2GFHA

Crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
246
Chain Sequence
HHHMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKVSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Protein C20orf147 homolog (17391249) from Mus musculus at 1.90 A resolution
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords haloacid dehalogenase-like hydrolase domain containing 4
total genus 94
structure length 246
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2gfhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2gfhA01
2D2VA 2GO7A 3AR8A 4C4SA 2ZOSA 3UMGA 4OD0A 1L8LA 3UMCA 3OCYA 1Z4LA 4MWOA 2WM8A 4RESA 5AK6A 3U26A 2G1AA 3QU5A 2RAVA 4FE3A 5ALFA 2YN4A 5AW6A 2NO5A 1NRWA 2O9JA 3N5KA 4KN8A 5AKZA 5AK3A 2Q4RA 3PCTA 3DAOA 3W5AA 4UAVA 3U7GA 4I9GA 4KX5A 4B6JA 3AR4A 3QU4A 1YV9A 5ALRA 1WR8A 2B82A 4AS2A 4HGOA 3QYPA 4MUMA 5ALNA 5ALUA 5ALXA 1JUDA 4L6CA 3SLRA 3SKXA 2IOHA 2GMWA 4BNDB 4DW8A 1ZJJA 4YCNA 3L8FA 2R8YA 2QYHA 2O2XA 4UMDA 3MMZA 3OCWA 4YH1A 4PNHA 4YCLA 4XE5A 5IT0A 3PDWA 1XP5A 3A3YA 2WF9A 2C8KA 2YJ5A 4Y2JA 2G06A 3E81A 4UAUA 1PW5A 2IOFA 5AKGA 3DV9A 3L7YA 5AW7A 3SKYA 4C4RA 5ALPA 3S6JA 2FI1A 4NWIA 2YJ3A 3ZVMA 4HGQA 2EATA 3QNMA 4NV0A 4AS3A 4I9FA 3SF0A 1RPZA 3U13A 1KYTA 3ZX4A 1RQNA 3A1CA 2HF7A 4DCCA 2FPWA 2HX1A 2IOFK 3KBBA 3R4CA 5ALGA 3ONNA 5ALLA 3WGVA 2I55A 2R8XA 5A3RA 4EENA 3OCZA 5ALIA 5ALWA 2OYCA 2RARA 5AW3A 4NFLA 4Y2UA 2I6XA 2B8EA 4BX2A 2Q5EA 4NABA 1VJ5A 2JAWA 4UATA 4O8CA 2MSNA 1TA0A 3N07A 3MPOA 5AI0A 2G0AA 1F5SA 2OM6A 3ESRA 1YJ5A 3IRUA 4BX0A 2JAOA 3WK5A 1SWWA 1Z5UA 5AIAA 5AI4A 3AR9A 5ALSA 3ZTWA 5AW2A 2ZXEA 3U19A 5AHXA 1X42A 4GIBA 1N9KA 3FGOA 3L8EA 2CFTA 5ALDA 1RLOA 4HAIA 5AVRA 2ZBEA 4HGRA 3IB6A 3KZXA 4CF3A 5AW1A 1T5SA 1TE2A 5AKYA 3B8EA 1AQ6A 4JDPA 2YBDA 5AVXA 4Y2XA 1FEZA 1U7OA 4IFTA 5AKIA 1L7OA 5ALJA 2AH5A 1RDFA 3CZ4A 2HDOA 4BX3A 2DQSA 4GXTA 4NAVA 3QUTA 2ZBGA 2BDEA 2ODAA 2FPSA 1CR6A 3L1VA 1TJ3A 5AK4A 4ZEWA 1L7PA 3K1ZA 4OCZA 2YMMA 2AUTA 3ED5A 3PGVA 3I1YA 4UW9A 1T9ZA 1J97A 1U02A 3SD7A 3P96A 4YGYA 3WKEA 2JARA 4UU1A 2ZG6A 3ZVLA 2WHEA 1RQLA 2CFRA 2OA0A 2GHTA 5AM0A 1Z5GA 2W11A 3QXGA 4Y2SA 1LVHA 1Q91A 3QU7A 2HCFA 3AR6A 3WKBA 4J03A 5AK5A 2ZBDA 3DNPA 1O03A 1VFPA 2I34A 3RFUA 4QJBA 5AICA 4F72A 3QU9A 3OCXA 2G08A 4UM7A 3FPSA 4HGNA 4UARA 5AI6A 5AW0A 3DDHA 4F71A 3L1UA 2PR7A 2QLTA 3M9LA 4EX6A 4BNDA 2R8ZA 1RKUA 5AKLA 3L8GA 2WFAA 3QUCA 4KNVA 1Z88A 4KYTA 3WKDA 2FPRA 1NF2A 5AKXA 3U7EB 1EK2A 3L0YA 3E58A 2CN1A 1J8DA 4FFDA 4Y2QA 3ZVNA 2B8JA 4DWOA 4QQFA 4Y2VA 2FEAA 5AW8A 1S8OA 3W5BA 2YJ4A 1YDFA 4Y3UA 5AM5A 3KOOA 5AW5A 3TLMA 4BKMA 5AM2A 1Z4PX 1ZS9A 2C9MA 3EPRA 3R09A 5AM1A 1SWVA 2HHLA 2FUEA 5ALVA 4HGPA 4EX7A 5IT4A 3N28A 5ALMA 3WK9A 3WKAA 1EK1A 4ZEXA 3AR3A 4Y2YA 2NYVA 4J2TA 1YS9A 5AVQA 2W43A 2R8EA 2WF6A 4Y2PA 4YIKA 1WVIA 1O08A 3WK7A 4Y2TA 5ALKA 3QLEA 2G07A 5AVUA 1XVIA 1MH9A 1N8NA 1ZOLA 1S2OA 3WGUA 2B30A 5AVWA 3ZU6A 1QQ5A 2YMLA 3FM9A 1NNLA 2IA5A 4Y2RA 2YMQA 5AESA 5AVYA 2AGVA 4E88A 3N8GA 4RETA 3FZQA 5AW4A 2RBKA 2YJ6A 2BY4A 2P11A 2YY6A 3NRJA 4UM5A 1RKQA 4UMFA 5E0OA 4FYPA 2C88A 5IS2A 2GHQA 1SU4A 2G09A 3UM9A 3ZI4A 4XOUA 4XPZA 5AI8A 3ET5A 1LTQA 2VKQA 1RLMA 3VAYA 1Q92A 4BEWA 2I7DA 3MC1A 1RMTA 2I54A 5ALZA 3OPXA 2FPXA 3OCVA 1ZD3A 3HYCA 3W5DA 1ZD4A 3CNHA 2P27A 3MN1A 3D6JA 1TJ4A 2W4MA 4UASA 4CNQA 5AM3A 2P69A 1ZRNA 5ALHA 4YIHA 2C8LA 3FVVA 2NO4A 5ALYA 3EF0A 2ZBFA 2YFYA 2B1RA 5A3QA 3B9RA 2G80A 3ZX5A 3I28A 1QQ6A 2PQ0A 3NAMA 4EZEA 3WK6A 1QH9A 3I6BA 1RMYA 3OTQA 4CF4A 4JB3A 2WF8A 3BWVA 3AR5A 1QYIA 1U2TA 5ALEA 3A1DA 1WZCA 3A1EA 3EF1A 2MU1A 3ZW7A 3AR2A 3UMBA 5ALOA 4C4TA 1Z4JA 1RRCA 1ZD5A 4UMVA 1CQZA 1TJ5A 2HO4A 3ZWKA 5AVTA 2HEGA 1VJRA 4EEKA 5AKEA 5AVZA 1ZRMA 3KDPA 1T5TA 1YNSA 2GFHA 1L8OA 1XPJA 2EAUA 3GYGA 2FDRA 4YCMA 2WF5A 4L6AA 3B9BA 2AMYA 2WF7A 2I33A 1Z4OA 2X4DA 3I76A 4KNWA 4BEVA 2CFSA 3U7HB 4OHFA 3ET4A 3F9RA 4HYTA 1RC8A 3NUQA 4DFDA 3OCUA 3RF6A 3ZUPA 2EARA 1QQ7A 5AKKA 5AKHA 3WK4A 2BDUA 3SMVA 5JJBA 3E84A 1U7PA 3EWIA 2RB5A 3ZWDA 5AW9A 3U7FB 1Z4MA 3W5CA 4UMEA 3KD3A 1U2SA 3L5KA 4BYGA 1Z4IA 4EELA 1RLTA 1RMQA 5AM4A 3SHQA 2HF2A 2JAUA 1Z4KA 2C4NA 3QU2A 4KX3A 1Y8AA 3AR7A 3PGLA 2FUCA 2HI0A 2YMPA 1ZD2P 3NALA 4H1WA 5AVVA 3WK8A 2P9JA 5AKJA 3NANA 4CF5A 3QX7A 5AIBA 3BA6A 2HSZA 5ALTA 3L0BA 1Z4NA 2B1QA 4G63A 2HOQA 3NASA 4G9BA 3M1YA 3FPBA 3HLTA 2Q4TA 5FP0A 4CE6A 3ESQA 4UU0A 1L7NA 1Z4QA 3QGMA 4IG4A 2JGAA 3IJ5A 1YMQA 3QUQA 1L7MA 3QUBA 4BBJA 3WKCA 3E8MA 4AP9A 1RKVA 2B0CA 5AI9A 4OFZA 3NIWA 5AI5A 1L6RA 3L8HA 1WPGA 4L57A 3N1UA 3J7TA 2IYEA 3ZTYA 4XQ0A 5T41A 1IWOA 2OBBA 3KC2A 5AVSA 3R9KA 2PKEA 5ALQA 3L0CA 1K1EA 2FPUA 4ZEVA 5A3SA
chains in the Genus database with same CATH superfamily
2W6OA 1OLXA 4XSHA 2WVNA 3K5IA 1HNNA 2QMQA 1BAPA 4OHBA 1KKMA 4CUKA 4LDKA 2ZSDA 2HA6A 2EQBA 2XH8A 4BWYA 4LLCA 3TSCA 2L7AA 3SXZA 5FORA 4IH9A 1TJNA 2DETA 3GDWA 3DUFA 5JS6A 3ZI0A 4NZZA 2ZAYA 3O95A 1A9TA 1X19A 2NTJA 4K6MA 1FBTA 4LA4A 4KN8A 3OKFA 3D2BA 1TT5A 3RYTC 2C4TA 2IHBA 3H5OA 3TIFA 3D8UA 4CUJA 2WTUA 3ZC4A 3HU3A 3O8BA 4MV3A 4EAQA 2VOEA 4FYKA 2Y0CA 4BU1A 4DB4A 4JVSA 1IONA 2ID8A 2X2FA 1W34A 1X7WB 1ZHHA 2FWRA 3A6GA 3NXSA 5TB5A 1EUQA 3QEKA 1CY2A 4RVFA 1KZ4A 1PRYA 2PVPA 2CB0A 4IWYA 3G0IA 3UK2A 5KYYA 4GO1A 4RHTA 2HSBA 4YRAA 1YQGA 2X8JB 4IXMA 2UXCB 4QOSA 1E8DA 5ALUA 1KY5A 2XNSA 3MGAA 2H85A 1B0PA 2PTHA 1QF9A 2XW6A 4ZVSA 1RQ7A 3K1AA 4RA9A 2AFIE 2WMYA 4WUVA 1P73A 1U1EA 3CUVA 2B1JA 2FEXA 2RGUA 5DNUA 2I2AA 1C7EA 4KQHA 5I9BA 3VO8A 4YAUA 5JU6A 4DSNA 4LNAA 1LLFA 5KHAA 1MJNA 2ATIA 5LOVB 4IZOA 1NTRA 2ZI7A 3E15A 2CL0X 4YECA 4M9RA 3LPAA 3MTGA 2DWCA 1QGAA 3U0BA 4RA9B 3CEMA 1CZKA 5EZSA 5T3WA 3IYLW 4NDAA 1AVOB 4WKPA 1RAGA 5GMOA 4C21A 2IIBA 3PFNA 4YCLA 1SCUA 2R02A 4GEHA 2HMZA 1Q77A 3BRSA 3HXMA 4YN0B 4M9UA 4QVIA 3R9XB 3GLIB 4KPFC 2JFQA 1YK0A 3MJDA 4PSAA 4XH9B 1PJ2A 3TOMA 1QK5A 1PE0A 2EW2A 2O8VA 2ZVJA 3HNRA 5H83A 2CD9A 2H9AA 3O31A 1ECGA 2VPTA 5AP9A 1U2GC 2IXAA 3RQSA 5IVIA 3VR1A 3SZGA 5EMNA 5KTKA 4LYEA 2XOXA 4DYDA 3KQVA 4I1OA 2QI9C 3D6VA 1P44A 1XMXA 1OBFO 4FFRA 2IUEA 1NUHA 3J06A 4I1MA 1OZHA 2BGIA 2JIDA 2O50A 3JVUA 3NOVA 4PU0A 1NSFA 1TXGA 1KJIA 1MXFA 2AMFA 3VDRA 4HK4A 1T1SA 2R8RA 2VHEA 1ZBDA 1ZCFA 2QRUA 4GC5A 4N18A 1XWFA 4HEHA 4Q5SF 1OWLA 3KKOA 4P4GA 1V4VA 4PX3A 2OCXA 4R2XA 4UVGA 5AR1A 4ZIRA 2XCRB 4ZVMA 2IDZA 1JMWA 2QTCA 3STWA 3C8MA 3GG9A 5A04A 1C0LA 4MQMA 221PA 3AOGA 3EEOA 1Z6QA 3AKCA 3C7KA 3TOCA 3V2IA 4A03A 4B3XA 1FTGA 2JI4A 1DBIA 4KTTE 1NQVA 5HGXA 4EGCB 4M3NA 1V41E 4FU0A 3NHFA 2GPAA 4N4AA 1TNDA 2VP5A 1E0JA 4OL9A 2OHGA 4B73A 5E3CA 3EGXB 3FUWA 4JUDX 1ZM9A 3EQ2A 4NYIR 5IVDA 4F3YA 2AMVA 4I4CA 5F3WB 4MUYA 5GZ6A 1NZJA 5IZ4A 5FWYB 3TLXA 2GLXA 2FSIA 3DV0B 5HF5A 1T6XA 1ZHWA 5LA6A 4LJ9A 3LKZA 3ISVA 3IXMA 3EXIB 2EPNA 2XSEA 1EWVA 1ULTA 5GPBA 2POQX 4B47A 1DADA 3U4HA 1CS0B 2R7KA 3OZDA 4MPPA 5E2IA 1I0LA 2J3QA 5J2UF 3DB2A 4H7JA 1R0XA 3HCBA 1J24A 4I1SA 3LPNA 4Z4GA 5IUKC 5ABPA 2CNOA 1OI7A 4ZCSA 4BG0A 1KRWA 1E1QD 1TM4E 1T6QA 1MMGA 2O8DA 5DYYA 2R7NA 4WNAA 3BSWA 4J1SA 3C63A 2ZB8A 4WXYB 2RIPA 4UQPA 2GFIA 2OCIA 4JFAA 1VLHA 2H4ZA 3U3KA 1TQ8A 1TQ2A 2ZBEA 3EW7A 3NBMA 4GLFA 2G5TA 1SUIA 3ZYCA 4BVKA 3ETCA 4MNDA 3I6YA 1XZKA 4NAUA 3MZ0A 2R79A 4HI0E 1E7RA 1H2ZA 3GNTA 4BQFA 1OH5A 4PINA 4OX9Y 5LBIA 3LV8A 5K2MA 3N8IA 1VIVA 1GG8A 3MWYW 5E3AA 3MMPA 1MR3F 4OOEA 4B4VA 4DM7A 5HX7A 3B6IA 4J6EA 4KIGA 1PJQA 2QNBA 1RJWA 2QMEA 1JQDA 3VYWA 1KY3A 1L9KA 4IHJA 4RPJA 1O5TA 2DR3A 4KAFA 5G0TA 5I9TA 1NQ5A 2JCBA 5EJAA 4Z0TA 2GAFA 1PGQA 5FA5A 3C3JA 1PGJA 1VSQA 3ZLJA 1IC6A 3FFAA 1MP0A 1R8SA 3FVTA 2NTYC 3TG2A 2DQSA 2NU8B 1LC0A 1M5UA 4G0HA 4WUTA 3QUTA 3R20A 2KYHA 3EF3A 3PWKA 5IC6A 1PHPA 5G0SA 5HQJA 5EJ4A 1DQZA 1G42A 1OVGA 1ZVMA 2X23A 2OV6A 4ZC8A 4UOEA 4FXOA 4S1TA 3E9ZA 3JVIA 2FPIA 4MQ4A 3KR9A 1G60A 2DX7A 1RRFA 4E6EA 2OORA 4NE9A 1YUMA 3GOHA 4L16A 3NTXA 4X91A 2CY0A 4J7CA 1JQ5A 3GK3A 4RGBA 2H08A 1ESEA 1E2BA 2PSHA 2ZVPX 1QCCA 2R4TA 2Z8YA 4IGGA 3DPSA 3DVRX 3FPEA 3I3SR 3G13A 4PIVA 4RUKA 1E3EA 5DN6A 2W70A 3S3TA 1F1BA 2FMFA 2HZ8A 1Y8RB 4QTZA 3UF0A 2W6IA 2WVHA 1M6EX 4K8RB 3T8YA 3U3RA 3ZDQA 1K68A 1HX7A 1T8RA 4P3XA 4DBVO 1V7ZA 3FRJA 5C52B 4B3IA 2YWRA 3D3KA 1K7XB 3GMSA 4QL3A 3ZCXA 3LEVA 5AXCA 1P4SA 5L4SA 3WNCA 4LVCA 3GFVA 3A2LA 2G08A 4KXQA 5B2EA 5H9WA 5LM3A 1EK0A 2REQB 3D8NA 2QF7A 1CUSA 3ZDLA 1W0KA 1B00A 2AF3C 1UK8A 2P3OA 2Z3VA 5C7YA 1Y9AA 3EASA 4L5CA 4B0OA 2PZJA 3DBHA 3NYJA 1G2IA 2P6VA 1CGOA 2QG9A 2QT0A 2RHRA 2Z3WA 4B3BA 4F7WA 2P9QA 1YB2A 1NVWQ 1W47A 2XUPA 5BYKA 3GEGA 2XZDA 2AU5A 1G8PA 3Q4GA 1SA0B 3KPUA 3RE1A 1PUIA 1A8IA 1TUEA 3WKDA 5CT5A 4IDGA 1YO6A 4ITRC 5EJEA 1SKUA 1Z7GA 2BHNA 4A73A 2OCBA 2ZXPA 3POVA 4DMUB 3O4VA 4DNOA 3U17A 3M9XA 4KOAA 2WIAA 3LBYA 4MR9A 3PS9A 2LCHA 5F5XA 5L7YA 4B7AA 2QN9A 1YZVA 3UHAA 1WRBA 1SXGA 5KYUA 1A5ZA 3GA5A 4FFPA 5IM4F 1VTKA 2B20A 2FSFA 3HA2A 3WV5A 1FRQA 1FYWA 3AHDA 2VJOA 3CW9A 3I2HA 5KQRA 1V5WA 4FZRA 4TTAA 1UMDB 3BOSA 3HSYA 2FPPA 3NT5A 5K8JB 4HO1X 2GLTA 1A2QA 3A04A 4PLTA 2VK1A 4G5QA 1ZC3A 5FWXA 1I8TA 2HMSA 2YUIA 4UBIA 3VA7A 4HAWA 1GN8A 1RP1A 3UAYA 4HNHA 4NVRA 2Y6VA 2TMVP 1U2ZA 3BIOA 1G7RA 2G70A 3PEUA 1E3JA 4NNPA 5DHFA 3TX6A 3EMKA 5IDXA 2IYYA 3PC4A 4HBZA 5D01A 4I1PA 1Y8QA 2I1WA 5THKA 2JLRA 1GQYA 1K4MA 5HSWA 4GM1A 3PDUA 3VC2A 4KH0A 2CLHB 4KFSA 3KZCA 4CIPA 1QG4A 1C81A 3B60A 2LUOA 3M1CB 1G1MA 2XUZA 3ABQB 2PX4A 5DHQA 3ZXSA 3E9EA 3ZXYA 4GH5A 1IIBA 4JJ4A 1FNDA 3M2TA 1FUUA 1T2UA 5AJXA 5HA5A 1DAIA 2VYVA 1HQDA 2Z95A 3ESZA 4RDHA 2J9FA 4QRHA 1UK7A 3LLUA 4Y2PA 4YIKA 1O08A 2CMGA 3WLPA 1OW3B 4AJIA 1U28C 1P17A 4B7UA 2G72A 4CV3A 2OCYC 5AVUA 4P9FA 2RMKA 2CLEB 2WTMA 2NPOA 5ERYA 3A32A 3AUSA 4BNVA 1NFRA 5DNVA 5M3BA 3BZBA 2WWFA 5EZYF 5C37A 1JIIA 4EUNA 4JASB 1DJNA 4RTOA 4M76B 2HWXA 1WWKA 9LDBA 1IRXA 4I3HA 3TNLA 3WXBA 3WYCA 1YJAA 3NTLA 1P33A 1QIIA 1ZDMA 1ADYA 4I9HA 1ZP6A 5BWCA 5JNWA 2KBFA 1ZIXA 1XZNA 2F3TA 5C1PA 2DVMA 3W8HA 2R00A 2JEZA 3TOXA 2OY0A 2CLLB 3KHTA 4ZJZA 2M4EA 1YHNA 2YMQA 4L8GA 4BLOA 2FETA 2XM0A 1A9ZA 4DV6B 5KNBD 2I4RA 4Z9BA 3D4PA 3QPVA 2A9PA 1LSSA 4MW7A 4F4DA 2XZPA 2AP3A 5BR4A 3BHIA 4EB6A 3IEIA 2O6HA 3UWDA 4A8TA 2WLSA 1A4RA 1B73A 3MUFA 3UM9A 3UMJA 2A14A 2XZLA 2GYYA 3LQQA 4XOUA 3EVZA 5HNKA 2R7RA 4HEA1 4PRYA 2C00A 3GPLA 4ZU1X 4OIRF 5LB2A 1DAPA 3FXAA 3RVOA 2LP4A 2P41A 3TW8B 1R8JA 3HB7A 3GFGA 4F3RA 3RANA 2GYUA 5CVTA 4DVYP 3LXMA 4NCHA 3LT2A 2PLFA 1RZRA 2HJ9A 5MGBA 3WAJA 1FZTA 3OCVA 3Q1KA 4OIPF 2XOKA 3AFNA 2FZEA 1G7TA 4M1QA 1EGMB 2XLWA 5T4HA 2WUVA 2BFCA 1RBYA 4H1HA 2P6OA 4PF1A 4Y1RB 1TO1E 1T9GR 1ODJA 2AOTA 3P71T 4PG6A 1Q44A 4S3MA 1ZI6A 4RJIA 5JOQA 1GQRA 2PQ2A 4EP1A 3WQBA 2BGJA 3HKEA 1RPAA 3A9SA 1JZTA 4IVPA 3P9YA 2PBZA 2G80A 3R0XA 5JXHA 1GTG1 1W0KD 2W8BB 3A0RB 4OI1A 2ANCA 1G5IA 2HZBA 3M2PA 4TUYB 4G1CA 3SBXA 1I2ZA 1KOFA 4X5OA 4ND8A 4FPXA 3VHXA 2PCJA 1H5QA 4JB3A 3H4MA 2JGKA 2ZUDA 3MMNA 2Y76A 2VT7A 1EVEA 1GPNA 2OD7A 3EVBA 4DGSA 5JSZB 1NRIA 4ZYXA 3EF1A 1L5LA 2RGAA 3RKRA 2AJCA 5EOVA 5JZBA 3UMBA 1NUSA 5I4IA 2X0FA 1Z4JA 5AHWA 3AM4A 4MR7B 2UKDA 5EWLA 4BNTA 2H2WA 2G6BA 4PFQA 4RY9A 4X20A 1ZXXA 3I62A 1SZJG 4CS9A 1BWPA 1QIKA 2Z2JA 5BOSA 4AE4B 1L8QA 5HIIA 1Z0KA 4KQ1A 1CP3A 2NUPB 4DBLC 4YI3A 2IH5A 1AK2A 1CRPA 4YJ3A 1BHJA 1H2FA 1RCUA 2GAQA 1DBSA 4YRCA 5IAKA 2XKKA 2HEGA 3VHRA 4INZA 3TJ5A 4E94A 4YHHB 1PR9A 3HY3A 3ILVA 1JH8A 4NF2A 4GWLA 5G02A 2NAPA 3K1JA 2WF5A 3TI7A 4YASA 3DPIA 2WA2A 2F3SA 1DDIA 2A5GA 2RHOA 3BL8A 4GICA 1KEPA 1KFBB 3G68A 3LP6A 3VUFA 3N7AA 2KB0A 1YAJA 1SIWA 3IIIA 4ETMA 3WRXA 4MGZR 1O57A 3FMIA 4LPKA 1THMA 1WHSA 4QDUA 1F9AA 2EDAA 2YV5A 4P98A 3FSGD 3ZGXA 3V32A 4O29A 2EARA 3ECSA 2R6FA 3UN1A 2QVXX 3MFQA 5CVEA 4G5RA 4BJHB 1EXNA 3M49A 4IJ5A 2IUSA 2ZXUA 2EEPA 2P79A 3OFNA 4JLPA 4NENB 5ADHA 1CS4C 1IBCA 2Y3GA 4NCBA 2SCUA 3C6KA 1A0OA 4YL3A 1G20E 2O2HA 3LBAA 3W79A 2JJMA 1GPWB 2B9EA 3EQ9A 5B57C 1YGYA 4EPVA 4AY5A 5JAPA 1GPJA 3TMKA 1KI6B 1W1IA 3S7ZA 3WA7A 3FOZA 4N5MA 1Z6GA 3QP9A 5DLQC 4BGVA 4W5NA 4G23A 5FPKA 5M29A 2ECPA 2FSHA 4W7SA 2Z09A 3IAEA 1TYDE 1Y4AE 2YL0A 2QZZA 3T3EA 3VGJA 6LDHA 5KX5B 2WV9A 3B2QA 2BC9A 4QQKA 1ZW6A 2PNFA 4UUOA 4BE7B 2QM0A 2VJDA 4CF5A 4PBTA 1TZJA 2WHPA 3BJRA 4JEAA 3G7NA 4RVGA 1K75A 4FNOA 2ATEA 4ZO8A 1B23P 2B1QA 1KH2A 2HQBA 3DGEC 1KO5A 4WAUA 5KNBA 2VDVE 3NBYC 1XUOA 2R84A 3WLKX 1O7JA 2F9MA 4FCWA 3OCJA 1QGUA 1D7AA 1KWKA 3PEEA 2RAPA 1T36A 1WP4A 3CX3A 3H75A 1KO7A 3ABOB 4CE6A 1TQ6A 3LQ2A 5AUQA 2Z5LA 1ZMXA 3G2MA 1PFVA 3OETA 3DVQX 4Y0AA 2HNBA 2AQHA 1UBTS 4M1YA 5DMHA 1NPDA 5H1YA 3QUBA 4FGKA 2YN0A 2JCVA 1G21E 3L7LA 1XZIA 3PENA 2FR0A 3LCMA 4YCSA 3DLCA 5DI3A 1CDEA 1XCOA 3PQFA 1RWPA 1BYIA 2B0CA 4CIHA 2C0CA 2PGNA 2QRJA 2VA9A 4OF4A 1WPGA 3AHJA 5ERXA 4LTNA 5TQVA 1O97D 1XNHA 1YB7A 1UMCA 1P1FA 1H93A 1ULAA 1Y3HA 3AEKA 3OY2A 3GANA 4ARVA 1G8XA 1AB5A 3JVEA 4I5FA 1CE8B 4WT7A 3W5HA 2EJBA 3IMGA 5HEKA 4PVCA 5AVSA 1E9VA 5K4HA 4GOMD 3LLKA 4U5CE 4LRYA 4LRWA 1L8AA 4ZQGA 1KYVA 2BJHA 4BL5A 4D0NA 4EYKA 4JJFA 1MX3A 2Q41A 2DMRA 4O6NA 3M3PA 4ZEVA 5DM70 3QOYA 4C76A 2P2CA 2FHSA 3WJAA 2JVJA 1PQYA 1RYDA 1I4TD 2WG0A 3L43A 4OD0A 2ZCJA 3EG5A 1M2NA 2A30A 1R18A 3EAGA 3KKLA 1IBRA 3V5XA 1FFEA 5LJLA 5CFPA 1TX4B 3AM1A 4Q6WA 4OP2A 3PIRA 2VZ8A 1DJPA 4FE3A 5KOIA 1E77A 4ACBA 4RFSB 2XTJA 1EXVA 1LXCA 4ZREA 4JUIA 1OMOA 3N5KA 3EYAA 3Q7EA 2IBTA 1KEEB 1DARA 3ANYB 3H9BA 1W5EA 4INJA 3CYFA 4AY3A 3GFRA 2HSGA 2DPXA 4ES6A 2ZI3A 3I1IA 4N03A 4CMKA 1DZIA 3ORHA 2CHVA 4RVCA 5EE1A 2NG1A 1GKIA 1X92A 3ME5A 2QRQA 4H3KB 4S0ZA 3KQLA 4TKUB 3U3FA 4J0HA 3F96A 3MLEA 1W36C 2CXOA 2XVXA 3SJZA 4RTMA 4Z9HA 1UWCA 3R6GA 5E4FA 2P5UA 1TC1A 1KA9H 3DJFA 4FLEA 1I4ZA 2AFIA 5KQGA 3N8HA 4PYKA 1P77A 1QONA 3FMVA 1OYOA 1GPH1 1ZMOA 4LJ8A 4Z7OB 2VH1A 3KYIA 2CNBA 5B3KA 1RXWA 2PH3A 4MS4B 1IZZA 3RVDA 3U37A 1JPNA 1LVGA 2G7ZA 4Z3KA 5JRDS 2AR7A 2WA1A 3ZGOA 2H4WA 3BCRA 3AIOA 3QFRA 2BGTA 2COEA 3KZ1E 3BE8A 4GLLA 1H4TA 4LJKA 3SHOA 3HEAA 3QVYA 3R0VA 3LC0A 3B78A 3OT4A 2PLAA 4YC7A 4OD5A 4FI3F 3ZY5A 4WN3A 1QRUA 1FJHA 1ZQ1A 2VNHA 4CL3A 3AVYA 1MAHA 3WODF 1F2VA 2Q5JA 4HQOA 3TH5A 3KUXA 4K9DA 5JNSA 4BFVA 1RLIA 1AOXA 1O54A 1VLJA 2R6HA 2D0IA 1U8YA 3S6JA 3OPMA 1C3EA 4ZT2A 4QHYA 4BNJA 5JNRA 4P8RA 4DTIA 1A3CA 2NV0A 4IYRA 5B1IA 1YBFA 3BWYA 5JLAA 1Q1QA 3GJ3A 4P7BA 3SF0A 1UKVY 1ZR2A 1M5TA 1XTSA 4AJLA 4CTOA 3I0MA 1KYTA 4GPD1 2ID4A 2WUFA 4GBED 4JUAA 1CUVA 1QNFA 3L7NA 3O1IC 4XIFA 2BM8A 2Z83A 3G8YA 3HB5X 3SC4A 2MYSA 1GZ4A 1BZYA 5E3HA 3KYCA 3RSFA 5LZ4A 3FVWA 1LW6E 3DI5A 1XTZA 4AP5A 4J0FA 1XJWA 4JL6A 3LQ1A 4ZYUA 1YA7O 1XCMA 2R25A 2QVYX 2V26A 5JS7A 3LT4A 2IK8A 4KGVA 3E2IA 4Y2UA 1VMIA 4X3CA 4BE9A 5JH7F 3OIYA 2RJOA 4JY7A 5H80A 3ASVA 3OE7D 2WW8A 1IEXA 1PFUA 1RJFA 1SNYA 3GL9A 4IAQA 3CBQA 4BBZA 4D0LB 4BJ1A 3AO0B 5B36A 1QHEA 5KVAA 4OKIA 4Y9SA 1CUZA 2JCSA 5FUQA 1N2IA 4OAPA 1HLGA 1M7BA 4O2AF 1HDZA 2Y2VA 4HLUA 4PO8A 4ZHSA 5HOQA 4RF2A 4ZTUB 1VPEA 3HH8A 4E31A 2C7BA 1DWUA 4IHJF 4PHHA 1UBJS 4U2KA 4TZ6A 2A5YB 2V1XA 3AP2A 4UXJA 2HXGA 3TLKA 1WASA 4BRWA 4RJKA 5C4MA 3RWMB 3D1LA 4D81A 5IT5A 3EWNA 4MIKA 5JYCA 4KQ6A 5ALSA 3EDCA 2H7VA 1QDLB 5IN4A 1XOIA 5A71A 5K51A 1XAGA 2WSYB 1LRKA 3HJRA 5ICGA 3RG2A 5TF0A 2BFEA 3SC3A 3AF2A 1TZBA 3GT7A 1M57C 3SQLA 3OPNA 1NJSA 2AUMA 3IR5A 3M4YA 3SHFA 4OHYA 2B4QA 3PC8A 1QIHA 2QX9A 1CJCA 1X1QA 5JDCA 3N87A 2PR2A 3I9KA 3KZXA 1BCRA 5H68A 1X8LA 5ELLA 3ADPA 2NXNA 4OGFA 3RSZA 3PFKA 4BFUA 1RIIA 1R6AA 4R1NA 3CVWA 4XWAA 4MTLA 5J4KA 1QR2A 4JLUA 1DFGA 3HCWA 2F55A 1APCA 5HCNA 2NV2B 2HS5A 4YUWA 1E1KA 2P9HA 2C2HA 3BKXA 5K7SA 2P91A 2J46A 2AC7A 1AY0A 4MW4A 4UZEA 1JRLA 3LL7A 4YMHA 2EZTA 2I6SA 1HZJA 4Q1BA 5DHUA 5DT2A 1ZHYA 3JQBA 4AS1A 1B8NA 2BRUA 4CKEB 1E5TA 3OJ0A 1QPBA 3WLTA 3A1SA 5H9VA 1V3TA 3MCZA 2P5SA 2ODAA 4EARA 5KOHA 1TJ3A 1E1DA 5SICE 1O0BA 1YL5A 2PJUA 4XFKA 2AB0A 5FUBA 4I0WB 4P08A 2YMMA 2IU0A 1P18A 2M9MA 4P9NA 1NW9B 4XGNA 5TLSA 2X1HA 5AO9A 3T7AA 3FX2A 2A4MA 5SZJA 3IJPA 2J30A 1EWYA 4IHQA 2BF4A 3KU4A 2I6UA 4FN4A 3HI6A 3H5IA 4TTPA 1RADA 3I9JA 5LXTA 4PR9A 2J0UB 2UYQA 4LBZA 1PJCA 4MVXA 1JV2B 3OICA 4ZO9A 2OBXA 4DA0A 1VLTA 2FH5B 5AM0A 1LNSA 3PD7A 2NM0A 4Y2SA 2P30A 5FFFA 3TBKA 3LAYA 3DV2A 3LWBA 2NUTA 1V7CA 3MTQA 3UHPA 4HS4A 1IWPB 1A7JA 2N46A 1FLVA 2PKRA 2VDMB 3C3EA 3JAKB 1Q3TA 2GYVA 4J9VA 2VF4X 4ND4A 3SGLA 4DMKA 3R2JA 4RDCA 1IK4A 2I34A 1AQLA 3WQSB 2Q3FA 3MTIA 1XPOA 5JCOC 3ASYA 2PGLA 2E55A 2YQ4A 4X41A 2NTNA 4O4IB 5LMUB 4N41A 4YTEA 2ZBQA 2V3VA 3DCNA 4XVHA 5EYPA 3O7WA 4OX9B 2HJWA 4IDDA 3DE0X 4HGNA 3HDQA 4OQQA 1QVXA 3PI7A 2BSAA 1V2GA 3OKCA 1IJEA 3VR0A 1R0ZA 1SUFA 3L7CA 3PC3A 4H31A 5H3LA 3PQ8A 3MT7A 4UHJA 5DLDA 1OLSA 1T2EA 1QF7A 2OZPA 4RSRA 4CFZA 2Y0PA 4L2IA 1FDTA 4NMXB 2CYCA 2XWBF 1E3TA 4YDQA 2XZTA 4JKVA 5E6RA 2Y3IA 4DBLE 5EJ6A 2R6JA 4FOSA 2A5JA 2QE7A 3I2FA 4ZU3A 4EG1A 3UGOA 2C54A 5IJAA 1C30B 4YRGA 3OE7A 3E23A 3FCUB 4OIOF 4PPYA 1KR2A 1WB9A 4JJEA 2WM2A 3MJFA 1LPNA 3R3ZA 1N8TA 1L7EA 4FUTA 4MA5A 3E58A 3IEMA 2GZAA 3G50A 3WYBA 4AXBA 2P6NA 2CV2A 5DYGA 3KAQA 1OILA 2BMAA 2ZETA 1L5WA 3GNQA 4AJOA 1Z0ZA 2MR6A 3TQOA 1J2YA 4MQEA 3FIJA 4M1KA 3U7JA 4LE1A 2G8NA 2HL6A 1CS0A 2R7LA 3KOOA 4J76A 4BKMA 4U5HA 1ISGA 1EAMA 2WFLB 3EDMA 1VCMA 4H08A 2C9MA 1DX6A 2LPMA 1BMTA 4OSOA 1SWVA 5E2BA 1HTWA 4M0FA 4NSNA 1FS5A 2BJWA 4JYBA 1NVGA 1QS0A 4J6FA 4O4JF 3PRYA 4Y2GA 1HEYA 4UNRA 2IBFA 1RKEB 4IWNA 1UPBA 3QVKA 1JPJA 3PE4A 4R8SA 4WADA 2Z9CA 3F7MA 3PFWO 1YS9A 4MLZA 4R3NA 4G8DA 4DV0B 1CDZA 2HN9A 4AL0A 1BS2A 2J31A 2O7NA 3SP1A 3N58A 2X6QA 3AXTA 3PRJA 4N0PA 4AY6A 5EMJA 5T7BA 3JYOA 2NUTB 3ZIBA 1UC8A 3PLRA 4OJQA 2BAGA 3BB4A 2OD2A 4XCVA 1U2GA 2JIPA 2CW5A 4CFYA 2AYZA 3GP8A 3UMFA 4HHEA 4JXZA 2H54A 1OXMA 3NHMA 3CKYA 3KL2A 2DUMA 2VWGA 3GJQA 1R6VA 4R7TA 3B0VC 2EW1A 2X41A 3I6MA 2V55B 4G0QA 4F5DA 3D4OA 4JI6B 5BNTA 1A77A 2P9ZA 3IVMA 4JBLA 3O3NB 2QAGB 3P2OA 3KB6A 3ZSUA 3TQIA 3R8XA 1ENYA 1IB0A 2YXEA 1BE0A 2YMLA 2M6RA 5DZSA 4FI3C 2EPMX 2IA5A 4MVMA 4Y2RA 4AUMA 4AZSA 1NXVA 1AO3A 1F1MA 1XLVA 1JSZA 1TK3A 2ZQYA 3FZQA 4KV9A 2HRDA 5LLSA 1OF1A 4FWVA 2CDCA 2UUHA 1N36B 3F9CA 4Y9DA 1V4NA 3RYHB 2XADA 3L7MA 4XYGA 3KWMA 4FYPA 4WK2B 2OKCA 1Z0JA 2FGJA 5KOYA 1SCDA 3PQ7A 3TLZA 2Y1FA 4J4BA 4FESA 2X0CA 2C7VA 3HV2A 3BWEA 1M6WA 2P2YA 2ZIXA 2ZPTX 2H5JA 5E6SB 4YQEA 3SYRA 5CEEA 1VIMA 2B4YA 4QG3A 1KAQA 2OAEA 3D2AA 2AFVA 3N05A 2G3VA 1QFJA 2LK4A 1LDEA 2NNLD 2Q3MA 2R60A 2PYIA 3FR8A 1TOAA 1HOXA 3IV9A 4KPUA 5DLYA 5KB3A 4U7FA 5H3HA 3VH4A 4C7KA 1KKUA 1GPAA 3DCYA 1EX7A 3KLOA 5K3BA 5CLHA 4EG6A 3CNHA 5FAKA 3MWEB 1J09A 4C0XA 2GF2A 4TRRA 2VDQB 4OP1A 2Y1WA 4F9EA 5GZ1A 2A5FA 1F51E 4QUJA 5IXJA 4S12A 1VBKA 5AMXA 3U7QB 5CG1A 1BN6A 1O77A 4C30A 2MINA 5JO0A 1OPXA 2IYUA 2YZNA 3QBEA 5AHRA 1CRZA 4FS8A 4HDMB 3H5NA 2WAOA 1FU4A 2Q6TA 1W4ZA 1MNDA 1S9HA 3FPHA 3KPVA 4GKAA 4XX0B 4GYTA 2BHRA 3ZDAA 2NO7A 3GY0A 4BASA 4LC9A 1CR0A 1RQ2A 2LCQA 3V7NA 2WZQA 1QO9A 3H2ZA 4C0HA 4W8OA 3UMHA 1N6RA 2E48A 4Q6BA 5DWVA 3DCJA 1GD1O 1JXAA 2H59A 3W6PA 3THXB 2O8BB 5KKNB 1YK1A 3MPUA 4LXQA 5ALOA 2FSGA 3CHYA 5KQLA 3H3XA 1OFGA 1MMAA 1LBHA 4LTMA 1RRCA 2WD7A 2I6TA 3O8OB 4LYGA 3KT6A 3LBNA 4PR3A 4TSKA 4YONB 1TJYA 5DTQA 3D8SA 5K0TA 4OOFA 3QHQA 2HO4A 3QPDA 3G0CA 5J1TB 5TMEA 3Q40A 4G5SA 3HCNA 4B32A 3CW8X 5LA6F 1FMCA 1WETA 4EBKA 1PAUA 5A69A 1XPJA 1S9DA 2GFHA 1DKPA 5IKEA 5H7XA 3HR7A 3C3XA 2GXUA 1UCFA 3L8JA 1L3PA 3DO6A 5DJ5A 3VTAA 5H4GA 1R27A 4CU2A 4X6LA 2PGJA 1C9NA 1ZK3A 4RPLA 3EVFA 4L5IA 3T5GA 3W4IA 2J59A 1MO2A 5EGSA 2GPTA 2WFZA 3RJ5A 3PIIA 1A9YA 1UODA 3KSZO 3B51X 4U7JA 4L4SA 2J3MA 5DN6D 4N49A 4L0MA 2BR5A 2LBPA 2H3HA 4LOLA 4WW0A 5B4TA 5F7OA 2MHRA 1G55A 1T5DX 2WSIA 3NUQA 1EJBA 1ZH6A 3PYMA 5FBLB 4B4KA 3BHNA 3HJTA 1EBFA 5JXWA 5I8PA 3TULA 5AKKA 4RIGA 4UBOA 2WVGA 1XQYA 5LL6P 2GCNA 4XAQA 3F4KA 4XX0A 4DR2B 1DKQA 2MSKA 1G5RA 3OOSA 4QBHA 3CX7A 2RD9A 4AN0A 1D0IA 3OURA 4CODB 3U0VA 4Z51A 3OWHA 5B12A 2QW0X 3W5CA 1S8AA 3U40A 4EELA 5A03A 4UM9B 1SZIA 2CJWA 3B8HA 4PX5A 2FXIA 4WFKA 5EG5A 4OJYA 3SHQA 2JFOA 1MORA 3SKVA 2JAUA 4QGAA 2EFCB 3IO5A 2ZJYA 4CMCA 1E2DA 1PFQA 2H7YA 2FUG6 2QLBA 1X7HA 1ABFA 2C07A 1HDIA 2C98A 4GI7A 4OREX 1B6GA 2YMPA 1ENPA 2GPJA 2V45A 2X5OA 4M0CA 4BZWA 4CR8A 4TKUA 2V74B 4M38A 3U9TA 1Q0LA 2OB1A 5DLEA 3HU2A 3ND8A 3R23A 1KTVA 1DBPA 1P4JA 2GCOA 3H5AA 1N2CB 3BTUA 5JMTA 4MKXA 2HQRA 4QUHA 5EPOA 1JFSA 3U2MA 3BUSA 3EA4A 4ND1A 4QUIA 3SG0A 1IRIA 1M8JA 5DW3A 5KI6A 4CNBA 3CF6R 3CWQA 2WZLA 4IIDA 1BX1A 4IY1A 2H31A 5B3SC 2VXBA 4NYJQ 1TLFA 4UU0A 5D1NA 1E7YA 4DLNA 4E08A 5I7RA 4WLOA 5DTEA 3DOEA 1U0HC 1N6OA 1Q83A 3JZMA 4Q66C 2VJKA 1FYFA 1OCRC 1H3FA 1OUMA 1VYTA 4IJQA 4BBJA 4Z53A 5KCZA 2A6PA 1C8VB 3KUCA 4WV3A 3OIDA 5I45A 2WIKA 3DEAA 1XL0A 3O2JA 1NGSA 4OFZA 2ZDHA 2I65A 2J0EA 4XTCS 5AI5A 5A1JA 2F8TA 5BY2A 3U3BA 1DTSA 4AM8A 4N6CA 1VHTA 3HCEA 1ZL2A 1H1TA 1TTPB 3TAXA 2C5SA 1JLSA 2FF5A 4LMAA 2FXVA 1BEUB 2M6SA 4MI6A 4Q93A 4AKTA 4J4HA 4Z7QB 1N5KA 4XQ0A 1Q7EA 1BCSA 3A3PA 2BFFA 5JQGF 4LECA 3O3MB 4KXWA 4AE4A 1XDDA 5EP3A 3W6OA 1JL3A 3WG7C 4JNCA 3OOHA 4IF6A 4QJIA 3THRA 1KI2A 1E2KA 2GBIA 4UHFA 1DT5A 3CX8A 1FXWF 4DKXA 4ZV7A 5E38A 4TT8A 1KFCB 2YRWA 3WYGA 3LU1A 2O8NA 4IFIA 1GYPA 2AG1A 3GJ8A 3QITA 4N3AA 3JARB 1CVIA 3DFZA 1X77A 5HS6A 2PP4A 3WLQA 3IAM1 4F5YA 1NKTA 2R7WA 2E5WA 2WU8A 3TO5A 4ZI7B 5IYZB 1CVRA 2NO5A 1G8YA 3T5CA 2PKQO 4FWIB 1YOVB 3C62A 1HDGO 3LXUX 5LP6B 3P52A 4HDNB 1UKYA 4KRGA 3FAJA 3PUWA 3THOA 4D9HA 1OROA 3FI9A 4AX8A 1SFRA 1YXMA 2OU6A 2QM7A 3KNZA 4J91A 4V03A 5CM2Z 4CS8A 3WB2A 3DW3X 4G09A 3LF1A 1EHIA 1E3LA 4ULVA 5KVCA 1PJTA 2ABWA 4UPVA 3R3YA 1JUDA 1YASA 4KIUA 1XZEA 2C92A 3UFBA 1RTTA 2J6HA 1G98A 1K6XA 2HB6A 3EBOA 2R6ZA 1YA4A 3OA2A 4YXWD 4ZXFA 2FPLA 1UBOS 1BWSA 3RIEA 5LU9A 5IXYA 3ASZA 4M0MA 4H7KA 5JP7A 3X2EA 3RRNA 3VKVA 1YFKA 1K66A 3D64A 4QTYA 2BFMA 4YI5A 3DJUB 4DCVA 3HJHA 2IV7A 1GTZA 4TXHA 4BATA 2H4FA 1PK9A 4QE3A 4H18A 1NBBA 5CB4A 1N33B 1J0CA 1RAAA 2GASA 3QVGB 3W05A 1JKMA 4XGIA 4BRSA 2Y0BA 4IOMA 1W0CA 2XOKD 5FADA 1SCNE 3DOHA 4CKWA 2YLIA 4OM8A 3L01A 3T3GA 1GKUB 2DR0A 4UVHA 3TMAA 2PMBA 3HJCA 3DV9A 2BP7B 4FOLA 2ZWAA 4R2JA 5DBGA 3K16A 3CONA 4EGFA 4CXMA 5L0JA 2ETVA 3H99A 1DGQA 4CT5A 3RV3A 2VT6A 2WP8J 1P9LA 3OD1A 1FFDA 1B2LA 2CK3D 2IOYA 3R0JA 3L6BA 4D3ZA 3KQHA 1IB6A 1POXA 1EUCB 1F1JA 1FNMA 2AZMA 1U04A 2QN6A 4BMOB 1TQDA 1XU9A 2ZB7A 1Y6GA 1VMAA 4HN4B 1OLUA 2Q8QA 2V8BA 4DCCA 1DXQA 1Z5OA 2WB7A 1THGA 1YZNA 1BE8A 2DU8A 2HLNA 4A6XA 4KZKA 1NSGB 3MWDB 3BWCA 4WD3A 4CIWA 2XMQA 1OZGA 5ALWA 2OYCA 3Q8WA 3I04A 3LG2A 3M5DA 1LTHR 1Y42X 3U7RA 1YHZA 2RARA 5FBVB 3EH1A 2J9FB 3BTOA 1BXZA 5H5JA 5EUBA 3C3MA 1MW9X 1ZA1A 3NGXA 3AY6A 1CYDA 2ZJ2A 1VLMA 2D62A 2DZDA 2YX1A 3JVDA 3FRIA 4KQFA 2L19A 5E7JA 2QM8A 3V8MA 4JGGA 4BVFA 4CW7A 3U6BA 5C8XA 2J0UA 3OLCX 2FJPA 4B75A 4E32A 3K8OE 4B3GA 1LFDB 2FG6C 4LVUA 1FFCA 1LD3A 1X1AA 4R3UC 3OEOA 3E1SA 3HC7A 5DBIA 5LP6C 1EDDA 1JTVA 3EIOA 3QZUA 4OYYA 3T0FA 5DPMA 2NPFA 3ZU4A 3ZZ0A 2HK6A 3F3KA 3CGGA 4FJ2A 3IRUA 4FTWA 2JAOA 4WGGA 4H9GA 1RP7A 1SWWA 1Z5UA 2H0RA 2M1XA 5IJ0B 2ATCA 1PG2A 2WHXA 2E5FA 3IHKA 5ANRB 5I9LA 4X6YA 2DJIA 3PQEA 1ZNXA 1X7DA 4NBTA 2NNWB 3PFIA 4PHFA 5DOZA 2D5RB 1QE5A 2OQ2A 5IANA 4X6UA 5AW2A 5JI3E 2CXXA 1Y81A 4X1YA 2IYVA 2PUDA 2BMEA 1ZUWA 3WYDA 4F4JA 4ROSA 4FBLA 2QX7A 3W2FA 3H0KA 2Y2UA 3QX3A 2ZIGA 3ESXA 4REOA 4Q7LA 3BYZA 1DIAA 3GZ4A 4Q3AA 4ZOAA 4IUBS 1DHTA 2ZZNA 3AIMA 2BM0A 3C98A 3GZNB 4UHBA 2XTNA 4OO3A 1JQEA 2WWGA 1E1QA 1FFBA 3SSAA 4HCJA 3SX0A 2V5AA 4FEYA 1JEYA 5KEIA 2VQ6A 2C5HA 3V4VB 3TW8A 2EXXA 2OC4A 3IPAA 4FYJA 8ABPA 4LEIA 3W6ZA 2O8FA 5CI8A 5KZMB 2I2XB 3OJLA 2QG4A 1D1QA 4NJMB 4XGRA 1LIHA 2OCGA 4Y2XA 2A58A 2QTVA 5F7XA 1YMVA 3DDWA 1RZRD 3NRHA 1E1CB 2I7XA 1M2WA 4GWGA 3NMUF 3M33A 1P2TA 2WG2A 5BN3A 4IFTA 4QPDA 3ZGYA 1XD9A 1C8BA 1RBMA 3RC3A 5DX1A 3NORA 4LERA 1GZ6A 2AH5A 4KDFA 3WWDA 4E30A 5JECA 3URMA 4E4YA 1FCJA 2E87A 2AF4C 1FSGA 3NHRA 4UTVA 1PU2A 3SVTA 5LQUA 1XL1A 3GM3A 1L1FA 3R7BA 1UOEA 3UJ8A 5EVCA 3WGYA 4D79A 2WEKA 2QT1A 4DRXA 3KQMA 1SVNA 1W30A 5CDYA 4OCZA 4U7HA 1DO0A 2LKCA 1GGHA 2Q0XA 2DB4A 1Z13A 2VAMA 1U31A 2DWQA 3DV0A 4ND6A 4Q9HA 1LCIA 4RPHA 3F6YA 2RGNC 3O4GA 3PDIA 1JSCA 2JHGA 5AC4A 1AE1A 3C3KA 3SD7A 4GGMX 1S3IA 3WFIA 2EHDA 2WT9A 1PZMA 1OLXB 3PNYA 4YXWA 3VKWA 4NE2A 2XNJA 3C39A 3WIVA 2E5LB 4Z4EA 2GZ1A 3SI7A 3RIGA 2YR0A 4O7GA 3KPWA 3K1IA 2Q07A 2G3YA 2C7PA 2GRUA 5FL7D 3NCTA 5WRFA 3JYHA 2BTEA 2A6EF 3LLIA 1P9NA 2EKPA 3A28A 3QEMA 2ONZA 2JG3A 1PKXA 3LHKA 2IOQA 4MS2A 3K2EA 1EBBA 4D6PA 5LP6F 3E5MA 1OWMA 2UZ4A 2PEYA 1W6UA 4FIZA 1DRKA 3GWZA 3CR3C 4BIIA 3BH7A 3IA7A 4YRBA 1SD1A 1NVBA 3CH7A 1CZNA 3DH0A 4M37A 2R05A 2YV3A 4YJGB 5I8ZA 2VHUA 2OGTA 4G26A 3RREA 4EG0A 4FOOA 1KYXA 4R1SA 4QXAA 3I6IA 4XEVA 4C06A 3OCXA 1L4YA 5B53A 3SHTA 4NBWA 4OPMA 5I51A 1M2KA 2KQ9A 3HYTA 2PRKA 3DJYA 4Z4QA 3K0SA 3C7AA 1TTHA 4F71A 3A4VA 5ICSA 3B1KA 1TKBA 4JZAA 1VG1A 3T7CA 3K6SA 2JAQA 4DCMA 1N5DA 1MJGM 1N7IA 4XARA 1SXJB 2RJNA 5J2TA 3LESA 1QG2A 3K4QA 4RXUA 4CS7A 1HT3A 3ZNQA 1G16A 1JT9A 5CX4A 1U3VA 3G2LA 2GDCA 3ETNA 5J4VA 1EVZA 2ZE5A 4YJHB 3K0FA 1GVHA 4YRPA 2I6QA 1SXJC 5TARA 2EX1A 3NC0C 2WJPA 3B20A 1A9QA 4DWOA 4ESOA 2HT6A 2QTMA 3RC7A 3VDMA 2E85A 2G17A 4PCUA 1HH4A 5CDSA 4LNUA 1UF9A 3N53A 2F9FA 1BHQ1 4Y30A 3TGLA 3GP5A 4XFJA 3FTPA 1YDFA 1T6NA 3MMXA 4PGGA 1AUXA 1XKQA 1TA9A 2FUNB 2DLDA 2W6JA 3DFFA 1J0BA 3O75A 3OZRA 4V2IA 3F4BA 3JAWB 4MYHA 4WZ6A 2JIRA 4BFLA 3A4MA 3SE7A 4E7OA 4PBRA 4MUXA 5G41A 2OXEA 3PGKA 3KSDO 4JR1A 2BWJA 2WTXA 4XCXA 4YB8A 5TY0A 3SEOA 1XYVA 1WB4A 3T5DA 2LWIA 1VDMA 2GJKA 4XD7D 2NZYA 4BGIA 4PW0A 3HXPA 5IFKA 4FIDA 2OMKA 2C95A 2Z1NA 2OHJA 1UEXC 2AKAB 3EY9A 2C99A 3AU8A 3N2KA 2IUYA 4H7IA 1M2HA 3L7JA 4K87A 4HDSB 3V1KA 2P62A 3E48A 4OUKX 4NZNA 3HP1A 3HMKA 5E6UA 5B2ZA 2V0CA 3SM3A 4CM3A 2CHQA 3G85A 3RU3A 4PNEA 4ANJA 2W0SA 3MUEA 2G07A 2Y9MB 1JKJA 3QENA 1NQWA 3HTXA 1NW3A 1X7ZB 2PRJA 1DUIA 3PL5A 2J6IA 2B30A 3DEIA 4PGAA 2CNLA 3FNIA 4R1MA 1G4WR 3WNVA 5E0KB 1YS7A 1SULA 3NX4A 4AF8A 2FJ0A 3A1NA 4F2DA 3G5AA 3R40A 4EG5A 5KTTA 5CR9A 2R7QA 3ACBA 3RSHA 3E3OA 1SHZA 1P7CA 1XR3A 2IYTA 3LZCA 4YK5A 3R0ZA 4PBSA 5HIKA 1FJ2A 1VRVA 3QVSA 2R7SA 5D3ZA 2AGVA 1KBOA 3KWFA 4N76A 1Q14A 2ORVA 3G2HA 1BN7A 2AQIA 3H42B 3ZY6A 2YVAA 3COSA 4I55B 3I2KA 2QTZA 2CLIB 2YJ6A 1VIYA 4AKIA 3JQ6A 4QLOA 2BY4A 2P11A 1CXZA 4EUSA 3UPTA 1SBHA 3LDHA 1T4MA 4Q82A 2APJA 3IKLA 4ZCLA 5HGJA 2CJYA 4GLJA 4A0FA 3A36A 4H6PA 4B9AA 4ZDJA 4EIWA 1LSOA 3TKLA 3WR5A 4N7RA 4Y7CA 5DF1A 2XA2A 4XPZA 3YASA 1Q19A 4FNAA 3ZWXA 4DMLA 1RABA 5IW8A 5KTNA 4OXNA 1NJGA 1MOPA 2QL6A 3ZNPA 1UJMA 2Z2KA 3SICE 3ZJ5A 5KNLA 2M98A 2NPIA 1QPGA 3RF7A 4B4DA 1K2WA 4WZBE 1K4KA 3C8HA 3F78A 4OINF 4JQOA 4JVOA 5E7IA 5ISMA 1FDRA 3ZJVA 3WAGA 3EVNA 3OI7A 1GT6A 1QDUA 3FIUA 4AX2A 2HCJB 3MWLA 1ZGJA 4NYJR 1DRUA 1OYWA 1W5AA 1OQCA 1YS2X 1ZD4A 5IEJA 3AI2A 2QE9A 3HRIA 2WLTA 2ZRKA 3M3DA 4MO2A 4MZXA 4F60A 5BN4A 2ZSFA 2A1DD 1IDN1 3L02A 1GXSB 3PC8C 5K3FA 4Y2HA 3ROEA 3QYAA 1PT7A 2P69A 2CJWB 3RI3A 2VSNA 3V9PA 3KR0A 5C7LO 1OX5A 5K01A 4OB8A 3RJMA 5B4VA 4D4KA 2X19A 5J2TF 3VR3D 1MDFA 4F9TA 3AH8A 4LYJA 1W4BA 4EGSA 4W7IA 2HADA 1NW4A 4WFJA 1GM5A 3P0HA 4FHGA 3HABA 3KVRA 1KYYA 1VECA 1G3IA 2I2WA 3KHSA 5JY1A 1YVUA 1SBQA 3AV0B 4WASA 4AO7A 5DX8A 3SDSA 5E6RB 3DUFB 4TQ9A 3G9UA 1E4EA 2LDXA 3OQ6A 4GKVA 4GM4A 4OHRA 2JDID 2WF8A 3EQ8A 4GUAA 5JZMA 3G49A 1ML3A 3TQSA 2FZKA 4CV1A 1N0HA 5LKRA 3WB0A 2FWBA 2OO7A 2TMKA 5U4QA 1W36D 1W93A 1QM5A 1LH0A 3FYUC 1T5HX 1H4QA 2DEUA 1L5FA 2YV4A 4LN1A 3SQOA 2VP4A 1V9SA 1R0KA 3ANNA 3B3QA 3FI0A 1KK0A 3ZWKA 1G0OA 1UWLA 3N2EA 3K9FC 2FLKA 2FOIA 1XU7A 3ZCQA 5KWJA 1Q7CA 1CUDA 2GD2A 2PUGA 4RIHA 3GYGA 1JW9B 5JD5A 3AC0A 2CNWD 1M2OA 4MYRA 2F59A 4CCWA 3K7DA 2I33A 3IQ5A 2W2OA 4UOZA 5DGIA 1XVUA 1FU8A 2AA3A 1CQIA 2XB6A 1ODCA 3OHSX 2B5VA 3HKCA 1PNTA 4QHTA 1BBHA 1RYFA 4Q39A 4KOEC 2QX6A 2JZCA 1VFNA 2ZDQA 1U2EA 1UDXA 1CT9A 1EINA 4L7VA 2IV3A 3FCEA 2EYQA 5AKHA 4E7SA 4LI3X 4MMZB 2PV7A 4AP6A 3U5TA 4IJJA 4MINA 5DK4A 4MUAA 1R6TA 1KVSA 1YI0A 5IULC 2NSHA 4PG5A 4ARCA 3L9WA 1J7JA 1W8IA 3VGPA 1E85A 1ZCAA 4NDNE 3TRFA 4RDAA 4UMEA 1YKSA 1U2SA 2C2BA 3DQPA 1HDXA 3CPSA 4JLDA 3M6XA 2GSDA 1T0UA 3ZZNA 5KKAA 3S40A 2OENG 2EGUA 3FTFA 1JPUA 4N06A 1VLQA 2B9VA 2BTQB 5JV5A 4BGEA 1GZ3A 2AD5A 2HD4A 2VHJA 3Q7RA 5DNCA 3RTDA 1HXHA 3TD2A 1MIOB 1L5VA 4ZZ1A 3AW8A 3DS8A 4ERNA 1B1AA 2P7HA 2CUTA 4GPBA 3FW1A 1NQUA 2RDMA 3CIFA 3O2NA 4V24A 4P4SA 3T0IA 2BTQA 2JJYA 1D0SA 1UAYA 2XQKA 3Q12A 3VJMA 2C9DA 2KJQA 3L0BA 4I8DA 5BT8A 1Z8HA 2Z30A 4DY6A 3BIJA 3UJ6A 4KR9A 4D9FA 1USKA 2Z6VA 4INPA 5C46F 4GG1A 1WAMA 4L1KA 1NFQA 1W4RA 4TWRA 1FRFS 4WHMA 2JFBA 2LCFA 3RLFA 4DJTA 2O0LA 1SXHA 4PQGA 1ZH0A 4K86A 1CG6A 1VHLA 2HLPA 3G82C 4R40A 2RJ3A 4PLHA 3VU8A 1V1MA 3EDYA 1W5TA 1J9GA 2O2YA 3QK7A 3F0TA 4G2NA 4IJWA 2NXWA 3UJHA 3GI1A 3V3TA 3EVCA 2LFDA 2GF9A 3E8MA 3FYHA 3IAUA 1UXKA 4OQNA 4C0LA 4BQEA 3PTAA 2X8AA 2XT0A 1WVGA 5EQTA 4HYEA 1TIPA 2C0QA 3AEUB 5E3JA 3ZQ6A 1DCMA 1L6RA 4QPNA 4WEQA 3QVWA 4B4WA 2C3UA 4EQ6A 3DR3A 3ASUA 4C5AA 2A0KA 2DLNA 3BE4A 2UVDA 1GNSA 2GAIA 4FHCA 4RANA 5K0CA 4DA4A 2Q5HA 4Q1EA 4NS1A 4P31A 1A8QA 3RYIB 2H16A 2GA9A 2CXRA 2A6HF 5ALQA 4ZCIA 4CJXA 4ZA2A 3P9KA 1J22A 5FHQA 2LFFA 5KU7A 3EAFA 3X1JA 4EHPA 2WD8A 3WADA 2RH5A 2WILA 2YOFA 2BFBB 4J30B 4OMUA 5EP2A 5C3UA 1TD9A 2I03A 9LDTA 1U4NA 4CKCB 2DKNA 1XU4A 4KQEA 1DT3A 3EEBA 4D4HA 4A8HA 3V8RA 1ZGAA 3I8XA 4G36A 1AS2A 3FSRA 3TD9A 1FQKA 3AP1A 2RGGA 4A8PA 7REQA 4JA0A 5TIIA 4LUCA 1NSYA 5AW6A 4NYMR 4HFFB 5K5EA 1C7RA 3VNBA 4U7PB 1GWNA 4WXPA 5BYAA 4GZ5A 1ULHA 3ABLC 2P40A 5HKLA 3RVZA 1HF3A 4W9RA 3C8UA 3QNWA 3U39A 3DXYA 2KNHA 3ETJA 4EJ0A 2BH9A 2WD7B 1BH6A 5A6KA 4HH3C 1V1JA 2J0VA 3ISJA 4PS1A 2NU8A 3CJRA 4MEJA 1T43A 3LBHA 4R3WA 4U3JB 3RC1A 5IJZA 4YRFA 3U61B 1N32B 2OHIA 2GKGA 4HAXA 5BWMA 1ZZEA 3RASA 1G38A 4GL4A 3RSSA 2V03A 2WR8A 3V2GA 1EA5A 5KTSA 3MIIA 4YNBA 4PTLA 3D3WB 2QBYB 5J2UB 4CNQA 3X43A 1TKAA 4D8XA 4L2IB 4LYFA 3DBLB 4Q1CA 4BNDB 4Q7JB 3H2GA 2QJRA 3T7DA 3T5MA 4KRYA 4XR4A 1JXOA 1NDHA 1EJ6A 3DWFA 4ZQIA 2DECA 5KX5F 2SNIE 3AEQA 4EBJA 3BJMA 1CERA 1LI7A 1O6FA 3KK0A 2C78A 5EUCA 4QWWA 5CDUA 3TTYA 5IUJC 2JH9A 3CURA 4IFEA 4J1QA 3DE5X 1CEEA 2P8JA 2AZTA 4X6XA 1RRPA 4KQIA 1YQXA 1J0AA 4GP7A 1GZHB 4JFRA 3KKQA 4Z49A 2HSJA 1R5ID 1MB4A 4ZT4A 4QM7A 3FUUA 5EUMA 4V3CA 2OAQ1 3HK2A 2HRRA 4NBSA 3JQRA 4P7FA 2AJLI 2JD2A 1UWKA 2IZOA 3LVRE 1R64A 5EA2A 5F5LA 3S44A 4AYXA 1EUDA 4K6GA 4N5DA 2P2ZA 1M1NA 2CWWA 1XQ6A 5H59A 5IP5A 2VJNA 3UOGA 2NXCA 4KE7A 3ZV5A 2Z98A 4IYJA 1KAGA 5L6LB 1E5LA 2HU2A 4IDAA 4Q01A 2XVYA 5BPHA 4LFBB 4MP6A 1G8GA 2OAP1 1WHTB 2ZRPA 2C31A 1KNXA 2FSVA 4MVJG 3JALB 3IIKA 4NG4A 4AS3A 2BFFB 1G6HA 4RPIA 4OJTA 1Y34E 1E9CA 3AHIA 3IIMA 1BIFA 2PAAA 1QV9A 4Q3BA 2HFIA 1OJLA 2F67A 5CGQB 5JYBA 4BQQA 4EPTA 1JLKA 3HCCA 3O0TA 3TE7A 1D1BA 2P6UA 5CA1A 1W88B 4GLBA 1QAMA 1OAOC 1I3MA 1FP6A 4E0HA 1HG0A 2WRZA 1R16A 2XF8A 3JALA 3NWBA 4BLRA 3GT4A 2FPOA 1MVOA 1QPZA 2CYAA 2ETXA 4UQLA 5FRDA 2HHAA 5HDQA 3HXQA 4R5HA 1SQ0A 5KYGA 4RVSA 4UATA 1DQPA 3UMIA 1CDOA 3TUIC 4HPWA 3IILA 2H06A 2OQIA 5B3JA 2JFGA 1RKBA 4D8WA 2IDJA 5BQFA 4KJXA 2AYYA 2Z08A 4RXMA 2X0IA 3VHLB 4NESA 3C18A 4YRMA 3ESRA 2RI1A 3EA0A 4XWWA 2KGOA 4CTMA 1LPBB 1OR2A 1Q2UA 1SC1A 3UJ9A 1IUOA 1M6VA 5CVUA 3G7UA 1SJ9A 4LJAA 4Z9IA 2B36A 5GONF 4QOJA 4WL0A 4UHKA 2PS1A 3UICA 2ZXEA 3O92A 4Q4DA 3WAKA 4G9GA 3H3FA 3D8RA 4JX9A 1QLJA 2DR2A 1OQAA 4QI2A 2X5XA 2GJ8A 1G3MA 1P75A 1X42A 1W59A 4MJLA 2AOWA 3FETA 4H7FA 1N5JA 2WU4A 5T5QA 4Y1RA 1ADCA 3I8OA 2D2IA 2JJQA 3KAPA 4KGXA 3WLOA 1SQ6A 2L42A 1M7HA 2AEEA 3ABIA 3IQDB 3QXCA 4KI0A 1S01A 4WZAA 4CF3A 1CUIA 2G1KA 5AW1A 4WCFB 1AU9A 3M4BA 1SIBE 4FZJA 4N0MA 4WBNA 1SN7A 1F2TA 4PQEA 4RM2A 4BPMA 3PNLA 1E6MA 2QLMA 5A4AA 3H2UA 3WFJA 4S35A 5H02A 3SSMA 3WA6A 4PLPA 4FDAA 4EL0A 1F20A 2Z57A 4GGOA 5BYBA 5JXIA 3KSBC 5K8TA 2R1VB 4NATA 1HYQA 3KO8A 5FWNA 3WGZA 3BAFA 1IZ0A 4DOZA 4FGJA 3RW9A 1FXUA 1TFOB 1T9GS 3PKIA 2GKSA 4ASUA 3VDQA 1S8NA 4EO4A 1W36B 3WGLA 1KIAA 2NXJA 2RCYA 3VMMA 4LBVA 3X1DA 4A8JA 2SCUB 1FFAA 2WD9A 4K28A 3ZJYA 4D4IA 5HJ5A 1I7NA 3VH1A 2FFHA 1LV7A 2VXCA 1NASA 3CUWA 4JJ8A 4MAAA 4ZEWA 3ONEA 3K1ZA 3UXYA 2IXOA 1U3TA 3WGJA 3P2MA 4KAJA 1E6UA 1BU8A 5LNK1 1QQBA 3ED5A 1NQOA 3NMKA 3DZIA 1H8ED 1KK2A 2XUFA 4G0YA 2PZMA 1T9ZA 2A88A 3ABKC 2CHGA 2J4CA 2QUAA 3AVPA 4JCOA 2BCEA 3AERB 1U3WA 3ZUGA 4EB3A 5FH9A 2QDXA 4K88A 4ZOLB 3FGPA 4TVSA 2O7QA 1I01A 4L50A 2OWDA 3K32A 1RJGA 5DQZA 4EG3A 3FYTA 3IR7A 1BXGA 2SKCA 4RHYA 3CRRA 1Q91A 2Y05A 3O8OA 2J5XA 3PNOA 1T6ZA 2DKFA 4O4LA 4MB6A 2ES4A 2RHCA 3ROQA 4BVGA 2DWPA 1DJQA 3EZGA 5CCXA 3QIAA 2CVQA 2OGWA 4D4XA 4AZ3A 4G24A 3A9WA 1N2CE 1P80A 3QOXA 4WNYA 1IEQA 2ZS7A 4YAWA 2O19A 4AICA 2VRCD 3R7FA 4WN9A 1XZQA 1T6YA 3PTLA 4AMGA 2P6RA 4KBFA 5DFAA 5HP4A 2XRYA 2H2FA 3IQ6A 2WOOA 2Y92A 2DKOA 3AV3A 4M6WB 3TZQA 3ZS8A 1G8HA 5HQ3B 2XWQA 2B34A 3ISTA 1ZKDA 421PA 3LA6A 2QWXA 4DV5B 2OB2A 1GR0A 1U1DA 1F8YA 3I9OA 4TQGA 1X70A 3LGAA 4HF7A 1BD4A 1C7FA 1KI9A 2QN1A 2WKRA 4QC2A 4RY8A 4Q4AA 4U2GA 3WHNA 6REQB 3PGMA 5JJLA 2A1TS 3CTMA 4UBJA 2R8ZA 3USCS 3STTA 3TW0A 4D9KA 4DQKA 4Z54A 5EKSA 4IS2A 2PN1A 1N6IA 4EFMA 4F12A 4XWOA 1OXKA 3BORA 4KI2A 2Z3ZA 2FG7C 6Q21A 2OCDA 3KKEA 1HQKA 3JRWA 4P82A 2XCTB 2FPRA 3EDOA 4EIYA 5KYXA 3V6LA 4QELA 2JFPA 4Z3OA 4ONSA 3Q2KA 3M15A 2WJHA 2IITA 5AKXA 3OLWA 1TKNA 1K4YA 3PUVA 3WDSA 3S29A 4NCKA 5B7QA 1H2EA 3LTEA 4BO2A 3OPYA 3RRFA 2HFJA 5DTRA 5BOVA 4BVEA 1A4XA 4FT2A 5KYXB 1V3UA 1WEKA 4XWJA 3NIBA 2RHJA 3EXHC 3DE8A 1AKNA 1OYVA 1D7OA 4DSOA 3BS4A 1KNYA 3CRMA 1XD8A 1V4AA 2QPAA 4B71A 5U4XA 2I3GA 3D1JA 2P2DA 3NH9A 4P6IC 1H6DA 3LW8A 3H5LA 3HZZA 5TVKA 3TLMA 1R4AA 3PHBE 3SX4A 2V6MA 1W4AA 2E4UA 3RYLA 4CL8A 5IZCA 5MGNA 3CE9A 4M55A 2J9VA 2HHLA 1TF7A 3FZNA 3I8SA 4URYR 3R7DA 1C7ZA 4C6SA 2LQGA 2CHEA 4CDGA 1MU0A 4MV4A 5I3ZA 4REMA 3AW9A 1LC3A 1YTUA 3DVSX 4DNPA 4O63O 3AOUA 1A9RA 3WAQA 5BQXA 4ZWNA 4HQNA 2W43A 4YAGA 3OA1A 5JNVA 3VOBA 5ITWA 4Z9XA 1VHWA 1X7ZA 4ZYLA 1F7VA 3R3JA 1JXMA 1SUSA 1YJ8A 2AUNA 2W6ID 3QLTA 5C7IO 2VTDA 2LNDA 4M89A 4EY5A 2J9YB 4MVCA 4AWAA 3EXHA 4U9DA 1JVSA 4K05A 2PVCA 4A36A 1M76A 4UEQA 4DUPA 4LXUA 4QU9A 3WMRA 4BUJA 1E20A 1FFSA 1LSUA 4PCLA 5CX1A 4Z4HA 2X7XA 4P22A 1OXBA 1BW9A 3FH0A 4YP0A 4HJRA 5DV9A 1CBUA 2LSEA 1II8B 1BJKA 1JE0A 1FNTc 3I9MA 3G5UA 3AZOA 3TZLA 3U44B 1G5FA 4V0LA 3UV6A 5B58T 1EVLA 5BORA 1D0XA 2W83A 3BXOA 3GFSA 3H1GA 1R1DA 4AROA 1SGWA 1V1RB 1KQOA 2FK8A 4RULA 1UFQA 3RRJA 4BNLA 4UTZA 3DKIA 4QPPA 4UMFA 1VPDA 1O95C 1W85B 1X7XA 2C88A 5JT1A 1V3QE 5DIZA 3FOBA 3GLTA 1YJCA 2HLHA 4O4LF 4RKQA 2B6NA 3D0RA 4O5AA 4MVWA 1OKKD 3COVA 4UVIA 3FDZB 1AKUA 1BVRA 3UOAB 4REQB 4DDHA 5B30A 1U7TA 2WE8A 1XK6A 3ET5A 5EQJB 5EE5B 4W8PA 4MCJA 4P2BA 1LJLA 1BMDA 4LY9A 2D54A 3NKLA 3KE9A 1RBZA 3H13A 1HW2A 5DWQA 1O3YA 3K0EA 1QVRA 4PLWA 1JHZA 4FKZA 2FPXA 1E64A 4R9UC 4IQFA 4BJ6A 4WTOA 3PD0A 1UEIA 1FMJA 3TNYA 3K0AB 3IC5A 1A5SB 4O0MA 4E1VA 1N1CA 4NKRA 2SHKA 1ZZPA 4O25A 1KI4A 3MGCA 4XEHA 3TNJA 4PFPA 2H7XA 3UT0A 4Q47A 4UASA 1FFHA 2XEDA 5AM3A 2ZITA 4NCQA 3TFOA 5ALHA 3FKSD 4L15A 4KBLA 3B5EA 4E12A 2DT8A 4EWCA 2NZXA 2JLBA 4A6PA 2YIDA 4YROA 1EJ0A 4Y1FA 1A04A 4CLOB 3KYIB 1Z0FA 3ZX5A 2UUAB 1XA0A 5DCYA 3B85A 2BH2A 4RAQA 3VNUA 2BT4A 4ZYZA 3PC2A 5HPYB 4RMIA 4BN5A 4C88A 1E2NA 3HY4A 2Q46A 4TXLA 1XZHA 1T2FA 1P0MA 3BF7A 1P4AA 1D4ZA 2JFVA 4Q24A 1PHRA 3WYFA 3E70C 3PT9A 4Q4HA 4Z2YA 2QLFA 1CUEA 4P7GA 1OWNA 4WXMA 5T4FA 4A8JB 2H7OA 1YQ9A 4KQGA 3VVMA 4B3FX 1L5RA 3BGOS 5L7WA 1FFYA 3ENNA 5KIAA 3A1EA 2QMOA 4MVJM 4D3YA 1HETA 4EFNA 4KQKA 3DO5A 1RI2A 1BR1A 1I24A 2ZQ5A 2W2QA 5ETJA 1NF8A 3SWWA 5LQSA 3OMXA 4LDQA 5KHOC 2OBFA 1LJUA 3CPHA 3Q85A 1CQZA 2V6BA 2HEIA 3WMEA 4ZDIA 1URPA 1MIHA 1XJ0A 2WWYA 2Q2NA 1R5NA 2XXBA 3L1KA 3E0QA 2BV3A 3HZOA 3QFHA 3RSLA 4PRZA 3UYKA 1IVYA 3KDPA 3NHYA 1PSWA 3GXBA 3P0EA 1WTCA 3HE3A 1AXGA 1JKJB 1OXVA 2WKWA 2B2XA 2ZREA 1R4NB 3H97A 3ICVA 3SZ3A 2Q6IA 4EI9A 2QNLA 4DC9A 2QR3A 2ZJ6A 2W58A 4FR0A 1QJ4A 1SBZA 1CJSA 2H4YA 3P9IA 4I1YA 1OBOA 4FP9A 4UEOA 2OAGA 3ITEA 4Y67A 2WAAA 5KC8A 5DP1A 1IXKA 2P0YA 2XMPA 1YLMA 4N8SA 1GTSA 1Y9JA 4PK4A 5GONB 1I94B 1K7EB 1ZWKA 1WZEA 1N9ZA 2FZCA 1KK1A 2X1LA 1Z62A 4GOXA 3NMJA 3VJKA 3ZKAA 1NFNA 1E2JA 4LVNA 5JATA 5JI2E 2HTFA 1UZNA 1BGVA 2GEDA 3D7LA 3GRUA 5A5DA 4YT2A 3UK6A 1FSZA 1QQ7A 3T6GB 1EDEA 1WA5A 1YZTA 2FMKA 4LZAA 4YJFA 5ECDA 4YMUA 5C5DA 2H65A 3M4NA 4OHUA 4X63A 3V2HA 1OR8A 2RG7A 4DCJA 5EZYB 1EHCA 4IWXA 3RYCB 1WOMA 4LDRA 2YWBA 3ZPXA 4KVGA 4EDHA 1GGNA 2YVKA 4MCHA 2OO5C 3NAZA 4U1RA 5FPSA 1I80A 3C6YA 4KG7A 1Q0QA 4BYGA 3L4SO 2I3ZA 2ZXWC 2CDRA 4K6OA 2PJRA 3N0VA 2HF2A 1L5KA 3UJBA 1WCV1 2PZKA 4XRRA 4L07A 4E4RA 2QVGA 3VU0A 4RTNA 3EHEA 3AESB 5FKJA 4O1IA 3ZE6A 1DIRA 3I6QA 2Z8ZA 1WZ2A 3S8MA 5DP2A 3S2YA 4MX8A 1YJGA 1YUBA 2JI8A 4AJEA 4C0AC 4EG8A 5FUXA 4W1SA 3QX7A 4CV2A 1FUIA 1DMSA 1O6GA 5HE9A 2ZU0C 1MGOA 2R7MA 3PDCA 1I6LA 3LPDA 4PNZA 3W7BA 1LY1A 3M1YA 1N77A 1YFLA 2F4NA 4NBNA 4LDZA 2O8EA 3V8BA 2ZYWX 2Q4TA 5FP0A 4O6YA 1G64A 1CPRA 2YWGA 2I1LA 3ESQA 1RAHA 3LK7A 5J23A 2ZJ5A 4PZ9A 1EFVA 1PVVA 4V0QA 3E8SA 2A92A 3IJ5A 3LRTA 5ULLA 1W9MA 3FZGA 2Y1GA 3ZKWA 2M32A 3R7NA 4EMSA 3RT9A 1L4FA 4Z9JA 1Z08A 1U98A 1TFKB 3A05A 4NMHA 4IDBA 1RKVA 3D5TA 2KSFA 3R3HA 4I55A 4PAWA 2J33A 3QE0A 4KE9A 2GH1A 1VDZA 5LA6B 4LF4B 2I0FA 4B46A 1DMRA 1NIPA 2XL6A 1PFYA 4C3UA 1YF3A 3WSWA 1ZCJA 2JGIA 1N2OA 4A3SA 1D3AA 2JGFA 4FSHA 2GSWA 4I4TB 4JENA 2CWDA 1OE0A 1WTYA 2IYEA 5JROA 3GODA 5ER6A 2OOKA 4K0KB 1E5DA 3FPFA 3V33A 1TKCA 1C9JA 2C58A 1ZVJA 1XA3A 1Q2XA 2X5NA 3LUPA 3PUHA 2ISQA 3ZCVA 1KGSA 5HZHA 2WQZA 4F2HA 5HF8A 1Y9EA 3GLVA 1IUPA 3GT3A 3TQCA 3FYSA 3RS2A 4US0R 5IT9A 1U0RA 1BA3A 3WLFA 5I9SA 2QZSA 1XAHA 1P5RA 4JHXA 3UUWA 4R7ZA 1H0HA 4GQBA 2AFHB 2L0XA 4N9QA 1L4KA 4MQFB 3I53A 1ZNQO 4TYMA 1B41A 3B70A 5HF9A 4CKYA 3QE2A 2VJQA 1XMOB 1PTJA 1OV6A 1K6JA 5EQFA 3VISA 3QLVA 4AB1A 4WK0B 4GFDA 4BB9A 4KPYA 2WJVA 4F5WA 1H22A 3GEHA 1QRSA 4OL0A 1G0NA 5I3CA 4OJKA 1OFIA 3OTHA 3BMQA 4NPAA 3V55A 4UUNA 3DVAB 5F23A 2VCAA 2VDPB 3HCDA 5AVJA 1E6LA 1PL0A 3V1NA 1K5DA 1WR8A 4TZ0A 2GN9A 2VNSA 3H3JA 2QE7D 5F9FA 3CPJB 3SXPA 1CUJA 1S2DA 1JHQA 2P90A 1HPLA 5HCIA 2FP4A 3LK6A 3TVDA 1NPTO 3ETGA 3SLRA 3A6EA 1UJ4A 3G3EA 2BOVA 3C8ZA 1WCXA 3D7MA 3NYQA 1BQEA 5JDIA 4DKJA 1QKIA 2WSSD 2RFLA 4NHOA 1XTBA 4H1TA 1YSCA 3L7BA 1SZCA 3PQ5A 3SZRA 2REQA 2OCKA 3OCWA 3R8CA 1B42A 1MJFA 3ANXA 1FQOA 3VSCA 3O2SB 2WYUA 3G0DA 4RMGA 2FWMX 4P9TA 1YAHA 4E4TA 1DEOA 3QMVA 1ACMA 3IEPA 4ZAGA 3WLEA 3KTFA 1TCAA 2XIJA 3DC7A 3GW8A 5C8YB 1XN4A 2PS3A 4HUQA 1P1HA 5CVJA 3RRXA 1KU2A 3HSKA 1OOEA 1UC5B 4CDNA 1VKHA 4YDHB 1F2UB 2I80A 3I64A 5AW7A 1E6CA 3RTEA 2Z0MA 3I30X 3P9CA 3QXJA 2OV8A 4MQFA 4NZMA 3T94A 5DK6A 4DV7B 2XAAA 3T3MB 1XELA 3AZQA 3HKCB 4MQLA 2O1XA 4TMZA 4OI4A 3U1TA 2G5PA 2HMYB 4Q4CA 1ZUNB 5E9AA 2KPOA 3E3AA 3P2YA 5BSMA 1Q0RA 3GHYA 4YRRA 3NG1A 4PV7A 3A1CA 2H9YA 2A4KA 4QBIA 2XQVA 4H77A 2HX1A 2IOFK 2Y4NA 3DOJA 3BIWA 1T2CA 3CNOA 3PPYA 1I3NA 3K66A 1PZEA 1T15A 1NNI1 2I55A 4LMBA 4R8MA 4EENA 5ALIA 4IARA 1CUGA 2FX5A 4CHTA 4E1BA 1NU6A 1X7GA 2MYUA 2R68A 3SVZA 1E1LA 2V58A 2YL2A 3DZJA 1EE1A 1NF3A 1WF6A 3G7SA 4M1MA 4W9NC 2O5EA 3ELDA 2OXRA 4GKJB 5KCMA 2Y68A 1IQRA 4ZPXA 1AV7A 3L8YA 5JPCA 3K3PA 3BEHA 3KQOA 4FCVA 3DXXA 1I3CA 2VJLA 3HWSA 4RE6A 2GESA 4KR0A 2HHCA 1T2AA 5JCJA 4F0JA 3HYRA 1N2XA 2VJPA 3PA8A 2X4LA 4WNAB 1JWAB 3V42A 4JI5B 5KWIA 1Q0SA 2I9PA 4AUNA 1K7SN 3HUDA 4JYMA 4IVQA 1VL8A 1T9BA 3GV0A 2C5BA 2GVDC 3UGJA 2C3YA 2ZE6A 1YCHA 1F3LA 4QWMA 3UA3A 3P26A 5L0GA 1X8JA 2EDCA 3RIMA 3J81k 2ARKA 1SBCA 1S1CA 4TKMA 3MYYA 4I1UA 3B36A 1N9KA 3EVGA 3FGOA 2XB9A 2G8LA 2DH6A 1AD2A 2R1TB 3LLSA 3SQNA 5DGTA 4B6SA 3KQNA 1ZQ9A 1V55C 3P5BA 2E6KA 2I4LA 5JTUA 3K33A 3N75A 3U9LA 2JFXA 2C2GA 3GEBA 2R1VA 4FFWA 4LZZA 3RH0A 4ARZA 1J0EA 1K97A 2QNIA 1NVAA 2Y99A 2NVOA 3F90A 4RQAA 5AKYA 4UHEA 5T6BA 4BNYA 5TXGA 4BMYA 1QU2A 4JMPA 4GEKA 3EUAA 4PJLA 3DBLA 1ZCBA 1YT5A 2VPZA 3MF4A 2XS8A 3DDOA 3VPGA 3W5VA 3GLGE 4MDYA 4B6EA 1HMDA 1CKEA 1KZ7B 5JRZA 1LB1B 2ORWA 3BIXA 5AJWA 1KJYA 2F43B 3L04A 4J07A 3LO8A 3ZE9A 2YYSA 3H1TA 2Y3HA 4PS0A 1ZVQA 2HWKA 3GEEA 1C29B 3DZAA 3AUUA 3D4IA 1ZOOA 5AYVA 1LZKA 4G9EA 3ACCA 2VL7A 3G5LA 2G28A 3LPLA 3NYIA 4K6CA 4N0QA 4X44A 1N3LA 2XE4A 2YC2C 5KINB 2AOUB 2NU7B 1H4SA 4KPGA 2FZLA 3LNRA 1E2FA 1PEYA 2VUUA 1LK0A 5DBOA 3RUPA 2BZ0A 2UYOA 3ZVNA 3HDYA 3OJXA 4DV1B 4I3FA 1YRLA 2IU3A 3DLHA 3P2KA 1M1UA 4Q9AA 1OV4A 4KQWA 3GAZA 1DQRA 1OB2A 4LF9B 1DEAA 1B15A 1GZUA 3UH0A 2D5AA 4N39A 3H2YA 2RKBA 1Z38A 2PMDA 1MO6A 1T1IA 2XCIA 3BERA 2ZYUX 3SLGA 4DMMA 3JYYA 2OC9A 4GDMA 2R44A 3GXOA 3IOCA 2KE5A 1G2PA 1ZY2A 3GN2A 2J0SA 5CNKA 3P7MA 1EG7A 2DY1A 3IVGA 5ESRA 5BW6B 4YRIA 3ZH9B 3BXGA 2TSYB 2OA0A 2WZFA 4MR7A 2W11A 4Q1VA 5L53A 1HNXB 1DAFA 2VRNA 2J3HA 4KC0A 2QD1A 1NFOA 3QX8A 3W6UA 4IRMA 4U9IS 5GAJA 5EE3A 2DFTA 2KJGA 3Q7LA 4TUYF 3K15A 5E4TA 1A41A 1SD5A 2BW0A 2PS0A 2C4VA 2YNMD 4LOKA 2AV6A 1IHUA 2JGNA 3OUTA 3BKWA 3AVWA 3ZG6A 3WSVA 5JSQA 1RD4A 1SR8A 5CUQA 1HC7A 2RGDA 4DJAA 4WFQA 4LQ4A 3RSOA 1RWKA 3ZTTA 5HTKA 2G1JA 3KKZA 2V7XA 2XQFA 1PCXA 1BG6A 4JW1A 2OG1A 2R47A 3K1IC 2IZ5A 4IJ6A 4RSGA 2D3TA 2O2GA 3UFXB 5DS6A 4MTOA 4YT4A 4QD3A 3SXYA 2GEFA 3TZEA 4BKOA 5FPHA 5K3EA 4HUTA 4OJNA 1C0EA 1IE3A 5KNCD 1RKUA 3AYZB 5T4BA 4HWGA 2Q3EA 1ACLA 1FP4A 1CJTC 2DYSC 2GPNA 2QI9F 3L8GA 3WOVA 1DEKA 1WQ3A 3MLBA 4BVAA 4TLBA 4A91A 3W2VA 3A9TA 5GP1A 1XPRA 3ZZ1A 1U9JA 1UP4A 2MSDB 3DMGA 4MI3A 4CI0B 3KQKA 4N3CA 4Q21A 2PZAA 3P9XA 3FHTA 4NBUA 3FSEA 1EXMA 4FYHA 2WHPB 4GOKA 4OAQA 4EKEA 3TL3A 5CK5A 5K3DA 5BSWA 4CQJA 2D59A 4R4JA 4NXNB 4HMQA 1GARA 5EHHA 1LW7A 1Z6YA 3CC8A 3EPPA