2GFHA

Crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
246
Chain Sequence
HHHMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKVSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords haloacid dehalogenase-like hydrolase domain containing 4
publication title Crystal structure of Protein C20orf147 homolog (17391249) from Mus musculus at 1.90 A resolution
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 94
structure length 246
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2gfhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2gfhA01
5ALKA 2W4MA 1L7PA 5ALWA 3F9RA 1N9KA 4QQFA 1RKUA 4FFDA 3KD3A 3FPSA 1FEZA 5AKLA 4KX3A 2FPWA 5IT4A 3DNPA 4Y2QA 3ZVLA 5AHXA 5ALOA 5AVSA 5AW0A 3DDHA 1Z4LA 3GYGA 5AKXA 1ZRNA 4YGYA 3OCYA 5AIAA 2B8JA 2AH5A 3OCVA 4E88A 1L7NA 1RLMA 2YMPA 3E58A 4G9BA 2FPXA 3WKDA 2RAVA 2C9MA 3B8EA 4OHFA 4XPZA 2CN1A 5AIBA 1XP5A 2RB5A 3NUQA 2HHLA 4UU0A 4EX6A 2C4NA 3L8HA 2FPUA 4JB3A 5AVYA 2G08A 3UM9A 2OM6A 3ZI4A 4UASA 4C4TA 4UMEA 5AICA 2Q4TA 5AVQA 1NNLA 2FI1A 3N1UA 4F71A 3QUQA 3FVVA 2HOQA 1L8LA 3QU7A 4F72A 1RRCA 5A3SA 1Q91A 3N07A 3OCZA 5E0OA 3AR9A 5AESA 5ALYA 4L6CA 4UATA 3QGMA 5AKHA 4EEKA 2G06A 4B6JA 3NIWA 5AW4A 2ZBFA 1Z4JA 1Z4OA 5AKGA 3IB6A 3AR6A 2G07A 4YCNA 4HGRA 4UMFA 2YFYA 4Y2TA 2WFAA 1CQZA 5ALGA 1JUDA 3MC1A 4UM7A 4BEWA 3K1ZA 4RESA 2HEGA 3L0YA 3AR3A 4MWOA 3ET5A 2BY4A 3QUBA 4Y2VA 3B9RA 3E81A 3L0CA 4I9FA 3FM9A 3IRUA 4Y2PA 4UU1A 2I6XA 1K1EA 4EENA 1TE2A 1O08A 3QU4A 3U13A 5AW3A 3UMCA 2B8EA 4YIHA 1U7PA 2D2VA 4UMDA 4EELA 2EAUA 1LTQA 2G09A 4OFZA 4ZEWA 2ZXEA 1MH9A 1ZD5A 3WGUA 3ET4A 2WHEA 5AK6A 1YV9A 3AR5A 3DV9A 5ALMA 4NWIA 2P69A 2BDUA 4Y2XA 3A1CA 5ALVA 1WZCA 5AVRA 4BX0A 1CR6A 2W43A 2YY6A 2JAWA 1VFPA 5AM5A 4BX2A 4NV0A 3HYCA 2WF7A 3N8GA 5ALQA 3L7YA 2ZBGA 5AI5A 3AR4A 2MU1A 2OA0A 3RFUA 5AM2A 4EX7A 3OCWA 2RBKA 3W5BA 1TJ3A 1SU4A 1EK1A 1L6RA 4HYTA 2IOHA 3L1VA 3NASA 3R4CA 1ZJJA 4OCZA 4KYTA 1T9ZA 4AS3A 5IS2A 3A1EA 1RDFA 3U7GA 3HLTA 1YNSA 1YMQA 3QNMA 1Z4KA 2QYHA 3SLRA 2HF7A 4YH1A 2PKEA 4DW8A 2YMQA 5AK4A 3FPBA 1XVIA 3SKYA 2I7DA 4Y2SA 5AM0A 5ALPA 3DAOA 1NF2A 3KZXA 1ZD4A 2P27A 1F5SA 3A1DA 2WF6A 2G80A 2GHQA 5ALIA 4Y2JA 3E84A 2B1RA 1EK2A 2IYEA 4G63A 3ZWKA 1ZD2P 1QH9A 3FZQA 5AVTA 3MN1A 2G0AA 2ZBEA 5AKEA 3QUCA 5AVUA 1KYTA 5AW9A 3WKEA 1S2OA 3P96A 5FP0A 4GIBA 3EF1A 3W5CA 3UMBA 1RQLA 1X42A 1RC8A 3ZWDA 4Y2RA 2VKQA 3U26A 1RQNA 5ALEA 1U2TA 2I33A 3ESQA 2HI0A 3AR7A 2JARA 1Z4MA 2YJ4A 5AVXA 3OTQA 4HAIA 2NO5A 4UM5A 4FYPA 2R8ZA 2WF8A 5AI4A 3PCTA 2WF9A 4XE5A 2B0CA 1ZRMA 3L8FA 3J7TA 3L8GA 1Y8AA 2P9JA 2AMYA 2PR7A 3ZX5A 1Z4IA 5AW8A 1RMQA 2I34A 2OBBA 3QXGA 3WK9A 4PNHA 4YCLA 3ESRA 3EF0A 3OPXA 3A3YA 2YJ5A 4BYGA 5AW2A 3ZVNA 2AUTA 4GXTA 5AKKA 4UARA 4CF4A 3NAMA 3SD7A 5AKJA 2HF2A 1YS9A 2YMLA 4MUMA 2I54A 2IOFK 3OCUA 1U02A 3CNHA 4RETA 2CFRA 3R09A 4HGOA 3S6JA 3E8MA 3KDPA 4ZEXA 1VJ5A 2Q4RA 3QU2A 4DWOA 1Z88A 1TJ5A 1QYIA 4UAUA 3WGVA 3R9KA 4CF3A 2ZOSA 3W5AA 3QU9A 1J8DA 2JAOA 3ZTYA 1ZD3A 1QQ6A 2B82A 1S8OA 1RLOA 1SWWA 4C4RA 4ZEVA 3QX7A 2NO4A 3QYPA 4XOUA 1PW5A 5ALXA 2FPSA 5AVZA 2HO4A 3U7FB 5AKIA 2FUEA 1T5TA 3KBBA 2C88A 4HGQA 3BWVA 3NALA 3QU5A 5AW1A 3W5DA 1RKVA 3U7HB 3M1YA 3WK7A 1T5SA 1RLTA 4I9GA 3ZUPA 2IOFA 4KNVA 5ALLA 1TJ4A 4NABA 5AK5A 2DQSA 4QJBA 2AGVA 2B30A 3FGOA 3I76A 4KNWA 5ALRA 4IFTA 5AW5A 2PQ0A 3ZVMA 3ZU6A 2C8KA 1Z4NA 3AR8A 4NAVA 4J03A 2HSZA 3M9LA 4EZEA 4BBJA 2C8LA 3QUTA 3U7EB 2FUCA 4L57A 1L7OA 3I1YA 1Z5UA 1ZOLA 2ODAA 3ZTWA 2W11A 3KOOA 2MSNA 5AM3A 1U2SA 3CZ4A 2GFHA 2IA5A 4BEVA 2YJ3A 3L5KA 3NANA 4BX3A 3OCXA 1Q92A 2WF5A 2NYVA 2EATA 2JAUA 1ZS9A 4UAVA 3WKCA 5AI0A 4YCMA 5AW7A 2QLTA 3ZX4A 2B1QA 4CF5A 3WK6A 1RKQA 2JGAA 3MMZA 4HGNA 3WK8A 5AK3A 5ALJA 4CNQA 3BA6A 5IT0A 2RARA 4IG4A 2ZG6A 2CFTA 5ALNA 4KN8A 2G1AA 3I28A 5AKYA 4FE3A 3UMGA 1XPJA 1SWVA 5ALZA 5T41A 4BNDB 1TA0A 3QLEA 5ALFA 3N28A 3EWIA 4UW9A 3SHQA 4BNDA 1N8NA 3IJ5A 1VJRA 5ALHA 5ALDA 2YJ6A 3SF0A 2HCFA 3WKAA 3AR2A 4Y2UA 5AI9A 5JJBA 2P11A 3L8EA 2GMWA 3WK4A 2R8YA 2OYCA 4CE6A 1J97A 4HGPA 4H1WA 3MPOA 4NFLA 4DCCA 2HDOA 4J2TA 1AQ6A 2GHTA 5AM1A 1NRWA 3RF6A 4AS2A 4Y2YA 2FPRA 3SKXA 3TLMA 4AP9A 2WM8A 5AKZA 2FDRA 1L8OA 5AVVA 4Y3UA 3U19A 1O03A 3N5KA 3KC2A 5A3RA 5A3QA 2EARA 1RMYA 1WVIA 1WR8A 3PGVA 2FEAA 1U7OA 1Z4PX 4UMVA 3VAYA 2CFSA 3WK5A 2Q5EA 5AW6A 1IWOA 4XQ0A 1QQ7A 2X4DA 1RPZA 1QQ5A 5ALSA 2R8XA 1YDFA 2HX1A 2YMMA 3SMVA 5ALUA 4DFDA 5ALTA 2O2XA 4C4SA 1RMTA 4KX5A 1Z4QA 3PDWA 1WPGA 4YIKA 1L7MA 5AM4A 2O9JA 3PGLA 1Z5GA 3NRJA 2BDEA 2I55A 3I6BA 3B9BA 2YN4A 4OD0A 4O8CA 4L6AA 3EPRA 3ONNA 3WKBA 4JDPA 3ZW7A 2R8EA 4BKMA 5AVWA 2ZBDA 2GO7A 3L1UA 1LVHA 5AI8A 1YJ5A 3ED5A 5AI6A 3D6JA 2YBDA 3L0BA
chains in the Genus database with same CATH superfamily
2W4MA 2X77A 5JCOA 2CMDA 2Y92A 3ZVLA 2AW3A 3JQAB 2G67A 3RHTA 4MUJA 3LY7A 1JI3A 4YHHB 4OMUA 3CLTD 3UW1A 4B6IA 3QVGA 4EHHA 1V1MB 2IXAA 3SU8A 1WRBA 1JLHA 4AQDA 2NQTA 1YQDA 2BZ0A 1QQ3A 4IDDA 3D6HA 3IR6A 4I46A 4WK4B 3ZHBA 5LZ8A 5A0FA 2HO5A 4OBXA 4MDEA 1J0CA 4K6MA 3UV3A 1IRXA 1VIYA 1A9RA 2PRKA 1IJFA 4K28A 4DLVA 2I1QA 1SHZA 4FIDA 3RSOA 1UM9B 1N5MA 4YMUA 4UOQA 2ZETA 1W29A 1QS0B 3ZWIA 3EGOA 4L28A 2NU9A 2OHJA 4DA8A 1B4DA 2KLBA 2ZXEA 4HNUA 3KLNA 2L2QA 4CHGA 4WZZA 4RD9A 3W5IA 4Y2XA 3I3SR 3UB3A 2VG8A 4CTKA 3BGSA 1KETA 1X7DA 1P77A 1P1KA 1RTTA 4PNZA 4XQ1A 2F1OA 1LK5A 2WTUA 1C4XA 2V5UA 2GM9A 3AGTA 5IH3A 2WUDA 5DYGA 5FOQA 1YCHA 4IINA 1PJBA 1DTSA 3ZBTA 3QNMA 2EEPA 2VP2A 2G4LA 3CF2A 3SKYA 1AQLA 1PU2A 4YPFA 3F7TA 5I8WA 1PG5A 2AW5A 2LR0A 1B93A 3NYLA 4GVPA 3UG6A 3I1FA 3I2YX 4NJMB 1DKUA 1T91A 5E2IA 3TQQA 2PS9A 3LEVA 4RZ2A 3GEGA 3AXSA 2Q6KA 4ZZ0A 3ZHQA 2CUKA 1Q3TA 1E98A 2R7LA 3NVKI 1DOAA 2G5PA 4FNMA 2X8JB 1IDOA 2QMYA 3AJ8A 4J3FA 5CJJA 1YK0A 2P2GA 2XRHA 4ER9A 1WSBA 1VMIA 1SM4A 4RE5A 2NMVA 1T4CB 3T54A 2Y0PA 5BSHA 2WG1A 2IELA 3SXJA 2ZRJA 4W5NA 3OT4A 4ZYUA 1Z0DA 3JQ6A 3KETA 1CGME 4EPYA 4IQFA 4ZMBA 2AP3A 1ZUIA 2AN5A 1DC8A 3KXDA 2QDKA 3U7FB 1ECBA 4HS4A 1WDKA 1DWOA 4YV2A 1OAKA 4GLJA 1JAZA 1JTVA 5ALLA 2AN9A 3GJ7A 4JURI 3FOFC 4FGWA 2I03A 3KU4A 1GWNA 5FWXB 1WAMA 4FXOA 1FLNA 3DBRB 4RMGA 2WBLC 3DGFC 4RSMA 1SGWA 1GA6A 2Q6LA 2B98A 2DBYA 2PRJA 2F64A 3ZG6A 4UFNA 1A9PA 4MJLA 4G56A 3CW2A 3H17A 3N24A 1IBLB 3WBJA 2J5BA 3LPNA 2D06A 1BDIA 2DP4E 1AXGA 1YZ3A 2IT1A 5HJ5A 1RXIA 3FFWA 1KZ1A 1CP3A 4LXIA 4PHGA 4MLZA 3ETNA 4PVDA 3DKRA 3JSZA 4QOIA 4J4BA 4RHXA 2CL6X 5ESXA 3NIDB 2OBNA 4ME6A 2OL4A 4FN4A 4RHYA 2GM4A 2JX0A 4M1WA 3SLGA 3N6VA 4KPUB 4RNCA 3SKXA 1K63A 4LACB 5JSFA 2H2AA 5LYYA 3HJBA 5AVVA 4YJHB 5TPWA 1RM5A 1E2UA 4Y1RB 4NKRA 1E9SA 3B7WA 1LV8A 1TL7C 3FSEA 1EWQA 3JVVA 2XJ9A 2YDXA 3UPDA 4FYMA 4ALNA 1A27A 1VG9B 3CTMA 3RTEA 4NNJA 3G0DA 5TT1A 4ESHA 2BWJA 3ROPA 1NIPA 2O9JA 4QXQA 3AFMA 1EWTA 4O8CA 4FBLA 2WT8A 2CHUA 1UP7A 5SY9A 1TK3A 5BR4A 2F59A 1E1NA 4Z4HA 3CEJA 2YV1A 5THKA 4DLZA 3AKYA 1AVOB 1E8DA 3MWDB 1QRSA 2A1UB 4OQNA 3VC7A 1O89A 3LQQA 4ENSA 3L8IA 3H3XA 3MS4A 2ZSUA 3EJNA 2FK8A 1KMQA 2NLOA 5EPUA 4EDFA 1FFXA 2JJ1A 3I5AA 1FYDA 2Q1YA 2R8OA 1Q0TA 5B1DA 1UBJS 3LDGA 4OXIA 1ZX1A 1DZIA 2OGWA 2FI1A 3PYLA 3LKZA 1TW2A 1UJ4A 2YOHA 1AGYA 3FVVA 3F5QA 4AZVA 1UKCA 1RI1A 2YXPX 5DP2A 1IN8A 3SQMA 1W0JA 3L6DA 1KH1A 3IKJA 1XTBA 5TJ5E 2GN4A 1KOGA 2B5VA 1Z73A 3HPRA 2DTDA 5TQ2B 3ONFA 3SY8A 5EQDA 3PHCA 3LPMA 4OQDA 1KEVA 3LEOA 4X5OA 1QH8B 3G2QA 3T4UA 5DLJA 4HBZA 3UKDA 4FB4A 3FOPA 5EJ6A 1YNOA 1AVTA 3RRNA 4YAIA 3RGWS 3Q87B 2IW1A 3OY7A 1SBQA 2DUNA 1BQ3A 2C4UA 3WAQA 2VJPA 4UBOA 3P9YA 5M7EA 4BQSA 3ITDA 1UC9A 1YBMA 4HDOB 3K15A 4DCNA 4O2BB 1AKNA 5BWNA 3O5AA 3K1JA 3R5TA 1H6DA 1ZINA 3UN1A 1F2UA 4O4IA 4XXHA 5IBRA 2XLHA 5IXYA 1A71A 1P61B 2LCQA 4XOIA 1JKJB 3IDSA 5IN4A 3HH8A 3IXLA 4MS1B 1XZQA 2NTVA 1NN0A 4D9IA 2ZJAA 1WJGA 4HH0A 2L82A 3W79A 3L06A 3U26A 2Z9CA 3FGZA 3UUFA 3EZ6A 4H0FA 3VR4H 5U4QA 4TV9A 4FFRA 4WK6A 4RTOA 3HLYA 1U3GA 1XXHA 1RMQA 3TZEA 1N2CE 2V7QD 3CXUA 5C1IA 2Q0QA 3ZHRA 3I2HA 4BOYA 1ZR4A 4EKWA 3RDPA 2G4CA 4HXEB 4WESA 2B20A 3K0EA 3EVTA 4IIDA 5A6KA 2QL5A 4A82A 4HLUA 3LC1O 4B85A 4AZ3A 4CF3A 3QU9A 1PR9A 2G0TA 4DPKA 2W2NA 2Q0SA 3DPIA 2WABA 1BH6A 1Z6GA 1W5EA 1KJIA 2F6RA 4QOSA 1W25A 2Q21A 3ABIA 5EQJB 1G41A 5BSRA 1OC4A 4QUGA 4B0PA 4AMBA 2BIFA 4HRYA 4G4SO 4GE0A 4BV3A 3WFZA 1FSGA 2QLMA 4PO3X 1NI4A 4HN2A 1HOTA 3C8ZA 2VZ9A 4ICIA 5A6BA 2V7VA 2GCPA 2DM6A 4ZOLB 3VH3A 4HGYA 4RPJA 2JGAA 1QIJA 1I5NA 1E6WA 1U2RA 3EVDA 5CNIA 1A7VA 3P8ZA 2W2OA 1ZESA 4A15A 1CEXA 3LT4A 3EQ7A 5EMKA 2G83A 2Y27A 1B23P 4D92A 1UBLS 2DPYA 2H59A 1XJQA 2XSEA 4GYTA 1GCIA 3PHLA 3AQBA 3J06A 4AY6A 1Z12A 5FWYA 1LRJA 2FSVC 1OI4A 4CUKA 3EIEA 3QWAA 5KKCA 5CXUA 3QF4B 3SYMA 2DQKA 4Z9FA 1HBJA 4BB0A 3NNSA 3PJDA 2EG9A 1CWUA 1IWOA 1HSZA 3U62A 3B6KA 1M57C 3H2IA 5F7ZA 2P6UA 3HFJA 4KRGA 3DT6A 2RHMA 2ATVA 3E2PA 4OD0A 3BRQA 4B82A 2QMUA 4MW0A 1C7RA 3VKVA 4DRYA 4G81A 2BEVA 1W88A 1X9IA 1CZRA 5C8YA 1KI1A 1DX4A 3CE6A 4EJSA 1KI3A 2KB0A 1VIAA 1XJ5A 1Z2DA 1EK5A 3CQZA 4M8IA 1EM6A 3VJLA 2HZ8A 2WSLA 4C0KA 1E2BA 4QOJA 1JU9A 1Q1QA 3SZ3A 1EFDN 4ID3A 1IDN1 4NSNA 1RFGE 4G5SA 2BMWA 3QA9A 2ZJ6A 4L7VA 2QVYX 2H54A 1ST2A 3MINB 4HG2A 3RLIA 3PD1A 3RQFA 3HK2A 3JZMA 3DBLB 1C2TA 2H1OA 3B60A 3ZI7A 1NVKA 3DOOA 1K1EA 4X92A 1V71A 1GEGA 1LJ8A 3ZG1A 4YRNA 3ABRB 3I0MA 3X1MA 3HM9A 1O3YA 4JMLA 1ODCA 1ZD5A 3EN0A 4DQVA 2ASEA 5TPZD 4O33A 4CRWB 3S55A 2ROQA 2AFHE 1X8KA 4TOIA 3LT1A 1ISJA 1NVBA 1UJCA 4MVCA 3L7YA 1N9GA 2D1YA 2RBGA 1EFKA 1QX3A 2D1SA 3UH1A 3OCWA 2HH9A 3NGLA 1NJ1A 3PBKA 4PNPA 4E94A 2P5YA 1A88A 3AQCA 5CT6A 3VU9B 3B9QA 2Q3EA 2HCBA 1GQ2A 2ZANA 2V7EA 4LDQA 2HZ7A 1RRFA 3OCCA 4H7KA 3GLIE 3COYA 3KT6A 2J9ZB 2C31A 1W85A 5ED0A 2V5VA 1RHUA 2QMQA 3NMIA 2O1SA 2HHAA 3EF1A 4J7AA 3STHA 3ELUA 1SKAA 4WXPA 1ISRA 2JEYA 5HWSA 4KAJA 4L15A 1PLJA 2AZMA 3V7UA 1GG2A 3RSCA 2KC3A 3NIBA 2PYIA 1N0WA 4OJTA 5ERYA 2J46A 3HQ4O 5A69A 2QTLA 5IZCA 4HDKB 3OC0A 2AT1A 4MVSA 2GPBA 4RETA 3E3AA 1MOQA 2P1DA 2BTOA 2XA2A 2JHAA 4BWVA 3C0KA 4KC9A 3QBEA 1GNVA 4KQJA 2A9RA 4DIMA 4OG2A 1G98A 3IA7A 2CXRA 2CDCA 2CZGA 3UAWA 3DKAA 3Q12A 3F4KA 4EVQA 1TADA 3E3MA 4G84A 1DEOA 1O95D 1O2DA 1KIAA 3EGDB 1FFHA 3CVYA 2OJQA 2Z6AA 2I6TA 1US8B 1Y1RA 2GNPA 4JX8A 5ITWA 3GJTA 1POWA 1TIKA 1JFTA 3CEAA 3PDMP 4IEIA 1XU4A 3OOYA 4KO3S 3CBQA 4L5BA 2DFNA 2VCYA 2Q3FA 5ARBA 4CLEA 2PANA 4O79A 1Q1BA 1U3DA 1PG0A 3K6RA 2H4XA 4M1SA 2IWRA 4OBEA 3QOWA 3C62A 3MW8A 3KT0A 1X1EA 3DE8A 1BU5A 1MAUA 1VE9A 5KWVA 4GYYA 1I7LA 3R5JA 3JQGB 3PXXA 1USIA 4RGVA 4EY5A 3OJFA 2RK6A 1PLKA 1DRWA 1USWA 2X9NA 2O7NA 1L5OA 4Y3UA 1A7JA 1O03A 1CQJB 2J9BA 4PQRA 4YAWA 1BE1A 1ZJ5A 4GEHA 2EPMX 2Q29A 1N7HA 4K3VA 2F1HA 4KBLA 3ZQYA 2QYOA 3U5TA 2Q5EA 4KO1S 2RI1A 1J8VA 1E2EA 1GZ6A 5JUWA 4B40A 2DUWA 1UQRA 4BV9A 4EG6A 3KHSA 3SSAA 3PRKE 1GLVA 4P9FA 5T67A 2GO7A 4Q9NA 4N5HX 4R7GA 1FUYB 1PUXA 3ZWMA 3JATA 2ZR8A 3K0FA 5KEIA 5ALOA 2OCAA 1Y6DA 4EUHA 3AY3A 4FMCB 5AKXA 2OZEA 1E3TA 4I55B 3OPYA 3NEYA 4D0SA 1OCRC 2PS3A 2XQGA 4TUYF 5CEFA 3ITFA 4P93A 3U80A 4PCVA 1HDZA 2FPUA 2KJQA 1S4QA 4KAFA 4I99A 1HWYA 2XNDD 3L07A 4XX0A 3HDGA 5BN5B 4N4AA 4IJKA 4WBSA 4BS9A 4M63A 4TYQA 4YDRA 3OEYA 1YZKA 4LI0A 1H2HA 1EFVB 3FNIA 5E6RA 1Z36A 2EIHA 1VRCA 4F4HA 3WIVA 4HKTA 1U8XX 1KTMA 3CT4A 2I65A 1D2GA 2EIJC 8ADHA 2J5RA 1E0KA 2I71A 4QNNA 3EXAA 1A04A 2HU5A 1PD0A 1J9EA 4X6YA 4QTXA 2WIKA 3PXCX 1H2FA 3H4VA 4XZ3A 3QMWA 5C5CA 5FNVF 4Q9LA 3U7JA 3MJDA 4LMBA 1IHYA 4JVOA 3FJOA 1SUCA 5KTSA 1C0EA 2M6KA 4XM2A 2XCUA 2BSXA 4MLDA 4DUPA 1KPGA 3ZGXA 4TXHA 1V4NA 3OE5A 2H4FA 1TMYA 3K8YA 4RIEA 2XSZD 1YVPA 1ZSNA 2H7BA 2XVXA 3ADDA 3DSRA 2OG2A 3A4IA 4RKRA 3HZOA 4M0EA 4KQHA 2H51A 3ZHVA 2R7NA 3QE2A 1XIVA 1YI1A 1QGOA 1OE0A 3PXEA 2DVMA 5T4FA 3ESQA 1QP7A 3ZNOA 4BQNA 3T5DA 3BTVA 3ZIAD 3EWNA 5DXFA 4JI8B 4MUXA 1Z4IA 1ST6A 1R5BA 4LLCA 1RWXA 3IUEA 3BG5A 1Y3AA 3L8MA 4NLLA 4KUEA 5B1BC 5HF8A 1J22A 4CM8A 3RH3A 3OZGA 2JFFA 3N74A 2UU9B 3O8QB 1FC0A 3H42B 3F5DA 3O2SB 3SE7A 4HQNA 2HHJA 1I4ZA 1R9MA 3E1GA 2FY8A 2P9HA 3GPCA 3N9IA 2VCBA 2R25B 5DWQA 5IMSA 3UT5A 5I8ZA 5IKEA 3NWPA 2RGCA 2E4ZA 3C15C 2QUHA 1GGEA 5FBKA 4CIYA 4WD3A 3DBOB 2ANBA 1PQUA 2ETXA 3GX1A 4ZVLA 4X84A 3REQA 4L4SA 1P33A 2JVKA 2DYKA 1HE3A 4RQUA 1G19A 4KPYA 3URKA 5L0IA 1NN3A 4AB1A 1NVWQ 3PWTA 1ZHTA 3DNMA 1JFLA 3IUBA 4DQUA 1HV8A 4BNYA 4WOKA 3BVPA 1CUDA 4LE1A 1QYWA 1ZUHA 2QR2A 3Q9NA 1KZ6A 5FBWB 3I12A 5TGDA 3IBYA 1ZCJA 4DJEC 2WWRA 2ZRIA 3H2SA 3KZNA 3I28A 4IV5A 2BUCA 1XZKA 5LUBA 3O1HB 3RSFA 3NYWA 4MS3A 4NL4H 1O9HA 4MTCA 3PDIB 2H4WA 3MXOA 3NV9A 4OFBA 3AESA 5IASA 1U8AA 1WUJS 1CETA 1JQEA 1T1EA 1ADYA 2LK4A 5EPEA 3N39C 1KU2A 3OF5A 1KMHB 3S99A 4E5VA 1WMSA 4M0PA 1Z68A 1X1DA 2C2ZA 5EG5A 2IODA 4HADA 2ZAYA 2FZGA 1H1TA 1XZNA 1M72A 3TBFA 4PM4A 5K9ZA 3SM9A 5F5LA 4RQBA 5EJEA 2BFCA 2ZYUX 4O29A 1V5FA 3HCAA 2P9QA 5C51B 3KUUA 1NJGA 2JDIA 4Q0MA 4W7HA 2BFOA 3WDLA 4Q9JA 3FPHA 1E3QA 4BB6A 4RKFA 4A7PA 5HMLA 3GEDA 1XEXA 1FPMA 1YCDA 4UCFA 4ZVVA 1J7JA 4JR0A 2EKZA 3IJEB 4R01A 4TWAA 1HK7A 2Z15A 4GKBA 2Q5FA 5KREA 1OX4A 4LOLA 1EWYA 2I4RA 1R5JA 4MUIA 1A98A 4F71A 1Z74A 5FHRA 4AYTA 6YASA 5FOTA 4U5BE 5FH9A 1MGOA 3IQCA 3Q3CA 4IMIB 1M0WA 1T3TA 2X8BA 3DUWA 5EKUA 3KKKA 1XLUA 1P6XA 3D6AA 7ABPA 2FN3A 3FM9A 4B87A 1WSAA 4B0OA 4BLSA 1KHTA 1V9SA 1ZZGA 4FHGA 1QF7A 4OFZA 1F8YA 2F4VB 4AJ1A 2RKWA 4JA2A 3M33A 4YJWA 3V2UA 1ZZPA 5KBYA 3HMQA 4DANA 4AF7A 4DAEA 2BBOA 3Q2KA 2R6CA 4EA7A 2WB4A 1N2BA 3NGXA 4YRIA 2UUIA 2PL9A 4FR2A 3ZDEA 2AOWA 5JI2E 4BVKA 5GQSA 3BN3A 2FSUA 2BVNA 4N6GA 4EY7A 4CQNA 2QN8A 1WCIB 1RKEA 1CY4A 4QXMA 1D9XA 4WERA 3TGPA 3EE6A 3PU6A 2XPCA 2ONKA 3T95A 1RBMA 3CSUA 3C5EA 3UPTA 2YZ7A 2COKA 1PR4A 3LK7A 1NNEA 2YWFA 1GUAA 3G0IA 4MQEB 4XIYA 3KOYA 3Q88A 3KS9A 2LE0A 4HVLA 5DNDA 2QW0X 2ZYHA 4JLUA 5K4GA 3GCWA 2PDAA 1MMNA 5IDWA 1GFIA 2ABWA 2GHRA 1D04A 2IKQA 1JG2A 3TQHA 5CFQA 1N7IA 2BHTA 3HN2A 1E7MA 1Z6ZA 5C3UA 1QYCA 3CMMA 1XD2B 1QG0A 1YR2A 2Z98A 3AIMA 3LLSA 2BM8A 2DGJA 1GTJ1 4KDEA 1OFGA 3HVJA 2NO4A 4CPDA 4J76A 5CD1A 2C0CA 4PC3A 3NEAA 5H82A 3IEPA 1V1RA 3O4VA 4ZQIA 5HM6A 2XT0A 2G76A 1XMOB 2I66A 2VHJA 3R3ZA 2B30A 2FWIA 4PFQA 4F4CA 2YTZA 2RJOA 5KTTA 2VC2B 1U3WA 4QDUA 4CTNA 2UXBB 4J3JA 3UT6A 5HKKD 3EEOA 1PR6A 3C24A 5B6JA 5IC4A 3FJYA 4FFOA 4WKCA 5F9MA 4V0MA 1L5WA 3M4ZA 1MEEA 1P8JA 4CDNA 1CR1A 1OR8A 5AW7A 4TL9A 1HMPA 3UAXA 5K3SA 4R3NA 2BCGY 5JE8A 1XPJA 4RZSA 4Z54A 3A2MA 3IDZA 2RH5A 1KU6A 1JP7A 5FUBA 1RYNA 5FBHA 4F7DA 3M6WA 2DU8A 2ZI9A 4AM8A 4RGYA 1XHLA 3N2EA 3BMCB 3TNJA 1R6UA 4A6DA 1G64A 3QITA 3LVQE 1XNRB 3QPCA 2G3YA 1XZAA 4JI0B 3AY6A 1I3OA 3NAQA 4RZXA 1ZFNA 3LKVA 4Z51A 1UFQA 3KQLA 1SXJA 2RGRA 2NSLA 1ZYUA 5JXHA 4PINA 4F5WA 1ZK2A 4Q4HA 2OYSA 1CNFA 2ATEA 4DMLA 4JP1A 2ZJ4A 4RPLA 1AQNA 2XNHA 4P35A 3EPKA 2GPTA 5JSQA 5BW5A 3BWXA 5NLLA 4R2JA 3ER9A 1X1CA 3L1UA 3LQFA 1TEXA 4H1UA 1PYGA 2ZCUA 3AGUA 1P4SA 3ONWA 1EK6A 3U4MA 5A0VA 5JNUA 4RVUA 2W6IA 5JR3A 2BH9A 2BF7A 3HU1A 4JYMA 1SUWA 3CEPB 2G6TA 3LZDA 1QB8A 1MQSA 2XCSB 4PCLA 1Q84A 1EUDA 5EWJB 3WWYA 3BEDA 3AHIA 3B8EA 1YA6A 4F3RA 3GNTA 4Q1CA 3Q7GA 4DBLC 4I4NA 4DLKA 1PBTA 4NZOA 1IJKA 4E31A 3PJEA 4EL5A 4URYR 4HWOA 2W45A 1F6BA 5L7WA 1K6IA 5LQCA 4P4GA 3FMFA 5A4JA 3DCYA 2VSYA 2WNSA 4P36A 2BEJA 5I9MA 4OI0A 3DWGA 4XWWA 3B8HA 3D8UA 2HCJB 1GDHA 1JSRA 1RLJA 3BXZA 1KOLA 5FTNA 1E1CB 4MJXA 4BKQA 4LRWA 3K5IA 2DPGA 4YL1A 1ZGCA 2EAUA 4PGAA 4AVYA 4KTVE 3UWOA 3ERCA 1RZUA 1CZNA 1C81A 3G2NA 4ARVA 3SHOA 1FYEA 3VX3A 2J30A 2IIVA 5DQZA 2YY6A 2ZM6B 3BIOA 3NHPA 1IXRC 1NQOA 3FRJA 4AN4A 4DE5A 1AOXA 1ISSA 2GCGA 5JV5A 3QYJA 2FMUA 1KERA 4H7PA 1PCXA 4PPNA 1N0UA 4BU1A 1Z37A 1SVOA 4LOHA 5B58C 1ZEJA 4FQ8A 4UNPA 1B0ZA 4TMWA 2XDQA 1E59A 3HBLA 1VE6A 2GUGA 1WU7A 3MOIA 4X7MA 5FWDA 1CHNA 3UBTA 1YU6A 2PKCA 5FQOA 3RT1A 5AVUA 4GDMA 4P5EA 4BZXA 1A96A 1DRKA 2XGGA 4PSCA 3VMMA 3LJBA 2O3TA 1NU7D 3PXGA 1GCAA 4ZD6A 4I1UA 1JBQA 3VU1A 1DELA 1DQZA 5IULC 1GITA 3JWPA 5ENZA 4RTMA 2ZB4A 2EERA 3FAJA 2NXCA 4ND2A 1E32A 3QEKA 4RZUA 3RS0A 2YW9A 4FFLA 2C9ZA 2Z08A 2Q62A 3GFRA 4CFYA 4DZZA 3QVYA 2BTEA 3HEMA 3NO4A 2GD2A 1YYJA 2OESA 3FPFA 3WLKX 4NVRA 1ZVMA 3NTUA 1IU9A 1H1LA 1SXIA 3EVAA 5AKIA 1P4JA 1KIFA 2ZI3A 2I99A 3UJAA 4K2AA 2EKBA 1NP7A 1MV5A 4BFTA 2YV5A 5E8RA 3HI4A 2R44A 1NFFA 4JLNA 3GT0A 3FR7A 5I7EA 3OJOA 3T3DA 4MQ5A 1AS2A 1PQYA 2VJAA 3U39A 2ZZNA 1D0ZA 5AJHA 1TQ4A 1CY8A 4QUKA 2RHHA 1ENOA 2FGKA 4S3MA 1JHUA 4KKVA 4AJNA 3T9FA 1L5HB 4A8JC 2Y9PB 4EYEA 1A2KC 3LY5A 5KWEA 5DH9A 4GRIA 3TLEA 3AM5A 2D59A 3HGMA 3VPCA 4Q7QA 2ZSFA 3PTZA 2XMCA 4U7FA 5EJMA 4UFPA 2G62A 2DC1A 3O92A 2VSNA 3D2LA 1VE5A 1KAMA 3BSYA 3M4NA 4WACA 3NT4A 2ZQYA 4J4TA 4UOZA 3PXUA 1OLUA 3N2GB 1UDCA 4BJ5C 5H4GA 1GTG1 1GNQA 4U9HS 3ELWA 4H1WA 4B3SB 1PTJA 3EFOA 5DJ5A 3G0HA 2LTAA 1NLYA 1Z2EA 1M2KA 1D1CA 4LS3A 3GI1A 3D1JA 4LVCA 3EH2A 5KU7A 4S04A 1VYVA 1NPDA 1JDBB 5FXMA 2IHJA 4B3BA 3MCAA 3NRHA 5B1HA 3IQXA 1WZ2A 1TMGE 1YDMA 4WK2B 1G8KA 2VPWA 4H4EA 2WRZA 5JROA 3PGLA 4JK3A 2Z2KA 1F06A 2BSAA 2IGTA 1OW8A 2F8TA 3GHYA 5KNCA 5KYYB 1DIRA 1RRMA 1K27A 5ABPA 3DO5A 4TM8A 3D0OA 3FUXA 2I4OA 3GK3A 3L04A 4C05A 4Z4QA 4JNCA 4E5KA 4UQOA 1QHSA 1QJ4A 2ILTA 1NE2A 2IYFA 3VR2D 3CVWA 2F3UA 5IFKA 4OHFA 1Q14A 4Q9KA 2W8BB 1QORA 1UM8A 3A2LA 3N1UA 2UVPA 4F11A 5AVOA 1E9DA 2VQEB 1G5RA 4U9DA 1N3LA 4B8ZA 2A9KA 2DFLA 3DT8A 5G4KB 3W1EA 3ESAA 3CUSA 4FILA 4I1VA 1B3RA 1PJLA 2HJWA 3T7JA 2W6CX 4ES6A 4MUKA 1U8ZA 4A16A 2HMUA 1GPYA 2WIJA 3CLVA 4UU7A 2HIMA 4HSEA 2W5UA 4Y9TA 3WGOA 2QN9A 2Q8PA 3JRXA 5IAJA 2G7ZA 3HJUA 5U4XA 1GPMA 4WJ0A 2VHXA 1CLEA 5ALMA 5JH7B 2C2WA 4OQEA 5HJ7A 5BRJA 2J09A 1NUHA 1QHNA 3ZZNA 1COWA 3CG0A 4L8LA 1S5PA 2I6QA 3BXHA 4X44A 3HCBA 5IKXA 5DLPA 3C1UA 4FLEA 4MKGA 3PDJA 1MO6A 3VNAA 2Y1EA 2G80A 4WXRA 2YIMA 1M6YA 3FUVA 1JQKA 4ZT2A 3T9BA 4CG2A 2ORIA 4FAPB 1PO7A 4LOKA 3AVQA 4NJEA 4K8OA 4D97A 5T3WA 3T6JA 2DUMA 5KNDH 1ZJ6A 4N40A 1F2TA 2IZ5A 4AE4A 3TSZA 5FR1A 3NWEA 4JVSB 5JJCA 2O7QA 3HZZA 2EBHX 4JJKA 5A5GA 4K9OA 3OIGA 1PGOA 4PXYA 1BXRB 1N6HA 2QSUA 3ND7A 3WLIA 2IYXA 2A35A 3GGGA 5D01A 4RF3A 4HI0E 3ZUGA 4REMA 3V8BA 1KKMA 2J5QA 1F38A 1GDDA 1XAHA 1A7KA 1E1LA 3MCUA 1IJBA 5E9QA 1L4BA 4CIDA 3RBAA 3F3MA 4UZSA 5DGDA 1V7PC 4WINA 3Q7RA 1STOA 3QU2A 1NW6A 3UXHA 3QELB 5EE3A 1Q0DA 3NOXA 5IC5A 4G5GA 4BY9E 4H7DA 2YFQA 1ADCA 3ZVRA 3JQEA 3SF8A 1HW2A 5DP1A 3TO5A 1TQGA 4P4NA 1AQIA 4EHJA 4CFZA 5M5BA 3A28A 1SUEA 3FNRA 4J0JA 1XVLA 3T9EA 2VAPA 4KNWA 4IWYA 2Y71A 4MA5A 4Y6OA 2FFBA 2QP3A 1QV9A 1PL6A 2MTBA 4QUJA 1R15A 3DW3X 3JASB 4DR6B 4XWKA 3RC9A 2V0CA 1GQRA 1IOZA 3NKEA 2VJLA 1M7GA 5BN4A 3F96A 1XI2A 4A4AA 4C7MA 4OP3A 3ZC4A 1OYVA 3IX7A 1IAVA 1ZIDA 2N0SA 4H4DA 4TUYA 3PXDA 5LM3A 4HDSB 4UDYX 5EE5B 2NADA 4RCZA 2A4KA 5CVUA 5F64A 1XJWA 1OMOA 4BE9A 1SVUA 4MQBA 3IPAA 3QLJA 4KQKA 2WYUA 1GO2A 1L7QA 1VOTA 1OQAA 3KBOA 2LIGA 1YBAA 3GLFB 1MGPA 1QHHA 1S02A 2A9OA 1RQRA 2PEYA 3VR3D 1XTKA 2REOA 3FNFA 3E7XA 4K8RB 1YDHA 1I0IA 5GMOA 3ZOKA 1J06A 3VPFA 3WO0A 4KRFA 6GPBA 5AW6A 3C6BA 3ESYA 1T10A 3KAPA 4NBLA 1YDFA 5JRDS 3UH0A 5LBIA 5AUNB 2VVTA 3CF4A 4MVJD 1GQQA 3QNWA 4UFOA 1G20B 3PNYA 2P4SA 4JEHA 4K5QA 1SQ6A 1HF3A 3A3NA 1M2WA 5E7JA 3DULA 1G291 3M70A 3STTA 1D2HA 2UDPA 3U0BA 1YXMA 3L6EA 2M32A 4RORA 2I2WA 1I7DA 2ZI6A 1WHSB 1TFKB 1FFCA 1NIJA 4TWRA 5FNVA 1Z63A 5CTJA 4ZTZB 5SYNA 3JQ9A 1Y7LA 2ZRNA 1ZJWA 4BCCA 5JYDA 2ZS8A 1K97A 5T8KA 1P2GA 2V5AA 3C7KA 4F8YA 4YL3A 3NYIA 5GZ3A 3ICEA 4QAJA 5ESWA 2X1HA 2GSWA 1E3MA 5IJZA 4OU4A 2JLSA 5CB4F 3EASA 1RXVA 5H16A 3DLHA 1CSEE 1LIHA 4ZT6A 3C5VA 1K6JA 2XRMA 1RWNA 4EO7A 5KKAA 4TT3A 5EWLB 1LBTA 2PL3A 5DV9A 1KE2A 2HBQA 1TLFA 4XR9A 5IVKA 5BN3B 1E6CA 3QY9A 5BQPA 4QGSA 5FI3A 2RGYA 2BL4A 1I5EA 1TE2A 3P2JA 4ZCIA 3NBQA 3M4YA 1MRNA 3C3KA 1U8EA 3D3QA 3TLGB 3P2EA 1IL0A 3AR5A 4PXSA 2FZCA 4NWIA 3A11A 3MLEA 2GSDA 1V3UA 1CR6A 5F1KA 3W9YA 1AA9A 3QZCA 1AZWA 3KSZO 4ZVQA 1SOAA 2CNDA 4BG0A 2XUDA 1L3BA 2FPGA 2F4NA 2FRXA 1RW4A 2ZJZA 1ZVKA 3P5SA 5FOWA 1FP2A 4JC8A 1QONA 4CHTA 3S7ZA 3SC4A 5TRTA 5B3IA 3MWEA 5DM60 1P44A 3KJFA 4DWWA 2I0FA 2KSFA 1KO8A 5EE9A 1L3CA 4MYSA 4JC5A 1U0OC 2QYTA 1E92A 1NBME 5K8VA 2IJGX 4AWXA 1T6NA 2FG7C 1LDEA 4PX9A 1USUA 3NRBA 5FI1B 2D1FA 2XCQA 2OEPA 3QFHA 2CHEA 2HI0A 4V0SA 2J9GA 3P45A 2WZLA 1U2GA 1LWNA 2VJOA 2WF9A 2B0CA 2WTXA 1E3JA 1U8UA 3CFYA 2H8KA 3W3AD 3N3AC 2OCLA 2WFLB 1F8GA 4Y7CA 3P0JA 1MNEA 3L82B 4DA9A 5EVCA 3QLTA 3ZQJA 1ZM2A 5AKJA 3TCKA 3RYFB 1NSGB 4PZ9A 1TYZA 5B1YA 4E03A 1DBVO 3U6KA 4CLRB 4ZHSA 2I9PA 5JISA 2OD9A 5INTA 4M46A 4O0LA 1Q6ZA 1O4WA 4MOWA 3KWFA 1Q7CA 1QQ6A 3KLPX 1KK0A 2B82A 4PFKA 2J9YB 4JGIA 4U2BA 4JEAA 3GCZA 4XX1A 2NSHA 3FXHA 5EJ7A 5C7YA 1XRRA 2QL9A 1PGJA 3BJRA 2NVBA 4OHRA 2PWYA 3KV1A 4IJJA 1GZHB 1OX5A 3VRCA 3MFNA 3EIWA 3FZNA 1NVGA 1L5NA 3RC1A 1HOXA 4B3DA 1V25A 1IZ9A 3NTVA 5EIAA 3ZTWA 4CS8C 5K6RA 2P3SA 5ARDA 4GR9A 1FS4A 2VDRB 1T8UA 1IY0A 3OOJA 2XHEA 2FSHA 1WDTA 5D5HA 3LP8A 3ZV5A 2CFTA 1GLGA 2NT3A 4B44A 4BVAA 4UHBA 3ER8A 1DARA 5BXYA 2WU0A 4C4ZA 5AI9A 3KR0A 3DDOA 1LSSA 1CZKA 2GDCA 4Q5SF 3KVRA 2JFOA 4ZO6A 4F2GA 4CJOA 4TN5A 1G3IA 1AU9A 1RC0A 2ZWOA 1L8QA 4EB6A 3CHYA 4FP9A 5HHTA 3F5SA 3LU1A 4IGKA 3WYNA 3DOFA 4V39A 3FAPB 1YC2A 2VDQB 2OMEA 3GJQA 2EFGA 2R03A 1MZVA 2RGUA 4ZAZA 1V5IA 1MNDA 4P7BA 1CNEA 1X6VA 2JANA 5B30A 3MYRA 1QG4A 3IPXA 2R6HA 3I6YA 1WY7A 3L84A 1UAAA 1FF9A 2VDPB 4KWHA 2VP6A 3L0BA 3Q7LA 2IIPA 1M66A 1PV1A 4NYMR 4KP7A 4J07A 4H7HA 5JXGA 5BO5A 4ZAXA 2FPKA 1XTRA 1JL3A 2OY0A 2LP4Y 5JXIA 3RF3A 1FUKA 1U2DA 3UWSA 1ZIPA 1H2YA 1UBFA 2FSGA 4F4BA 3M5DA 2YRFA 1T0JB 2FZEA 4F56A 1T8PA 3G89A 2GLXA 5GOZA 5EJIA 2MINA 2J7PA 4RWEA 4LXHA 3PFFA 4UM7A 3ADKA 1A4UA 5A6SA 4TKMA 2XMGA 1MA3A 1PD1A 2SKEA 1LH0A 1QIGA 2NOAA 4ZOBA 1L4EA 3KM0A 1QMPA 1HQDA 2KNHA 1G21E 4QJ3A 1TVCA 2M6LA 1J20A 5C9ZA 1YR8A 3N8GA 2RI6A 1EWKA 1KY3A 2MSKA 4WE3A 4N5DA 3IP1A 4J91A 1YONA 1DRUA 1ZNZA 3TECE 1PX2A 2IYPA 1X7WB 3N3BC 1G4AE 1AN0A 1APCA 5B37A 1KYYA 5KYTA 3L0ZA 1JN0A 1RSZA 2IBTA 5AM0A 3N2KA 3LIPA 4B4KA 4XWAA 2PSJA 2IYUA 5CP8A 3I62A 1DEKA 2AZXA 2IOQA 4JBWA 3U44B 5G0VA 3MCZA 3LO8A 3QYAA 2R5WA 4FZVA 2OO3A 2UUCB 1X7XB 3SC2B 4UUQA 3QA3E 1P2DA 4YXWD 2VWQA 5T6BA 4RWZA 4G1FA 2XBLA 4CIPA 4Z0HO 1L1QA 1MFPA 1RHRA 4AJ4A 2G8NA 3TOLA 1KJ9A 3MM4A 1FTYA 4BYGA 3A3YA 4IOJA 3V00A 4S1OA 1X70A 2YWAA 4RTKA 5KYNA 3DD1A 3LUTB 2H2FA 4JR2A 2D4UA 1TQ2A 3SZLA 4AP6A 1AKUA 3O94A 5LYJB 1XVAA 1QYIA 1T0BA 3R9KA 4YUWA 2ZUBA 3D8SA 2QD1A 2ACEA 4F46A 1E5QA 1YKGA 3KUKA 4J49A 1F6WA 2WU3A 4LOJA 1JLMA 1G5PA 3DTNA 4OJNA 4G0XA 5THQA 3D0QA 4II7A 4IXWA 4IIJF 2JLWA 2YHSA 5D85A 3RS8A 4BJ6A 5JJ5A 2FWAA 5KTNA 1Z4NA 4WGFA 2WT9A 4JL6A 3MF4A 3JR7A 4YDQA 2YX1A 3DEJA 4NU0A 2OHFA 2OAP1 3DLTA 3O8OA 2OLKA 2P3LA 4LNAA 2GTHA 2XADA 4DVGA 4CF7A 2L6GA 4GGPA 2MSEB 3LXRA 5F52A 2OXTA 1GG5A 4O2AB 4Q34A 1BN7A 5IT9A 4EIYA 3PI6A 1UZUA 4H9GA 1DOHA 1ZHHA 1UAGA 2PKRA 3IT0A 3R9WA 5I4CA 3SPXA 4JIGA 3R0IA 6AT1A 4NOKA 1K7SN 1L4YA 2YASA 1INLA 2DLNA 4UQLA 1L8OA 3W2HA 3UO8B 2ZUTA 3FHDA 4EABA 1ONPA 4UHFA 1YIAA 4M7OA 1WDMA 2VSXA 3LZCA 4URXR 4LJ5A 2R65A 4PSVA 4O63O 1L0BA 1QQ5A 1GAWA 1KI4A 2GJ8A 5KINB 3K8QA 4LBZA 1T1JA 3DMHA 5D3QA 3IP6A 2KLHA 2VL7A 5IBQA 1LVHA 4ZV7A 2DUJA 4IVRA 5EWMB 4FHEA 3RS5A 1TCUA 2O8FA 1KJQA 1W8IA 4IEFB 4DNXA 1FFTC 3R7AA 3E27A 2A0YA 3AB7A 1UBHS 3OCYA 5HE8A 3BZUA 4P31A 1ZCZA 4NBTA 5EZQA 1BKDR 4PQYA 5JEDA 2PCJA 3O47A 1U1DA 1BWRA 4KKXB 3BXPA 4GU5A 3K1IA 1P6QA 2CNNA 1MIOB 1QBGA 5B1IA 1Z8NA 4UU8A 4AJ2A 2HOQA 4JLPA 5F5FA 3V4RA 3UTDA 1RXUA 4MS4A 2BF4A 1L5SA 3IBFA 4DSOA 5TC4A 4JDUA 5JBQA 3I5PA 2Y1LA 3P97A 2NTEA 2XNSA 3UQYS 2G1JA 3RQGA 2R751 3LLCA 2ZUUA 4JC4A 2V96A 5JCZA 1QIHA 2HCRA 1P7PA 2N9UA 4HLNA 3QQPA 3IBCA 3NTXA 1HFEL 2JIZA 2YXNA 5KTKA 2CJPA 3H65A 2JGDB 1FP4B 5DHRA 4R83A 4ER0A 3MT7A 4NV0A 3HDTA 4DWJA 3AQIA 1UKYA 4Y0VA 5CI8A 3OEED 1EDBA 3F6EX 3T6BA 4JB8A 1RIFA 1J7KA 3H11A 1YHNA 3KZCA 4R9UC 3ORRA 5K3EA 4P2GA 2DSNA 4Y7DA 3F7OA 4KE7A 2WKRA 1BA2A 4UUAA 1JFFA 2OOKA 1MIHA 1C7ZA 1VBNA 1JLLA 3MN1A 2HS5A 1AX9A 1XUOA 3BL5A 1RQLA 1C80A 5BQOA 3U0CA 4HV4A 1LUAA 4WEOA 5C3MA 4RVOA 5ALEA 5DNAA 1HE9A 4U9UA 3SXKA 3SG0A 3L40A 1SOUA 4E14A 1NVMB 1V16B 3FTQA 4NXNB 1CY0A 4UHHA 3ETCA 1L5FA 3COSA 3QXGA 4TTSA 4BAUA 4DCTA 4M87A 1K7CA 1EHCA 2NSJA 5EYPB 3AV3A 4AAYA 2XW6A 1GZ5A 3H3FA 3A06A 4MUEA 3V7OA 4IIFA 2I15A 4CLOA 4BNNA 1O77A 1ONNA 2FXVA 2I29A 1ZD3A 3FYUC 2P2CA 2JGRA 1SWWA 2C7RA 2Q2QA 3G8DA 5IJWA 2E4WA 3D6FA 2NU6A 3DFMA 3AVPA 2XXBA 4DRIB 1X8LA 3AEQA 3GFGA 4ZCLA 2QS9A 3QU5A 2NVOA 5H0IA 1PUIA 2UUBB 2GAFA 2OK8A 2ZRPA 1AV6A 4QJBA 4YAOA 5H02A 3RSSA 3G8CA 1R16A 4P3KA 4UUBA 3K8ZA 3ZR4B 3KAKA 3HNKA 2YZMA 1ULZA 5E2BA 3TAXA 1KMIY 4HGNA 5IT0A 3IVCA 3EIUA 1ADGA 2GAIA 1D6MA 1X0XA 3I2KA 2B4QA 4BNWA 3KK0A 1E9EA 5K51A 2VKTA 2O59A 1JPJA 2PXHA 4DBQA 1EE9A 4DV2B 3GAZA 4Q21A 2XH8A 4NCXA 4XAQA 3SXZA 3R7FA 1ZCBA 4FEGA 1L7DA 2ZUWA 3IAXA 3O8RA 1MRSA 1VCIA 2PXAA 3QE9Y 2OCPA 5ICFA 2BELA 4IMRA 2G1KA 5LCXA 3W5JA 3CRW1 3KJEA 4Q6WA 5K0TA 3KFLA 5L4SA 2A7QA 4U5FE 1QQTA 4QSHA 3U9JA 1CJUC 2YN4A 3H1GA 1PHRA 5JASA 4H1HA 2VRWA 2OQIA 4OJKA 1OTXA 3SX0A 4JITA 4QSMA 3L7OA 5K0SA 3VSCA 4LHYA 3EAQA 2RCYA 1DX9A 4CDRA 3A4LA 4DMGA 4LGMA 3CEHA 4WMLA 4BAZA 1K8RA 3A7DA 3BXGA 4E12A 1WKBA 4O3MA 3VZSA 3QWBA 1DAOA 4YMIA 2BDTA 1C7FA 1O97C 2H0QA 2DJIA 3PQ2A 4DWVA 1P4RA 1XQXA 1DTWA 3FOEC 1KWGA 1VLLA 3PQ8A 4TGLA 4F6CA 2VJMB 2YNMA 3LUBA 4TXLA 4DEYA 2VHZA 2CSUA 4IHJF 3WADA 3T12A 1SUIA 3D3JA 4DDVA 4WNIA 5I4KA 5HRUA 1T9HA 3B20A 2GK3A 1UDRA 1AZSC 2AG8A 3GLHA 4G09A 1L5QA 5CVDA 4MW7A 4C21A 1Z75A 4P2BA 1N0HA 1XROA 1I3MA 3WMFA 1E96A 2B1IA 3JD1A 1IY8A 3NWBA 4NDZA 3NYJA 2AD5A 4DLAA 2PAAA 4YREA 1XP8A 5DYNA 1K75A 5B1SA 1T0PA 1RABA 3JQAD 4ALIA 1KH2A 1FK8A 2QTCA 5NULA 4URVR 3FBGA 5E9WA 1KY2A 2JFZA 5ERGB 4GZMA 4TVSA 3NZEA 4KPEC 4KLAA 2Y9MB 2GPAA 5L4NA 4QVKA 3IQHX 3DWIA 4EYGA 2PHZA 1E6EA 3JARA 3I4UA 1VL6A 3JYLA 3OFVA 4JLJA 2LBPA 1F51E 1J9GA 2C2OA 3VPXA 4PFOA 4CGYA 2D7JA 1HG0A 2F3RA 4I8DA 1H85A 5LQRA 5AJZA 4X90A 3W0LB 3FKSD 3DE3X 5ICEA 2QGZA 2LD4A 3HEAA 2YINC 4OHZA 4OSEA 1D0VA 4KXVA 2ZFUA 1OU4A 1EP1B 3RIEA 1IK6A 5EIWA 2X3UA 3U3OA 3NAMA 5FTKA 1EGAA 3LBYA 1MN6A 4K9KA 2Z30A 5LR6A 1KZGB 2AN1A 4TWZA 4J0FA 1KVQA 3IFSA 3KTAA 3IAUA 5FI5A 2MHCA 2CNBA 3HNJA 1WEHA 1S8OA 3FOZA 1XJ0A 1MOZA 4HMPA 2VNKA 4G5OA 3USES 1P17A 2IDZA 4KQ1A 5J2TB 2RAPA 3HB5X 2J4FA 3VDMA 4IRXA 4U6NA 4TPKA 3ICCA 4KIGA 3U2MA 1QCZA 4JMPA 4Q3AA 4DZRA 1KH3A 2ZYVX 3BWMA 4CUZA 2E37A 4W8PA 3BTOA 3SBDA 1C9EA 4LW8A 2CDAA 4BZZA 1NBBA 2QVZX 1GSIA 4AXBA 1ZOLA 2FAPB 4UKDA 2RG7A 4QVIA 4L74A 1AURA 2RGAA 4DJDC 4CKYA 2EWWA 2O0JA 1ZS9A 1FX0B 3TLYA 3HADA 5LLSA 1E1YA 4LI3X 2JF0A 4M0FA 4BO1A 1P1JA 1KO1A 1DJLA 5KB3A 1ZK1A 3GD7A 3PEFA 4BNDB 1TTHA 4OQXA 2A8YA 2IBFA 5J1TB 1GPBA 4D99A 3PQEA 4ZYVA 1JR2A 4P86A 4Z2YA 7YASA 1L5ZA 5KHAA 5CB4A 2VK8A 4BV2A 5HZHA 1K8ZB 4HUTA 3AFGA 1N7GA 2W2LA 5DCLA 3KYJA 2WJJA 4HDRA 1U2EA 3EIHA 3W4KA 5JRZA 2ZUEA 3ZHZA 3WMRA 1Y6ZA 1DV2A 1G2IA 1G8SA 5LBTA 2VUSA 2A5LA 2XQVA 3TD2A 2TMKA 2JIDA 2C04A 2I5PO 4D3YA 3SNHA 3R7WB 2R7KA 4ARUA 2FN4A 4NR0A 2A6EF 3D8RA 2V03A 2B9VA 1YJQA 2HPHA 3Q7EA 3GBSA 1S7CA 3AVXA 5DK4A 4UTZA 5JAZA 4CQLA 3C8HA 221PA 4IJUA 3K0HA 2R1VA 1YJ5A 3ONVA 4I5FA 4DCGA 4NEGA 2X2EA 5EZYB 1KEEB 4OATA 3KKNA 1PZFA 5HZMA 4JY7A 1BAPA 3MG9A 3DM5A 2I8AA 3ZWYA 5CLJA 4XR4A 4MW2A 5JJKA 2QN3A 2W37A 4F84A 3TCXB 2ZSHA 5CA1F 4WLNA 3NV7A 5AVYA 4OVKA 4E7PA 1L7EA 2UUOA 3IMGA 1R6BX 2XA9A 1LPEA 3E9ZA 4EY3A 5DYIA 4O6NA 3OKFA 1Q91A 1MB2A 3SBXA 3ABOB 2H17A 1Z4JA 1TZKA 1OXBA 1QVXA 1BZ4A 2C8JA 1X14A 3UC5A 3KHTA 5GZ6A 1SJ9A 1U7WA 2OOSA 1DQRA 3NDIA 3A0UA 3TD6A 4BO7A 2EYUA 3U13A 4FTWA 2CC2A 1XWJA 2FPIB 3F67A 1KORA 5DKFA 3WFIA 5FF9A 5HIKA 4XUEA 1THTA 2ADFA 2JAWA 1IK4A 2NPIA 4HS9A 1F9AA 2C42A 1XZFA 4WOCA 1LRLA 1VE7A 4RLHA 1P7YA 4HYTA 3H8JA 4ALMA 2AFIB 4B7XA 3HCWA 3NHLA 1GRCA 3MX3A 3W2EA 1I51A 2FW7A 4WNYA 3PX7A 3U7QB 1OWNA 1N1GA 3TTTA 4B2LA 4CN8A 1UFRA 4DDUA 1TYBE 4O25A 3S40A 3ZBUA 2PX0A 2Z5FA 1P4GA 4MV8A 4JD5A 1O96B 2IHUA 2PWPA 3ID6C 2BGUA 2PGAA 3WI7A 1WS6A 5L45A 3B7GA 3GN2A 4IHKA 5KX5B 4DGSA 2Q9CA 1SOWA 4ETIA 3BA1A 3Q7QA 4AG5A 1P2VA 3ZS8A 3OIUA 4J6FA 1M5RA 2CD9A 1KS9A 3FPAA 2ZKIA 1IVSA 3TR6A 3NDBB 1BX3A 5E33A 3SZUA 4GX2A 4JYBA 4RK5A 4TV8F 4E17A 3S9OA 2X42A 4GP7A 5EK0A 2XAUA 4C3BA 4CIWA 4XCVA 3VZCA 3PNBA 3EVGA 9LDBA 1Q6YA 5ADUS 4A2NB 2GBCA 4IIBA 4MMXB 3DLAA 2IK8A 2YC4C 3IP9A 1YQEA 1SBZA 4DMRA 2C88A 5BNTA 1YQ9A 2H1CA 3GA5A 1HXHA 4RV9A 2C20A 3VRHA 5IF3A 3AEKB 2FPMA 2FZ4A 2GLTA 1RVV1 1XTSA 2PKQO 3DYBA 1MO2A 4AJEA 3WGMA 2W11A 1GAQA 4PPQA 4LXUA 4IZIA 1KRXA 1H9GA 4D4NA 4GKKB 2B9EA 3VU3A 5EMNA 3WK6A 3U4DA 3PFIA 5DIZA 3A6LA 2EX4A 1UDBA 2OENG 4OAQA 1NZJA 4MR8A 16PKA 5HR5A 3LTNC 3GWNA 1K6MA 4HZUA 1FNSA 4TQ9A 3PL1A 1IB6A 5ALHA 3K72B 1DAKA 4KR7A 1OBVA 3SXYA 1LF0A 1UBGA 1F1BA 3QXXA 2R8YA 4JVNA 5AT1A 2FR1A 4XTCS 4PTZA 1N0IA 2FPRA 4QXRA 1OX6A 1K8XB 1G8YA 1G8MA 4A91A 4FJ0A 4S1PA 4NPAA 2RGXA 4HAVA 4XLPF 2P62A 4BXOA 2WVGA 2WIBA 3REOA 3PGVA 3VAYA 2WAMA 3BL6A 1NXQA 4CTMA 1QQ7A 4XQ0A 3H2YA 2EJCA 4WKNA 4YDHB 2O3QA 4DJTA 4MNDA 2WA1A 3E22A 2WHPA 4MPJA 4KRYA 5IEJA 1WSDA 1DKQA 3ACBA 3SN6A 2C7BA 3ZE0B 2DSTA 3V5ZA 3N6RA 1QRTA 1OKKD 2VJDA 2P6NA 1Y1QA 1XDUA 1EDZA 3O10A 1EK0A 2Z6QA 3QJGA 1E9RA 1QGDA 2MWQA 3JX9A 1CQIB 3AHHA 4OYLA 1JXQA 4LDJA 3AKCA 1P0MA 1JJIA 1H6CA 1J24A 4RA6A 2VPTA 2IVFA 2ORWA 3PG5A 3TZKA 1PJZA 5A4KA 5A3SA 2QU7A 4EHDA 1EQUA 1NURA 2I9KA 4JKVA 3BRWD 1JR3D 4Y2TA 1T24A 1K2VN 4O4LF 4FDLA 2Y05A 3KAQA 1RLUA 3P2OA 5AHKA 4Z3DA 1NVFA 2WD7B 3ZWWA 1NV9A 3W8EA 1U9IC 2C84A 3WOVA 2JHCA 2QUAA 4CIVA 2OV3A 3MMNA 4AZWA 4OFWA 3HYSA 2XE6A 4I36A 1R37A 1UBOS 4FK8A 2R48A 1HNNA 4DXDA 1WQ1R 4XJVA 2Q41A 2ENWA 3O7WA 4TMFA 4LDPA 4KRXA 4LWQA 4QRHA 4KR2A 3BDVA 5EJGA 3CPEA 5K2OA 1SKUA 2NTJA 3EXEA 2JW5A 4AJHA 3GFVA 1P8AA 2UZ1A 3ROKA 3SHWA 3ZHXA 3K70B 1YHZA 4FONA 4ZK6A 2VNHA 4CSAC 3EW7A 5KMGB 4XUGB 2FWRA 1MX9A 2PQ6A 3WRXC 1C7IA 4IIJA 1OWMA 3AWIA 3T1OA 3NKDA 1EK2A 2CK3A 3V97A 1F8FA 3PTLA 3JXEA 3PNSA 1CUHA 1VHJA 1Y6FA 1D07A 2QQ0A 5HQ3A 4CL3A 3AR7A 1WUTA 2H1HA 5FL7D 1RKBA 5HF6A 4XQ9A 4CS9C 4GUAA 4A0SA 1SZJG 2O3SA 3F49S 3RYTC 3PNOA 3UQZA 2G04A 1JA9A 3H97A 3OECA 4F21A 2AXPA 2ZE5A 3QFRA 2IEYA 3OQIA 2RG1A 1EFLA 2ZB2A 4V24A 1T13A 1Q95A 3QH4A 1Z8HA 5EJ2A 1HE2A 4ZEXA 1VTMP 4U7DA 4WNAB 3A14A 4Z9AA 1HO3A 2GASA 1J8FA 5JZBA 2X19A 2I1VB 5ALXA 5K99A 1U1FA 4J43A 4FSHA 3FNHA 3TR5A 4CT5A 4LBYA 3FSGA 2QTZA 1XG5A 2ODBA 5DLDA 3DF7A 4G4SP 4C07A 3PR1A 4DADA 3X1JA 1O0CA 4E4RA 2O9XA 3PLRA 3CBGA 4DKJA 1VJDA 4JLOA 2X9LA 2V4UA 2P77A 2ZIGA 2ALJA 3CH5A 5DNYB 1N6OA 2LPMA 1AUVA 2WSMA 4MQ9F 2YJ3A 2PZGA 5D00A 4QRIA 3EZIA 1O5IA 2JCVA 3WMGA 2A5GA 4FCCA 3PDCA 3GY0A 1WHTB 2RSLA 2YRXA 2PH1A 1NRXA 1T36A 2GCOB 3UYLA 2IZ1A 3K16A 1MQAA 5K8IA 5LSAA 1IQ0A 1R00A 4DV1B 4A92A 4J1TC 2FSVA 3U61B 3FVRA 721PA 3HS3A 1CUAA 4U0KA 4HFKB 1H66A 2BBTA 4W8GA 1H9TA 3O9MA 3IDAA 4TTPA 4B09A 3WSWA 3CX7A 1LLCA 1NSFA 2MYNA 3FWNA 4HJXA 4Z7QB 3TLKA 4GSKA 1UC5B 5D8DA 5JAOA 2P67A 4QFCA 3ICOA 2L81A 1QFXA 4OMFG 4XVQA 3PJGA 3CUWA 1DJQA 1B74A 1NMSA 3A6PC 5IH7A 4MR9B 3EQ9A 4QQNA 5K6AA 3CNOA 1MHTA 3WGNA 3II6X 4YJ2B 3NVMB 3KPVA 4G67A 4WX2B 1MAAA 1U8YA 2VOJA 2JAQA 1Y42X 3M6UA 4DUZB 4IY1A 1FDIA 5G3YA 1A8PA 4ZVTA 1BJRE 5KTPA 4QDZA 3JQ8B 4G37A 1DO8A 3FFAA 3GJYA 5JRAA 1ECJA 3HZRA 2PCLA 4DNFA 1NBOA 2A7XA 4ERNA 3DB1A 3GJSA 3R9XA 4J9VA 3N2NA 3VYSB 1W5TA 4CDVA 3D4NA 1NZEA 4MKZA 3FMVA 5LXTF 1UXGA 2ZYIA 2Z04A 3R4VA 5ALYA 2MMCA 4C0XA 4Z0NA 2D0OB 3IB6A 1OILA 3PI7A 3G2JA 4E46A 1GV0A 2AG5A 3SI7A 4AIRA 3JT1A 3TL3A 2IUTA 4P9TA 3RT9A 3FWPA 4PS0A 1DC3A 4Q82A 2GPWA 4PO8A 5JNSA 1N9ZA 1SBHA 2PXCA 4E33A 4WZAA 4GC9A 4YI5A 4D80A 4FFBB 3D02A 2IU4A 3T15A 4TLAA 3B0VC 1U0TA 4YRPA 2GM3A 3NATA 3OKCA 2C3OA 4C7XA 2AZTA 4MDFA 4KIFA 3V1MA 3LQ2A 3NASA 2I7CA 1KAQA 2BEWB 3QLUC 5DOVA 3LV8A 1RJ9A 5UKDA 3UNGC 5AO9A 4DGQA 4ZDJA 3VAZA 1UPXA 4JLAA 4RS4A 1E1RD 2YWBA 2WKQA 1F2DA 5K5EA 2GEDA 1NKVA 2LZ0A 5IDYA 1HEYA 3JWJA 3KWLA 3NM5A 4WA8A 2HJGA 1M6EX 4ZOCA 1CRQA 2R02A 1N5RA 1NOIA 1YSCA 4HH1A 5DOZA 2BEUA 2OGSA 1P2BA 1HE1A 4KMRA 1E77A 1OJ7A 3NQ41 3GFBA 2BI7A 2EVWX 4CLDA 5A3VA 4KO8A 2ZS9A 3HO1A 1SC3A 3DQQA 3T7RA 3DZBA 1SCAA 3I83A 4G5XA 5KJCA 1NU9C 4FPXA 3AJEA 3WYDA 2PUVA 5D3KA 5J5VA 1LD3A 1Z62A 4DG8A 2GAOA 3NAZA 3OPYI 1NQTA 4TQGA 2RKBA 4DCPA 3O93A 3SHVA 2VNSA 1Z2CA 1RE0A 4NDNE 1YB7A 4DLBA 3B1XA 4GZ6A 5FL3A 2IFTA 2ZXOA 1SBYA 5U1PA 3K9BA 2D7DA 2RI0A 1K04A 3DDWA 1E69A 5CJ2A 4HUJA 2EQAA 4Y6QA 4X3CA 2GBFA 3I4CA 3E05A 4FMBB 1P2UA 1KQPA 4ARCA 3INGA 4CDGA 1ZMXA 3EWSA 3KUCA 5HJEA 4Y0AA 1Y9JA 2Q1SA 4K9PA 4YWJA 1BFKA 4FNOA 1JHVA 5KS2A 2V8OA 1E2LA 3SEFA 4FHDA 1CULC 4W8KA 2FP4B 4B3CA 1O7JA 1Y63A 4G0PA 2FSFA 3DD5A 3K6KA 2ARKA 4EGJA 5JHGB 1VCMA 5CDYA 5AHWA 2NWQA 2OAEA 5C4MA 3E9VA 3QTLA 2HLDD 4NNPA 4UTOA 4UW9A 3LCRA 1IXZA 3ZXSA 1NNUA 2PFKA 4AIIA 4CI9A 4G07A 3RU7A 3MAAC 1Y4AE 1Y89A 1ZO8A 3CKMA 4CU5A 4LJ8A 2WYOA 3WRYC 5ELMA 4BMSA 2NUPA 3S81A 1LCIA 2HQRA 2CY0A 1HEUA 2XEXA 5C37A 3FDZB 2ZKLA 4IHJA 1T9KA 5K3DA 1EINA 1GUDA 2ICAA 4FYXA 2QAJA 3Q6IA 1UZLA 3O2JA 5DU2A 4C4SA 1RXYA 1HLDA 2H5IA 4QDXA 4OH1A 3N75A 3WKBA 1KO5A 1GCGA 4ZO4A 2I6GA 3JV7A 4TWJA 4WBNF 4LSMA 4FGSA 3H5OA 3Q7PA 4CJXA 1DFIA 3BFVA 4HN4B 4UNRA 2JH3A 2XJ4A 4B6FA 4KBYA 2PJDA 1ULUA 5JSZA 3CM0A 4TYWA 4GI3A 3VBCA 1V4BA 4Z8YA 4L4XA 1II8A 3D8BA 3G49A 4BTVA 2FW0A 3G4ZA 3HFRA 4KWTA 4A0FA 5MHTA 5AICA 3VQTA 1MVOA 1Y5IA 1GARA 3G59A 4PGMA 1RYEA 2GF2A 1R6TA 3IPCA 4Q7CA 4YRBA 3AHEA 2NZUG 3TDKA 2DY1A 3DB2A 4LF9B 1TT5A 5HJ2A 1U3TA 3UJDA 5JSUA 1RI3A 1XBTA 5K3BA 2JJQA 5REQA 1ZUD1 3WNVA 1FTQA 1HT2E 4HK4A 2HU2A 3CZ9A 1QR2A 4M1OA 3I32A 4FYYA 4ZEWA 1VBFA 3H5LA 1ZHOA 5AGFA 1TKAA 4B32A 2YHIA 5JY1A 2UZ4A 4QXPA 4XEFA 5B57C 3TTXA 3E35A 4NPCA 2OM2A 2XUZA 1L1EA 3FMOB 2B99A 3WJAA 4NC9A 1OZ0A 4GM1A 5KNCH 2JKZA 2FKNA 4P7JA 4K9RA 3UMRA 3VDNB 2ODEA 3GB9A 3ASYA 4FJ2A 1NLUA 1Z0IA 2HJSA 1T9ZA 5H9VA 2EKPA 3GVIA 2Y76A 2XEDA 3GO4A 4BJ1A 2PFDA 1NJFA 2A6PA 1D0SA 3C39A 2UYYA 3GXOA 2Q3HA 4ZI2A 3LAWA 2P0EA 4DR5B 4O59O 4HD8A 4ML3A 2ZIWB 5JPDA 4LVOA 4UNNA 4YT5A 1VSVA 2YV3A 4RH1A 3FW1A 3CA8A 1GV1A 3P9QA 3CZPA 3W5CA 1HQYE 1XU9A 1I9GA 2QX6A 3RIXA 3DL4A 4FHCA 5EP3A 5EIFA 2IXMA 4LX0A 5EIBC 3NTQA 4WCVA 4MICA 3MTIA 3M1AA 3RWBA 2AOXA 4QQRA 1QK3A 4OBWA 3KSMA 3L8FA 3QP9A 4OLFA 1JA0A 2H4JA 5KOHA 1SQGA 1WASA 3H3JA 1DGQA 3KWMA 4C29A 4NK5A 1WV0A 1E58A 1IWBB 1VMAA 1YAUO 4YRQA 3BS4A 2AXEA 3MTEA 4DQXA 1GTZA 3LWDA 3UHPA 3VR6D 3KVNA 1YA4A 3VKHA 3A4YA 1MHPA 3G9UA 4EEZA 1AUEA 1MNAA 2B69A 1X9HA 3HA2A 5DIFA 3VZPA 2ZD9A 3MJRA 2QNRA 4ECEA 2ZAMA 4IVQA 1SB8A 4LDAA 1DNPA 2BKLA 2NPOA 5JMWA 4CKEB 3LE8A 1G8FA 1I3NA 5T1DB 3A2KA 4IXDA 3MOGA 1Z2OX 2QTMA 2GGSA 4RJIA 2G5GX 5DCYA 1IH8A 1OA1A 1HDYA 5DBHX 2AGVA 2A33A 1M2OB 2VRNA 5KVSA 1SB9A 2IP4A 1VYKA 4OIRF 4I4TF 4RIFA 3F0TA 4I4IA 3NEJA 2RJNA 3HKCB 2Z58A 5CTAA 1O4VA 3ZNNA 5T7BA 4CF5A 4X97A 5ALJA 2FLWA 4C06A 4EBJA 3WHLA 3SIRA 4KHPB 2ZRFA 3CUTA 5KOJB 5MN5A 3NJ4A 2GERA 4QARA 1Z28A 3T06B 1IOLA 3KEGA 5CA1A 3T41A 5F2EA 3N28A 1GPWB 5I6DA 3NB0A 2BBSA 2BGRA 2Q9UA 4HH3C 3GJ6A 1VIDA 4PBSA 1VL8A 5CLQA 1WA5A 5GVSA 2VLBA 4MUGA 3PNKA 3PF9A 3BQNB 2QKYA 1ZSYA 3EVNA 1WTYA 5AC4A 1H6GA 3ESZA 3M1IA 1TUGA 3KC2A 2FZKA 4BNZA 1DJNA 3EDOA 1U7OA 3WLSA 4MW9A 4QPZA 2ZT6A 3W8RA 2EP7A 2WJIA 2XHZA 3EDCA 5BW6B 4PLZA 1BSVA 2IS4A 1F4VA 1Y6QA 5I9LA 4GI2A 2D2XA 3WV5A 2GN9A 3CZCA 3OURA 1YFLA 5CAEB 3CNLA 4FC6A 1XTQA 1N9KA 1OXVA 1ADBA 4TVOA 3JRWA 4QGHA 3ZCXA 2VCAA 3DOIA 5THXA 4IKPA 2B34A 2Q6IA 3K9GA 5G40A 3MEQA 1WIWA 3KYIB 4DBZA 3WG9A 1N2IA 1JHZA 3B1YA 3K66A 5JLAA 4GPTA 3TIFA 3N53A 2B1GA 1ISMA 4D8XA 2JZCA 3QUQA 1Z35A 4HNRA 3F6SA 1V26A 2IDKA 3UJ8A 1H8HA 4V0QA 3WL7A 3P0HA 2QZZA 3K9HA 1W2WB 2AWCA 4PHFA 1D0IA 4X0RA 4XD7D 1ZOIA 1UCFA 4HQKA 4KQMA 4D0NA 2BY4A 4DVJA 1YULA 3UGJA 2O5EA 4MVRA 3OIYA 3L7BA 4K7JA 4Z9JA 4AJOA 3L01A 4HTAA 5AHRA 3FLAA 3QW1A 1Z45A 1G66A 2WKPA 1OYYA 4HDMB 4JELA 2P69A 4TV8A 1W75A 3U56A 4U5GA 5IANA 2YYSA 3BM5A 3OZCA 1SKQA 1YR9A 4G8CA 5KWSA 1DKOA 4IICA 3IPMO 3KKOA 2OA0A 1K5DA 2CDQA 4GPD1 3NIGB 1YR1A 3EF3A 3RB8A 3ZY3A 3AYZB 2FPLA 1E20A 2A0BA 4N8DA 2DQ4A 2ZIAA 5CEJA 3CKLA 1H42A 3D0KA 1RMVA 3T0FA 4OGKA 5E0KB 1IZZA 2ZUSA 2WF6A 3CF0A 3LHDA 2GHQA 4X91A 5CFRA 4OHWA 4JJ4A 1HGXA 5DDIP 1DDIA 2CL7X 3AIOA 4Y2GA 4D2IA 1I14A 5E38A 2IUYA 3GARA 1IM8A 4YQFA 2PGLA 4OYYA 1XNQB 3L9WA 3K09C 1YARO 3JRTA 4FKZA 4A10A 1YFJA 1TWCA 4NV1A 1Z7EA 4WASA 4X6LA 4U9EA 2QR3A 4CJGA 4TMYA 2QJWA 2Z3WA 3CXRA 2C59A 2ZITA 5E9AA 4HEHA 3R3YA 2R3SA 4N03A 2TRSB 2EBWA 2PGXA 4K6OA 4NRDA 3V4FA 2ZU0C 3GZJA 3FETA 3EGXB 1G3UA 1K3FA 3DEFA 1CJVC 3PEUA 4ITVA 3CZRA 4QM7A 2G36A 4ETWA 3FTEA 4YCCA 1DUVG 3ZCSA 1E18A 5IDVA 4CBVA 2Y0DA 5JUAA 2X58A 3DW1X 5BNIA 4TRNA 5BT8A 4MUAA 1ZNXA 2W6OA 3ETGA 4DXWA 1VHTA 2F62A 4U1RA 2PQ0A 3L9XA 4N48A 1KJYA 4BKPA 4QTYA 3OQBA 1F7VA 2ZRHA 1MF7A 2QM8A 2V97A 4KIWA 2EJBA 3FUTA 1YRLA 4KGDA 4LF6B 3IP5A 1J90A 4OQYA 4JOBA 3IIIA 2LIPA 1RCFA 1W0KD 3FWYA 2P9BA 2QLBA 3W4YA 3YASA 1GGNA 3ZX4A 3CNBA 3W8IA 1RKQA 3IQ5A 3WK8A 4EPXA 4RTRA 3L6OO 1Z22A 2AOUB 4OQ4A 2H1RA 3QNUA 4G01B 1R6VA 5I5EA 1ULSA 3CN7A 4OL9A 2M1ZA 4ARIA 2A5JA 2C9BA 4E70A 2OWDA 4OX9B 3IAS6 2D1QA 3HDQA 1TK9A 3NLLA 2DYRC 4ND4A 3L92A 3U19A 3QW0A 4O4LA 3CYFA 4LWOA 4BKUA 1YZAA 4PWZA 1RVDA 2NUAB 3TRKA 1KIMA 1A2BA 1DC7A 1WVIA 4IX1A 4OXKA 2ZZMA 1RWQA 2QVGA 1XQVA 3JW8A 1E4OA 5EQTA 4CKWA 2AYXA 2HMAA 3EXHC 1VDMA 1TM2A 4MVJE 2OG1A 5HCIA 1UBKS 3PLAE 1L7MA 1P0IA 2EBUA 1LLDA 1QHXA 2CHVA 2XDYA 2VA8A 1V41E 3FUCA 4KK3A 3DEHA 3HXMA 1PR2A 2P8SA 1GZ7A 1ZH4A 2RC6A 5JIBA 3K5WA 2JJMA 3QG1A 3PPIA 4RFSB 5DO9A 5JQGB 4BMVA 4LJ6A 4OIPF 3R24A 4CM5A 5EIEA 3NHFA 3O82A 1JWLA 3WQSB 1FZQA 2E9SA 1L5KA 3GLGA 1CY7A 4C30A 1VXRA 5AK0A 4WLEA 5GJWC 4HX2A 4FFWA 2V58A 1XP5A 4EX6A 5H83A 3HUUA 3GLSA 2IOYA 1EFPB 1JMKC 3WQQA 1KAGA 3BIJA 2J9FB 3EQLF 2XZOA 4OIFA 3L7AA 4B6OA 2Z3VA 1DDOA 1X2EA 3EYAA 4IZOA 2A67A 2N1BA 3SZOA 1W1WA 2Y8EA 4M7PA 3AR3A 2W00A 1DC6A 3DOEA 2JI7A 3K5HA 3RH0A 1I2AA 3KP1A 2H1SA 1GVHA 1NSTA 4G4JA 1WTAA 3NKLA 2QBYA 1TK2A 1AKTA 2GBGA 1JG1A 1XPOA 4MINA 3ET4A 2V6JA 3P2IA 4K40A 2Y3DA 2ZBRA 4MRRA 1TDJA 2CXTA 1MW8X 1KOJA 1U3UA 4J16C 4ZAFA 1Q21A 3WLMA 4A5SA 1G8AA 1WCWA 2WF7A 2YVKA 3CRNA 4RTLA 1G3QA 2WAOA 2VXBA 4NE2A 3IQDB 1UZAA 4YP0A 3LRXA 3Q7IA 3IJRA 4RDIA 1QLEC 3HL4A 4RTSA 3EZFA 1YMQA 1WOYA 1R12A 5JS2A 2I7DA 3EXIA 3FNBA 1P4HA 1HTWA 4KPGA 5CIQA 4HHEA 3KYCA 4HAYA 3E84A 1MMAA 4M49A 4AD8A 1URPA 4M1QA 5FR2A 2HF9A 2Z8XA 1KDPA 4XI9A 3CH6A 1YRAA 3KB8A 5DS5A 3O0DA 3OQPA 2EIXA 3IULA 2BHNA 4AX2A 5G53C 2PFGA 3OBIA 1KBQA 2ZWVA 3FUUA 4OV6B 2PH7A 5BV8A 2QRKA 5CXSA 1GD1O 3WK9A 4I08A 1ZWKA 4FZ3A 1K4MA 3UJ6A 2BOVA 4KYVA 4BO8A 2BI4A 3ON5A 1IIBA 3ONEA 1F12A 2I54A 5IG2A 3T9OA 2FEMA 2OEXA 1G5QA 1ZP6A 1C1XB 4JJ6A 1EDOA 2E4YA 1X80B 3UCFA 5IUKC 4NMXB 1FFEA 2XRZA 3KYDB 1I30A 4MWBA 1ULAA 2IU0A 5FTJA 1OIVA 4Q48A 3NALA 4O8ZA 2G7MC 4HNQA 3DKKA 4URWR 5CVJA 2VBGA 4WVLA 1OUMA 3GEIA 4NABA 3U3JA 2KBFA 4S1VA 1ZIYA 5ELLA 2CEKA 4CMIB 2HWUA 2UZIR 1IY2A 1T0IA 4MGZR 5G0SA 1NKSA 1ZK3A 5B36A 3H1TA 1QFJA 5CDSA 1GN9A 4N9QA 1RE1A 4UAVA 3ESDA 4NU5A 1OU0A 3DOHA 4BFCA 4R7ZA 4Z49A 5L8VA 4WKBA 3LJKA 4V3BA 3M49A 2C7GA 1BX1A 1VYIA 4D46A 4P3XA 3FTFA 3P9ZA 1XF9A 2OGZA 2PZFA 2O2ZA 2Q7OE 4H3VA 2EPLX 5LP6C 1ARZA 2BR3A 3B6MA 5EP2A 3EEYA 3DTYA 3LG2A 3CLTC 5LXTA 2ZT7A 3SZRA 5AKZA 4D9NA 1DKMA 4PAWA 3CONA 2GF9A 5IDQA 2X5JO 1HG1A 4QO8A 2XVMA 1Y8QA 1U11A 1T6UA 3VZBA 4CMCA 3W34A 2ZT5A 5C34B 4UTNA 1R8SA 1VHWA 2WV7A 4MZXA 3RS4A 1DMSA 4R2IA 3G88A 4GXNA 4P3PA 1SCNE 3JQ7A 5CT5A 3ZQ6A 3C8GB 3AUKA 4PC6A 3PQ7A 1T9CA 3PXAA 2FX3A 3U4QA 2ONCA 3MB8A 5FRDA 2CXUA 1EQ2A 3G17A 1KAEA 3T7IA 1S1MA 5J2UB 4E2ZA 1S89A 3AF2A 3D3WA 3L7DA 1BGVA 4RVCA 3AUUA 1HE5A 1XELA 1IBKB 3COVA 4ALKA 1REQA 4DLRA 2H3HA 4Q3BA 3N8IA 2O07A 1ZCAA 3UMFA 4YMSA 1DIOB 4RTQA 1EFCA 2PLNA 4DIEA 4P6VF 1JB1A 5DM70 2R6GA 2Y4OA 5A9SA 5DYWA 2ZIUB 5HGJA 1KFEB 3BMNA 3E9MA 2W2MA 3ZC3A 1TMOA 5BR7A 2VEDA 5F21A 1WXQA 2B2CA 4IIHA 1NJ2A 2Y4NA 3R41A 5TJHA 1GFWA 1M67A 1OH5A 1XNJA 5E7IA 2C99A 4HYYA 1B2LA 2OR3A 5EJ9A 1T1IA 3GJ3A 4J7UA 1SH7A 1OOEA 3O03A 1YRWA 4BLWA 3BMQB 1G4UR 3DV9A 5TGZA 1PT9A 1ZMTA 1P72A 3EPVA 2CJWA 4BNTA 3O1JC 4PPFA 4LJ9A 3PA8A 2QAGC 3ZGOA 3TLXA 4AQYB 2IU3A 3L79A 1RT9A 5KDOA 3RYHA 1LQ2A 3LOQA 4E2FA 2QTHA 3H1EA 4OGLA 1B41A 3K0AA 3IR5A 4HNTA 1EZ1A 3NH6A 2JFYA 5M3BA 1XDDA 4YPOA 1W30A 1T8TA 2A5YB 3C97A 3BEHA 2Q2VA 1BO6A 3MJFA 1TWAA 1NATA 4FESA 4M1EA 1ZD2P 4IRUB 1ORHA 1QK5A 3OQHA 4R1MA 2ZSIA 1FNCA 3VI4B 5LMNB 3GEPA 5FCLA 4PIPA 1G8XA 1LVUA 4N4WA 2E85A 4PG8A 4RHTA 5TF0A 2GT1A 4YT8A 4DJAA 3AHCA 3Q8WA 3N05A 2AUTA 4B74A 4MHSA 2P6PA 1MPTA 2QTGA 4LHWA 2CFRA 1P5HA 1ZHYA 1A5AB 2Q4RA 3FMPB 1Z88A 4HMOA 4BLOA 2OBFA 4BQIA 3RODA 3T61A 4UM9B 3ZTYA 4D25A 2FEPA 1N8SA 2Z2XA 3WLOA 2Q0XA 1E99A 2IY7A 1GXSB 1P9WA 3ZHTA 1IN4A 3PUYA 3AGQA 4X94A 4QHSA 1M1UA 3WLRA 4LZLA 2AXNA 5JVDB 2Z1DA 1QHIA 3B3QA 3FNQA 2V74B 4P5DA 3TBHA 4QGFA 1Y8RA 5AH0A 5J3JA 3OEWA 3BB4A 1AUPA 1H3EA 5CLLA 1GA1A 5DN9A 3WA6A 1FQJA 3IUMA 2AX4A 3U8VA 3DBHA 3OJ0A 4EUKA 2AK2A 1CVIA 1GPLA 4YUXA 1GT91 2NNWB 2PYZA 3CVJA 5IVDA 4WBNA 3JD0A 2Q3JA 4FUQA 2FSPA 4J7CA 2XGJA 2PMCA 2ZDHA 1CJBA 1HFKA 4Q4AB 3PVZA 4RA9A 1JEYB 1GUYA 1NVDA 3M6MD 2W0MA 3BA6A 4GGMX 2I8LA 4KAAA 4B45A 3IHKA 3TQRA 5AKYA 3FF1A 4MVJG 3I6QA 2BFNA 4O1HA 1Y6RA 5A6JA 2CLIB 3WOHA 3I9MA 4AJLA 1G63A 4MLPA 1ENYA 2JL1A 2WW8A 1ZW6A 1EUYA 1U65A 2AJDA 3JQCA 3MCVA 4XSVA 4RQTA 1C3XA 3GW8A 2WJVA 2VYNA 5KU1A 1SD1A 2QJTA 2JGFA 2VF8A 2CB9A 2QLJA 5T4EA 2ZAIA 4Y9SA 4LYFA 2IS1A 2O54A 5C53B 2WYWA 3EQZA 3TR0A