WVNA 1F1MA 1I5NA 2PX0A 4D4XA 5JLIA 2I8BA 3W8HA 5DS5A 5EK0A 2J0WA 3X2QC 3ZG1A 1O5HA 4YT5A 3TJ5A 1RJ9B 1T9KA 5A6BD 2Q9CA 5IY5C 1YLMA 3FDQA 3T6GB 3QTHA 4OD4A 2A0BA 2FGYA 3EG9B 4JCZA 1SYQA 3S84A 1V55C 3EGXB 3EH2A 2J9UA 4P9TA 4GQHA 1LIHA 2QUPA 4CS8C 2BL2A 1TWGA 1OW8A 4U5HA 1HY5A 3QVZA 1NZEA 3U2LA 1XWJA 5F5FA 2KSFA 4C3EA 1HE9A 3MLGA 4XPXA 3NKDA 2DI3A 4NY3A 2Y39A 1JPNA 3S27A 1IW7F 1NFOA 2WZGA 1QZXA 2ZD9A 3W4YA 3ZIBA 5JP7A 1MQVA 3ATPA 2Y69C 1WOLA 2YKZA 3DM5A 4CDYA 2CDQA 3T4RA 2A6EF 5JVEA 1AVOB 5FZTA 2TMVP 4LLCA 2P6VA 2Q9BA 3CEXA 4J7YA 4YT8A 1RMVA 5KYNA 1OW6A 2HS5A 2M64A 1A7DA 1BBHA 3WAQA 2G62A 4XLNF 4O6YA 4U5DE 3SEOA 5E3AA 1QLEC 1FR0A 1RKEB 4XEVA 1KNYA 1LPEA 3GORA 3VM6A 2A68F 3ZSUA 2H7VC 3ZDLA 5EHHA 3WG7C 1H9GA 2NG1A 3M4CA 3B9QA 3E9VA 3TJ6A 1ORSC 2O9XA 5AGFA 4E7ZA 4Q5SF 4ZLCA 1TWCA 2CNWD 3FMSA 2AP3A 2NPUA 3LLKA 4MQ9F 3DMDA 2XL6A 3SXZA 5AC4A 3FAJA 2OOCA 4N6CA 2R7UA 4J30B 2CCYA 2YVKA 2LQGA 3W2VA 2ZXOA 3V5YA 2R7VA 3GM3A 3CSKA 3L34A 3U9JA 2R7RA 1V74B 4G78A 4R32A 1C17M 2NSFA 3RQEA 1T6UA 3WODF 3JRTA 2J7PD 2HSBA 3QW0A 4G7ZF 1LVKA 2JX0A 1Z7Qc 5L3QA 2A6HF 5B1BC 2KW3C 2XL8A 1M6TA 2WZLA 3T6BA 2ZPAA 2L6GA 5BQHA 3U5SA 1VB5A 5KYWB 3SXMA 1BR1A 2YHSA 3N0TA 5L0JA 2VASA 2LFFA 3I5QA 5T3WA 4BJ5A 3EHMA 5GPGB 1GS9A 2L6FA 2IXOA 4PR9A 4BJTA 4EUKB 4JW1A 1O87A 4BG0A 1E85A 3GWLA 4XWJA 2CGEA 3FOOA 3U8VA 5KYYB 2V3CC 4JJGA 2D4UA 4U5BE 3O6XA 4XLPF 3DKAA 4ZLDA 4C7OB 2OJQA 2IXPA 4IB4A 4JTCB 3EQLF 3RYLA 4OIRF 5CIVA 2P61A 2P1AA 3C8GA 3S0XA 1YVIA 3BRJA 4K0DA 4DBQA 4JVSA 3GEEA 4I1OB 3O55A 3V5ZA 2YL7A 3SYNA 5HSWA 1SZIA 5COMA 1J8YF 3KYIA 2BE5F 2NUPB 1H7IA 3S90A 1YAUO 5B1AC 3R7CA 1FFHA 3VF0A 4XEFA 2P7VA 1WASA 1ORJA 2HJMA 1EA8A 2YEVA 3MYFA 4PK4A 3B0VC 4YWQA 1ZHXA 3UMIA 4GYTA 1D0YA 4LLEA 2Q7RA 1NBBA 5CI8A 5L0FA 2PNOA 4PJMA 4AE4B 5T3TA 1T6IA 2G3KA 3RQFA 3QZCA 5COFA 3ABLC 1ZHWA 3EPVA 3U3BA 1E86A 4RBNA 4XTKA 1O3UA 4OIPF 2DB4A 4OINF 2QLAA 3MX3A 2IXMA 2IM8A 4CJGA 1A0BA 4JTDB 2OEVA 3ZVRA 2JPUA 4P9FA 3VYWA 2H8AA 2R02A 2X0CA 4AL1A 2LK4A 4EHPA 5KYUB 1SR2A 3IQ5A 3G4ZA 1A7EA 1VYKA 4CS7A 4OIQF 4G7OF 1Q0GA 3EGDB 3T6JA 3TQOA 1E84A 3QW1A 3K7DA 3ECSA 3GM2A 1APCA 3LEOA 4Q7CA 4D4NA 4G7HF 1OCZC 5E33A 4PJLA 3N24A 4FX5A 3RQGA 4B6IA 4CX9A 4KBLA 3QVYA 1NU9C 4IGGA 5DS4A 3L1MA 3EFOA 3M1CB 4JEAA 2HFIA 3V5XA 2LCHA 5DVWA 1HMDA 1EQ1A 2YL1A 1BDJB 4FWVA 4JIOA 4N6HA 1C03A 4W8KA 3UGOA 1DOWA 1OKKA 4EIYA 4JKVA 5DLJA 1Z6AA 2KNHA 5CI9A 2EPLX 3NYLA 2XLDA 5DS6A 5FCLA 3K6BA 1LE2A 1K04A 1D0XA 3AOUA 3U9MA 3C18A 1I4ZA 1RKEA 3L0IA 1Q0DA 2XLEA 3QMKA 3S9OA 3IQ6A 2FFHA 2VH3A 4E0IA 4PFPA 4U9EA 4LDQA 3JCUQ 3AG1C 1FMWA
chains in the Genus database with same CATH topology
3TOMA 3ZQYA 3DE8A 3U8PA 2XL6A 4CDVA 3HNJA 3HNKA 2CCYA 1CGNA 2XLVA 2XM4A 3C62A 2J9BA 2YLGA 4CDAA 3QW0A 3C63A 2YLIA 2XL8A 1M6TA 5JUAA 3DE9A 1QQ3A 5JS5A 4WGZA 1EKYA 3M79A 1LM3B 3ZTMA 5JRAA 3NMKA 3M4BA 1GQAA 3HNIA 4N4WA 1E85A 1S05A 3FOOA 3ZTZA 3NMIA 4IARA 1YYJA 4CJOA 1YZCA 5B3IA 3FOPA 4IB4A 1YZAA 4JEBA 1JAFA 4ER9A 4L6RA 2YL7A 2YL0A 3ZWIA 2BC5A 4NC3A 2J8WA 1QPUA 3HNLA 4U9DA 1E83A 3TOLA 3M15A 2XLOA 5AGFA 4D4XA 1NBBA 5JLIA 3ZQVA 2YLDA 1RCPA 2XM0A 1E86A 1A7VA 2QLAA 3VRCA 4JE9A 4CJGA 2YL3A 3QVZA 3IQ5A 1E84A 3QW1A 1APCA 4D4NA 1CGOA 1MQVA 4IAQA 2YKZA 5JSLA 2XLWA 5JP7A 4CDYA 4CX9A 5JVEA 3QVYA 3L1MA 5JT4A 4JEAA 2YL1A 1BBHA 2XLHA 4N6HA 1CPRA 4EIYA 4JKVA 2XLDA 256BA 4CIPA 2XLEA 3IQ6A 4ULVA 3M4CA 3NMJA 4U9EA 4WGYA 1CPQA 2XLMA 1YYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOM A;  3ZQY A;  3DE8 A;  3U8P A;  2XL6 A;  4CDV A;  3HNJ A;  3HNK A;  2CCY A;  1CGN A;  2XLV A;  2XM4 A;  3C62 A;  2J9B A;  2YLG A;  4CDA A;  3QW0 A;  3C63 A;  2YLI A;  2XL8 A;  1M6T A;  5JUA A;  3DE9 A;  1QQ3 A;  5JS5 A;  4WGZ A;  1EKY A;  3M79 A;  1LM3 B;  3ZTM A;  5JRA A;  3NMK A;  3M4B A;  1GQA A;  3HNI A;  4N4W A;  1E85 A;  1S05 A;  3FOO A;  3ZTZ A;  3NMI A;  4IAR A;  1YYJ A;  4CJO A;  1YZC A;  5B3I A;  3FOP A;  4IB4 A;  1YZA A;  4JEB A;  1JAF A;  4ER9 A;  4L6R A;  2YL7 A;  2YL0 A;  3ZWI A;  2BC5 A;  4NC3 A;  2J8W A;  1QPU A;  3HNL A;  4U9D A;  1E83 A;  3TOL A;  3M15 A;  2XLO A;  5AGF A;  4D4X A;  1NBB A;  5JLI A;  3ZQV A;  2YLD A;  1RCP A;  2XM0 A;  1E86 A;  1A7V A;  2QLA A;  3VRC A;  4JE9 A;  4CJG A;  2YL3 A;  3QVZ A;  3IQ5 A;  1E84 A;  3QW1 A;  1APC A;  4D4N A;  1CGO A;  1MQV A;  4IAQ A;  2YKZ A;  5JSL A;  2XLW A;  5JP7 A;  4CDY A;  4CX9 A;  5JVE A;  3QVY A;  3L1M A;  5JT4 A;  4JEA A;  2YL1 A;  1BBH A;  2XLH A;  4N6H A;  1CPR A;  4EIY A;  4JKV A;  2XLD A;  256B A;  4CIP A;  2XLE A;  3IQ6 A;  4ULV A;  3M4C A;  3NMJ A;  4U9E A;  4WGY A;  1CPQ A;  2XLM A;  1YYX A; 
#chains in the Genus database with same CATH topology
 3TOM A;  3ZQY A;  3BEH A;  3IEE A;  3GEI A;  2EPM X;  3KYJ A;  3K33 A;  4U5F E;  4CS8 A;  4DBR A;  4QI0 A;  2A0U A;  4HEA J;  4U5G A;  4DRJ B;  3B29 A;  1A41 A;  1MMG A;  1Y4C A;  3LEV A;  1JMW A;  2EIL C;  4QI2 A;  3O10 A;  4NQF A;  5A6A A;  1UFB A;  1ZZP A;  4BJ1 A;  1M2V B;  4MTG A;  1LE4 A;  1KU2 A;  4BPM A;  2YLG A;  2UUH A;  3DD7 A;  4CDA A;  1TQG A;  3C63 A;  2J45 A;  3HLZ A;  5EGY A;  2R7S A;  4CS9 C;  4LDK A;  4U5C E;  2VCA A;  2Q3T A;  3AG4 C;  1PCX A;  5L0I A;  4YL3 A;  3ZC4 A;  3AQB A;  1Q0K A;  3B71 A;  3HKK A;  1Q0M A;  2LIG A;  2R03 A;  3DE9 A;  1FAP B;  4A4A A;  1OXK A;  2W4M A;  3AG3 C;  5L0H A;  1RKC A;  1K05 A;  4EWC A;  5F28 E;  1EKY A;  1PD0 A;  3M79 A;  1LM3 B;  3H2V A;  4GEH A;  3ZTM A;  4NTB A;  5A69 A;  3EHN A;  2L81 A;  2JD3 A;  3R2P A;  1VOM A;  2MHR A;  2R7X A;  2ZXW C;  3I4U A;  3NRH A;  3UGP A;  1S05 A;  3SZR A;  1UG7 A;  4CSA C;  2IOQ A;  2PF4 E;  3AJM A;  4CBE A;  5KYY A;  3TUL A;  2L6H A;  3LAY A;  4MTF A;  3OA1 A;  1YA7 O;  2XXA B;  4YN0 B;  2ZXP A;  4JRZ A;  3FOP A;  4C7O A;  3KKB A;  3L8I A;  4C3B A;  2B0J A;  4OD5 A;  3N2Z B;  2HUJ A;  2LD6 A;  3L8J A;  1QSP A;  4XPW A;  2KK1 A;  1ZW3 A;  2OCC C;  4L6R A;  4IWB A;  4AL0 A;  3LJB A;  1JRA A;  1WWP A;  3ZWI A;  2KGO A;  2J9W A;  1PD1 A;  3IQC A;  2R7T A;  1M56 C;  3NG1 A;  1JOG A;  1VLS A;  2BC5 A;  2NUP A;  4NC3 A;  3HTK C;  2J8W A;  3SP1 A;  3LES A;  1E83 A;  3T9O A;  3RVY A;  5F5H A;  3U2M A;  3TOL A;  2QY9 A;  1OR3 A;  3UNG C;  2IBF A;  2XLO A;  1G5Z A;  1C02 A;  4HFF B;  2W4B A;  3RKO F;  2LSE A;  3LUT B;  4KNV A;  2YLD A;  1NFN A;  5BQG A;  3F46 A;  4AE4 A;  1HMO A;  3AG2 C;  2XM0 A;  1OCC C;  4I3M A;  4MS2 A;  1ZHT A;  3ASN C;  3FAP B;  1CGM E;  4Z9I A;  1VK5 A;  3VRC A;  4JE9 A;  3K66 A;  1LI7 A;  5A6B A;  3KMI A;  2EIK C;  1R5I D;  1GGQ A;  2OQM A;  4JC7 A;  2R7Q A;  2A1D D;  3Q7L A;  4N06 A;  3JSZ A;  5KYU A;  4MW8 A;  3I5P A;  3SXY A;  3EGD A;  1HE1 A;  1QVX A;  2XSE A;  3PCV A;  4IRU A;  1CGO A;  1S7Z A;  4HFK B;  4IAQ A;  5JSL A;  1V4A A;  1D0Z A;  2XLW A;  2OEX A;  4H54 A;  2HV7 A;  1OR2 A;  4XEK A;  2HKV A;  4MND A;  4F4B A;  2R7O A;  3UMH A;  4EKW A;  4Z9J A;  4YL0 A;  4OIO F;  2EIN C;  3ITF A;  3PDM P;  3GWN A;  2YQY A;  1L7C A;  2C03 A;  3K1H A;  4RDA A;  3RW0 A;  1TWA A;  4YT4 A;  3AGU A;  1RJ9 A;  3B0P A;  2CW0 F;  2WZF A;  4O6M A;  2FAP B;  3IHU A;  1W2W A;  1D1B A;  1Z23 A;  2MYS A;  2UUI A;  3EG9 A;  1TKN A;  4CIP A;  1T01 A;  1SMY F;  3ABK C;  3EGX A;  4WAB A;  3JT1 A;  1T6Q A;  1ZYR F;  4ULV A;  5DQT A;  2OG2 A;  3WHN A;  4YT2 A;  3MBG A;  1BR2 A;  2A69 F;  2OJE D;  5BQI A;  2I15 A;  2J0X A;  1IZM A;  2VB6 A;  3DZA A;  2QTV A;  3K1I C;  4PJJ A;  4MVU A;  2D5R B;  1H6G A;  4AK9 A;  1ZHZ A;  3AQC A;  3CAX A;  4CDV A;  5A6J A;  3HNJ A;  1T5O A;  4HE8 D;  3HNK A;  4EBJ A;  3DAG A;  3NYJ A;  2R25 A;  2XM4 A;  3AGT A;  1M2O A;  2AWC A;  4I44 A;  1R4T A;  2CNW A;  4CIH A;  4KI2 A;  3C62 A;  5E3C A;  3JYY A;  2DGJ A;  1MMN A;  1M2V A;  3U0C A;  1ST6 A;  4LER A;  4DXW A;  5KYX B;  5COG A;  1NG1 A;  2YLI A;  2GAQ A;  3Q7G A;  1TWH A;  2WL8 A;  2Q00 A;  4BJ6 C;  5JUA A;  1HW1 A;  1MMD A;  2VC9 A;  3HJC A;  2J7P A;  3GM1 A;  1MMA A;  4E18 A;  1QQ3 A;  5JS5 A;  4PJN A;  2J9V A;  2NUT B;  4DVY P;  2F22 A;  1TFO B;  4JCH A;  4DRI B;  5JRA A;  3LLI A;  1AEP A;  1MNE A;  3M4B A;  4K1O A;  2IYL D;  3HNI A;  4MVR A;  4NTF A;  2EPN A;  3UR3 C;  3S29 A;  4KNW A;  1I4Y A;  1JPJ A;  1NLX A;  1KTM A;  2ASR A;  2YRF A;  3C8G D;  3CQZ A;  4IAR A;  4Z9H A;  1ORY A;  1VLT A;  3DM9 B;  2QNL A;  2EIJ C;  2QE9 A;  2HJ3 A;  4O79 A;  1HW2 A;  2HMQ A;  3W8I A;  5B3I A;  2XXA A;  3H65 A;  4C3D A;  3RH3 A;  2PP4 A;  1LKX A;  1YZA A;  2KYH A;  1E2X A;  4JEB A;  4X0R A;  4JZA A;  4XQ1 A;  3VAY A;  3J06 A;  3OWT A;  4Q4Z F;  3KPH A;  4ER9 A;  3GAN A;  1ZVZ A;  1YAR O;  1LS1 A;  3H2U A;  2YL0 A;  3IQT A;  1MND A;  2EPK X;  1QKR A;  2X51 A;  3G4X A;  4G0H A;  4U5E E;  4YK5 A;  4A2N B;  5KYW A;  4CS9 A;  3B0U X;  4MW3 A;  3SNH A;  4MVO A;  4MVM A;  2GFH A;  3PHF 2;  3EFO B;  3ABM C;  3G50 A;  3DI5 A;  3M15 A;  4BEM J;  2W45 A;  4P6I C;  4FAP B;  1XZP A;  1Z3I X;  3ZQV A;  3MFN A;  2XL4 A;  4IAO A;  4J32 B;  2VCB A;  1ZW2 A;  2OKU A;  2H7B A;  3JZ0 A;  3EZH A;  3NYM A;  1RCP A;  2RD9 A;  3JTL O;  3MYI A;  1A7V A;  2RSE B;  4PFO A;  3TD7 A;  2YZS A;  4EBB A;  1TR2 A;  3DAF A;  3EH1 A;  4CSA A;  4O7G A;  2W9Y A;  1U6H A;  4J7T A;  3US6 A;  1TFK B;  3DJU B;  1VTM P;  1G4U S;  3U3F A;  2WVQ A;  2YL3 A;  2ICW G;  2EIM C;  5B3S C;  4W8P A;  1AUE A;  1WGW A;  2M4E A;  4ANJ A;  2LFD A;  2KQ9 A;  3POV A;  3RFY A;  1J8M F;  3FVY A;  4H4K C;  4QDL A;  1OKK D;  3ASO C;  1OXB A;  5JT4 A;  1ZHY A;  2EPO A;  1BZ4 A;  5TJ5 E;  2XS1 A;  1G8X A;  2KC3 A;  3X1O A;  4MVQ A;  2HMZ A;  3A11 A;  2XLH A;  3KH2 A;  4ULW A;  4IJJ A;  1CPR A;  1VYI A;  3PMR A;  2GA0 A;  4FES A;  3FHD A;  4AX2 A;  2G3V A;  4E7S A;  2R9R B;  1NU7 D;  4E17 A;  3LS0 A;  3IPM O;  2Y3H A;  256B A;  2GWW A;  4BJ5 C;  4DVZ A;  1YJG A;  4NTA A;  2WB7 A;  1JR8 A;  3W2W A;  1FNT c;  3CZ6 A;  3NMJ A;  4WJ0 A;  2GDC A;  4E0H A;  2Y3G A;  4WGY A;  4BEJ A;  1CPQ A;  2DYS C;  1YYX A;  1LS4 A;  2PBE A;  1FMV A;  2XLM A;  3A9C A;  1XZQ A;  3C7J A;  3F47 A;  4JUR I;  1Y6D A;  4XPY A;  2C04 A;  3DE8 A;  3U8P A;  3C8Z A;  2J46 A;  3RF3 A;  2KJG A;  4LAC B;  3EJN A;  4EBK A;  5A6K A;  2HZ8 A;  4KC9 A;  1ZU5 A;  1CGN A;  2IXN A;  2XLV A;  1PV3 A;  3GOD A;  2Q9A A;  3RVZ A;  2HV6 A;  2XRH A;  2H7O A;  5D92 A;  4DJ9 A;  4MVZ A;  1H9T A;  3NKE A;  4MVS A;  2J9B A;  1D1A A;  2WVO A;  3S28 A;  1YDI A;  1OW7 A;  3DXJ F;  2R7W A;  5L0G A;  4I1M A;  3Q6M A;  5KYX A;  2YWA A;  1BR4 A;  3LS1 A;  4YL1 A;  2PX3 A;  2B0H A;  1ZU4 A;  1G4W R;  5HV9 A;  1Q0F A;  1K40 A;  3LNR A;  4RD9 A;  1DOV A;  4WGZ A;  1N1C A;  3UMK A;  5BUO A;  2OU6 A;  2ETS A;  2Y3B A;  5L3V A;  2NUT A;  1Z63 A;  3NMK A;  2PFD A;  1EI7 A;  1GQA A;  1L3P A;  2CYD A;  4MTO A;  4N4W A;  4YJW A;  4LDR A;  1NSG B;  2LP4 A;  2MWQ A;  5D91 A;  1Z5Z A;  5L0D A;  1V54 C;  3ZTZ A;  1YA9 A;  2Q4F A;  1B68 A;  3JRM O;  3NMI A;  1WAT A;  1YYJ A;  2HSQ A;  1OQC A;  1SF8 A;  2Z15 A;  1YZC A;  3K1I A;  4JTA B;  4CJO A;  1D1C A;  2DYR C;  1U0B B;  3Q6N A;  1OCO C;  2NSG A;  3C8G B;  3FXH A;  2V26 A;  3JYH A;  3JSE O;  1JAF A;  2E87 A;  3O39 A;  1FTS A;  1WN0 A;  1M57 C;  4NCQ A;  3RIP A;  5L0C A;  1VMA A;  2AU5 A;  4O6N A;  2ZXR A;  3KL4 A;  1FFT C;  2Y3D A;  3GEH A;  4JJF A;  4PAC A;  1WTY A;  5DQZ A;  1GM5 A;  2L9J A;  3DWW A;  5T1D B;  4DOZ A;  3DJN B;  5K0I A;  3V7O A;  4DRH B;  1QPU A;  3HNL A;  3OEO A;  4U9D A;  2AWY A;  4BJ6 A;  4UDV A;  2R05 A;  3E70 C;  1LI5 A;  3EZI A;  1U89 A;  1OCR C;  3SXK A;  3NDB B;  3LNM B;  2L7A A;  2AVK A;  5AC5 A;  1RXQ A;  2VCC A;  4ONS A;  5E2Q A;  2P0N A;  4K7B A;  2XS8 A;  4M63 A;  3TK0 A;  2WVN A;  1F1M A;  1I5N A;  2PX0 A;  4D4X A;  5JLI A;  2I8B A;  3W8H A;  5DS5 A;  5EK0 A;  2J0W A;  3X2Q C;  3ZG1 A;  1O5H A;  4YT5 A;  3TJ5 A;  1RJ9 B;  1T9K A;  5A6B D;  2Q9C A;  5IY5 C;  1YLM A;  3FDQ A;  3T6G B;  3QTH A;  4OD4 A;  2A0B A;  2FGY A;  3EG9 B;  4JCZ A;  1SYQ A;  3S84 A;  1V55 C;  3EGX B;  3EH2 A;  2J9U A;  4P9T A;  4GQH A;  1LIH A;  2QUP A;  4CS8 C;  2BL2 A;  1TWG A;  1OW8 A;  4U5H A;  1HY5 A;  3QVZ A;  1NZE A;  3U2L A;  1XWJ A;  5F5F A;  2KSF A;  4C3E A;  1HE9 A;  3MLG A;  4XPX A;  3NKD A;  2DI3 A;  4NY3 A;  2Y39 A;  1JPN A;  3S27 A;  1IW7 F;  1NFO A;  2WZG A;  1QZX A;  2ZD9 A;  3W4Y A;  3ZIB A;  5JP7 A;  1MQV A;  3ATP A;  2Y69 C;  1WOL A;  2YKZ A;  3DM5 A;  4CDY A;  2CDQ A;  3T4R A;  2A6E F;  5JVE A;  1AVO B;  5FZT A;  2TMV P;  4LLC A;  2P6V A;  2Q9B A;  3CEX A;  4J7Y A;  4YT8 A;  1RMV A;  5KYN A;  1OW6 A;  2HS5 A;  2M64 A;  1A7D A;  1BBH A;  3WAQ A;  2G62 A;  4XLN F;  4O6Y A;  4U5D E;  3SEO A;  5E3A A;  1QLE C;  1FR0 A;  1RKE B;  4XEV A;  1KNY A;  1LPE A;  3GOR A;  3VM6 A;  2A68 F;  3ZSU A;  2H7V C;  3ZDL A;  5EHH A;  3WG7 C;  1H9G A;  2NG1 A;  3M4C A;  3B9Q A;  3E9V A;  3TJ6 A;  1ORS C;  2O9X A;  5AGF A;  4E7Z A;  4Q5S F;  4ZLC A;  1TWC A;  2CNW D;  3FMS A;  2AP3 A;  2NPU A;  3LLK A;  4MQ9 F;  3DMD A;  2XL6 A;  3SXZ A;  5AC4 A;  3FAJ A;  2OOC A;  4N6C A;  2R7U A;  4J30 B;  2CCY A;  2YVK A;  2LQG A;  3W2V A;  2ZXO A;  3V5Y A;  2R7V A;  3GM3 A;  3CSK A;  3L34 A;  3U9J A;  2R7R A;  1V74 B;  4G78 A;  4R32 A;  1C17 M;  2NSF A;  3RQE A;  1T6U A;  3WOD F;  3JRT A;  2J7P D;  2HSB A;  3QW0 A;  4G7Z F;  1LVK A;  2JX0 A;  1Z7Q c;  5L3Q A;  2A6H F;  5B1B C;  2KW3 C;  2XL8 A;  1M6T A;  2WZL A;  3T6B A;  2ZPA A;  2L6G A;  5BQH A;  3U5S A;  1VB5 A;  5KYW B;  3SXM A;  1BR1 A;  2YHS A;  3N0T A;  5L0J A;  2VAS A;  2LFF A;  3I5Q A;  5T3W A;  4BJ5 A;  3EHM A;  5GPG B;  1GS9 A;  2L6F A;  2IXO A;  4PR9 A;  4BJT A;  4EUK B;  4JW1 A;  1O87 A;  4BG0 A;  1E85 A;  3GWL A;  4XWJ A;  2CGE A;  3FOO A;  3U8V A;  5KYY B;  2V3C C;  4JJG A;  2D4U A;  4U5B E;  3O6X A;  4XLP F;  3DKA A;  4ZLD A;  4C7O B;  2OJQ A;  2IXP A;  4IB4 A;  4JTC B;  3EQL F;  3RYL A;  4OIR F;  5CIV A;  2P61 A;  2P1A A;  3C8G A;  3S0X A;  1YVI A;  3BRJ A;  4K0D A;  4DBQ A;  4JVS A;  3GEE A;  4I1O B;  3O55 A;  3V5Z A;  2YL7 A;  3SYN A;  5HSW A;  1SZI A;  5COM A;  1J8Y F;  3KYI A;  2BE5 F;  2NUP B;  1H7I A;  3S90 A;  1YAU O;  5B1A C;  3R7C A;  1FFH A;  3VF0 A;  4XEF A;  2P7V A;  1WAS A;  1ORJ A;  2HJM A;  1EA8 A;  2YEV A;  3MYF A;  4PK4 A;  3B0V C;  4YWQ A;  1ZHX A;  3UMI A;  4GYT A;  1D0Y A;  4LLE A;  2Q7R A;  1NBB A;  5CI8 A;  5L0F A;  2PNO A;  4PJM A;  4AE4 B;  5T3T A;  1T6I A;  2G3K A;  3RQF A;  3QZC A;  5COF A;  3ABL C;  1ZHW A;  3EPV A;  3U3B A;  1E86 A;  4RBN A;  4XTK A;  1O3U A;  4OIP F;  2DB4 A;  4OIN F;  2QLA A;  3MX3 A;  2IXM A;  2IM8 A;  4CJG A;  1A0B A;  4JTD B;  2OEV A;  3ZVR A;  2JPU A;  4P9F A;  3VYW A;  2H8A A;  2R02 A;  2X0C A;  4AL1 A;  2LK4 A;  4EHP A;  5KYU B;  1SR2 A;  3IQ5 A;  3G4Z A;  1A7E A;  1VYK A;  4CS7 A;  4OIQ F;  4G7O F;  1Q0G A;  3EGD B;  3T6J A;  3TQO A;  1E84 A;  3QW1 A;  3K7D A;  3ECS A;  3GM2 A;  1APC A;  3LEO A;  4Q7C A;  4D4N A;  4G7H F;  1OCZ C;  5E33 A;  4PJL A;  3N24 A;  4FX5 A;  3RQG A;  4B6I A;  4CX9 A;  4KBL A;  3QVY A;  1NU9 C;  4IGG A;  5DS4 A;  3L1M A;  3EFO A;  3M1C B;  4JEA A;  2HFI A;  3V5X A;  2LCH A;  5DVW A;  1HMD A;  1EQ1 A;  2YL1 A;  1BDJ B;  4FWV A;  4JIO A;  4N6H A;  1C03 A;  4W8K A;  3UGO A;  1DOW A;  1OKK A;  4EIY A;  4JKV A;  5DLJ A;  1Z6A A;  2KNH A;  5CI9 A;  2EPL X;  3NYL A;  2XLD A;  5DS6 A;  5FCL A;  3K6B A;  1LE2 A;  1K04 A;  1D0X A;  3AOU A;  3U9M A;  3C18 A;  1I4Z A;  1RKE A;  3L0I A;  1Q0D A;  2XLE A;  3QMK A;  3S9O A;  3IQ6 A;  2FFH A;  2VH3 A;  4E0I A;  4PFP A;  4U9E A;  4LDQ A;  3JCU Q;  3AG1 C;  1FMW A; 
#chains in the Genus database with same CATH homology
 3TOM A;  3ZQY A;  3DE8 A;  3U8P A;  2XL6 A;  4CDV A;  3HNJ A;  3HNK A;  2CCY A;  1CGN A;  2XLV A;  2XM4 A;  3C62 A;  2J9B A;  2YLG A;  4CDA A;  3QW0 A;  3C63 A;  2YLI A;  2XL8 A;  1M6T A;  5JUA A;  3DE9 A;  1QQ3 A;  5JS5 A;  4WGZ A;  1EKY A;  3M79 A;  1LM3 B;  3ZTM A;  5JRA A;  3NMK A;  3M4B A;  1GQA A;  3HNI A;  4N4W A;  1E85 A;  1S05 A;  3FOO A;  3ZTZ A;  3NMI A;  4IAR A;  1YYJ A;  4CJO A;  1YZC A;  5B3I A;  3FOP A;  4IB4 A;  1YZA A;  4JEB A;  1JAF A;  4ER9 A;  4L6R A;  2YL7 A;  2YL0 A;  3ZWI A;  2BC5 A;  4NC3 A;  2J8W A;  1QPU A;  3HNL A;  4U9D A;  1E83 A;  3TOL A;  3M15 A;  2XLO A;  5AGF A;  4D4X A;  1NBB A;  5JLI A;  3ZQV A;  2YLD A;  1RCP A;  2XM0 A;  1E86 A;  1A7V A;  2QLA A;  3VRC A;  4JE9 A;  4CJG A;  2YL3 A;  3QVZ A;  3IQ5 A;  1E84 A;  3QW1 A;  1APC A;  4D4N A;  1CGO A;  1MQV A;  4IAQ A;  2YKZ A;  5JSL A;  2XLW A;  5JP7 A;  4CDY A;  4CX9 A;  5JVE A;  3QVY A;  3L1M A;  5JT4 A;  4JEA A;  2YL1 A;  1BBH A;  2XLH A;  4N6H A;  1CPR A;  4EIY A;  4JKV A;  2XLD A;  256B A;  4CIP A;  2XLE A;  3IQ6 A;  4ULV A;  3M4C A;  3NMJ A;  4U9E A;  4WGY A;  1CPQ A;  2XLM A;  1YYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...