2GFHA

Crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
246
Chain Sequence
HHHMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKVSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords haloacid dehalogenase-like hydrolase domain containing 4
publication title Crystal structure of Protein C20orf147 homolog (17391249) from Mus musculus at 1.90 A resolution
rcsb
source organism Mus musculus
total genus 94
structure length 246
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2gfhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2gfhA01
2GHTA 2ZXEA 1ZD5A 1QQ5A 5AVRA 3N28A 3ZU6A 5AW1A 4UM5A 2IOFK 2YJ3A 5AW4A 2YMLA 2G06A 3DAOA 5A3SA 3WK5A 2C4NA 1RQLA 3MN1A 1S2OA 2YJ6A 2FUEA 3VAYA 4UMDA 3L8HA 5ALKA 3ZI4A 4KNVA 2YMPA 3ZVMA 1RQNA 4UU0A 5AI9A 4XE5A 5AICA 5AVUA 2B30A 5AVZA 2RARA 4HGQA 2HI0A 3U7HB 5AKKA 5ALWA 4CF5A 3KZXA 3NIWA 2BY4A 3K1ZA 4EEKA 3MC1A 1S8OA 4UMFA 3L1VA 1ZD4A 1SWWA 2FPRA 1L7NA 2WF7A 2P11A 2MU1A 2WF9A 4OCZA 1Q92A 2PKEA 4BX3A 2WHEA 5AHXA 1Q91A 2DQSA 4HAIA 2NO4A 3U19A 3OCUA 5ALZA 2I6XA 5AKLA 2C9MA 3WGVA 2C8LA 1YJ5A 5ALEA 2G80A 3IJ5A 4Y3UA 5ALUA 4Y2VA 2OM6A 2EARA 5AKEA 4EENA 2P9JA 2R8XA 3ET4A 5ALPA 3OTQA 4UATA 1N9KA 1NRWA 2ZBFA 2FI1A 3NALA 5AW3A 3WKEA 2RAVA 2Q4RA 1TJ3A 3AR5A 3NASA 2BDEA 3S6JA 1L8OA 4UAUA 3SKXA 1RRCA 3QUTA 3U26A 5A3RA 5ALLA 2HDOA 3NAMA 5AVWA 3ZX4A 1RC8A 1RPZA 4GXTA 3QLEA 4Y2TA 2CFSA 4L6AA 1ZRNA 3ZUPA 5ALRA 2G1AA 3ZX5A 4XPZA 3F9RA 3UMBA 4CF4A 4J2TA 2JAWA 3AR7A 1X42A 2W11A 2VKQA 2P69A 2I55A 4YH1A 1SWVA 5AVYA 2O2XA 5AM4A 4BNDB 2PQ0A 2RB5A 3QX7A 1RLTA 1K1EA 1NF2A 5AKGA 3A1DA 2HF7A 4Y2PA 3U7GA 5ALTA 5AIBA 3HLTA 4DW8A 2IA5A 4ZEVA 1PW5A 1U02A 2G0AA 4C4SA 1IWOA 3FVVA 4NABA 4AS2A 2HEGA 4NV0A 4JB3A 1N8NA 5ALMA 2YJ4A 1ZD2P 3E84A 3M1YA 5AIAA 2NO5A 4YCNA 3U7EB 3QYPA 1ZOLA 1WPGA 2Q4TA 1YV9A 2YN4A 4B6JA 2JARA 2WF5A 3OCYA 1Z4KA 1L7MA 5ALJA 1Y8AA 1Z4OA 1L7OA 4BX2A 2ODAA 3MPOA 4ZEWA 4QJBA 2QLTA 3R09A 3WK8A 1RKUA 3A1CA 1Z5UA 4NAVA 3UMGA 4DFDA 3FPSA 2AH5A 1U2SA 2FPSA 3KBBA 5E0OA 1TJ5A 2I34A 1YNSA 2HSZA 4FYPA 2QYHA 2HHLA 2ZBEA 3HYCA 4G63A 4I9FA 4H1WA 3KC2A 4O8CA 4Y2XA 5ALIA 4OHFA 5AM5A 3B8EA 4UMVA 1T5SA 2YFYA 4F71A 3FPBA 5ALSA 4F72A 5IT0A 4Y2YA 1F5SA 2EATA 3QU2A 4L6CA 2YMMA 3OCVA 3N8GA 3WKAA 4EX6A 3I76A 1LTQA 3IRUA 5AKZA 3ZVLA 1L7PA 3OCXA 1Z4QA 3WK7A 4EX7A 4EELA 4UU1A 5AKXA 3FM9A 4MWOA 4YIHA 5ALGA 4L57A 3W5BA 3ZWKA 3ZVNA 1Z4MA 2YBDA 3P96A 4QQFA 3M9LA 4HGOA 3SD7A 4YCMA 3AR4A 1RKQA 2WF6A 3SKYA 1QQ6A 3L8FA 3L0YA 5AK3A 2W4MA 4BEWA 5ALVA 1QH9A 2CN1A 4G9BA 4UAVA 4NFLA 1LVHA 5A3QA 4IG4A 4YCLA 2EAUA 5ALHA 1ZS9A 3N5KA 4ZEXA 3BWVA 2W43A 2PR7A 4UM7A 4Y2UA 3ZWDA 2ZBGA 3L1UA 2OA0A 3CZ4A 3EF0A 3CNHA 3I1YA 4Y2JA 5AK4A 4HGNA 3ET5A 3E8MA 5AVXA 3UM9A 1L6RA 3B9RA 3DNPA 1YS9A 4C4TA 4E88A 4OFZA 1NNLA 4HGRA 2GFHA 4UARA 3RFUA 4KN8A 2R8EA 2BDUA 2OBBA 3KD3A 5FP0A 4JDPA 1VJ5A 2FPUA 3GYGA 4BBJA 1RMYA 2IYEA 3AR6A 2AMYA 3FZQA 3PDWA 1CQZA 1ZJJA 4Y2QA 3B9BA 2B82A 2RBKA 2WM8A 2X4DA 1YDFA 4AP9A 1EK1A 2R8ZA 1RLOA 1Z4JA 1WR8A 4OD0A 3U7FB 4RESA 2GO7A 1QYIA 2GHQA 3NANA 1RMQA 1T5TA 2B1RA 5AKIA 5T41A 5AKHA 2I54A 2WFAA 1T9ZA 1Z5GA 3A3YA 3PGVA 3NUQA 2WF8A 2D2VA 1FEZA 4KX5A 5AI5A 4UASA 4Y2SA 3DDHA 5ALYA 3ONNA 2YY6A 2HOQA 3I28A 5ALDA 2NYVA 3QNMA 3IB6A 2FDRA 1J97A 4HGPA 2B8EA 4GIBA 3BA6A 4DCCA 5AW8A 3E58A 4BEVA 3QUCA 4KYTA 5AKYA 5ALFA 5AVVA 4HYTA 3AR9A 1RMTA 3L8GA 5AI8A 1Z88A 2R8YA 3W5AA 4IFTA 3L0CA 2JAOA 1U7OA 2FPXA 4BKMA 5AVSA 5AM2A 2G07A 3FGOA 5AW9A 3OCWA 3I6BA 3AR3A 3R9KA 5AKJA 1YMQA 3SMVA 3WKBA 1VJRA 4CE6A 1KYTA 3QGMA 1L8LA 5ALQA 5AESA 1Z4LA 5AW7A 1RLMA 4FE3A 1AQ6A 4C4RA 2P27A 3U13A 1TE2A 2C8KA 5JJBA 5AW0A 3A1EA 5ALOA 3QU7A 5AM3A 3PGLA 4CF3A 3QUQA 3WK6A 3EPRA 4KX3A 2C88A 3DV9A 4I9GA 2AUTA 5AI0A 3QUBA 1JUDA 1Z4IA 3QXGA 3PCTA 3UMCA 5AM1A 2B1QA 5AK5A 3WKDA 3W5DA 1XVIA 4CNQA 4KNWA 2B8JA 3N07A 2B0CA 4UW9A 3OPXA 3QU9A 2ZOSA 4EZEA 5ALXA 4PNHA 1VFPA 4Y2RA 2HO4A 1QQ7A 2HX1A 3OCZA 4UMEA 1ZD3A 1XP5A 3TLMA 3WK9A 1EK2A 2I33A 2FEAA 3ZTYA 3NRJA 4MUMA 4RETA 5IS2A 3AR2A 3ZW7A 2AGVA 5AW6A 4J03A 3N1UA 3R4CA 1WZCA 3ESQA 4NWIA 3WKCA 3RF6A 4BX0A 5AM0A 3WGUA 2IOHA 2GMWA 5IT4A 3KOOA 3ESRA 3WK4A 5AK6A 3W5CA 5AI6A 2O9JA 3E81A 2FPWA 2IOFA 3EWIA 2FUCA 3L0BA 1U2TA 1RKVA 1Z4NA 3L7YA 2I7DA 3ZTWA 5ALNA 1O03A 1TA0A 2JAUA 3ED5A 2YJ5A 2ZBDA 1U7PA 1Z4PX 3MMZA 3SLRA 2HCFA 1CR6A 3QU5A 5AVTA 4DWOA 3EF1A 2ZG6A 2CFTA 4AS3A 4BNDA 5AI4A 4YIKA 2CFRA 1ZRMA 3KDPA 3D6JA 3QU4A 1MH9A 5AW5A 3L5KA 3L8EA 2MSNA 3SHQA 1RDFA 2HF2A 2G08A 2YMQA 4YGYA 1O08A 1TJ4A 1SU4A 3SF0A 2Q5EA 1XPJA 4XQ0A 3AR8A 1J8DA 5AW2A 2JGAA 5AVQA 4BYGA 1WVIA 4XOUA 2OYCA 2G09A 4FFDA 3J7TA
chains in the Genus database with same CATH superfamily
2H1IA 1ZAYA 3JD4A 4MZDA 1DQRA 3EB9A 3GUUA 1DWUA 3MUNA 3FHCB 4BV8A 3GZTB 1EUZA 3S0XA 3CT4A 3UV6A 1OU4A 4Z2AA 1GPAA 5CIVA 1GRQA 3ACDA 5KYUB 2WV9A 5I9LA 3C7KA 1DXOA 2BPOA 3QE9Y 2V3VA 4FDVA 3S2EA 3GUCA 1NM5C 3FYSA 3QVVA 3F5FA 3G50A 5FPYA 4Y2VA 4OHWA 2FZEA 4C04A 3K96A 1IK6A 2SKCA 4IB4A 3U8VA 1D2AA 1VG9B 1JE1A 5KSZA 1YDWA 1O8CA 3DW3X 4MB0A 4XIIA 3G1UA 1JPUA 4CIDA 2O3SA 1XPOA 3R0IA 2FPOA 1KO4A 1NVTA 1I3NA 3PKZA 2M2IA 1S4QA 1TO1E 3Q9LA 4Z4FA 1F1MA 4L8LA 1ID8A 3DUFA 1T2NA 3QVTA 2V7EA 2FQXA 1E3EA 1I2BA 3OOHA 5C4GB 1ZD2P 3VMFA 4DVZA 8MHTA 1ZMRA 1KZGB 1PCXA 2JBAB 3HTXA 1Z23A 1TF5A 1HEUA 2ODAA 4ZHQA 4H4CA 1H7IA 1ISHA 2BAGA 2HJSA 2ERXA 3VPGA 3V8BA 2RGNA 3VZDA 4DSZA 2O3QA 4KQHA 1FQKA 1L5FA 4II3A 1PZHA 1DBQA 3F2VA 3KRTA 1NLFA 4J3JA 5KS2A 5I47A 3A9RA 1QCYA 5CB4B 3VR6D 4EY6A 3F7MA 2B94A 4NZOA 1H8ED 1S1MA 3BXZA 1CZLA 1VLJA 1ESEA 1KO1A 4OGFA 2IQIA 3ZWMA 4E5UA 1H9TA 4LVUA 3TPCA 4KGXA 4CMIA 4JKIA 4CS7A 4J0IA 421PA 2PMKA 1EWVA 1L7AA 5F9MA 4OI2A 3WQSB 4QODA 1QZ3A 2AI2A 4KXMA 4HGRA 1C4KA 4KO1S 1UPCA 2D54A 1MEOA 4FMPA 4QTYA 3PGJA 2IEAA 2AMYA 2CJWA 5LXTB 1G19A 3L92A 3AF2A 5GIPE 3A9CA 1MBZA 2Y0EA 3KPUA 4OLFA 3OZWA 2YCBA 2NQTA 1CZHA 4HLUC 2YV5A 5JAIA 3BJIC 3L7OA 3STVA 5C52B 1CV2A 5HUQA 4UASA 1DO0A 5E3HA 3BL6A 1KIFA 1T9AA 4B3MB 4PBRA 4UEKA 2WUDA 3KOMA 1MOZA 3AQBA 1L5VA 3SR3A 3V7UA 1DS6A 2B4AA 1EJ2A 2KI5A 4ASUA 3E35A 4QLBA 3KR9A 3T7AA 3C15C 2GFQA 3T1NA 5KX5B 1COWA 3LBIA 1GGFA 4UEWA 1XD2B 3BTVA 5ICFA 4QEZA 5J59A 4JUFA 1WXWA 3OC0A 1OXTA 4YN0B 1U7UA 1W44A 1XZCA 2I7CA 1IMJA 5KVVA 4IL5A 2P2ZA 1L5MA 1SA0A 4DMLA 4Z4IA 2B0CA 4RTPA 1JIVA 1ZX1A 4JUAA 4E07A 5EWLB 4C4XA 3JAWA 4J91A 1EK2A 3QOYA 2C5AA 3AV0B 1RFLA 1KS2A 1F0NA 4D43A 2CNLA 1USGA 5KZMB 3WGLA 4NFSA 2QW0X 3WKCA 2H8KA 4GPBA 4FFWA 3O6XA 4JI8B 5HZKA 3UWSA 3E48A 1QYWA 2GCEA 1EB8A 5DTQA 4LS3A 4V0SA 1ODKA 3LUGA 1J0DA 4QJ5A 4W8GA 4QU9A 3UUWA 1PR1A 5KINB 3WIOA 2QIPA 3KZNA 3WGOA 1VM6A 3WB9A 2ZB8A 2ZTMA 3H19A 3AF1A 2Q0QA 4C78A 3AEQB 1I9CA 4FBGA 4QUAA 4EI8A 4J32B 4LCEA 2JD2A 3II6X 1DX4A 4BP8A 4RZIA 3F4BA 3BCRA 1B42A 1LPSA 4IICA 2M98A 3A1FA 3QVUA 2OXIA 2A0XA 4L5CA 1VP9A 4OAOA 3V2UA 2KM1A 3F2IA 4JC8A 4OB6A 2PKQP 3MTJA 2QTBA 4X41A 4Z8XA 5HW0A 5HSWA 4BS9A 2QV0A 3DFUA 2PGOA 2H11A 3EZNA 3VYSB 4RUKA 3KQKA 4NZYA 5EYPA 1Y1RA 1L7CA 3NAMA 3E1KA 1W94A 2C2GA 1V35A 4PIMA 1TAGA 3NM6B 1ISMA 1ESDA 4R2HA 1GD1O 4XEKA 4FGLA 5JSUA 1OIWA 2R7NA 4BEMJ 4ZCIA 4NONA 1HF3A 4E5KA 3ASYA 5CUQA 5E38A 2B4YA 1YFZA 4CKZA 4RNDB 1T6QA 4ZZ2A 2DI3A 1KDVA 5H3LA 4JT9A 3G5MA 1XYGA 1Z0DA 3CUYA 5H9VA 1L4FA 1S2MA 4QBIA 4JBGA 1IC6A 2GO1A 1WP9A 1KE2A 3A27A 4AZTA 2FG7C 4HPWA 1SQFA 2BRUC 1QYVA 2R48A 4AZ0B 4YAFA 3G82C 2AYXA 4LRQA 2LIGA 3KLPX 3AX6A 3FPBA 3D8UA 2O8BB 1GRVA 2HRQA 3IPCA 1HE2A 1DJLA 3KZKA 5G3YA 3U80A 2FAXA 3D2AA 3EPJA 3H9EO 2PYIA 1CNEA 2RGUA 4C89A 5B3KA 1NBAA 4YUYA 4OQNA 2MR6A 1H1LA 4HAVA 1CGNA 1UKVY 5IYZA 3WMGA 5KYNA 3TD2A 4EBBA 2NX2A 2MYSA 3WWYA 2JANA 1C3XA 3O1HB 4RSGA 3OF5A 3CSSA 2GBPA 5FP0A 2PFGA 1UBRS 1MKYA 4HEHA 1EG2A 2O52A 3DLHA 2JIZA 3AI1A 3PIDA 4Y2QA 2NM0A 4INPA 1XXHE 3S2SA 2B98A 3OZUA 1ULSA 1HDGO 4UXHA 2XGGA 2AMFA 10MHA 3WO0A 4DZZA 3UT5A 3RUEA 1ENYA 2Z58A 4D56A 2JIPA 1SCQA 2EW8A 5LKAA 2GDJA 3LLVA 5HFAA 5AUPB 1ID1A 2EBFX 1V9CA 1XHEA 2Q6IA 4B2YA 1BJRE 1WDLA 3MCUA 3BRWD 1XEWX 1PFQA 3UGTA 3BXFA 4QE3A 4LACB 4DDUA 2H2IA 4KC9A 4E7ZA 4CMHA 1V37A 3PCXA 2PGXA 2TS1A 2VJLA 4BO6A 4KBGA 2XJ4A 3N2EA 4GQHA 1TW2A 2Q3BA 1MNEA 2ZIAA 2HJ9A 3WKDA 2J09A 1H0RA 4E18A 3H2JA 4AO7A 5F23A 3QE2A 2R8RA 1OR2A 3SQOA 4FB4A 2KYHA 4N47A 1PUXA 3QZCA 16PKA 3MJHA 4TT3A 4DARA 2VNSA 1NX6A 3HMQA 4NJOA 2DHRA 3DE8A 3LQ4A 2IY9A 4WLFA 4NH4A 1P9RA 4U9DA 4JBIA 2IOFA 3RFXA 4MUYA 1U0SY 4YI3A 4Q3BA 3JQEA 1XA3A 4PNPA 1TU4A 2ZT5A 4NMHA 3HV2A 3ZZTA 3ZZNA 3OIWA 3P2MA 3CX8A 5THXA 3TOXA 1LBIA 4CKWB 1I1OA 2P3LA 4YT5A 4RVOA 4URHA 2XD9A 3T52A 2IXEA 1HFEL 3BHMA 3ABLC 1Z0JA 3FKSD 4IGAA 2PGDA 3QMMA 3A3PA 1L4GA 3DW1X 3CS3A 3OJWA 3OQOA 4PZZA 3KWMA 2W93A 1LLCA 3OTHA 3R0VA 3CLSD 5IAEA 3AUSA 3U7HB 3DEHA 2PBEA 3K5HA 4GX0A 3G85A 3IPAA 1LTHR 5M2QA 3TEMA 3VGPA 1G1AA 3ZGLA 5IKXA 1XLTC 4CMKA 5FWNA 3KXDA 2C59A 1DMSA 3TVYA 4P0TA 1TM3E 4XEFA 3OOWA 3LUBA 3NALA 5AW3A 1AD2A 1JV2B 4RANA 4RL6A 3EG5A 3RSSA 3S6JA 1L8OA 2ICAA 3QUTA 4DUGA 2CNOA 3IVRA 1ULTA 2J5BA 3D7LA 2I2AA 1QGDA 2ZWPA 2WJZB 1MABA 4L08A 3TLYA 7AT1A 1KJ8A 1VLSA 3CO5A 2HSJA 5KJ6A 4DRJB 1QB7A 2IDMA 5B1YA 4CHTA 3DBLA 3K1IA 3PB3A 1TX4B 2EBUA 2EW2A 3OHSX 2G9ZA 4I8XA 4PYRA 4EMUA 5AT1A 4IRUB 3AKEA 1A4IA 2VHXA 4AYXA 4C30A 4CF7A 3KL2A 1VG0B 2VXCA 3CN9A 3FTEA 1RJWA 3C39A 1KPIA 4KE7A 1U2SA 1PBNA 1APCA 2OPHA 4QICA 5BR1A 1HV8A 1E58A 3GCDA 5IULC 1T8PA 1V4BA 1R0LA 1BOOA 4H0FA 5A3VA 3PEFA 5CFMA 2CXNA 3MWJA 1D04A 4IM7A 3P97A 3HB7A 1JRAA 1NONA 3HWRA 3LCCA 4HNRA 1EMDA 1UOOA 3MB8A 3TL2A 3UJNA 1VKOA 1Z75A 2QT0A 5ICCA 1MJNA 4B6OA 1K88A 4JBHA 4RVSA 2G77B 4IV5A 1JU4A 2BEJA 2RJNA 1G6OA 4INAA 3HQ4O 4MHTA 1JFLA 4EHFA 5A69A 1V54C 3GRAA 1M2OA 1YZTA 3DHNA 3C6BA 4HGNA 4PQYA 4PG7A 3RSOA 3M6VA 4A8JA 2J4CA 2RHCA 3RVNA 3OEEA 5AOAA 1C8LA 5GONF 4V3CA 2PG3A 3QJYA 4UEJA 4C7OB 3AVUA 4MIEA 3LBYA 4DPMA 1UADA 1IZZA 1PR2A 1LVKA 3IHKA 4OBWA 1MAHA 2XQVA 3I2YX 3BWEA 4KKVA 2CGEA 1AUOA 3TFWA 4R32A 1QP7A 4GRAA 4B83A 1AS0A 2DQKA 3T5CA 9GPBA 3OJLA 1Y8RB 5IH7A 3CRQA 3WV4A 1GCIA 4EG3A 1QZUA 2IZ0A 1J2JA 4RSMA 1YZCA 1WGWA 4PSAA 2YNMD 3PUYA 1U81A 4I8IA 3MJSA 3GAZA 2DT5A 2X8LA 2QUBA 1XZJA 4UBIA 3H9GA 3HA2A 4UCFA 1AZSC 2E4XA 3L7DA 3V8RA 1W75A 3MS7A 4JJIA 3FKQA 4CFSA 3LUJA 4GLLA 2V9ZA 3HFGA 1XJQA 1RHKA 4B85A 4YP0A 3K1JA 1HZZA 1Q0GA 2ZR9A 4B3CA 5JNSA 4IJQA 3G2IA 4EAAA 1SVNA 1P8AA 2B8NA 5LQRA 1YMVA 1U2DA 3RF6A 3UANA 4S2UA 1R4TA 2F3UA 3WK4A 4Q4AB 3CSDA 5E6SA 2PX2A 3NKFA 2HCFA 4PHGA 4LBYA 3PJFA 1RHRA 2JLQA 3CX3A 3NJRA 1ZGAA 1IOVA 2VOEA 1NJFA 4JSRA 3FNEA 3E2MA 2AA3A 3S9OA 3EGWA 2VF8A 2G63A 3BUSA 4JOCA 3GLRA 1IY8A 5KVSA 5LWHA 4YDHB 2Z0MA 2A9PA 4YT4A 1KYQA 4BTEA 2HWKA 3ER9A 2I62A 4CJXA 1HKHA 1T8YA 1OLSA 1V5GA 4JK3A 1Y82A 3U6BA 3ASVA 3OTGA 5YASA 2NN3C 2COKA 4OYHA 5K2OA 2MINB 4DVGA 2H5EA 4O2AA 3NBUA 1FBNA 3ES9A 1LW6E 3G49A 2PQ6A 3T7IA 3ZHZA 1K75A 4KTTE 1SXJA 1QQTA 2B6HA 1Z8NA 5HG0A 4D9NA 2VHWA 3QFRA 3FSGD 4AXBA 4J16A 4Q05A 2PXCA 3SFZA 3VR4H 1ACMA 4KMSA 1GA6A 4MS1B 1S3FA 2QDKA 4M86A 2I4MA 4E2WA 5TS3A 5JFOA 3AFGA 2VTDA 3MYYA 4KBFA 3UK1A 2Q5OA 1UPBA 1SG0A 1JG4A 4U2CA 1DIRA 1E2UA 2JGEA 3FNRA 5IUKC 2GCPA 1ECBA 1G60A 1N3BA 3GPDG 1OZ0A 3ENWA 1KKUA 1VOTA 3KPVA 2VJPA 3HU2A 1ZCBA 3SXYA 4Z9IA 5FQNA 1Q0UA 2PSEA 3HVRA 2J0WA 4JBWA 3WHPA 4WOCA 2QLAA 2IGBA 4Q47A 2I34A 4NEQA 3CZAA 4ZZ0A 1PEYA 3QEMB 1JHQA 2Y66A 1VBNA 3SEOA 2QG4A 4R8SA 2P0NA 3N2KB 4MUAA 4PLVA 1JLRA 1YIAA 4HX9A 2BCEA 4FHGA 2GRAA 4RY0A 2D5IA 2Z6AA 3N87A 4RMJA 5JH7B 5EWMA 4XTCS 3FM9A 2AUNA 1GGKA 3ZK9A 2V65A 4QGFA 1UMBB 3SSOA 1NAHA 1KERA 4XEHA 4N39A 3HJFA 2O2YA 3E5RA 4ZVRA 4JN6B 2Q5FA 3T3HA 4FFRA 2PEZA 1MB0A 3RC7A 1AKUA 3AHFA 1XNHA 5DN9A 2GEUA 3AF4A 4NTFA 2YQ4A 1LDNA 2JGNA 4ZJUA 4FIZA 3QBJA 3WFJA 1V4VA 4UFNA 2WSSD 4JEIA 1KQFA 4WXMA 1WDKA 5KAMA 4P4SB 1L5RA 3PV0A 2ZR7A 3BE6A 2JZOA 3KYDB 4RD4A 1KGSA 3C85A 1CPYA 2NLOA 1M2HA 4KGZA 1Z37A 4YAUA 2XS1A 3WGMA 4FGZA 3TRDA 2PT7A 3MWEB 3AM1A 2QL7A 3Q7IA 1DPGA 3K0BA 1PV2A 2QUPA 2QROA 2YHUA 5A4JA 3FYTA 4X95A 4RLSA 1QUFA 3MJ4A 2D8MA 1C7ZA 1MNQA 1X74A 4P58A 4M98A 4QAJA 1THZA 5KNLA 1GRCA 4MUIA 2OEVA 4PGMA 4AULA 2OZVA 2P27A 3YASA 3QX8A 3HABA 3N2YA 5TNXA 4P3XA 4EHDA 4X93A 5TXGA 2UV8A 3QXGA 1EQ1A 1MFPA 5AK5A 5C1OA 1I94B 5IU6A 3DKIA 2C9OA 3R7WA 2A5JA 1ZD9A 1MRZA 1FXWF 4LLEA 3A6DA 1KKMA 4R6WA 3RO7A 3WLFA 1C9DB 4RPIA 1TVCA 1GTL1 3L7LA 1DEAA 2UVPB 4NFYA 4WCFC 2C1ZA 3QFHA 3GRRA 3UYKA 4G7OF 1KMMA 4DBZA 5HPYB 1DXYA 1PQUA 3MTAA 3PXDA 4HS4A 2AFIA 1SD5A 3E70C 4IRMA 2X9LA 4RTRA 1NMXA 1TM5E 4BNWA 2QZSA 4UUNA 4HE8D 4DMHA 2ZATA 1T6ZA 1GXSB 1Q1EA 4I14A 2GHTA 4OB7A 4M9UA 1X7ZA 4A73A 4F56A 4DV3B 2ILVA 4JURI 1IBMB 1HX7A 3KAQA 2V58A 3PQFA 1HMOA 4EMSA 3ZQUA 3HLZA 5JHGB 1XYYA 3A25A 1SQGA 1E5LA 5ALWA 4JI7B 3EIUA 1D2CA 3MF4A 3GGOA 1FTYA 2YZSA 4R2WA 3BTUA 4LWQA 2C5FA 4E3ZA 1DBRA 1J2EA 4U6QA 1MA3A 1LBQA 3I58A 3POVA 1EVLA 5KOIA 1O0CA 4S0XA 3OT5A 5FLYA 2NO6A 3W7VA 3INTA 5AJHA 4KQCA 2IQ5A 1ODIA 3RV3A 1QDEA 1XO1A 2B2XA 3PCRB 1KC1A 5T4HA 2BL2A 3BH0A 5EQDA 5B37A 2AF3C 3E0XA 4CWAA 3EXEB 3EA0A 3R20A 1W85B 3CEXA 2JJ1D 3RBZA 3NZEA 3M4XA 3FGNA 3GVIA 2OCCC 1CR4A 5DSTA 3D4LA 5T67A 4B3FX 4MHSA 1D6NA 2XLEA 4UDXX 4DQVA 1OIVA 1MO3A 2Y99A 3E5HA 2ZPUA 1AH2A 1XLWA 3FOPA 4RTNA 2BFCA 3I92A 2GTHA 4JJAA 2FRXA 3GXOA 4E09A 5AC4A 1L1EA 1MJHA 1JWAB 1Z5ZA 3WL7A 4TL8A 1T0IA 3TXYA 5BO5A 5MHTA 3A6PC 1PLLA 5AFSA 3A36A 1YS7A 2WF6A 3DWEX 3F5QA 2OO7A 1TI7A 4FE7A 1MVLA 2WILA 3ZLVA 5IWAB 3G8DA 3U4QB 4JLDA 1NN1A 3GCZA 3P9RA 4O4HF 5KQSA 3CCBA 4YPOA 1OXXK 1QFJA 3AUUA 4BZXA 4YLGA 3DNPA 3H1AA 2I7XA 3SEZA 4WGGA 3EZ6A 1XLVA 3I0MA 2ZUTA 2BSQA 4IJ5A 1KORA 3EQ2A 3IDAA 1Z0IA 1ZM7A 5K0CA 1KZ9A 2IC5A 2VYCA 5MFZA 4LZZA 1HQDA 3LY9A 1V7ZA 1OI7A 4OYRA 2ORYA 4RXMA 1DC3A 5FUYA 3TSCA 2XLMA 4DLTA 1SUPA 1M9NA 2I03A 3OE1A 3TM4A 3P52A 1J97A 3L8ZA 4N01A 1TA9A 2AUMA 3DAFA 4Q3LA 4ZEMA 4K9RA 1GV1A 1ZCZA 2PBLA 2XHEA 3T3PB 4W6ZA 5EZ5A 4NCXA 2XMPA 3GVHA 1W6UA 4YNBA 5MN4A 3NC1C 2GBGA 3UAVA 4GOND 1F6WA 4UAGA 5HZMA 4Y1GA 4TTQA 1CC1S 3ZWBA 1DAHA 1XJCA 3S99A 4RABA 5A4FS 3N70A 5IKMA 4NZ9A 3Q6IA 2IHNA 3GQBA 1FJHA 1J1IA 2AC2A 3PGLA 4CKEB 3M1AA 3E7XA 1AKVA 3HRHA 1I0ZA 3PWTA 1XMPA 4FT4A 4MVJG 4CS8A 4JTCB 4GL2A 3M33A 5E8JA 5KSPA 5CGZA 2W6JA 1R0ZA 5DSXA 4DSAA 3SMQA 3R9XA 2XBUA 4OXXA 4WNYA 1UDXA 5KNCH 4AJOA 4NESA 5LP6C 3DBVO 3KQTA 3N3BC 4QNMA 3JYPA 4F85A 2Z8ZA 4FOPA 3DXXA 4DWOA 1FDRA 1TJYA 5JRDS 2JHPA 4UCQA 3REGA 3RTEA 3HJTA 1P45A 3JQ7A 1Y37A 2AJLI 3V7YA 3ABQB 3WL3A 1CY6A 3ATPA 1SN7A 5I9BA 3WTCA 1YBAA 1UK8A 3BILA 4BNIA 3KK0A 4TZKA 2OB1A 1I1NA 1Z8DA 4NPAA 2ZRMA 3R0JA 2IKQA 4F7DA 3IQCA 1UT6A 2CMKA 2VP3A 4N3AA 1U2PA 4I1SA 4CF5A 3PJDA 4J1TA 2I3BA 4F5DA 1ZD4A 4MSUA 3F3MA 2DR2A 2YASA 4BY9E 3X1JA 2X0KA 1QH8A 5EJEA 1X2EA 3TSOA 5KTRA 1PG2A 3JYYA 2NZJA 2L42A 3TTSA 2HF8A 3C7TA 2F8TA 1I7DA 2JCVA 4ZYTA 2BI8A 3OO0A 2D7CA 1RWMA 4W1SA 3T1QA 2C4UA 1E0SA 4O63O 1U8CB 1CS4C 3QEKA 4NBTA 3C45A 1X1QA 5JQGB 3KZVA 2M64A 2GZ2A 3TCXB 3V3TA 1B0ZA 1NN5A 1O96B 3I04M 2IA5A 3RI3A 1U28A 3C5HA 3B48A 3OZVA 2P4UA 2VQSA 1KYXA 4ZU1X 2OFOA 5A03A 1KU0A 5IDQA 1VHQA 4X45A 3QV2A 3GGGA 5IDYA 521PA 1CQIB 1GKLA 2ZAOA 3TLGB 1PGNA 5DEIA 4PYKA 4FT2A 1WSBA 4JVSB 3FPJA 1U6JA 1WY7A 4AFNA 2H7CA 3VYWA 3B9PA 5L9AA 4MV0A 3V4RA 3DZFA 4DLXA 1H2HA 1JIIA 4BU0A 1JS1X 5JAQA 1CZNA 1A5TA 4KH1A 4B7XA 4NBVA 4N3BA 2CLOB 3WGQA 1XNJA 1XZFA 3IMEA 3LIIA 3ND9A 5JCOA 3L8FA 1BBHA 1GP2A 1KAOA 4ALLA 1PNTA 4HDOB 1JQ5A 4I55F 1ZS9A 1IBLB 1NI4A 3L18A 3L79A 3NDPA 2BELA 4CDMA 3CT6A 2J6HA 2Q6VA 1YS9A 3S90A 4Q3CA 4OHYA 1PR3A 2LBPA 3VKFA 2R25B 1KNYA 1TM7E 3GN1A 3IL2A 3CA8A 4Z8YA 4ZCRA 1XL0A 1F5NA 3A10A 1W47A 1E18A 2DBYA 2UXDB 4EPWA 1H3EA 1R8XA 3A6ZA 3MFNA 1NQOA 4HMPA 1C1YA 3H1BA 3MYRA 4LWOA 3G0DA 1FP4A 3DMPA 2AEEA 2CYBA 2ONKA 3D6NB 4N9WA 4G0YA 1IZ8A 4URYR 5JD4A 3DDHA 1NU9C 2AJ8A 3LQFA 4IO1A 1A0BA 3C6MA 2X6QA 1B73A 3UQYS 1I2AA 2QBYA 2F3PA 2NO9A 3QEOA 3RKOF 1YFKA 4HZIA 2W0MA 1NSGB 2Z1DA 5EAIA 4D98A 3VZSA 4KC0A 1DKQA 4K8RB 5SYAA 4U3JB 2PGIA 4N40A 3T34A 3OY7A 5DNWA 1G8PA 5CYGA 2QVGA 1N1GA 2GD0A 4ZQIA 3TO5A 1T9GR 1AZTA 2D2FA 3OTWA 2ZRLA 1AQ6A 2FWRA 5NULA 1Q0ZA 4MYHA 4KYIB 5K0ZA 2JVIA 4KCGA 2QHXA 1S05A 1EZ4A 2GM3A 3OWXA 3MWDB 1HPLA 1XVLA 2G5TA 1EVKA 4CMEA 1CQPA 4LHZA 1P77A 1VC2A 3AFMA 5JS1A 3QBDA 5AW6A 3P2OA 4J03A 1K5HA 1ULUA 1XL1A 1XTTA 4G0OA 4AD8A 2VJAA 4Q9AA 2Z5GA 4MRAA 3B0VC 3AVWA 1QVVA 5KQMA 3G2NA 1GQ2A 4HAOA 5TC4A 2G17A 2E82A 3M5WA 5B36A 1GILA 2N75A 2B9VA 3FIUA 1QHFA 1AUPA 3L46A 3GROA 1CUXA 4QULA 3EZHA 3DDSA 2NUAB 3AR8A 4U9EA 4IEFB 3D1JA 4FFDA 3B1YA 1IBSA 1KWGA 4XYMA 1QRAA 4EBJA 3HKBA 1CVIA 3MA0A 3PNMA 4TL6A 5IJ9B 4C3BA 4QUEA 3NBMA 1HEIA 1CRPA 5KJFA 1M2NA 2HPAA 3GRUA 2PGNA 2A2ZA 3HYRA 2G88A 4HV4A 4JJGA 3H13A 1AS3A 4HOYA 1DAPA 3EG9A 1MF7A 2X0EA 3IJ5A 3QVOA 4ZKEA 4EA7A 4M4SA 5AJYA 3RRZA 1ES9A 4R7GA 1YQQA 1RE1A 3Q7GA 2O59A 4KQ1A 4ZVQA 5FO0A 1EKXA 1Y80A 1CUIA 2OV4A 1H4VB 1TLLA 3UA3A 1P7PA 2WSYB 4KIWA 3BMNB 4XD7A 4YRZA 4MUJA 1FFSA 1M6NA 3R3JA 3JVVA 3Q72A 4DLAA 2G40A 2W7TA 4Y6RA 2NQ2C 5JCPA 1NUTA 4AY4A 3Q3EA 4IUBS 1BE0A 4NFHA 4Z3KA 4X3OA 4U7JA 1T2FA 1RXEA 3ORFA 4B6JA 2YX1A 1JI0A 4HQRA 5AOVA 2VSQA 3ZCVA 1JAIA 4PFKA 3R09A 1ENOA 2WJIA 1QGZA 5LMNB 4BQFA 1E62A 2QPTA 1XDWA 3PL5A 5ENVA 4HPJB 4HNSA 3TVTA 3I5XA 1PQWA 1TM4E 3TD6A 3V5YA 4R16A 5D86A 1A5BB 1MX3A 4MPDA 2QIOA 3NFYA 3O82A 1RPAA 3U3OA 2JAQA 2XF8A 4AMGA 4TWRA 2SKDA 1JHAA 2VSOA 1WF6A 3W5IA 4XFKA 1CYEA 3SHVA 3W34A 2KBFA 2R7QA 1YS1X 3HV0A 5DN6A 3A0UA 1GNPA 2M6RA 5BRNA 4YK5A 3US6A 3K53A 1P5JA 4MVZA 4OY3A 4R2KA 3GGSA 3DE1X 1QQ6A 4URVR 4HH1A 3W1EA 2ZXFA 4F3KA 4QM7A 5FPTA 4I5DA 3EODA 4G0UA 3KOZA 2KSFA 4COOA 1UM9B 4IDPA 2BFEA 1Z6AA 1QR2A 4MW7A 1A8HA 1U3CA 2XW6A 1MNAA 1T5IA 3AP2A 3UWPA 3RDPA 2OFXA 4YJFA 3VYRB 3UAYA 1P3JA 3BZUA 4M8LA 4MJ3A 1ZU5A 1PTJA 3QY9A 2Q6KA 1KFEB 1ZEMA 3OFSA 4WW0A 2PT6A 4Q19A 4RVHA 1IUPA 3BQMB 2HB6A 4M89A 3NHBA 3UAOA 2MYNA 1OLUA 3DZAA 4IY1A 4IGIA 4A2CA 3PD7A 3K1YA 3PDCA 2CLKB 1J09A 2D1FA 3VX3A 3R5XA 1RWKA 3OJ0A 2ZFUA 4J9UE 3ZNNA 1L4LA 3DDWA 1AQJA 3LK6A 4CDGA 2I4NA 3F5SA 2WK1A 3VDMA 2J5XA 2VTEA 3LPCA 4QVIA 5F9HA 2G72A 3TL3A 4D1YA 3FYUB 4JJ4A 3M4ZA 5KYUA 2VOJA 2WTBA 3O3NB 2CW5A 5B1IA 2CVPA 1Y7IA 4IOKA 3L9XA 4ZAYA 3WWPA 1P9LA 1LUAA 3ZZ0A 3INRA 1J90A 4LJ5A 4J0CA 3OPNA 1TIKA 1MAAA 1ZD3A 1Q0PA 3V1UA 2DMRA 4RETA 2WG2A 5JHHB 5ILOA 1WZCA 3AYZB 5JPDA 2ZAIA 1ZNZA 5KYGA 1IEQA 2GPAA 1S1CA 2FZGA 5LP6F 4ZGWA 4D4MA 4C1NA 3AB7A 4XGRA 2VTBB 2QM8A 4RELA 2HV6A 2G7MC 3EXFB 1Z73A 1QYCA 2YMQA 4IIYA 4RF4A 3RTAA 4PG6A 2LDXA 3QTBA 3PHBE 2X5KO 4JYPA 1Q57A 2UYQA 2NNLD 1SF8A 3BB3A 3FA2A 3MN1A 2ISQA 2H4ZA 2VNJA 3GDOA 4M0DA 2DULA 1P5RA 1R5JA 1G4AE 3FOOA 2I78A 5KU1A 2OOCA 3ZWQA 1BMFD 5JJIA 2DBVO 5REQB 3I5QA 1YGPA 4IV8A 2A6PA 5DHPA 2GESA 5CB4A 1RAEA 2G9NA 4MYRA 2D5LA 2WJ6A 5ALPA 4G2TA 2QVLA 2K6GA 3V7WA 2YV4A 4HEJA 1YQUA 1R9JA 1YA6A 2JHAA 3ZJYA 4TWIA 4UZSA 4Q7MB 3H2ZA 2F1JA 2LIVA 3ZCQA 5CI9A 2ORVA 3LJBA 2OXEA 3EXHC 3IKJA 1PVOA 2QTWB 5ADVA 4ZEVA 2YS6A 5C5IA 1ICEA 1TZCA 4KIJA 1ENPA 3TW0A 5JS6A 1RXVA 3PQEA 5LXTA 1E3DA 2VG8A 3AW9A 3HZZA 5KJCA 2BE5F 3O9ZA 3JQGB 3IHUA 5ABPA 2GLUA 3CCFA 4DLKA 3CLHA 4TKVB 2A5FA 4XJVA 5SY4A 3RW9A 4PCUA 2BN4A 4XSHA 3EAQA 1VLTA 1WDWB 3C3DA 3BOSA 5FL7A 1FXUA 2D8AA 3WKAA 2CBZA 1FVHA 5C2JB 1YR7A 1G291 1R5BA 2BI4A 3HKCB 1RXWA 5KX5A 3WVNA 2SKEA 2A5YB 4DJTA 1VRVA 2RGXA 1G5HA 1XD2A 2O9XA 2H3HA 4Z0HO 3LWDA 1T6YA 4C0KA 3RS0A 4P3KA 2FSPA 2WTNA 1AHHA 3ITDA 3RWBA 3DD5A 3BH6A 4XARA 4LQDA 1NYTA 1YZNA 5IFLA 5EWLA 3F8WA 1PE0A 3ZIDA 2DYSC 3RVMA 3BRSA 3LH5A 2O0HA 3UK2A 3VFDA 1VIMA 1EK1A 5IT5A 3DMGA 4G7ZF 2I4LA 2YQYA 1ZYRF 1HDCA 1YB4A 2LFDA 2YVAA 5EJ8A 1F8FA 3QKRB 2VWHA 3CH6A 2ZR0A 1Q3KA 3JQQA 4DAEA 4DIKA 2FEPA 4OQ4A 4NU0A 4P84A 3K20A 1XXHB 1CJSA 4BGVA 1DCTA 3LM8A 2QQFA 4S1NA 4HTAA 1HDYA 3AEQA 4FR0A 4YUAA 5KJ1A 1MN6A 4H0NA 4NCAA 4HNTA 6CHYA 3UFBA 5TF0A 5EHNA 5IZCA 2XAAA 5JJBA 2BFAA 5ALOA 1OHHA 4N76A 2XB9A 3UH1A 1N2XA 5AJVB 5JDCA 1LE4A 2G4VA 4BL5A 4DLUA 2HZ8A 1GAJA 4GRDA 4LGCA 2LXNA 4NBKA 3WQHA 3TH5A 1NOIA 4A6DA 5JQWA 4JP3A 5GGXA 1K86A 1W1UA 1QTRA 3NGXA 5JI2E 1GNRA 1FSFA 3TZKA 3P9ZA 1QG6A 3EWIA 4L5JA 5KWVA 1YC5A 1G8MA 4LJKA 4XIFA 1WSAA 2CV2A 1XPUA 5IN4A 1RZVA 4YTEA 1U80A 2IYOA 1HNZB 2L17A 2VDLB 4WFKA 4G0NA 3OWTA 2GPYA 3X44A 5AI4A 1RJFA 2P6VA 5THKA 2HKVA 1Y3DE 3K6KA 2M1XA 1KAHA 1Q3TA 2A6HF 5I8ZA 3KV1A 1FA9A 1XQWA 1Z08A 2ZSKA 1XPJA 2H7XA 1BN7A 4OHPA 1GPKA 4P98A 4BYGA 3C3KA 1XTZA 4CTOA 2ZJ6A 2C5LA 4ESHA 5HF5A 1WXGA 1HEYA 1R18A 5EMMA 4CMGA 4FD3A 2QSUA 4K9OA 1VL6A 1TGVA 3T35A 2CLEB 5HQTA 4AZ0A 4Q9LA 3PPIA 5B3IA 2UZ3A 4JI0B 2OQ2A 1TVEA 2O8BA 1WCXA 1V95A 4JYCA 4CL3A 1L7DA 4GEGA 4R2LA 4HC4A 3GFOA 1OGYA 1PJQA 2MSEB 3I3SR 3DT8A 3S2YA 1FFAA 3BGSA 2H2DA 4JKYA 4PWYA 3FR8A 3R7FA 2OOSA 4GLFA 3HNKA 3FXAA 4S12A 3TCKA 1KQNA 3AB8A 3EZXA 4PLCA 4R9RA 3LSTA 3L8CA 4H7KA 2C99A 3ABKC 5CVUA 1NL3A 1HUQA 3DE3X 5EE9A 4OOFA 1RRKA 1U7XA 5LZ7A 4WASA 3GJYA 2PIDA 1JIJA 2FUNB 1PW5A 2Z57A 4C4SA 1PAUA 4CCAA 1DKUA 4IDFA 3LT1A 4KLZA 4NZZA 3TPFA 1TK3A 4WKNA 3IQ6A 1CS0B 2QLBA 4MJLA 4ZYYA 1L7MA 4R3UC 3U49A 5GONB 1E1YA 1EXNA 2ZAYA 4M54A 3K9QO 4BX8A 3HJRA 2W6ZA 5K0IA 1Q22A 2P9FA 4G97A 5D51S 2ORWA 3IUMA 1JTVA 2IL1A 3T0GA 4G89A 3B1XA 3LHIA 3VR4A 4ABTA 3EOBI 5KYYB 3QU2A 4AG5A 3PC3A 1DG9A 1AKTA 2B83A 3AHIA 3UYLA 1PGOA 1W19A 3KPHA 1MGPA 2X5JO 2FW7A 3W2VA 2VCBA 4N12A 5ADHA 2WM3A 3F78A 3IILA 3R1IA 1PZEA 4JB2A 1PYGA 1HSZA 5JOQA 3RNOA 3TTYA 1IB0A 4HJRA 1GGEA 4XX0B 4TTRA 1ZC4A 1DUIA 2PS0A 2OBBA 1Z26A 4KAFA 4TSFD 4D3DA 1JAHA 3OZCA 5B7PA 1SK9A 3HKKA 5KVQA 4XIYA 3O3CA 2ZPAA 3EXG1 3MX3A 4QU8A 5GV7A 3DPIA 4ZARA 5IAKA 5HIJA 1RMQA 4XWKA 1N6OA 2JGRA 2I2DA 4V2UA 2FUKA 1IU9A 1GTJ1 5AJWA 4N5IX 1EG7A 2IDZA 2FR1A 3V1NA 3WICA 4BKQA 1NIPA 5HX7A 1XF9A 1B6SA 4MPRA 1YB2A 1RMTA 1RYYA 4HVLA 2ZXUA 1R4ZA 4CKWA 4PR9A 2XLDA 2FZVA 1JIKA 1VQ1A 1KOJA 1YDGA 2ACEA 3QH4A 5JRJA 1GFSA 1CF2O 4DSUA 3NMKA 3GPCA 1PYOA 1Q7RA 2XMSA 1Z7WA 1JKJB 3PNKA 5B3SC 1E59A 3TAHA 1B3BA 2VDPB 1QKIA 3G5LA 2Z5FA 4AQ7A 3MXOA 5HGXA 1RAHA 3IEMA 3BF8A 2YY5A 3TLJA 2ABWA 3L1HA 4N06A 4NICA 5K0BA 5TV2A 3T3EA 2ZSFA 4BX0A 1M66A 3KDSE 4TYNA 1C3EA 4G9GA 3GEGA 3PE4A 4ZGBA 3KSAC 4NEGA 4RD2A 4HK4A 3QU5A 4S35A 3N39C 4JVNA 3D2CA 2R1UA 4JJKA 4YP9A 1XMSA 5DM70 1A9YA 3A4VA 3FETA 1GSAA 2ZWMA 1W0KA 1ZM4A 4A5SA 1KQPA 3MJCA 5H1YA 4KPFC 4DA4A 4IRUA 1V9SA 3DDNA 1NW7A 3NYWA 3FBGA 1EFKA 3PNYA 1W5EA 4IXDA 2PRIA 2ID9A 4QGHA 1JN0A 4K1LA 4DADA 4WBNF 2AFVA 2FR8A 1QK4A 4M9CA 1E3WB 3K1ZA 4EPRA 4RXTA 5TT0A 4P5PA 3VSAA 2F8MA 5CCBA 2HFJA 2XUQA 1TMKA 1Z2CA 2ZVQX 1M1YB 3N5CA 1Q2XA 2DUMA 1FYFA 2VBIA 4KKXB 4A2QA 1NMQA 1V5EA 2BRUA 2H9AA 2R8XA 4BECA 3FNBA 1C4WA 3TRKA 3D8NA 5K0GA 1H1DA 4WT7A 3DEKA 3ZKAA 2RHBA 3BFVA 3CXRA 4P53A 1WP4A 4P34A 4Y98A 2BUCA 2NYUA 3DXZA 4X20B 3RSFA 3AGUA 4TXJA 4G23A 2L81A 3IO3A 2IU4A 4KDFA 4IDEA 4MXDA 2Z4SA 1E1QA 4ZVUA 5BR8B 1US8B 2O3TA 3WYAA 4F11A 3I2FA 3K30A 5K2MA 1HA3A 2DLCX 1LQUA 4YUVA 3BDVA 3EC1A 1EDOA 4LY0A 4C7OA 4BVAA 2A1TS 4TL7A 4ZRMA 4LGMA 1QHXA 3VU1A 1P0IA 4AN0A 1JWBB 1XV5A 2I6TA 4UBKA 1Y8RA 3WHKA 4ULWA 2ZXOA 4IVRA 1EDDA 3UHAA 4Y2XA 3RIEA 3ZV6A 4F71A 2OECA 1M57C 1N1CA 1NAIA 1Z47A 4FGKA 1PR0A 1G20B 1MQVA 3QXXA 2VJKA 2BTOA 5TY0A 2OZEA 4YQFA 5JJ5A 3GX1A 4CN9A 1SQSA 2I6UA 4UU8A 1VIVA 2JLUA 2P2NA 3UAGA 1YL7A 3CUKA 3TLBA 3LVBA 4BUZA 1CF4A 3QI2A 2G67A 3CISA 4FUQA 4A26A 1KJIA 2NVWA 3E03A 2WSBA 1IHPA 1QONA 4C76A 4DCUA 1RM0A 2KNHA 1N5LA 1QMGA 1R0BA 3STUA 1FNNA 1QVWA 4XTKA 4O4JF 4XIJA 4MVMA 1MH1A 3KQSA 5KDOA 1R0RE 4Q4AA 3W7AA 2CJXA 2X77A 1MRNA 3A6GA 4BNLA 3JYNA 2AKYA 3LX8A 4IWXA 1UC9A 4F92B 4D9CA 5AHRA 3WLJA 2NU9B 3IQTA 4DGQA 2J30A 2WHXA 4ANJA 1UDCA 3PHCA 5DRTA 5FZTA 3FVTA 1WXDA 4XGNA 4GPZA 1E20A 1C9EA 1M1YE 4B6EA 1P2UA 4ETNA 2ZUDA 3P9SA 1A9PA 1N5IA 3CE9A 1M2KA 2VRCD 1AM4D 4UFOA 1K6IA 1SCDA 4BVGA 4QBGB 3ETEA 4I9GA 5GADl 1JG6A 3C3BA 1EYZA 5FEMA 5I5EA 4TLMB 3DV0B 1F12A 4IFIA 3TOCA 3V9PA 5D2CA 2DPMA 3EQ6A 1EJ6A 1U0OC 2MINA 2I33A 1DRUA 4XGKA 4X7MA 4YCJA 2ZYWX 2P9QA 1JILA 4AC9A 4KQFA 4UUOA 3KZ1E 5IT4A 1OC4A 1RYEA 3KAPA 2EPOA 4ARSA 3M5CA 4TLAA 2H8AA 5LZ2A 5CFNA 3LBFA 2BIFA 1KF0A 4MS1A 4Q3NA 1NFFA 2DYRC 3FSRA 3QVJA 3WMXA 3EF1A 2IXBA 3WIBA 1AGXA 2J7PA 2ST1A 2ZSIA 3U31A 4BFYA 1GL6A 3D6JA 1D0IA 1M74A 1H0SA 1LBHA 5JPCA 1SU4A 1TMYA 3HPQA 1V9LA 5AW1A 2GSDA 2CXTA 4DV0B 4JT2A 3T4RA 1G20E 3T4PA 3A3OA 3TZBA 4TS4A 5EJFA 2YMPA 1SHZA 2JGIA 1YDEA 4BEBA 4GWGA 3RS5A 5KNCA 4XUDA 1JFFB 3PDIB 2YJZA 2NVUB 3AINA 4JZAA 5EIWA 3L1VA 2MU1A 4RTKA 1UT8A 3QEMA 2DGDA 4IGEA 3R5JA 3O4GA 5LL6P 3NTXA 3DP7A 3N2KA 1V1JA 1OI4A 2D7JA 3RYFB 3SNHA 4AKGA 1BHQ1 2DC1A 2WM9B 3OWOA 5JH7A 5JMPA 2XLVA 1VKHA 2EFCB 2JIQA 4N0PA 1LFAA 2QYSA 4LWPA 1UMBA 1R6TA 4Q7QA 3I5YA 3LG2A 3OZEA 5K20A 3Q0IA 4E94A 2ZS9A 1DC6A 4E30A 5F35A 2WUFA 3TX6A 2X4IA 4MUXA 1E1MA 1V2HE 1P2BA 2QTFA 4NNJA 1EGAA 2WHQA 5JZMA 1JYSA 3AF5A 2YZKA 4EOGA 5IJZA 3GZ4A 4O4HB 1EFRD 2H7YA 3AEXA 1RXCA 1M8PA 4LY9A 4B8YA 4CTNA 1VGQA 3SQLA 1FLNA 1FY2A 4R1PA 5EUMA 3BIFA 2XMRA 4P4SA 3LKZA 1U5CA 4YV0A 3AP3A 2H8GA 3N8NA 3KYDA 4TYYA 1I4WA 3NETA 1Z28A 1NPDA 2JC3A 4B7AA 1WCWA 1MQ9A 3I32A 1KL7A 1RSZA 4G0PA 1NVXQ 4TLLB 3GWLA 1U3GA 4PQRA 2HA5A 3M5PA 3LUCA 3EZFA 1F4VA 5EZ6B 1KMCA 3QWAA 2X0CA 3MWEA 1UBKS 2PZEA 2HRRA 3N76A 3IR6A 2VYNA 4IUYA 3VPSA 4UBNA 4RV9A 4DA8A 1T10A 2ZJ5A 4G25A 2WIAA 2LNDA 4CCSA 1KGDA 1D6JA 3RK4A 3L6UA 4H15A 4HYQA 1I6KA 3L0PA 3ZTZA 1QK5A 5I01A 3GC6A 4KMRA 1W88B 3IXLA 2I4RA 2IZ5A 1B41A 2MSWA 4HDMB 2VP6A 2DKNA 4PQEA 4BRWA 2GHRA 1Q20A 2RC6A 2VF7A 4U5FE 3BX1A 1QKRA 4MW8A 5HMMA 3DMTC 3DLPX 2P1AA 1FVFA 3T7CA 3T61A 1QIEA 2I6FA 3HRIA 3FMSA 5ICGA 1GEGA 4XTRA 1DELA 1JQKA 2B5VA 3PC8C 4UUBA 2UVPA 4MCHA 2WG1A 1PJRA 3QKWA 2B3TA 3I8SA 3A9TA 1P2FA 2V9PA 2OLEA 1A3CA 4Y9UA 3EOAI 1XDSA 1QPGA 1UODA 4CBEA 1RBMA 5ITZB 2II6A 4RK5A 1Y6FA 3JD2A 1F0YA 3NATA 2FN9A 1Z88A 2FSFA 1QIJA 1GITA 4UHEA 4QPJC 2Q3EA 1GXSA 2KSQA 2AXPA 2HIGA 1NVWQ 4Z6KA 3DDOA 1AO3A 2DY0A 4Z3OA 5F4ZA 4F2GA 1XFAA 1XWJA 3SM3A 1OT3A 1SG6A 2HNBA 2C58A 3D4PA 4LAFA 5K4AA 1ULBA 3BB4A 5BYJA 3M6AA 4CNQA 4G4SP 2PLNA 1WLSA 1TCCA 4Y2GA 2IYPA 1YHZA 3ZE9A 1AMOA 4TS1A 1EWTA 4F21A 1CJKC 1C9NA 3RVQA 3CIOA 3DZBA 4C6HA 4CUZA 3GODA 1Q14A 1Q19A 3THOA 1H8HD 2ONYA 4HQFA 3ILYA 1KPGA 1L4HA 3ESRA 4H3SA 3CZCA 5AI6A 1QCZA 1NJ1A 3MTDA 3GJQA 4KVZA 3DAHA 4CM4B 4OHUA 4YREA 1ISJA 4IJWA 2AWOA 1ZRMA 1C14A 2PL1A 4BO9A 5TVKA 1ZKMA 2QRQA 4O4IF 1MG0A 3GY0A 3T6BA 2ATEA 4AJ4A 3EXEA 1W6RA 1UKEA 5H16A 2Y3DA 1W85A 1XFDA 2A7QA 4OK6A 1UIMA 3VVMA 3MMNA 3LHSA 1V96A 2HMQA 1IXSB 1ZP6A 2FSUA 1EWRA 4WVFA 5EOVA 2VF2A 1EP2B 3UT0A 4D42A 4QI2A 4D6PA 4UTRA 2W4IA 5FPQA 1G63A 1MO2A 1F14A 3U9LA 1FXSA 3REFA 4ER0A 3IIKA 1Z2OX 3P0FA 2IU0A 8ABPA 5FD8A 1GPDG 4EUNA 2WU4A 3C98A 2OHXA 4MEJA 2XUDA 2P68A 4L0QA 4P22A 5A9SB 3GUYA 1NOKA 1RRCA 1ZNWA 1PR5A 3F7OA 3D8RA 4YRMA 3HNRA 1EBBA 2PRKA 2M6LA 3JX9A 3T1HB 3FTCA 1YMUA 2OJQA 4MQUA 4B40A 1MIHA 2FR0A 4DG8A 2XQIA 1R64A 2H7BA 2Q3CA 1B93A 2IUEA 4MRRA 3MINB 4KFSA 4QA9A 5INTA 2RSLA 4KYVA 4I55B 4IMIB 5U4QA 1WM1A 5IC6A 4E4YA 1YZFA 2GJ8A 2HU2A 4NYJR 1VTMP 1A27A 5HWSA 2NV2B 3EN0A 3GVCA 4WEOA 3TR5A 1DDOA 3VR6A 3MPOA 1L4NA 1TUEA 3E2PA 5JANA 1NU7D 3DJYA 5FL3A 4CFZA 1H8EA 2FPSA 4CL8A 5DOZA 1X6VA 2VT3A 3BD9A 5DGXA 3T5PA 1PZGA 2JX0A 2FKNA 2WB2A 5CAEB 1KSHA 2JI6A 1U3UA 1N8TA 2R7LA 4OIOF 4EA8A 2X0NA 1TECE 3GA0A 4UXIA 5JAZA 1QVAA 2GD6A 2GAFA 1ZGJA 5BRAA 3HYTA 2XMBA 1EQ2A 3SPXA 2A0FA 1E5QA 1JXOA 3DT6A 5ITVA 3SIRA 2X1MA 2Y1DA 4PN7A 3KEFA 3AZOA 1N6NA 4CKEA 3QMPA 3CZ4A 1ONSA 2CL5A 1L6RA 2ZUBA 4RMHA 2RD9A 4PAQA 3UATA 3G13A 3HMKA 3OVMA 1ZI8A 1SYQA 2DWCA 4PYLA 4BBJA 4IIFA 1L9KA 4FVTA 4YXWD 2VPTA 3N6XA 4O8ZA 4MRPA 3ESYA 4XLTA 3M81A 3MAJA 2PKQO 1SUSA 5DHQA 3B5EA 3UK0A 4D6YA 4UBLA 1QOPB 4IIBA 5BSRA 1MDBA 1JAFA 1Y3FE 1A7UA 1OCZC 3OBBA 1JJIA 2FX3A 4WCFB 4DCCA 3TLCA 3COZA 1EX6A 2ZXWC 5AKYA 4WJKB 3UHJA 4KQJA 1QSGA 3M1IA 1RBZA 3MOSA 2ZRCA 4CL2A 5J4VA 2O4UX 4IKOA 1VCOA 3E1SA 4M76B 3SMVA 2WT4A 1S0UA 3OQMA 1R6AA 1KBQA 3LNTA 2J5RA 2ZI6A 5I4BA 2EL9A 3V4LA 5A1TA 4I1IA 1I6MA 4M1QA 4HG2A 1W0JD 1KEZA 2VQEB 4V1CB 3IV6A 1XCLA 2PAFA 1ZCFA 2B1QA 1N6IA 1L7RA 2QENA 1HT2E 3WRYA 4CZ2A 4NBSA 2VWPA 2QQEA 2VPXA 3RAEC 1LRLA 1JJFA 4EYGA 4A0FA 1Z5NA 4QDJA 1Z13A 4YWJA 5MDHA 3LQQA 4LTMA 1KI2A 2Y1EA 3PUHA 1LPBB 1FDWA 2OZKA 1LXCA 1FMLA 2DKFA 2FW6A 3FNIA 3NOXA 2JAUA 4FXPA 3AUTA 2A5GA 3HP7A 5D85A 1SPXA 3ZXIA 1W4BA 5JQGA 3HUDA 1UKBA 3WWOA 4WNAB 4NNPA 1CZRA 4IYJA 4GX2A 2D13A 3EUEA 4N6NA 1O96A 1UJ2A 2PUCA 3QFTA 1VMEA 1B8VA 3LAWA 2J3LA 1IZ7A 3HI4A 5BVGB 1EQUA 2FSHA 3AFIA 1E5TA 1N5JA 3EVNA 2AK3A 2ODEA 4DIFA 1EBFA 2JA1A 1H93A 2SECE 1VL0A 5AWFC 1CQIA 1U8TA 3RQFA 3TLGA 5DTRA 2ANBA 3E2IA 4UUMA 2WF9A 1E1CB 1NVGA 4J7CA 4X6YA 1E2BA 1P9NA 5DH9A 1OASA 3OUUA 3QWIA 5KNDD 4P3OA 5HBGA 2Q4RA 2E4YA 4CODB 5G0TA 3JV7A 1KO7A 1RC8A 3DL7A 1CUDA 2I2BA 5DHSA 1DU4A 3WIVA 5HRCA 5JROA 3V55A 5AVYA 2GXAA 2ZYGA 5DCUA 5EL0A 4N8EA 3OX3A 3HYSA 4N3CA 4ZI2A 2R25A 3M9WA 4XB6B 5JE8A 1XZLA 2ERCA 3E84A 4EH1A 3I6MA 2PZAA 1BVYF 4QXPA 4N4AA 4D82A 4M9SA 3DF9A 3ANNA 4G5GA 1ZIXA 2PJUA 2WD8A 1AKWA 2WB7A 3EZ9A 2HSZA 4PZ0A 1YSCA 1G5ZA 3TSWA 4NYMR 2BC9A 3EYAA 5J4KA 4CMCA 3M6LA 3F9IA 4KBYA 4L6CA 4N0EA 3VV2A 4G4JA 2WWIA 4U3JA 1A2QA 3E18A 5SY6A 4PZCA 3WA6A 1GYQA 3D8BA 2C5GA 2AWYA 4X0EA 3H65A 3AR4A 4PWZA 3DZDA 2XRFA 2GPTA 2W4MA 2HNKA 4S0ZA 4RHTA 3GJ8A 4ZA2A 3ROEA 4JBXA 3PVCA 1LK7A 3MWDA 4HYEA 1S8AA 3DI5A 3BB1A 3I2KA 1IZYA 2REQB 3DL2A 1YE8A 1XRNA 2JFBA 1RNLA 2FCAA 1P18A 3GYGA 1WG8A 2QMQA 2JIOA 3A9VA 4BCBA 2KE5A 5KOJB 3E9EA 4LE1A 3GBVA 3N7AA 3GT7A 1LSOA 4O79A 3MJVA 4ILEA 2YXPX 3BRWA 4OHKA 2IITA 3SJUA 1AB5A 2WVHA 4J7YA 4R2IA 1AQYA 4KAXA 2CJPA 2B8TA 4GBMA 4DEYA 3P2JA 3L7MA 1C0PA 1VTKA 5LP6B 3BA6A 1PFGA 1USVA 4ZYVA 2PV7A 3QM1A 2NUAA 3GOQA 5A0TA 1Z6TA 1ZIPA 2WPNA 5IJ9A 1C2TA 1DGQA 5CJ2A 4TLDA 2VJCA 2ZZKA 1OTXA 2XTAA 1L1RA 1E9SA 3PSHA 1SRRA 2AOXA 2B8JA 3N07A 3DFIA 4EATA 4CX9A 1I4OA 4LRTB 3JZ0A 5IVHA 3CF6R 3ZWOA 4TKMA 1DT5A 3WOVA 4K3UA 4CQMD 2GR9A 4KDRA 4GQAA 3ETCA 1G5QA 3PE3A 1RCTE 4BC1A 4CSAA 3FKSA 3BTOA 3USCS 4BNKA 4KUGA 3OQVA 4MHOA 2VCAA 1FP1D 2BZ1A 3ENQA 1C81A 3BMNA 5GJCA 4L76A 5AVTA 2R7SA 5K3BA 2V45A 2REXB 2IUYA 3K9FC 2FOIA 1RDFA 2BFFB 2FLVA 3DE2X 4FFVA 5CFLA 3E4CA 2FEXA 3M15A 4JR1A 4BQSA 3J7AC 1I5OA 1ZM9A 5AVRA 5ERYA 3IOCA 3LY5A 4JC5A 1P2GA 1ZK1A 4KOEC 1XDBA 3ZWPA 3ILSA 1FQOA 1ZD1A 5T6BA 4Y6GB 4ZKDA 5DRYA 4JOQA 1DAMA 1X8XA 4P92A 1A72A 4I81A 3T54A 2O8CB 4MWGA 4TQAA 4YGXB 3VGJA 3M9XA 3NTVA 2Y0CA 4P3YA 1HDRA 4EEXA 3ZHVA 1FTQA 1TUGA 1V3TA 4JYZA 4UATA 3DC2A 4QYWA 5GZ3A 4BDSA 4E5VA 3WL6A 2KS6A 1KYZA 5L8VA 2F90A 4HX2A 2OBXA 4B46A 2F4NA 1C8VB 5COBA 1L5YA 4P7GA 3ZWXA 1UFQA 1O7JA 1JNYA 2W11A 5L0HA 2I55A 1BCRA 1L8QA 1A71A 1DO2A 1UM9A 3I9JA 1NFOA 1CPRA 1UANA 3OFND 3UJ3X 3F8SA 5CVEA 4HQOA 4ZT4A 2NSLA 2R03A 4CIHA 1DOWA 2A92A 3JQCA 1E4OA 2VNAA 2J07A 3RGGA 3FPKA 3S3TA 3LDAA 1QYRA 5KREA 3MMXA 4YWHA 2ID4A 2INGX 4W9NA 2ZWAA 3K3PA 2HA7A 3C4VA 2QYHA 1U2ZA 1BJTA 3U2LA 2P35A 4LMBA 2O0MA 1H2RS 4M0PA 5LDDC 1F8UA 1BDJB 5GPGB 3TQOA 5G3ZA 3EF3A 3Q40A 1M6TA 4HWKA 1T5LA 1Z8HA 3K2IA 3E7DA 5AXAA 1NNSA 4AP6A 1E60A 4ZI3A 2XNSA 5AKXA 4I99A 3M9LA 3A4TA 3IUEA 3AHEA 3LP8A 2SCUB 2NSDA 3E9NA 3FYUA 2VR1A 3TOMA 2A4MA 1GTMA 3SX2A 2AOUB 4IEEA 5AQEA 3U0BA 4KP7A 4Q9JA 3BRQA 1OFVA 5F76A 1M2EA 1V26A 1VLQA 4PICA 4G7HF 4U2BA 4OUKX 2WM2A 4C20A 5A2GA 3HL0A 2BKEA 2QVXX 2R62A 4EA9A 5H5JA 2IBMA 4WGYA 3WLOA 2I1VB 4E2ZA 4AB1A 1WXHA 1TUBB 2QL5A 2YNMA 4F96A 2B1RA 1WETA 2VQDA 1P1RA 1YOBA 1OXUA 4NTBA 3NMIA 4V0OA 1I36A 2VTBA 3HEMA 2Q1XA 5EE0A 1IZ9A 2FWMX 3NBQA 2EXXA 3EXFA 1Z56C 1YVEI 3DHWC 2CVOA 3L0CA 1SHJA 4DLVA 1ZQ9A 2JBAA 3UJAA 1RRPA 1FYDA 4FDTA 1WKBA 1RQPA 1OH8A 5KI6A 1ZQ1A 4F3TA 2QN7A 3WRXA 1I0IA 4GI2A 4QU0A 3MTBA 4HEQA 3HWWA 2GVZC 4BAZA 4X1OA 2ZRHA 1XVIA 5REQA 4RULA 4X9XA 2GERA 3L6CA 3CF4G 1L4BA 4J30B 2UKDA 3C5EA 1NP6A 3ZY5A 3V2HA 1T3ZA 1BQ3A 4OXYA 5HZGA 2PBFA 1XTJA 4GR9A 4X6XA 1OGIA 1D0YA 3HXMA 4MW9A 3VR3D 1UKAA 4IVNA 1J56A 1OZGA 3IHLA 4GI5A 5LP1A 2AWCA 4LYHA 4JUBA 4S3MA 1J42A 1UDRA 4EM6A 1WUTA 4C0JA 3REQB 1UEIA 2RKWA 4DDHA 4ZOCA 4PVDA 1O54A 1T36B 3QTTA 2Q1SA 4GXQA 2QF7A 3OQBA 3VSBA 3SKVA 2HLPA 5KUTA 3MQFA 2O20A 1Y8QB 3QLUC 3JQGA 1LB1B 4YX9A 3GJRA 1SEVA 4AMZA 5AMXA 4KQIA 2IU6A 1Z15A 1QNFA 1DINA 3KB6A 4TKVA 4W8HA 1VPEA 4TRJA 1TMOA 1R66A 3FSGA 3LOQA 2IYRA 1CY7A 4XOIA 5LQUA 3WGVA 4RKWA 3JSEO 5LKRA 1T5DX 3G7SA 2LCQA 4IZ6A 4YO8A 3S7TA 4INJA 1C0IA 2B8WA 3GIWA 5DNYB 3RRYA 4P1ZA 1EUQA 2XUJA 4EPTA 1U8YA 2XMDA 1MV8A 1SU8A 1J6UA 4V0ME 3HNJA 2AX3A 2P2YA 1OFUX 3IXMA 1E2LA 4TZ0A 2N1MA 4UNRA 5FUWA 5HE9A 1KDPA 1K1EA 3OPMA 1ZMXA 1SZPA 3LOPA 3EAGA 4UE2A 3H8SA 4JV5B 4NV0A 4LV6A 1XTRA 1P19A 2XUGA 4DRXB 4EKNB 2LP4A 3MJDA 3OY2A 3HO8A 3E27A 3T5DA 4X66B 3ZHOA 3GVXA 3AJ8A 1IUNA 1T01A 3OOSA 3QKRA 1MJ5A 3BRJA 2IIPA 3MERA 3TD9A 2AVKA 1OWLA 2E89A 2C4WA 4UQPA 2VAXA 4Y1RB 3KL4A 1IL0A 3BCHA 1WWKA 1SOVA 1XXHA 2QAJA 1A96A 4V38A 2NXNA 3ITNA 3GPLA 3JD1A 4DBVO 3ZCRA 1CB0A 3LAYA 2BF4A 5C37A 2NSFA 4RD6A 5BSVA 3I4LA 3RAPR 3LCRA 3UKOA 4WLOA 3RLFA 2PHZA 2JVJA 3I2HA 1W59A 3QSYA 4RGVA 2WICA 2WSSA 4ZWNA 3S2UA 4PSUA 2XM0A 2JPUA 3TBKA 3F6YA 5DXFA 2HLNA 4G6ZA 2FG6C 3ET5A 3F9CA 1P39A 4PTZA 1VA4A 3KYCB 1E5VA 3HA7A 1NM5A 2PFSA 1WNTA 1ZRSA 5AH0A 4FNOA 3OPYB 2X4DA 1IQPA 1D2MA 1UZAA 2OD2A 4OQLA 1RXYA 2YOFA 4JUDX 1W4LA 4LYAA 2YYAA 3WAQA 3FCAA 3FCSB 2P79A 4PX9A 5TR9A 1G2PA 2PZBA 4RJTA 4XM1A 2ANCA 2OJED 4WFIA 4EB6B 4JC0A 3NLLA 1STOA 1WPXA 2HYDA 2BE7A 2GA8A 2QZJA 2I29A 4BJ1A 4HD8A 4N18A 3BJRA 3ETDA 1NR7A 5BQFA 3LL7A 3NC0C 3F96A 1QX3A 5LM3A 3MLBA 3OF2A 2AG5A 3JS5A 3DD7A 4CHGA 4Q1DA 3JATB 3JWHA 2NIPA 3PNQA 1SUCA 1UAAA 2WE7A 5A2QA 2CHVA 4B74A 5LU8A 2NUTB 1GDHA 5AESA 4QGAA 4QJIA 4YDRA 4DR7B 4KXNA 1Z22A 3H5AA 3H2BA 4C2UA 3ROQA 3C14C 1V3VA 3SX0A 1I6WA 3QUBA 4FEEA 3SN6A 2XT6A 4WBNB 1AE1A 5AVJA 3D54D 1E63A 1EESA 4XWTA 1XROA 4FR5A 2D0DA 4RD9A 3A31A 1JA9A 1W5FA 5FTMA 1PDWA 3OI7A 4AT1A 4BJ5C 1FRZA 3MSXA 1KZYC 2ZUSA 1AIPA 2W00A 4OFWA 3UXYA 2E4WA 2QMOA 4C3VA 1DTWB 4JVLA 1AGRA 5B55A 4D4GA 4X24A 4NARA 1FMJA 1HDZA 3LPDA 1EP3B 3B6KA 5DK6A 4PYMA 3GEEA 3WYEA 3JWIA 1SIWA 3U48A 2Y76A 2Q9AA 3T1TA 2L19A 3TWOA 1DC7A 3IIMA 3EXHB 3D6HA 1IM8A 1Y5RA 1OILA 1WU8A 1CS0A 3I1FA 3GMIA 4L22A 2QA5A 5GONA 2YXDA 3WX0A 2WZQA 5I4KA 1IK4A 1DBWA 4S1PA 3K9CA 5J4YA 4B4VA 5FLXA 4MKZA 4HLUA 2HSGA 4RVCA 3SXKA 4DREA 1BOFA 4R83A 1GG8A 3A3NA 3H6HA 2CZQA 3C8UA 5KYYA 2GF9A 4Q1VA 4B3DA 1PTKA 2BR4A 2P77A 1I5EA 5DNEA 4B2PA 3GFBA 2VPZA 1YJQA 4TTSA 3CUTA 1QIHA 3TZQA 4EYOA 5LZ5A 3PHLA 5EXEA 3B7GA 1UBMS 1HBJA 4TTPA 1VJTA 3SYKA 2JJ1A 4JEHA 5CVJA 3D7RA 1CEQA 1E9BA 3Q0TA 3IT2A 1VIYA 4YMWA 1CBUA 5ECWA 4WMLA 5DLPA 3UB2A 1YRYE 4QSMA 4XX0A 4D3FA 4OL0A 2GF0A 4NU8X 4DB4A 4EFMA 2D00A 2NO5A 5FI1B 3RUIA 4L73A 2VN8A 4D97A 1FNBA 3OCYA 5L7TA 2XVXA 4MV9A 3K0CC 4FEYA 3N8KA 2EZ8A 2QD1A 3A1CA 3GJ7A 1GSIA 2ET6A 3GFSA 5IBCA 1V3QE 4O4JB 4Q37A 3QKSB 1N3YA 2VSFA 3ON5A 3MUOA 3ECSA 1ECJA 3D4BA 3A9UA 4OHFA 5DCLA 4DDTA 5IX8A 4YC7A 4IZHA 3OLQA 1JR4A 3NYIA 3CZ9A 1EPUA 2ZRJA 2FFAA 4OSPA 2DPXA 5D1NA 1ZHTA 3ZY3A 3H4TA 3I62A 1BZ4A 2V0GA 3ETLA 3VOTA 3VBEA 2Y3BA 4QQFA 3WWCA 3ESBA 2ZRPA 2R79A 3OMWA 1VZ3A 1PZNA 2O07A 4RK4A 1QRDA 5M04A 4ZC8A 1JKJA 4YCLA 1RKCA 3S2FA 1NXQA 3BWVA 1K6XA 3STHA 1MCZA 2PLAA 3H42B 3UWKA 1RYMA 2VZLA 1YASA 1EM6A 1HT1E 3TW4A 4W1PA 2FSVC 2XQJA 3DWFA 2NWQA 4PZYA 3B9QA 3DAPA 1R74A 3PFHA 4A7PA 3JVDA 3EUWA 2B82A 1Q2UA 2DFNA 3HCOA 4QBTA 1D4FA 1YDMA 3B1WA 2ZJFA 2Z43A 1QYIA 3NCHA 5AKIA 5T41A 2VDNB 3R8FA 4KN9S 5DSZA 3G0GA 1LX7A 2NPOA 2Q49A 1Y9ZA 4YCSA 1N3LA 2DEUA 4N65A 4Q4JB 2HJ3A 4EJ6A 4QT0A 5DX1A 3DL0A 1JAXA 2WNHA 1NG9A 1FDIA 4MGYR 1QAQA 1M0TA 4LPSA 3K2EA 4BFCA 4F3NA 3R6DA 4GP9A 1T0JB 4PGAA 1QGOA 2BJWA 1IONA 3OQ6A 1EFUA 4C4RA 4EUKB 4Z9AA 5CFOA 1E3WA 4R5MA 3FCXA 1E89A 4KX3A 2AUTA 1DOHA 4EZBA 1Q0LA 2RI0A 4HMQA 4ARIA 1G2OA 2XZTA 3GLFE 1M1YA 4HFMA 2FPGB 3G5TA 1WOLA 4R8RA 4KWHA 4HJXA 2DU8A 1BJKA 4PYQA 2YWDA 3G9TA 3LQ2A 2B5WA 2QDXA 1P60A 2C4MA 3LWZA 1E86A 3U9JA 1M0WA 3I83A 4L4XA 4X20A 1X9GA 5DB4A 1IFXA 2QX6A 3GFPA 1UXIA 1US8A 4PLZA 2HWUA 1RI5A 4M8KA 2VXOA 4GMFA 3KSBC 1H5UA 3G2KA 1O6CA 4NHEA 3LT2A 5AVQA 1IN8A 2Q3HA 3C7CB 1EFCA 3CZ5A 5L0CA 4P4UA 2OFPA 2DUUA 3UJDA 4FGWA 2Y6VA 3G0CA 2XTJA 4JYMA 3UMFA 4BP1A 2OVFA 2AI1A 2BFWA 2GEDA 1E2DA 2CSUA 3C1UA 5T8KC 1IQUA 2GKOA 3IPMO 5TGTA 1G4US 1Z6YA 4B43A 1EVIA 5AHXA 1U9YA 1Y7PA 1LD3A 4MGZR 3WJAA 3DPSA 4L78A 1G20A 5EJ4A 1KVUA 5DMHA 2ZYRA 1WAMA 3R7NA 1UMDB 3TMKA 3ULKA 3U26A 3E23A 1M7GA 1QJCA 2PO7A 3WBKA 1TD1A 1Y1QA 2Y4OA 2QE9A 4L6AA 3TW6A 4JFRA 1QNLA 1SCNE 3C3XA 2OCBA 2QNRA 3I9OA 1X9HA 4IOLA 5HKKD 3I73A 4HAYA 2RJ3A 3ONWA 3KJFA 2YJNA 1B6TA 1U02A 5COQA 4RHYA 4KL8S 4KR0A 1KKLA 4IF4A 4PLYA 4JMLA 1K4MA 3H5NA 4G5FA 3PNBA 3W2FA 5FB3A 4D4IA 5WRFA 1FXWA 4FSHA 3SJAA 3NT4A 3E9CA 3O4VA 2ZBRA 4WOJA 1E2IA 4CKCB 3AU9A 4LECA 2VBCA 1LJUA 3NBXX 1TTPB 1U63A 1CEYA 1YIOA 3PMRA 2I5PO 4K2AA 2ZJBA 3I04A 2W42A 1M1NB 3A05A 3GA7A 1LWOA 4RJLA 4F5WA 4IQGA 1VL1A 4Y9DA 1P9WA 2O7NA 3I2GA 3SY8A 2Y67A 1FSPA 2ZULA 3TB6A 4D4XA 4G0XA 1MO4A 1FP2A 1ADFA 1X8LA 1GQOA 2OGUA 5A3QA 2ACVA 4M0MA 4JI2B 1YC2A 2RAPA 2H4XA 5K99A 4OP2A 1NVVQ 2NAFA 1WMDA 1VSUA 5DGHA 5JNWA 5L3QB 3DV0A 4DIDA 3KLBA 4N7RA 1A9SA 3PEVA 2I3AA 2AR9A 1KXZA 4TROA 1Z68A 1BKDR 3AR6A 3C8DA 1XLTA 5FBZA 3TJZA 5EHXA 3SWWA 3O31A 3ISJA 2YXBA 3RIPA 4IXTA 1TQHA 4UQLA 5DM2A 4S04A 5T3UA 4AIRA 1OOEA 3W3AD 3UH0A 2PA3A 1PX2A 4R4JA 4Q4DA 3GPIA 2HGSA 4MP6A 3EWNA 4XLZA 4JKVA 2CCJA 1DQSA 3MRSA 4O4IB 2LUOA 4DGSA 1LV8A 5B3LA 3ZTTA 5A0VA 1ONNA 4HQNA 1GADO 1PS0A 1AX9A 1DWOA 4V0NA 1E8DA 4ON9A 4Z7NB 1YRHA 1IULA 2Y8EA 4F60A 1LY1A 2I1WA 1JFFA 2IDJA 2P65A 3PDIA 3AJMA 2HBRA 3HUTA 2NVUA 4AZWA 4MA4A 3LRTA 2YC4C 3G8BA 3ZWNA 4M49A 3JRXA 3RYFA 1XTSA 3NORA 4D44A 2UU9B 5CCDA 4Q9DA 2VNIA 1JE0A 5LUBA 3RODA 1GTRA 1BNCA 1W4AA 1DHRA 4D9MA 2IPXA 3KH2A 1Z4NA 1JFSA 5KSOA 1Y63A 3SDSA 5BN3B 2PDAA 3QIAA 1T8SA 5BUSA 2VYFA 3KTFA 4O4HA 1M5RA 1N0WA 3EBPA 4JC7A 1QU3A 4M1OA 4D0LB 1ST2A 4S1TA 3B89A 2JA2A 4BEJA 2YJ3A 1NC1A 2M6SA 2VXYA 3AHJA 4GOOD 4CQMB 5C81A 2J9FB 2H0QA 3JPYA 3KXPA 4JQOA 3UB3A 4OQEA 3DO5A 2C9DA 1YCFA 3NIWA 1TLFA 1S8OA 3DDUA 4UHCA 2K2QB 3U3DA 3R5SA 5IM4F 2R05A 5E6RB 4PACA 4AU1A 5F5XA 4LIPD 2NSGA 1G8JA 4L5BA 3EMVA 2RGAA 4X97A 4PXYA 3EPPA 3Q87B 4LZNA 5LUAA 1EM8B 2HDOA 2B37A 1W9HA 2CWWA 1ODLA 4D8WA 4WZBB 1KZ4A 5A6KA 1ISFA 4BO8A 3K6SB 3PKJA 4M1MA 1W88A 3T6JA 4M9QA 3GMTA 4HDMA 3IEVA 1SOWA 2YVLA 1E6MA 2P3OA 1UFVA 1GUAA 1DC5A 2AJTA 4KFRA 1HE9A 3CWZA 3NEAA 3H6GA 3JASB 5CH3A 4C87A 1SOUA 1DLJA 1ECPA 2HQOA 4D3YA 4D9BA 4NAVA 1ZOPA 4QXRA 1HDIA 1RXUA 1C7JA 1NBBA 1GPWB 4RIFA 4WJLA 3DO8A 5ITZA 5H3HA 1IDOA 1GA4A 1JBEA 4K1OA 1W2GA 3LJKA 3OCVA 1DIBA 3EZ2A 4BWYA 3B3GA 2VZ8A 2YIMA 3DDCA 3KZOA 2G8NA 5K45A 4XB1A 4GUAA 1AF7A 5EZYF 2CT8A 4YUXA 2G4LA 1CUUA 1Q50A 4IFBA 1BD4A 3I6IA 3AMVA 1TO2E 1N2ZA 3V8EA 3VXKA 4PONA 1Z74A 4GE3A 1CJVC 3N5KA 4IQFA 1II0A 2W6OA 1JEJA 1IH8A 4GT1A 1X7DA 2ZBUA 4KPGA 5JEEA 3MRVA 2G62A 2R6JA 5LBTA 1GZSA 2J3KA 4RX1A 1Q5PA 4MQ6A 2YH2A 4Q48A 3K1AB 4UVGA 2HTEA 1E8NA 1ARZA 4K6GA 3WMRA 1NSFA 3U1VA 1BW9B 3WG7C 1RMYA 1XDDA 3FLEA 2R7VA 2O54A 1VHTA 2FPPB 4OXKA 1RLOA 1ZW1A 2JGDB 1L5ZA 4UM8B 4AJ9A 4RTOA 1YDHA 3PXBA 1B3RA 3DTYA 2Q1WA 2FYTA 2BEKA 3LY8A 1E66A 1QYDA 4GLOA 4CM4A 3DO6A 5KKCA 5CXSA 3EDOA 1SVMA 4PAMA 1HYHA 1TVKB 2R3SA 1FFTC 3EWSA 1ATZA 3UIEA 4CG2A 4PCLA 2F67A 1D4OA 1U5AA 4CIBA 2GEKA 4E7PA 1WSDA 2QTGA 5EVJA 5ADUS 3VPHA 4P7FA 1QS0B 4YQEA 2CFCA 2PUBA 4DWWA 1RLMA 2NTYC 4J75A 3GLGB 1HG0A 1KDOA 4WZBE 3RR2A 5LWQA 1S89A 4HNAB 3HEAA 4NDAA 1A1SA 5CM9C 1PK8A 3QU9A 3R75A 1X7HA 4PRYA 4YV1A 4X91A 4PG4A 3EA4A 2HCJB 2VDRB 5KNDH 2JFPA 2A9OA 5G02A 5KMGB 5A9SA 1HT3A 3WGGA 5A4IS 2JHCA 2VLBA 4TT8A 2BP7B 3ELDA 1X8JA 3U4QA 2OUKA 3KOOA 4K40A 1P5ZB 3IUQA 2G6BA 3JWGA 5IZ4A 2H4WA 5DWQA 3SCZA 3LLUA 4IIVA 4CM6A 2LV8A 4RD0A 1P31A 1JA1A 2GN1A 2CFTA 3K32A 3UENA 1UP4A 3IJEB 2BKLA 1UPTA 4CEJB 1I3MA 3DJFA 5DNDA 2VPIA 3QK7A 4M1ZA 4I55A 1BMFA 3ORRA 5IVPA 5JXHA 3HDTA 3BQ9A 5FKJA 1J70A 1ORTA 4B35A 5BWOA 3AZQA 3DZIA 1JU3A 1T26A 4A8TA 3L1IA 1X70A 3BWDD 2WINI 4K87A 3MYFA 5CXUA 1RQLA 5FNZA 3KT6A 4LVOA 4DR3B 1E2HA 2O3RA 3HTKC 1P74A 3RS7A 3NEYA 5DYGA 4C22A 3PQCA 4QWMA 1T35A 2F59A 1CD5A 1B74A 1ZM2A 4MK4A 4ABYA 5CAEA 1DEKA 2I67A 5G0WA 4PLFA 4DMCA 4Y3UA 4G81A 4AN4A 4EG8A 3B0PA 1MHTA 3ET4A 3EW7A 3R3ZA 5DYTA 2RAVA 3SE7A 5CLHA 1V11B 4U5QA 3W9YA 1Y7LA 8AT1A 5H4HA 2RGRA 2PL9A 3D1LA 3LCMA 2NAPA 5JVDF 2H48A 3CRNA 2JLBA 2BEWB 3G2JA 4YRDA 1QRTA 3HB4X 4DHEA 1P17A 2F48A 4JTAB 4Z4CA 3LLIA 3V9AA 4UNPA 3U39A 2OU6A 3WODF 2I99A 1E99A 5H3CA 3ZE2B 3CEJA 1K2WA 1FUKA 4IP0A 5C32A 3RVDA 3OSUA 1ZITA 1YI1A 2ODQA 1CWUA 5IKOA 2EWMA 2WC1A 1VCNA 4ZT2A 3OHMA 2YN4A 3BXHA 3A1WA 1D2HA 1KU6A 5KU7A 1J06A 2D59A 4RHUA 3PD0A 2B7LA 1XGKA 5AC5A 3OURA 4HS9A 2XCTB 4U0KA 2W6PA 3DOUA 4XJXA 1W34A 2V8OA 1MUUA 3ANLA 4ESOA 4I9FA 1TCBA 1TKCA 4WCFA 2QX7A 5T3TA 3QXCA 2R5FA 3GLGE 4UMVA 2Z4TA 5ALSA 2CCGA 2Q2WA 3E0QA 3CRMA 1ECLA 2R5NA 2H9IA 2SNIE 3N8DA 2PX3A 2X0RA 4XDZA 3KPJA 4PJLA 4LYJA 4KEAA 3ESXA 3V8MA 4I3GA 1JTFA 4BVHA 2I8BA 4YWQA 3QF4B 2O8VA 4V1CA 1QM5A 3ZLUA 3LRXA 4U7WA 2WFLB 4YECA 2WJJA 5FV4A 1ONBA 1UFRA 5F2EA 4URZR 5JT4A 2LRHA 4Q4LA 1NWHA 3TIGA 3IGFA 5DW0A