2GFHA

Crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
246
Chain Sequence
HHHMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKVSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Protein C20orf147 homolog (17391249) from Mus musculus at 1.90 A resolution
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords haloacid dehalogenase-like hydrolase domain containing 4
total genus 94
structure length 246
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2gfhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2gfhA01
2I7DA 5ALOA 5JJBA 1VJ5A 3AR9A 3N28A 5AHXA 2G07A 5ALGA 3S6JA 2P27A 4UMEA 5AVRA 5ALKA 2FPXA 5A3RA 4O8CA 1Q91A 3SKYA 1SWVA 5ALSA 3ET4A 5AW0A 3U7GA 4BX0A 3E8MA 4C4TA 5FP0A 3ZWDA 4YCMA 1N8NA 4UATA 1XPJA 5A3QA 2P69A 3L8GA 3UMCA 1U7PA 5AI9A 5AKZA 1RLOA 5ALUA 4OCZA 1JUDA 5AW7A 5ALPA 3OCWA 3PDWA 3MC1A 1Z88A 3P96A 4PNHA 1RQLA 1TJ3A 2B1QA 2C88A 4HAIA 1WVIA 3AR8A 3L0BA 2GFHA 1ZJJA 3BA6A 3WKDA 4CF3A 4RESA 2G0AA 5AKXA 1RKVA 4NFLA 3HYCA 1Z4IA 5ALQA 3FVVA 2B82A 1Z4KA 2B0CA 3QYPA 2YJ5A 3DDHA 4C4RA 3B9RA 4HGPA 1Z4PX 1SWWA 3CNHA 3QUBA 4L6AA 5AKYA 3ZU6A 3FGOA 5AW8A 3L8FA 1L8LA 1NRWA 1ZS9A 2G1AA 3FM9A 1WZCA 4Y2SA 4YIHA 3WKAA 3EPRA 3QU9A 1RLMA 3ET5A 4HGNA 1J97A 3A3YA 4BYGA 4BNDB 2HSZA 1LVHA 2YMQA 1ZOLA 4BNDA 4Y2YA 5AK4A 2IOHA 3NASA 4G63A 1S2OA 3ESRA 4Y2TA 2GMWA 2JAOA 4ZEVA 3OCVA 3QUQA 5AVZA 3ESQA 1EK2A 1CQZA 1Z4JA 2FI1A 2HO4A 2FPUA 5ALFA 3WK8A 2AUTA 5ALIA 2BDEA 5ALYA 1Z4OA 3R4CA 1NNLA 5AM3A 3WGVA 5AVYA 3KC2A 1ZD4A 3ED5A 1T5SA 4DCCA 2R8XA 3UMBA 1Z4LA 3PGLA 3ZX4A 2FEAA 5AVTA 3AR5A 2WHEA 2IOFA 4UMDA 3KOOA 2Q4RA 5AESA 3E84A 2W43A 4UAVA 4HYTA 4EELA 3L7YA 1XP5A 2PKEA 3E58A 3QU7A 2OM6A 1TE2A 3QNMA 1TA0A 5ALHA 4KN8A 1AQ6A 1L7NA 2I54A 4FYPA 5ALWA 1YMQA 2HHLA 2I55A 2FPWA 4IG4A 3M9LA 3U19A 3ZW7A 4BEWA 3QX7A 5AW4A 4H1WA 3MN1A 3AR4A 2YN4A 4EX6A 3MMZA 1PW5A 1U02A 1L7MA 3WK7A 3N8GA 4I9GA 5AI0A 3CZ4A 3ONNA 1VJRA 2ODAA 4XOUA 3QU4A 3WK9A 3OCXA 2G06A 2X4DA 3WK5A 2NO5A 3WKEA 1SU4A 2YY6A 1LTQA 2P11A 4NAVA 2ZBFA 5AIBA 3L1UA 1RMQA 3L8EA 3L1VA 2D2VA 1FEZA 5AI4A 3W5DA 3U7HB 4UARA 1QQ5A 3K1ZA 3HLTA 2B8EA 3W5AA 3BWVA 4UAUA 4ZEXA 1NF2A 4C4SA 5AIAA 2C4NA 3F9RA 3L5KA 5ALVA 2IYEA 4Y2VA 5ALXA 1QQ6A 3AR3A 4UASA 1L6RA 2QYHA 1QH9A 4ZEWA 3DNPA 3B9BA 3D6JA 2ZOSA 1WPGA 5ALLA 3M1YA 2HI0A 1X42A 3L8HA 3IB6A 2C8LA 4UW9A 4YIKA 4B6JA 4YGYA 2Q5EA 1RLTA 1RPZA 3L0CA 3QU5A 5AVUA 2BY4A 5IT4A 4HGQA 4BKMA 2CFSA 1Z4MA 1EK1A 2G09A 3NUQA 4J03A 3WKBA 3AR6A 3QUTA 5AVSA 3ZVNA 2YMLA 1F5SA 2YJ3A 2O9JA 1YV9A 4GIBA 2IA5A 3N07A 1T9ZA 3OCZA 2YFYA 3EWIA 2JGAA 2OYCA 3N1UA 1ZD2P 4FE3A 2GHQA 5AKJA 2ZBGA 2EAUA 5AKEA 5ALZA 3SMVA 2O2XA 2W11A 4YH1A 5ALNA 3ZI4A 3EF0A 3PGVA 4Y2XA 4XE5A 5IS2A 3ZWKA 1Z4NA 4EENA 2FPSA 3NRJA 3KZXA 2PR7A 1T5TA 4EX7A 1RRCA 3SLRA 2IOFK 4JB3A 2HX1A 2ZBEA 2MU1A 2RB5A 1WR8A 3AR7A 1QYIA 4Y2RA 3I76A 4CF5A 5ALJA 3ZUPA 1U7OA 5AKKA 2CFRA 4UM5A 4CF4A 1S8OA 4UMVA 2R8ZA 2FPRA 2RAVA 2I34A 3U13A 3GYGA 3WGUA 2YJ4A 5A3SA 5AVQA 5E0OA 1MH9A 2I6XA 1TJ5A 2WF5A 4CNQA 4YCLA 1Z4QA 2HEGA 5AVWA 4J2TA 2CFTA 3KBBA 3QU2A 3TLMA 4XPZA 1RMYA 2CN1A 3ZTWA 2HF7A 3PCTA 4KYTA 5ALEA 1L7OA 1RC8A 2EATA 2HCFA 3L0YA 3NANA 2YMMA 2AMYA 3FZQA 2I33A 1U2TA 2WM8A 4Y3UA 3RF6A 4KNWA 2NYVA 4EZEA 2R8EA 2AGVA 3IJ5A 3FPSA 3MPOA 1XVIA 2GO7A 3SKXA 3ZVLA 3QUCA 2YMPA 2HF2A 1ZRMA 3NALA 4Y2JA 4L6CA 3U26A 4Y2PA 2FDRA 1RQNA 4YCNA 1RMTA 5AVVA 1YDFA 4DFDA 3WK6A 1YJ5A 2B8JA 4KNVA 5AM4A 4KX3A 5AK5A 4BBJA 4RETA 1J8DA 2R8YA 4UU1A 3ZTYA 4BX3A 2C8KA 3EF1A 5AK6A 3FPBA 5ALTA 4QQFA 4EEKA 2JAUA 5AM1A 2NO4A 3QLEA 1Q92A 1O03A 4L57A 1KYTA 3SHQA 4MUMA 5AW5A 3IRUA 1L7PA 4XQ0A 5ALRA 4MWOA 3SD7A 4QJBA 3ZVMA 4NWIA 5AKIA 3ZX5A 3W5BA 4FFDA 3UMGA 3DAOA 1RKUA 4G9BA 1RKQA 1IWOA 2QLTA 2AH5A 2YBDA 1O08A 1VFPA 2GHTA 2WF6A 1CR6A 4UU0A 2HOQA 2MSNA 3QXGA 4AP9A 3R9KA 5AM2A 2PQ0A 1Z5GA 3KD3A 2FUCA 5AKLA 5AKHA 5AVXA 3I28A 4F71A 2VKQA 3E81A 1Z5UA 2B30A 3A1CA 3WKCA 1L8OA 2P9JA 3OCUA 4BX2A 3QGMA 3J7TA 5AW2A 4NABA 1ZRNA 1ZD3A 3A1DA 4Y2UA 1QQ7A 3U7FB 1U2SA 4Y2QA 2WFAA 3I6BA 2ZXEA 5ALMA 3AR2A 4JDPA 4CE6A 1RDFA 4NV0A 4HGOA 2ZBDA 5AICA 2G08A 2G80A 2OBBA 3KDPA 3B8EA 1N9KA 3OTQA 5AKGA 3NIWA 4DW8A 5IT0A 3N5KA 5AW1A 1YNSA 4GXTA 4E88A 3W5CA 3WK4A 3VAYA 3OPXA 3DV9A 2EARA 3R09A 2B1RA 2BDUA 3OCYA 4I9FA 2WF8A 4AS2A 5AW6A 2OA0A 1YS9A 3I1YA 5AI5A 3U7EB 5AK3A 4UM7A 2ZG6A 5AW9A 2DQSA 4F72A 1ZD5A 2HDOA 4IFTA 1Y8AA 4HGRA 5AM5A 3UM9A 5AW3A 3RFUA 2WF7A 4OFZA 5T41A 3SF0A 2W4MA 2RBKA 3A1EA 2JARA 2RARA 2YJ6A 1TJ4A 4OHFA 4OD0A 5AI6A 2JAWA 2WF9A 4AS3A 2FUEA 3NAMA 1K1EA 2C9MA 4KX5A 5ALDA 4DWOA 4UMFA 5AM0A 5AI8A 2Q4TA 4BEVA
chains in the Genus database with same CATH superfamily
1YBHA 3O8OB 5ARDA 4ZV4A 1PEYA 2ZAGA 3I9NA 1E79A 1MMGA 2BI8A 1KETA 2ORIA 4KDCA 1I6LA 5G3ZA 3FNHA 1H4TA 1SOVA 2R5WA 1RQPA 2QM7A 1K5HA 3OEEA 4TMXA 1X0VA 5FL3A 3ANYB 1DV2A 1P0QA 2QZJA 2GLXA 1P72A 4IHJB 4A73A 1F2UA 3A6FA 4X93A 4GM0A 2RKOA 3FNRA 3CGWA 2WAXA 3KFXA 4KRFA 1JFSA 5K0CA 2DQYA 5JRAA 4CEHB 1M66A 3A4TA 4KQWA 2UU9B 1HDZA 1NPDA 3EZ7A 1XK7A 3I83A 4BDTA 2Q3DA 2XDYA 2XYGA 2PGOA 3HVIA 3FNBA 4B3MB 2EDAA 2YIMA 4QOJA 3B5IA 4MWDA 4IM7A 2FRXA 2OKCA 1XI2A 3GZNA 4RGQA 2I9KA 4Q1BA 1SG0A 3LCUA 2GJ9A 3AB8A 4QX6A 3AZQA 5ALUA 2FPPB 3QPCA 1M2OB 4FDVA 2WTEA 4PLPA 8AT1A 3IQ5A 1EDZA 3MC1A 4CN9A 3BOSA 3FUVA 1AKYA 1RWBA 1NVAA 3JVDA 3DS8A 1J8FA 4BLPA 1EVYA 4PFSA 2V3CC 1TYZA 1D7AA 4F5WA 1AZWA 5L0HA 3WGYA 2XSZA 1M0SA 2CCJA 4CF3A 3WKDA 3CLHA 1O6FA 1CLUA 4X97A 4U9IS 2QUIA 5AKXA 4FUQA 3NVKI 5ERGB 1KSFX 3IUMA 2RI6A 3M4JA 2BLLA 1Z4IA 2PWZA 2YZMA 3HDQA 4MRMA 3FVVA 4PO1A 1H1LB 1KI6A 4QZVA 2VNIA 3SZGA 4U2CA 1UOOA 3QVOA 2JHGA 3CF0A 5COQA 2EL9A 3FGZA 4DBQA 1FP4B 4TM7A 2RHDA 2QTRA 2AQIA 3BC1A 4KE6A 9ATCA 1YA6A 2FSGA 2PFSA 3L8JA 4YIHA 2CLIB 3D4NA 3E1GA 3AILA 4NG5A 5HYVA 3RUPA 2YYSA 5L9AA 3ZJ5A 4I46A 3IUSA 4EDFA 1ND5A 2IPXA 3C41J 1B6SA 1JEJA 4GE0A 4HGNA 1JIQA 1N3IA 3E6AA 1ZI8A 1J4AA 1ZOLA 1Q17A 2WMNB 1WXEA 2EP7A 4G2TA 3UK2A 1E98A 5TQVA 1FP2A 4GZMA 5EIWA 4BFVA 2Y0PA 4B5LA 3OZGA 1ZX1A 3CXUA 1P44A 3OVMA 4WXPA 5FPQA 3UJ8A 5BUCA 4CIYA 2XLOA 1CQZA 1FDIA 3HA3A 4N6NA 4TXHA 3K33A 2XNSA 5H3CA 3O8NA 1N92A 4YQZA 4CU5A 1Q2UA 4IWBA 1DFHA 3C8GD 4Y6RA 4RD3A 1T29A 1DWOA 1VM6A 1SUIA 2PBRA 2QROA 3K9LA 4H4DA 4HZUA 2E6KA 3CU5A 4IXDA 4LKOA 3VPDA 3SEOA 1OTXA 5JUWA 5KVAA 4N0EA 3EEQA 3FDFA 3C3EA 1PX0A 3B5JA 3ZWWA 4CMIA 4RDIA 1VPWA 2WC1A 2KW3C 3RAPR 3IA7A 3NNDA 5AVYA 5F28E 3IP7A 2Y1OA 3VI3B 1FFAA 4FHGA 4P86A 1GT91 1P18A 3RTAA 1VDMA 2PH3A 2VDNB 3EGWA 3L7CA 1V4VA 2E85A 3V1MA 2BZ0A 1VCNA 4L73A 2DB4A 1Z4LA 4TTPA 4BGEA 1JJIA 3DL4A 3LLUA 5E1MA 5JCOA 3UJ6A 2UXBB 1KI1A 3ZJVA 1EQUA 4JR2A 2ZSHA 4KQ2A 2J0VA 2QRGA 3O8QA 1X19A 4MHSA 4O02B 4KLCA 4BVLA 4YAKA 2W2KB 1UT8A 1E20A 3AG6A 2W43A 2ZATA 4OMUA 1K7SN 2BBOA 2SKDA 2WOOA 5EQJB 3SJZA 2QZSA 4F91B 3HZRA 1GA6A 3MXTA 4FFRA 4E2YA 2GCOB 1F8UA 2H9AA 5CA0F 1E9VA 3H17A 1ABBA 1P1CA 1V5FA 3DF9A 2HIAA 1AXEA 5ALHA 3K9BA 2QV0A 1T43A 4WVFA 1NBMA 2IHBA 3RF3A 4HUQB 1R8XA 2Y1XA 3GFQA 4MJ7A 4DIKA 3BRCA 1QE0A 5JJ5A 3SM9A 2QX6A 1YA4A 4TTTS 3ONVA 2LVBA 3ZQJA 4ETIA 4G4SO 4OKSA 1J42A 1XZHA 3HKEA 5LWHA 5C8VA 1GJRA 1YZUA 4AUKA 5KC8A 1U31A 3MN1A 1Y7PA 4H1WA 1FRVA 2OCLA 2RONA 3JARB 1XLWA 3ADBA 1JAIA 1ZK0A 4LSMA 5D2CA 5TXGA 3TIFA 2TSYB 1JHDA 1KMMA 5T3YA 1W88B 4YUXA 4GHWA 2ATCA 3SE7A 1B6GA 3AKEA 3DWIA 2XDWA 1CQIB 2R9RB 3T9OA 1SXQA 4FHDA 3KUDA 1KMHB 4DPLA 1GNTA 4NJMA 1YJCA 4NXMB 4N4WA 4EH1A 3TLXA 1JG2A 4D41A 3BXGA 4FINA 2KB0A 4JAVC 3O55A 1E2UA 4S3MA 4N06A 2OD2A 5HKKD 1DG9A 3WKEA 2JA1A 5DGCA 3AYXB 1RYBA 3EIOA 2RC6A 3L49A 4GLOA 2AZMA 3LQ4A 1QFMA 4NH0A 3RTDA 1FMFA 3Q4GA 1IPHA 4EI8A 4RVOA 3VO2A 1RKEB 1ST2A 2QNBA 3FNQA 5C8XA 1CUZA 2Z9CA 1AZLA 1NDHA 1R4ZA 1V3TA 3A8TA 4KDEA 2YXPX 3HABA 5IASA 1DMSA 3GANA 1ZMXA 3PU6A 3JD0A 3W5DA 3UJDA 2YZ7A 2H1WA 3PS9A 3PTAA 1IM8A 1JDJA 3GMSA 3KNZA 4UARA 5L3RA 3I2JA 1XNHA 1PW7A 2HRCA 3JD2A 3TF5A 2GZ2A 5LQRA 3VH3A 4RENA 2E87A 1O0CA 2CYAA 3HRKA 1O6ZA 4QELA 4ZEXA 3UBMA 3JSZA 4YP7A 3DLIA 3NYLA 1ZP6A 1M1ZA 1N9GA 3IVXA 1C7EA 3KJIA 4NBUA 1VYHA 3G0BA 2VDKB 3S0XA 5JIBA 4URZR 2I2AA 2ICAA 1JWBB 5ESDA 1BFKA 4UASA 1ZCAA 2Q2QA 1QH9A 5CLHA 1V2HE 5ICEA 1R37A 1CQJA 2XMBA 2AXPA 3A04A 1FDRA 4Q3BA 1T2AA 1NMXA 1NG1A 2EXXA 2D06A 3LDFA 4Q1DA 1PFWA 8OHMA 2HT6A 2HI0A 4O0MA 5DHUA 4NQZA 3VPGA 3WQSB 3HDHA 1N7GA 2VP5A 5JISA 2Q5EA 3L0DA 5G0VA 4LQCA 2UZ1A 4O29A 5KKNB 2GZRA 4YTEA 3JD1A 2J9XB 4BKMA 2AZDA 3KR2A 5CDFE 3MHTA 2IS6A 4N39A 3RRMA 4JLKA 3ON5A 1YGPA 5ETJA 4ABTA 1G8GA 2XYHA 3H9JA 4ISBA 3QBVA 3FYDA 3JAKA 5DLPA 4PO3X 3JYHA 1UC5B 2C2OA 4J7CA 3QUTA 1VMIA 2ZIXA 3CIOA 2CLDX 2P8JA 4JH0A 2Y0BA 4TMFA 1U7WA 3CHYA 4CM6A 1ZH2A 4NLLA 3C5EA 5FA8A 5JTUA 1AGXA 2PMWB 1ZOSA 5KVCA 2DGDA 2OV1A 2XMDA 4ZVRA 4MUKA 1T9CA 3COWA 4H6WA 2JFHA 1PZGA 1Y3IA 2G4CA 4JROA 3V9PA 2PKWA 2Q7DA 2IEBA 3HBMA 3QX9A 4R5MA 2L6HA 1V8PA 3EVEA 3MW8A 2HS5A 4LYAA 1V26A 1QH0A 1OLUB 2F4VB 4B40A 3ZWXA 1I7QB 4D8WA 1F4PA 2DECA 4KHPB 2X2EA 1FB5A 2ONJA 1NYLA 1Y1LA 3ZE8A 4JI7B 1ZI9A 5FADA 5C7IO 3C39A 3W5VA 3ILYA 2G62A 4XGKA 1OH6A 3GJZA 1T6UA 1OD6A 2REOA 1HE8B 3GA0A 4L3WA 4RV5A 4IDDA 1JKMA 1X80A 1CT9A 2VDUE 5J23A 2WTNA 4C6TB 4JCHA 4HUTA 2PA3A 1YJQA 4D6XA 4HS9A 3RFVA 4ZCRA 1SBYA 3PE6A 4DZRA 4EDHA 2HYIC 1Q1BA 1TO2E 4GPD1 3DL0A 3Q8XB 5JZBA 4MQ4A 1NOIA 1H2AS 3GOQA 1F9AA 4BMNA 1VJGA 5A5FA 1M10A 1UMKA 2EQAA 2J7PA 3ROFA 1I14A 1FL9A 1XDUA 1XLVA 1Z38A 2GUWA 2VJKA 1BMTA 2Z57A 1UIRA 3HWX1 2X19A 3LLKA 1FNCA 3PFHA 4G36A 3L4KA 4Q7MB 3H1GA 4AX2A 1V5GA 5TB5A 4A0SA 3QVGB 2A7XA 3OJEA 1ZICA 3HFRA 1DAOA 5D86A 3DKAA 5LA6B 1HR0B 3HP7A 4YJ3B 5LQCA 3ZHRA 5FA6A 3OM0A 5LVAA 1JRLA 2P4EA 2WKSA 1JA0A 1N6PA 4BBZA 1UDCA 1VL6A 2NN3C 1XNQB 2Q45A 2Z30A 2QPTA 4A6DA 1I5RA 2NTYC 4DAOA 2GA0A 2I2XB 1PEKE 3C8GA 2UZ4A 4OD4A 1CPYA 2IS2A 3BM5A 3WQHA 3KBBA 1OWPA 1GUBA 2OK8A 5A6BD 1JKXA 3PQCA 4JJGA 2E3JA 1VPVA 4YO8A 1LC3A 5DM2A 4AWBA 2ST1A 4NESA 4P4NA 3VFDA 4ZCTA 1Q0ZA 2LCIA 2NPOA 5KJCA 4XUDA 1LPOA 1P2GA 2HC9A 5F9MA 1SUBA 4B3SB 1IXSB 5T4HA 4IGEA 3LX5A 3GQBA 1ISFA 4NBWA 1XL1A 2IODA 3DZBA 3GUVA 3RO7A 4UFOA 3TEJA 2Q6TA 1OBVA 2NACA 2AMYA 2ZUUA 1AHIA 2FFQA 3LY9A 4JL6A 4NS4A 1DADA 5CT4A 4DMRA 4F2HA 1OCEA 2VJBA 4LPSA 4V3BA 4A2WA 3OQOA 4IGKA 3AJMA 1Y1PA 5FLYA 1E94E 3A6GA 4WBNA 2I0FA 4E7OA 1P2TA 3BL6A 1C1DA 1AF7A 4GQHA 3PUHA 3V9AA 3LT5A 2Q5IA 3QKTA 3Q2OA 1UDAA 1N2IA 3LCMA 4MV4A 5E7QA 4BU1A 5IAAA 3GM1A 2O0KA 4G9EA 4LY9A 1HDIA 1E6CA 2G5CA 4M9XA 3WGKA 1ZJ5A 3RAFC 1IC6A 1OFTA 3BFKA 3GT3A 3PWZA 2H1VA 5D3QA 3JCZA 2WJPA 2O1EA 3GJ6A 5C51B 1FR0A 2QNIA 5DKFA 2HV6A 4MMZB 1ECGA 2DTEA 2B8JA 2D3WA 2WEKA 2UZIR 1KL7A 3Q1KA 5DSXA 5AM4A 3RAGA 4RULA 1D4AA 2AT1A 5AK5A 1A8UA 1XBTA 3JXEA 4GP9A 5JQWA 2B7BA 2IS4A 4UPVA 4WN3A 3SX0A 4ALIA 4JCZA 1L4YA 4WQMA 4KFUA 4RH1A 4NICA 3ZHBA 1KI2A 3UWPA 4NENB 13PKA 2VDQB 5H7XA 4NPCA 4RQTA 3ENVA 4D99A 2RCYA 3ANMA 3JRWA 3K05A 1JJVA 3C0KA 4L50A 5K3OA 2G9NA 2JAUA 1PFGA 3TOZA 4OGLA 4ICIA 4TYQA 2I3DA 2FAPB 1DRJA 2W37A 2IYPA 3ETCA 4LPKA 1HX7A 2G82A 2YL3A 1PT9A 2A0UA 1CZUA 1CWUA 1W5FA 3ADPA 3HRIA 2DFNA 2Q7OE 3EWNA 1JJBA 1OZ0A 2FZGA 3CH7A 3HN6A 2OBNA 3PVZA 4L57A 4LOJA 3EJWA 4B09A 4XQ0A 4E1BA 1A9SA 4MVOA 1LLCA 5CLQA 1IONA 1BWRA 1H42A 3M34A 1TVEA 4I1RA 4JIMA 2X8JB 1JV2B 2POQX 3AIMA 3DMPA 1CZHA 5JVEA 3PQEA 5EZSA 1DQSA 3ZHTA 5CFMA 5HKOA 1NUPA 3TPZA 1QR2A 2NTJA 7MDHA 1ST3A 4JD5A 3IURA 2NU9B 5I7RA 4MXDA 1QH8B 3FSJX 2FRDA 1NJ2A 2JLBA 4J0IA 4MI9A 3CZ9A 4PQYA 2A68F 5G02A 3TZQA 2IDKA 4PNZA 1D1AA 3THSA 4ZICA 1DO0A 3R0JA 4UVIA 1ENZA 3U09A 3DCYA 2HOQA 2WK1A 2QVGA 2VSOA 3R9KA 3RS5A 3PUZA 4EZEA 3EVBA 2ZT5A 1AD2A 3CRW1 3LQKA 1E63A 3DTNA 4K87A 1A96A 4KXYA 4LRTB 3KJZA 4GBGA 4IJKA 3EMBA 3V33A 1RE1A 3I28A 2ZIZA 4JYCA 1OFHA 3N8NA 2BP7A 4N49A 4YASA 1JZQA 1NZEA 1QMGA 1NR5A 3TG8A 2QTHA 4HN9A 2ZJ7A 4YAUA 3FKSA 3U5ZB 5FCLA 2NXCA 2J9ZB 3Q9SA 5CDYA 2PQMA 1YDGA 5CVVA 1N5JA 1HE3A 1QFJA 2WQZA 3ZCUA 4Q3NA 4WZBB 4G5QA 4M0CA 1ZGZA 1A5SB 4G2NA 4WV3A 4Y2UA 1KP2A 5DM1A 3WFJA 3ZBUA 5KOHA 1Q1EA 3L7OA 1ABEA 3F1LA 3PHF2 1U7ZA 4EBJA 5JD6A 1OW8A 2QQ0A 1RDFA 3JRMO 4HGOA 5CXXA 1PL8A 2GHRA 1JNXX 1W5TA 3O4VA 3JAWB 4M60A 1IHUA 1PQWA 3WYAA 4C7OA 3PDIB 2OMEA 3HV2A 3QNUA 1NSGB 1A3CA 4J90A 3U4QA 1WDLA 4YMTA 4X92A 5HF8A 2C4MA 4DJEC 3OPXA 1KU2A 1MVOA 4TT3D 2EARA 1EAYA 3JVVA 3PZRA 2ATIA 1FVHA 4ABYA 1XWJA 3A14A 3BF7A 2PV7A 4PX5A 3OX3A 2PNOA 1N2EA 2H2GA 5I5EA 1GNVA 1W0JD 2WINI 3LDHA 1GHTA 2J3IA 3F1KA 3VHRA 4EUNA 4MDFA 5AK3A 2J32A 4RTQA 2O3SA 1HSZA 3SF8A 1G5FA 2OB1A 1WQ3A 3ICEA 5DN9A 1F17A 2AI2A 1YT5A 3E9QA 4IFTA 4WLEA 2FU5C 3I6IA 5C4GB 2D8MA 1BQ4A 3E7PA 1IY2A 4OREX 2X5KO 3U8VA 1AS3A 4MIKA 1C3XA 5CM9C 1PYGA 2Q1WA 2JARA 3GX1A 3FBGA 3VR2A 1HL3A 3QVLA 2Q3TA 3V4VB 2G5PA 4B44A 4B8ZA 3LW7A 3RYFB 3RW0A 4KXMA 4NNOA 3OF5A 3PFNA 2ZT8A 3IAFA 3ETGA 2O2GA 4LNUA 4P6IC 3LT2A 5CYPA 2ZBVA 5AM0A 3UAGA 1PJRA 3RVBA 4X20B 2KMLA 1TUBB 3GNTA 3R7SA 4RORA 2DBYA 3I37X 1HPLA 1TQGA 3F3KA 1EK0A 4XQEA 5K0LA 5TRTA 4QDUA 1BD3A 1F4LA 1LLFA 1G8SA 2WAAA 3NU1A 5EE0A 1BJRE 3HMQA 3BWBA 1XP8A 3HLYA 5HBGA 1MMAA 1EG2A 3SKVA 1N3YA 4PGAA 1JRAA 4C4TA 4FW8A 4IWNA 4P3XA 1DRUA 1SOAA 4YCMA 4RJKA 2A84A 1VLTA 2OZEA 3BYZA 1FFDA 1K75A 3ONEA 1SIOA 2MINA 3NYMA 1XPJA 2FJ0A 1JAXA 1KQOA 2XQFA 2YICA 3DZGA 4K5QA 2FYTA 4L5BA 4KSBA 2P69A 4UNIA 4Y6LA 4X95A 4OKIA 2YWAA 1ODFA 1UPCA 1XN4A 1KDVA 3TR6A 4CU2A 9ABPA 1ORWA 3QP9A 4OI2A 1EKXA 4YVFA 3RQSA 4Q4CA 1MBZA 4OCZA 5K0JA 1AKNA 2MYTA 4N12A 3OE5A 5ALPA 4DV4B 2LD6A 3KZOA 3AY7A 4HWTA 8ADHA 4E5UA 1DKQA 1LJ8A 1X7DA 3AWDA 3INRA 4Q9KA 3LTEA 4YAWA 1LTKA 3WGQA 5BNWA 5IN4A 1CERA 4MAAA 5KCMA 2Q62A 1IPFA 2FP3A 4EYOA 4F2WA 1A50B 1SXIA 1MT3A 2OCAA 3GFRA 4AXXA 3DDUA 2P9EA 4JEUA 2WTUA 3DTVA 4LERA 1E2MA 3HKBA 3S81A 4NFLA 1H93A 1XTTA 2C2GA 4ND3A 5E9AA 3LJBA 4EJSA 2DI3A 3KO8A 2HBRA 2BJHA 3DAYA 2NO7A 1CUJA 3DH0A 3ROZA 1EEHA 2ZJBA 1T1RA 1QCDA 1JT2A 3WRWA 4YI5A 1RSZA 1YL5A 3EVCA 2ANBA 2D54A 3MAGA 4L6AA 5LKRA 1W76A 2JB9A 3TQCA 2NNLD 2X5XA 1HYBA 5F35A 4H7EA 3PKZA 2GF9A 4EUHA 3IOCA 2VYNA 5CPBA 2HNKA 4MKGA 4UHEA 1L5NA 4UTZA 2Q1SA 1EZ4A 5E8JA 1FSSA 3D6UA 3TVDA 5EP2A 3FHOA 5J63A 1C3OA 2IYQA 1RM3A 3U7IA 3O82A 3OIDA 4DEVA 2C78A 1JB1A 1MVLA 2X77A 2Y9PB 1FLAA 3FGPA 3IIKA 4LX8A 3VA7A 4JDUA 4IICA 3D43A 4YS6A 4ZEVA 2IUUA 4ZZ0A 5CDUA 1FJXA 3WNDA 3AESA 2VDPB 4NOKA 2R60A 3DMNA 4JSYA 4KQXA 3UXYA 5HGJA 1Z17A 5D3KA 4RYDA 1T8WA 3NBYC 4UXJA 1FYVA 1J0EA 3RREA 1NATA 1OQAA 1AG9A 1MDBA 2CDRA 5ITZB 4TXJA 3H87A 3NNSA 3L0ZA 4YY3B 1YR6A 1DDGA 1E5LA 4NPAA 4PPYA 3SDBA 4EPYA 2BGRA 4R1NA 1LZKA 5CH8A 1QQAA 1DU4A 1P5FA 1ZYUA 1QPZA 2HK8A 3C6KA 1YRQA 4QYWA 6AT1A 4G65A 4TXNA 3QBEA 4HLUA 1OIVA 1DS6A 1Q1ZA 2AC7A 2PMKA 4X1KA 5E3IA 2RKWA 1VHTA 3O4GA 5FBZA 5BN5A 5HNKA 1N34B 2PX3A 2FPGB 2G6TA 1ZWLA 1P2FA 2SKEA 2QGFA 2AJCA 3O1JC 1C1HA 4BJ5C 4KO8A 2AEEA 4N7JA 3U3MA 4OHOA 1UQUA 1AQYA 1RC1A 4MYTA 1I3MA 3DV0B 4D9BA 4IQ4A 3NETA 2BTQA 1P77A 1WB4A 4NX2A 1V8ZA 2FX3A 2PL9A 4JKIA 1V7ZA 2UYQA 2NQTA 2FFHA 1MJFA 5BR8B 3SXMA 3DGFC 3IV7A 4D43A 1I1HA 4A0RA 3GLGA 3VNBA 3RSFA 4OMDA 1F06A 1NONA 5FL7D 5KTPA 1TW2A 1UJNA 3FZEA 1S7ZA 4Q21A 1NW8A 2R7TA 2J41A 3C7KA 4FYPA 4LBYA 5CMLA 3WLNA 3U4DA 1HNNA 3D02A 3MTQA 1QAMA 4E18A 1KERA 3QFCA 4BEWA 5CD1A 3I2FA 4XD7D 3TW0A 3K5HA 1NXVA 4GZLA 3N2YA 1R16A 1MAUA 4DR3B 1K7EB 3A36A 3ZBTA 4EUEA 4FP9A 3CBGA 3FHTA 1YGYA 1PW5A 3O6XA 3O8OA 4R3WA 2ZYTX 3QE2A 5IJZA 1SK8A 4L9AA 3SDSA 4F4CA 1L4LA 1VJRA 4R41A 3QXJA 3VX3A 2FN8A 4O2RA 4R1MA 4FT2A 4XOUA 4CDVA 1JF8A 4YUZA 4W8PA 2WZBA 2A5YB 2W8BB 3ROXA 3OP1A 3ZPXA 5KNDD 1YR9A 2FMKA 4ES6A 5CCBA 2EKLA 3BGVA 5LYJA 5GZ6A 3ZDBA 1QLEC 4G0HA 4K28A 3FWKA 1OH7A 4GMHA 2OK7A 1UC9A 4ARBA 4JI8B 1UQTA 1L7XA 3T6BA 1OT5A 1I4EB 4U2FA 1N5MA 3VOBA 1V8BA 1XPUA 4UM8B 3ZTTA 5AIBA 2M6SA 1EWVA 3HB0A 4JBYA 4KH0A 5EHIA 1LNQA 4L9RA 5JZ9A 3PJRA 4NJOA 4GAEA 2VSNA 5I9MA 1NRXA 2XB2A 3GUUA 2XY4A 3OQBA 3DZHA 1X9GA 3L6CA 1FMWA 1KTMA 2D0PB 4JSRA 1RM5A 2FRVA 4Q4LA 5ECWA 2WJJA 2C5FA 3L4SO 1KP9A 3DHYA 5FR2A 4CUJA 4DV3B 3R7AA 3W5AA 3E1KA 4DSAA 3ID6C 2ZVDA 3K4QA 2GYUA 1I3NA 1MW9X 3ZE2B 1F6WA 3L5KA 5ALVA 2YWDA 4G4GA 3H8WA 4GMFA 3EPHA 4BMYA 2XA1A 2J9UA 1NRIA 2AOXA 2ORED 1YVIA 3RSZA 3A9WA 2BFCA 5EWJB 1YZ3A 4GC5A 1OCRC 1FCJA 3E9MA 3GPIA 1QZTA 3MTDA 3TOCA 3T7EA 1W4ZA 2QT1A 4XD7A 1F8GA 4J75A 3I0MA 5B3AA 4XX0A 4Q24A 4YGYA 3V2GA 8LDHA 1JQ3A 2YFQA 1WTYA 1U6KA 2QORA 2ACVA 2W2MA 3L1IA 5AVUA 3E1SA 2BW0A 1QE3A 1K8QA 1OASA 2CFSA 1HW2A 2DVMA 4XYMA 4BRZA 3PUVA 3DWFA 1Y9EA 1XOIA 4I1VA 4JX9A 1QVAA 3C7AA 4IY1A 1PRYA 1SCJA 3V7WA 2VZ0A 4LZAA 2SECE 3P0JA 4V1CI 1JEOA 3A9RA 4JJFA 2E4AA 5H16A 2FQYA 3ZGZA 2Q3LA 3E2IA 3RAJA 2YLDA 3LF2A 4HRXA 3L4BC 4D26A 4IOJA 3HBFA 3I8XA 5E38A 2KBEA 4DNFA 2H7CA 4RTKA 1GPYA 1QK3A 4MROA 3K96A 3OMLA 5GOTA 4QLOA 1YU6A 1PDOA 2Y67A 1AKRA 3RIMA 3ANSA 3TEFA 5HCNA 3RTBA 3EOZA 1SUWA 2X2OA 3E9NA 2CKDA 3LT4A 1N6OA 1PWHA 4JYPA 3TSYA 4A1OA 4DXAA 3AVVA 1DLIA 1ETUA 2AQKA 1MGOA 2VK2A 4GR4A 3W0LB 1LU9A 2GPAA 4FKBA 1BMDA 3EBPA 3KHTA 4YXWA 1JIUA 3TB6A 2E49A 4CIBA 2CE2X 1U1EA 2W11A 1X8LA 5F5XA 1MB0A 1RLJA 1XZGA 2C2YA 4ONSA 4E0BA 1VOMA 2X22A 2ZWMA 4U7TB 3IIJA 3EF0A 4ZXPA 3O90A 5DTEA 3P2KA 3RNLA 3HFSA 4PBSA 4LBZA 5D3MA 3NRJA 4MW6A 1HE5A 3GMTA 3W8EA 2GCIA 4AYXA 3KSMA 2QUKA 2V7PA 1DEXA 3QMMA 1CKEA 4P0PB 2PT6A 2CLKB 2XNCA 2XUAA 4BNHA 1KNXA 3NMIA 5LMZA 2IYYA 3IDSA 4ZT3A 1QYIA 4GWGA 5ALJA 3ZUPA 1AHPA 1RAFA 4TX1A 4EYQA 1AKMA 3I5YA 2XUOA 3SHVA 2J5XA 2CLHB 3LRXA 3KJQA 4OBXA 3MILA 5JC8A 2Z08A 1HLPA 1GLNA 3GEDA 3GYGA 4NDZA 4QNNA 3J06A 1ESCA 2JEYA 5FBWB 1IHPA 4KH1A 2DTDA 5CBKA 3PXAA 3BDIA 2EEZA 3K66A 1LVKA 4DB4A 3LX8A 1ZIDA 1FVOA 2HA0A 3H5AA 1Z4QA 2XWJI 3H8VA 3MB5A 3NRBA 2HEIA 3P4YA 1X0XA 4JS0A 4FIDA 2JGLA 3ABMC 4LDNA 3AVUA 4DMMA 2CFTA 5HKAA 5EMJA 4G85A 5LB4A 3DE9A 1RRPA 4BJ5A 4BKPA 3TFOA 1THGA 3NKDA 2NUPB 1LY1A 4WGYA 1PYDA 2LZ0A 2QLNA 3DOHA 4CM4B 4EECA 4EMBA 2GNPA 4QNMA 2CHFA 1A7JA 1XT6A 2QTWB 2XITA 3CRVA 1RVDA 2HCFA 3OJCA 2R65A 3H9UA 5A05A 2IOYA 1FYFA 3H7AA 2R7XA 3H5VA 4RS4A 4TSFA 3IKMB 3ZWQA 3D1JA 1TTPB 4C0KA 1H0SA 2B7LA 2K4MA 2FP4A 3BMCB 3IDZA 3WGZA 1AHHA 3WMWA 3UMVA 5BWBA 1TFRA 3ZK7A 1DAFA 4LHVA 2HMUA 5FJIA 3ZCSA 1MJHA 4MH0R 3PQ7A 4U9EA 4AMGA 2J0QA 1GGNA 5T4FA 2PPVA 3G6KA 1TK3A 3WLJA 2HXGA 4FZVA 5ES4B 3CZCA 2Z4RA 3G79A 3KOMA 5EKSA 3W8RA 3KXIA 4PFKA 3PC2A 1N3BA 3SXZA 2IHTA 1KMIY 4D44A 3CNNA 4MYDA 4DQUA 1FTNA 2NXJA 4ZGWA 2ZXPA 4WT7A 1YRYE 8ATCA 1FQOA 1FX0A 3ZV6A 2V7QD 4DRZA 1DC4A 2FFRA 4YONB 5ED4A 4CKBB 1Q0UA 1PQUA 3SVTA 1OH8A 2ERXA 4AG3A 1YOBA 5LL6P 4Z9JA 3BUSA 3GFBA 3RHFA 2IEYA 3QFSA 3VSDA 3ZJUA 2X0KA 1XTIA 3ZU2A 4H9GA 4CQNA 3AEQA 1LV7A 2D7JA 2EGHA 3FF4A 1X1TA 1FNMA 5IAKA 3R7CA 3JR7A 4JT4A 4QXQA 2Z4TA 2GFQA 4TM8A 2Y1FA 3W1VA 2F8SA 1UJ2A 1V9SA 3DMTC 1Z22A 1GFWA 3VPSA 3I6QA 5EIXA 5KVSA 1T01A 3H16A 3HNPA 3DVAA 1EFPB 4O4LB 3UGTA 2XCSB 4QYXA 2P75A 3A9CA 1F6DA 1KPIA 1UF9A 1KJYA 3IAAA 5ALZA 4B71A 1ZHOA 5IXYA 1GSAA 5EGYA 3FKSD 5LP6A 4IYRA 2ZQ5A 1KYTA 1P1IA 4JB2A 3T9BA 3NMJA 2XTMA 3ORFA 4ZN6A 5KYTA 5FBVB 1YF3A 3G2HA 2OL4A 1NXWA 2R79A 3ENKA 4CEJA 1XWIA 3NKEA 2FA9A 3R8FA 4KPGA 3EZFA 1UG7A 2IC5A 1V45E 1ZZGA 4CG1A 5ICSA 1OC2A 4YWHA 1MHTA 3RUFA 3LAYA 3L02A 4ZCPA 5SY6A 1GCUA 3HUUA 4RLFA 3B48A 3EZ6A 4DT1B 2DBRA 2I67A 2JJ8A 1YJAA 1KC3A 4REOA 5KEIA 5LXTB 4AFNA 1E3MA 2FZEA 2KLHA 1FQWA 1E1YA 4EJSC 2WYVA 2CJWA 5JROA 2IHUA 1UPAA 4XARA 1R0CA 1N8KA 2LBPA 1HDOA 5AKLA 1VTMP 1T1IA 5CVTA 2HSGA 3G5TA 3HCNA 1MX3A 4BJ6C 1YZNA 4OYRA 2ODBA 5JY1A 3NRHA 4DMKA 3G50A 4F9TA 3JQ6A 4IYJA 4D46A 3KLPX 4XVUA 2Y69C 3FD8A 3S3TA 3T5MA 1BDJB 3U4HA 2Z5FA 4H0FA 4HHEA 5E4JA 3H05A 1HF3A 3HKKA 1BYIA 4ZYUA 3ESBA 1NE2A 1XZBA 5AW2A 4OGFA 2ZSJA 5DRTA 2FN7A 3F5DA 4I3MA 2J07A 2FWAA 1EUZA 4AC9A 2DGJA 3GWNA 1PTJA 3JPYA 3FYUB 2PKQO 3O8BA 4JC8A 3G17A 3BPSA 3RC9A 2G08A 2QRNA 2JBWA 5YASA 4O4IA 4MS3B 5D01A 3WMRA 4F5ZA 5TEWA 1HG1A 1SHLA 2C0QA 2PXCA 4B6QA 1LLQA 1E3IA 5K8IA 3P1JA 2M32A 2L6GA 3HFGA 4NC3A 3HR4A 4ZAGA 4BQPA 1IB6A 2A9FA 4LKRA 1AK1A 2C3OA 4I1OB 1JXMA 4LXUA 1H9GA 1NA5A 3U5TA 1ZXLA 2BDUA 4RKFA 2I2DA 5A6SB 2WVNA 2H7YA 2EIJC 3CA8A 2C3MA 2HU7A 3L1JA 4WSOA 2MT9A 5BOSB 1CUWA 5C1DA 2AN5A 3ODGA 3V5NA 5AW6A 4LVNA 2VTBB 4XIJA 2QTVA 3AKCA 4CLXA 3IVGA 2VWQA 5HTOA 1IAQA 5IFKA 2CMHA 1A2QA 5I7AA 5IFLA 3H42B 2J46A 1FTSA 2HDOA 3VTZA 3C97A 2R2AA 3DFFA 1V8FA 3C85A 2A5DA 4KB5A 2IW1A 3JSEO 5BSUA 4UREA 3RS4A 4AZ3B 4NU0A 1BAPA 2GZDA 1C2TA 2ECPA 5EAIA 1JSCA 5HP4A 3GB9A 3IA2A 3BIWA 4ZARA 3W6PA 2VLIA 1PL0A 2I62A 5HJ2A 4C7KA 2PRKA 1RYYA 1BKSB 2CBXA 2PUWA 2CNOA 2H4YA 1T6NA 2QRVB 1T4MA 4CJOA 2J0XA 1LQUA 4YQEA 2XS8A 5JVDB 2AJTA 3N0XA 2WHPA 3SOZA 1XCLA 4C5AA 5FWNA 1NI5A 4L3OA 4RANA 1ZONA 1LD3A 1F6BA 4OH1A 4D9JA 1E3TA 1HC7A 4JIOA 3AXSA 4R8SA 1SUCA 4AJPA 4M9CA 4ND4A 2Q4TA 2XNDD 4EG3A 5ECYA 1AN0A 2P5UA 2CCYA 3ZKWB 3ADCA 5IKXA 1TC1A 4K6OA 2POCA 3C3YA 4IF6A 1DO8A 4UBJA 2R1ZA 2J87A 3GRYA 2N3ZA 3PL5A 4WASA 4EI9A 3HXPA 2QSZA 1T2EA 2PWBA 1Z5NA 1SKQA 4A1FA 1A72A 5F77A 2O8EA 1E0KA 3DL7A 4YAOA 1H9TA 1RRMA 5A3RA 4DXWA 4K2AA 1DRWA 5IC4A 4DCNA 2XLEA 1WXHA 2AJ8A 1K7YA 2C82A 2WIJA 3MWDB 2ATEA 4I0WB 2COKA 2M6LA 4ZDJA 5BV0A 2XZLA 3EVAA 2OQRA 3W7AA 1M54A 4R3UC 2PLNA 2ONKA 3H3FA 5GGXA 2OXCA 5G0UA 3VMMA 2E4XA 3FMOB 2HSDA 5IABA 1KQPA 2UVQA 1YCHA 2D1RA 4K0RA 1U6IA 3EXG2 2OU6A 4YRSA 2JFFA 2BYTA 5J47A 3WLMA 3GFSA 2VJQA 3MJTA 4EGSA 5CIYA 1XA0A 3HJGA 3FFAA 3DDSA 4BFZA 3PL1A 1U9ZA 4AIRA 3VBCA 2BC9A 1F1MA 4EWCA 1QYXA 3Q5EA 4EJFA 1RYNA 4MQFA 3W6OA 1RIIA 1DIRA 1EDOA 3L0BA 2IYFA 2QE7D 5C34B 3SYKA 1D6MA 3U3XA 2XWPA 4BTVA 4EB0A 4YDQA 4RESA 4XAQA 1KRWA 5IXJA 2I91A 6CHYA 3UBTA 3AQ4A 3EK2A 3EVGA 4QVKA 5ALQA 2AG5A 1QORA 4UD6A 4L15A 4KN6A 4LMPA 4L5IA 5A6VA 2QUHA 4MQBA 4ZT5A 4B2LA 2O8DA 5C81A 4DIMA 1IHDA 4ZDIA 5B6JA 1NG9A 3C43A 1SD1A 2G1AA 3IQCA 3IEXA 2LFFA 4YL0A 2CT8A 1Y81A 4YP9A 5G4KA 2UXDB 1FXSA 4TVOA 2VT2A 3DLBA 5B12A 3IXLA 2V8OA 3GLSA 1ZW3A 3LQFA 3D3JA 3H11B 4GPZA 3EG9B 2PO7A 4HDRA 3BIFA 1Y6RA 2J7PD 1SURA 2JFVA 3KZVA 3NASA 1D6NA 5JO9A 1Y9JA 3A9SA 4HB4A 1QH1A 4AUMA 2C07A 3QITA 4WX2B 3QUQA 3BH6A 3ITFA 1XJWA 1I13A 1B73A 2ZJ3A 1VDZA 4J1TC 3B0UX 2ZRMA 3NHPA 4FN4A 3EH2A 4EGJA 3V8PA 4YHBA 5LD2C 1PTJC 4MB6A 2RGRA 1SC6A 2R62A 5ALFA 4G37A 2BRUA 4TROA 3WK8A 4IH1A 1ZNZA 4JOSA 1RI3A 2VHZA 3SZMA 3QI2A 1QHGA 2NG1A 3U6KA 4CQMB 4A26A 4HUJA 1UODA 1XU4A 1TI7A 2HA6A 4CS9C 3LC2O 3KG2A 2HHJA 2UVPA 1YACA 4P81A 5T8KC 3RVPA 4O4HF 2IU4A 1SPBS 2GCNA 2HJHA 5LZ5A 3K9QO 1L5FA 3ZE0B 3MTEA 1GXSA 2GK4A 1XF9A 2ZYSA 4BWGA 4GEGA 5DTMA 4CMAA 4ECEA 1JAFA 3TDMA 2VWHA 3A06A 3ZIUA 1JMWA 1M2JA 2GAAA 4J7XA 3WIBA 5JCJD 1GRQA 4YLGA 1MT0A 4YDRA 3SZUA 3N74A 4R7TA 4OXXA 3PHHA 4ZYYA 4RY9A 2ZWVA 3FLEA 1MIHA 3DJNB 2N42A 3NFYA 1XP5A 4JA2A 1P9LA 3EPVA 4OMFG 1LDBA 1P6XA 4JLBA 1W2WB 4IEEA 4UOZA 2XM0A 1TE2A 2PL3A 1KKUA 3G8YA 4MEBA 3Q98A 5SYAA 2K7FA 1GM5A 1BEEA 5BQPA 3IQFA 3RC2A 5EN4A 1K5GA 2YV3A 2VH5R 3WJ2A 3W9YA 5JWRA 1WKBA 2CK3D 4K9LA 1M1YE 4KN5A 3RGGA 3ZWCA 4G09A 4ZOLF 4DLKA 3COSA 1DL5A 4N0MA 3SQLA 5E1DA 1N78A 4Q0MA 3RSSA 3CUWA 1RKBA 1IZ9A 4X66B 3PC4A 5ER6A 4N01A 4L5JA 1QO9A 3ES9A 2TMGA 3H2UA 1RVV1 1ZVJA 2VP3A 3JARA 3PA8A 4EX6A 5CT8A 1YTLA 1UP6A 1IQUA 1NN0A 1WCYA 1X14A 3N8GA 3OPYA 2CEKA 4JUCA 4QIHA 4V3CA 4XWJA 3DNMA 3D6HA 4EP1A 1M2KA 4OQNA 4CM4A 1TAUA 4H7DA 4PEVA 3KV1A 2WA1A 2BGUA 2NV6A 2OLKA 4BWVA 1G6KA 3BSFA 5CH3A 4EA8A 5ITZA 4R2MA 3ITDA 5E95A 3U8PA 1VZ3A 1W73A 2NO5A 2EW1A 3RIEA 5LQUA 3LBIA 4L5CA 2YY6A 5TARA 1P1KA 4GM1A 4NAVA 1LA2A 4EG6A 3CH6A 1T4DA 2XL4A 1E8MA 4FOSA 5K3FB 4K8RB 3DAGA 1LX7A 3M3DA 1MW8X 2PGLA 3L77A 1BA3A 2HK9A 2IZ0A 2VCEA 3EDMA 1H4QA 2Y4NA 1A7EA 2IXNA 3ZWIA 2DKFA 1S2NA 1VIYA 3OT4A 4MVCA 4L78A 3ZNQA 4HEA1 4ER9A 4PYQA 4TWIA 5KVQA 3NKLA 2F9FA 3K1ZA 2EX1A 1MXFA 4AJIA 4AZSA 1ZCFA 4ZCLA 3Q7GA 1UJ6A 5F1YA 5L3VA 1JSZA 4WPGA 5J9FA 1W6RA 3BAZA 1T6BY 1JMYA 2VJLA 3B52X 3DVRX 3G0DA 2WU3A 4GOND 3SPXA 1N2CA 4RF4A 1W96A 2FZVA 3F5SA 3RT7A 1MQ8B 1DKUA 4BY9E 5EXEA 1C7RA 4U2DA 5KYXA 1NMYA 5E6RA 1A8QA 4BPMA 1F8XA 1XVLA 3DNPA 4EBFA 5B7PA 4CL2A 2A1UB 4ZAXA 3RVJA 4NVRA 4EG0A 1IPEA 2JIBA 3ETNA 4CHTA 4J30B 1CUVA 3OPYI 2ZYIA 4WESB 1EESA 3HSYA 1M6VB 4HL6A 1EDBA 4MUHA 3SIPA 4AN0A 1BYUA 1I4OA 3DFMA 3QELB 3BRJA 1C0IA 4EB8A 4QEDA 1Z68A 2WWGA 3PDHA 4Y2HA 3UNXA 1ISSA 4P4SA 4HS4A 3ZDCA 2R7VA 4AROA 2I03A 1S9HA 4RMJA 1C9YA 1EK1A 4DLRA 6ADHA 1VE9A 2G09A 3GNQA 3KEOA 4IWXA 2P0EA 4KQ9A 1M7HA 2FTKE 1K27A 1ZGGA 2R00A 4GZ5A 2O59A 5ERXA 3G1TA 4RSHA 2LCHA 3H6KA 5I9NA 1LXCA 3M4YA 4D0GA 2OP1A 3H6HA 1CUHA 1MKYA 1Y4UA 3PPVA 4R1TA 1I6MA 1Q0QA 4RK1A 3FOOA 1RR6A 1YQWA 4I36A 4TT8A 4X1IA 1Y3BE 2A86A 1V4NA 2H17A 2ZRBA 3OESA 1DJLA 1H3FA 5GY7A 5B2ZA 4DLZA 1M8PA 1PNOA 1D9XA 3AEXA 3S2FA 2VHVA 1HNXB 5KNCA 1R27A 2W0MA 3NTLA 1T0JB 4DJ9A 4O5OA 5COFA 3UAZA 2XGJA 3NP7A 5FPPA 3HCCA 4OBEA 4EHDA 5CBPA 1C9NA 4F46A 3FTPA 2LCFA 2OXIA 2XGOA 3UFXB 3D54D 5DGTA 2UZAA 4ETMA 2X15A 4F3CA 1LBTA 2YZGA 1RQGA 2CWDA 4BMZA 1L5HA 2GO1A 5KSPA 3PX7A 4Z3DA 1Q11A 2WYWA 1EUCB 3Q88A 1PO7A 3VBEA 1QYDA 3A9UA 1MP0A 2Q9UA 3RYHB 4QT4A 4V0KA 5L95A 2W58A 1QGUA 2W5UA 3R0ZA 5EIBC 3JWIA 5FFNA 3RB8A 2H07A 2JGMA 4JLDA 2R7NA 5K0GA 4NJEB 1OJ7A 4OMCA 2BSXA 3DMGA 3NBZC 4MMXB 4S1WA 5ECDA 4Z0TA 1IZ7A 2AD1A 3NC0C 3GRAA 4E14A 4BVAA 4CS7A 4PJJA 4RE5A 4LHZA 2H18A 4G78A 1ACLA 4RFVA 3AR7A 2V0CA 4WERA 3EFBA 1GNSA 3IR6A 4TTIA 2X2FA 1LQTA 3STWA 2BKUA 2WZCA 1S8OA 1Z18A 3DNFA 2BRUC 4G25A 2X1LA 5DDIP 3GXBA 3UWOA 3MTAA 2LFDA 5GZ1A 2FG6C 3S4YA 2XIJA 2H1HA 1DT5A 2OFPA 4LHWA 5F76A 3U1VA 3GVCA 5E0OA 2LCQA 3I05A 4OD5A 2J3EA 4IOKA 3OG9A 4KQ6A 2HLDD 3GT0A 2GAJA 2I7XA 2R3SA 2HEGA 3SFVA 5D6OA 1TU0A 5GVRA 3ZY3A 2LIPA 5E9WA 4ZQHA 3GLIA 5H83A 1DOHA 2CE7A 4F3KA 4HQRA 3LUJA 3P7MA 1EFAA 1DJOA 4YT2A 4IDFA 1OI3A 5ALEA 3DVSX 3D2LA 5CDTA 3TGWA 1N2SA 3TOMA 2X0DA 2AOVA 3ZQ6A 4II2A 4ZC1A 5HKLA 4I8XA 5SZHB 3MBOA 3OEHA 5J4HA 1FFYA 3IBGA 2GN4A 3WG9A 1NMSA 2C59A 4YWJA 1C7JA 3WL7A 2EQBA 3I9MA 1RZRD 3M83A 3ZH9B 4LN1A 4I9UA 4TLAA 3EXHA 1RXQA 1DO2A 1MGPA 4J6EA 3DBOB 2M6KA 2PL5A 1EDEA 1L0BA 1RT9A 4KNWA 1WMEA 3REOA 4BV3A 1PUJA 2OBYA 5KYWA 4UAJA 3VC3A 2QGZA 1ODLA 3KYDA 5JH7F 3N76A 5EQTA 4RHTA 1JIIA 1W59A 2O4CA 2WT9A 2RCNA 3ZVLA 5JHGB 2VCYA 1MPXA 2VDRB 4KDFA 2EOAA 4LXGA 4OOFA 1IHOA 2DKNA 5CCEA 4P34A 2OFWA 4ZA2A 4F7DA 4F38A 1NBOA 2WTBA 3VRCA 4IP0A 4L74A 1GZ7A 2P6UA 1E1MA 1P3JA 3A27A 3Q0EA 3M2PA 1YHZA 3G4ZA 3KKOA 4EMTA 4UTRA 3ZV3A 4JBLA 1EM8A 3DLHA 5TS2A 1YJ5A 2PSSA 5FKJA 5TF0A 1JHOA 2B8WA 4NBSA 2YH2A 2HGSA 1J2JA 4NZ9A 4EJ2A 5H9VA 1BHQ1 4B2YA 3AEQB 5KQRA 2CXRA 4OYHA 5EPUA 4BN0A 1JPJA 1PD0A 1E9BA 2PD6A 4NMWA 4QYIB 1NC3A 3HM2A 5DHSA 4L6IA 3T5GA 3EF1A 2OCKA 4IFEA 4CCWA 1JHPA 2WWIA 3CNBA 5DULA 5IKEA 1AMOA 1SQ5A 5IJ9B 3ETHA 4DUGA 5B6PA 2I2CA 1A97A 1E6LA 4QTUB 2JLSA 3ILHA 5GWXA 2AX4A 2A1TS 2QLLA 2WFLA 4RD0A 1YL6A 5CITA 4PZLA 1TLLA 2I76A 4XWOA 1Q0MA 3DHWC 1PHRA 4FYYA 1LI5A 1O03A 4PF1A 5DOZA 3UK0A 4I6JA 1DKOA 1KWGA 4LF5B 3L8IA 2KPOA 3TLYA 4AY6A 3BX1A 4B2PA 4LISA 3C7TA 4YN0B 3UGPA 4HQ0A 5DVWA 1XD2A 3QEJA 3CVJA 4AX4A 5BVGA 2FJUA 4R51A 4RPLA 4Q5IA 2VF7A 5JAHA 2HKVA 1N25A 1QIJA 4IJVA 3DKKA 1U4NA 3Q7QA 4WNCA 4WKCA 3E35A 5H81A 5LUBA 2VRCA 1Q15A 1KAMA 2O8BA 1KKLA 2J9FB 1OKKA 4C0QC 1X8XA 4ZGBA 1YYXA 3H8SA 2GM3A 2Z2ZA 2MDTA 2WWWA 4NJMB 2IYLD 4BLTA 2PUDA 4QU9A 3TDNA 4I6EA 3HB1A 4G07A 5BW8A 4IH4A 2JGIA 5FTJA 1T5DX 3WKCA 4ZEOA 1F8FA 3VU3A 1Z45A 1H2YA 2C7RA 2Y0EA 1K92A 2P9JA 2ZYVX 1SXJA 1T5BA 1KAOA 2YFHA 3LQ1A 1ZBDA 4WFIA 5CM2Z 2M98A 4FFLA 2OJED 2V74B 1Y7HA 2BPOA 2O5CA 3CW2A 1VYIA 3AYZB 2O1WA 2PUFA 4MGHA 4Z53A 3TD6A 3D5QA 1WG8A 1L6IA 4W9NA 3N9IA 5CB8A 2R25A 1EVLA 3CB2A 3UCFA 3VR1A 4NZZA 2HBQA 3IFSA 1MTZA 1RAGA 4DCPA 5U9CA 4CJGA 1W5EA 2X5JO 5AICA 1NU8A 3MLEA 1DCTA 2X4GA 2A9PA 3WTCA 4YUAA 1N5RA 1ZL2A 5BV8A 3THYB 4JI5B 3IVAA 4ZI7F 4OL0A 2CK3A 1ISRA 4G0NA 1SBTA 4GXTA 4K6GA 5EXPA 1I2ZA 1I7DA 1W0KA 2QLFA 4A92A 3DV9A 3E9YA 2Z2XA 3CR7A 1NW4A 3PUKA 4EG1A 2H2HA 4A0HA 5EIHA 4AL1A 4N3AA 4Q7JB 1YS9A 3I1YA 1D6SA 4YDSA 2OBXA 3L84A 1T36B 2P7HA 3TAHA 5L4LA 1DAIA 4GXRA 4PV7A 4B34A 2QQFA 2JPUA 2NUPA 4MKRA 1SGWA 1G6Q1 5G3YA 5IJXA 4Z1MA 5EZYA 1U2EA 5JBNA 1EXVA 3CLSD 5BW6B 3GNSA 5CPFA 4LTDA 4MHOA 4E7ZA 1V11A 4JSTA 2PYIA 1JR3A 1Y5MA 1GZ5A 1GZUA 4KI7A 3IEUA 4ROSA 1X92A 3P2YA 4W8GA 5MHTA 4MKHA 5BQ3A 2F59A 2JFBA 4M0FA 1R4NA 2CWWA 1U28A 1P9WA 3NZEA 2YJTD 3UC5A 5HX7A 2EZ8A 3RT9A 3VGJA 3SMQA 1A9TA 2YDXA 3A4LA 4C30A 1C30B 3DDCA 3EQ6A 4Y2GA 2BHTA 1XMJA 3OSZA 4L08A 2PA0A 2QMOA 3T6GB 1HEYA 2X4LA 3GM2A 4KX5A 2RDMA 2RBEA 4PCLA 1KYYA 4XH9B 4RNDB 2GTHA 5A7HA 4I14A 2XT9A 5I7VA 3FPEA 1I4ZA 3V97A 3N24A 4INAA 1XDDA 2YUTA 3RS2A 1VXRA 3OFVA 1Y5RA 4RGBA 4GYJA 4OIQF 1SG9A 3QHAA 2O8BB 1YZKA 1N3LA 3BA1A 5DX1A 4A8JB 5JLIA 2HRDA 4YEDA 4PE5B 4CRWB 3WHNA 1CIVA 1UIMA 3EVZA 4J8PA 4S0XA 5ALKA 1ATIA 4D8VA 5HOQA 4HVCA 5L7TA 3TLGA 4XYLA 4XLPF 2IP1A 1EVEA 4RC9A 2PZAA 3T1VA 4HFFB 1CQWA 4FNGA 2VCCA 1WPQA 3MS2A 4PPFA 1QVWA 3D64A 2BM1A 4J7UA 1MN6A 4F6CA 5BQXA 5FH9A 1HFJA 4NV1A 1ZJZA 1XXHB 3P0EA 3K71B 3TE7A 1Z0KA 4NYJQ 4GQAA 1VIMA 1YRAA 3LP5A 4X3OA 1HH4A 2VA8A 5AKZA 1U0JA 1HZZC 1Y1SA 5DLEA 4DDVA 1EP9A 2DFPA 4XYBA 1DKPA 5E2IA 3SS8A 2BBTA 4I81A 1X1DA 4TYNA 4AP5A 4IFBA 1Z88A 4I44A 5JP7A 1RQLA 1SA0A 3UANA 2J9BA 4JRZA 3PLAE 1SXJE 1ZFNA 1JI3A 3PDIA 3PUYA 5DEOA 5J1SB 2GLTA 2R6HA 4BMXA 4HTFB 3U0VA 3VQTA 4MVXA 3PEWA 1UC8A 1SM4A 2MIIA 1KAHA 2CXUA 1O94A 4Q3OA 1TK9A 3KOYA 3DBHB 4IBOA 4LTNA 3LUBA 2PM8A 4MWTA 3HYCA 4TXMA 3O2QB 5HG0A 2VNHA 3L0IB 3JVIA 4IJ5A 4KXFB 3SNHA 4IDAA 1Z4KA 3CEXA 3OECA 3MWLA 3GJXC 4MV5A 2CLFB 5EXDA 3TRFA 3KQNA 4FCTA 2AC4A 4IDQA 4LYYA 7YASA 5CXSA 3FPGA 1ACJA 4B74A 3NO4A 4H6PA 3C5CA 3P2JA 1O8BA 4JENA 3C3BA 3I1FA 1SHKA 1T5IA 1L8QA 1KNYA 2AFIE 2PPLA 1FU7A 2XVXA 4K40A 4CV0A 4ZVVA 1N4AA 2G4LA 4FW9A 4KE8A 4BVFA 4D8XA 1U3UA 1QUEA 4JUBA 3CW9A 4URWR 4DJ5X 1N5KA 4DV0B 1X7YB 5KNBA 3L82B 2P4UA 3U62A 2VJMB 3BRSA 4DS3A 1J97A 2YXEA 4F3RA 4F93B 2AG1A 2YMQA 3UGJA 1WLYA 2VYQA 3ACBA 3WNBA 1BGVA 4Y2YA 4BJ3A 1DC3A 4EOGA 1U94A 1KSHA 1HYEA 1JIJA 3FJYA 3K9HA 1S2OA 1ECBA 3AVQA 3ASZA 4YMWA 3E23A 4HNGA 1BNCA 1I2AA 2ZANA 3HCPA 5LSAA 2I2WA 2AB0A 3ZWOA 5AVZA 3ESQA 3L6OO 4ZQBA 3JZFA 5HDQA 2PFDA 2JF0A 3OZWA 3ETJA 4OLFA 4TWJA 2C57A 2EWMA 3L06A 2BWJA 4M9QA 2EKQA 4BKRA 1GDDA 4M0MA 3LWZA 4I4LA 4LQLA 2AUTA 4B3FX 5J4YA 4PQGA 4O6MA 4IRUB 5ITSA 2VTEA 2YXNA 2G36A 4JXKA 4O4IF 2BR4A 4AX8A 3H7IA 4CIVA 1PV3A 2CSXA 4AF6A 1LTHR 1SKYE 3RI3A 1JIVA 4X1KB 2HA5A 3PFIA 4HDKB 2QN8A 4ZZ2A 1B8UA 5G0TA 3WL5A 2WIKA 4PCVA 1Y8RB 1I5EA 5ESRA 2O3RA 4EF5A 5EHXA 3IT2A 5C53B 3AR5A 3K53A 2XEDA 2PYDA 3E4DA 3LXRA 4LY0A 3DDZX 4NENA 2WHEA 1POWA 3PT9A 4OA5A 4AN4A 1DKLA 2DHDA 2YIDA 4C2BA 5DBGA 4ER7A 1A76A 4HNAB 4NTAA 4HYTA 3ZXYA 4CMCA 4PTLA 1EFCA 2JL1A 3A11A 3QW1A 2BONA 4L72A 4WGFA 2WJ3A 5A9TA 4B8WA 4C07A 1QOPB 1EFVA 4TWZA 1BXRB 4U3JA 1UKBA 3UT5B 4C4YA 4AQ7A 1BCSA 3LUCA 1M8GA 7ADHA 3PXUA 1MC8A 3NC4A 2VZLA 4IGAA 4GGMX 4GKAA 4WVLA 1IG0A 1LBEA 1JDBC 3FPCA 1L8AA 4M36A 2X0NA 4RV4A 4NBRA 1N33B 3NMKA 1E9AA 5K7SA 2MHRA 1PZMA 1GEGA 1TM3E 3ZGNA 1JFLA 4RKQA 1TQ6A 3C3KA 3ZW7A 4AJHA 3QX7A 1CRQA 2WKWA 3UNGC 2FDCA 4F9EA 1LPBB 1Z5OA 5EESA 3C18A 1TQHA 4E5MA 5ADUS 1OOEA 1LDYA 2A4MA 5AJWA 3UG6A 5KTYA 1YULA 1Z2CA 2DYRC 1KQ3A 3W05A 1DBIA 2QBYA 3GDWA 3P2IA 2LIGA 4JBGA 1E0DA 1BKYA 1AVOB 3WK7A 3INGA 4EQ6B 2VZ8A 5MFPA 3L6EA 1QK4A 1VP9A 2QPLA 4BUCA 4E2WA 3CGGA 1QG0A 2NVBA 5CLJA 3QU4A 5BN4A 3HPQA 4FWBA 3VTKA 4HNTA 1W8IA 1Q6YA 1AQUA 1YKFA 1JBQA 4PINA 5REQA 2EFYA 1KE1A 1UKZA 2NXEA 1OFGA 3IJEB 4JNKA 4YRCA 3W6NA 1WBDA 4RSMA 2R7MA 1GSIA 2WJ4A 5A5DA 1L4NA 1CJCA 4QSMA 2HH9A 1C8LA 3AVYA 2L69A 4PR3A 1AA9A 2J9WA 3WDSA 3X1MA 4BE4A 3WY9A 4OQEA 3KXPA 2CXXA 3QX8A 2VHEA 3F98A 4G5YA 1JXQA 2L82A 3PQ4A 4CDMA 1N2BA 3TECE 4OF4A 2E5FA 3KAPA 3V2IA 1VC2A 1JR3E 1OROA 2QMHA 4OA8A 1CVLA 1GL9B 1G2IA 3DCJA 4YPFA 1XKLA 4D9EA 1IN6A 1LS4A 4IGFA 2DR2A 3IBSA 4LV5B 1NVMB 5AYVA 3SSMA 3S5JA 3VC1A 4KYVA 1UANA 2B35A 2F1JA 1EJ0A 5INTA 2O23A 3LPLA 1Y6FA 2FPLA 4DKJA 1ZC3A 4G8CA 4KV7A 1E1DA 4UVDA 1GGJA 3BFVA 1WB5A 1GKYA 4Y2VA 2W6MA 1W6UA 4LZNA 3WQBA 1ITZA 4GU5A 3V1YA 3ITKA 4BQEA 4P9FA 1I2DA 1TMGE 4GR5A 4ZHQF 4J1NA 2XAAA 3OMWA 4KR2A 4M21A 3X1XA 3L0PA 1R4MA 5K0NA 1Z6PA 4QG7A 4CI9A 1KZ9A 2A3NA 2FWIA 2WIBA 4BPRA 2BAGA 1F4VA 2SNIE 4LYEA 2O6HA 4YIKA 3LNRA 1TA4A 3ESAA 2P6PA 4KHZA 4NQFA 1VLJA 3FE2A 3GO4A 3KSUA 3FUTA 3LLMA 4BP8A 3EE6A 2ZR7A 1RFLA 2H8AA 1UPUA 3O1IC 4Q7EA 5DX0A 4KWHA 1D1PA 3KHSA 2BTOA 1BCSB 4U0KA 1JVNA 3UEOA 4C0LA 1ZMOA 3I5AA 3UUWA 4DXDA 2G25A 4FZ3A 3KZNA 2OQIA 1XA3A 1MEEA 2JD1A 3ZIAD 1YIOA 1DAPA 1XZCA 2VH1A 4PTYA 2PN1A 1SUPA 4UNQA 3RYFA 4U5DE 2FB9A 3D6MA 3ZH2A 3AUXA 2G76A 5KREA 1F2DA 2BBWA 2H00A 2HU5A 3T12A 4BBAA 1XTUA 1U6JA 1GPKA 2NO1A 4PG7A 4HV4A 2KJGA 5I7WA 3T6KA 2BZSA 1SKYB 3JYNA 3LY7A 2PX8A 4Z8YA 3RYLA 1ZHZA 3ZZUA 4HPJB 1NW7A 4PGHA 3BSYA 2HMAA 3OE1A 3L43A 1T25A 1XSEA 3RT1A 2DSTA 3NGMA 1XEWY 3EQLF 1ILEA 4J07A 2W2LA 3UFXA 4GECA 3WGGA 1V6CA 1CZKA 1MQ9A 4XGIA 2ZBGA 1HT2E 2QI9F 1D1CA 2UVPB 1TCVA 3JQFC 2ACKA 3V5ZA 3IP5A 4QRDA 4YH1A 4BVKA 2R8OA 3IOMA 3O93A 3KB2A 1QRSA 2DYKA 2VBCA 2NWQA 3Q1LA 3FPAA 1QTIA 2ZJ0A 3LUPA 1AGPA 4KLRA 4L22A 3ZHCA 4AJKA 3LTNC 4MEJA 4ZQFA 1N5OX 4BMPB 1RNLA 4MITA 3CX4A 2K2QB 5LMUB 2FAXA 4IZHA 5H59A 1VFNA 4CTKA 4FILA 5KNLA 5K09A 1O77A 4WD3A 1Q7CA 1FDVA 5I9SA 3KQHA 1TYAE 4U5FE 1BGXT 3PKIA 2QR2A 5DHRA 4JI4B 4JP5A 5L3QA 1HDCA 5J4KA 2HSQA 1SUAA 2H7VA 1X1RA 4HWOA 4ESOA 5DS6A 4NFHA 1NY5A 1DPGA 2REXB 2ZZKA 3LL4A 4EF6A 4BKUA 3L7KA 1U5AA 5I4BA 3RROA 1M0TA 3U48A 5D91A 1R5ID 3U4IA 1KC1A 3IP1A 4N1AA 3U13A 3ZNOA 2R6GA 3SC2B 3H2VA 1XEXA 1NVDA 3PC3A 1EBUA 1WZIA 4K9SA 5IDXA 1O6GA 1ZN9A 1T3HA 4PC7A 3QMVA 2PMDA 3JQPA 3IGFA 5KOJA 1U3WA 2FOLA 4JE9A 1NBIA 3DE0X 3QU2A 2W4BA 3VM6A 3WNCA 1AQNA 2FGYA 1K8ZB 4R3NA 4KYTA 1K0FA 3PPXA 2Y1LA 4V1CB 1L7OA 2Z58A 1SVKA 2O5VA 5A4JA 3ILSA 3JZ0A 3GAZA 3FZYA 3QLVC 1NKSA 4B17A 1R9NA 2OO3A 3OLZA 1EUDA 2EBHX 4BWFB 3GVXA 2PZEA 2VQSA 3CKKA 3O8RA 1ID1A 2GD1O 1P7WA 3UWMA 3NANA 5E7JA 2KC3A 4OFXA 3W8NA 3KQUA 3H5RA 3EXG1 1T8UA 4C7MA 2EFGA 1U2TA 4ZVNA 4DIOA 3K1TA 3K1HA 1FUIA 2LK4A 2XODA 4J94A 1VLVA 1GL6A 1TZJA 3B2QA 3B3QA 1LPSA 2FW6A 5KWEA 5C7YA 1DKMA 4A82A 4EYEA 4DZZA 3LT1A 1WA5A 3IEKA 2GZAA 3LGSA 3TI7A 4UQPA 3R3XA 3U31A 3DO5A 3GDHA 5TVKA 2R02A 3R5XA 3Q6MA 1X6VA 1U9YA 3VR6D 2HBZA 4J2HA 2R7SA 2P65A 1EM8B 4NY1A 3GRZA 5D87A 1TIBA 4GSKA 5DM4A 1FW8A 5HE8A 1MA0A 3AXTA 4HNVA 3ELYA 4YV7A 5JJKA 2PRIA 2V58A 2WYUA 1W75A 1E3DA 3T3PB 3CIFA 3JT1A 1W85A 1I1QB 1ZH0A 4EHIA 3PITA 5DHFA 4W6ZA 4N47A 2L17A 3FPBA 2HQBA 2LNDA 4G0QA 1QGZA 2HTEA 1V4AA 4FT4A 4NCXA 2LR0A 2OV8A 4IVQA 4P5DA 4HC4A 4RJ2A 1DDIA 2YWFA 3BB3A 3U4CA 1P7YA 4FVTA 4TLMB 1ZAYA 2RHGB 3ESYA 5TQ2B 4Y6GB 4ZOLB 1QDUA 4TOIA 2H0AA 3NBAA 2HY7A 4X1YA 3USCS 1YUNA 2PFGA 1MMDA 3JQBC 5HXAA 4EW3A 3ASNC 1AUVA 4C3DA 1DQRA 2HUPA 3AETB 4QRHA 5E6UA 4WZBE 4TV8F 3BGIA 4ID9A 4EJ0A 5IBPA 1RHRA 2IXEA 3VR4A 4XCXA 3W2TA 4DNPA 3EZIA 4YR7A 4J2OA 4LGMA 4BLOA 1OMOA 4CV3A 1VFPA 2GHTA 2IRWA 5HQTA 2FZCA 4LF8B 1GADO 3JV7A 5EWLA 4Y18A 1SD2A 3JW8A 2P4HX 1OB5A 1JEQA 3GG2A 1OI2A 1Z5GA 2WP0A 1J8MF 3X3HA 1DMRA 4BGDA 3QVXA 2I4NA 1KYXA 1WCIB 4DRXA 2X58A 3RUAA 4DJFC 3GFPA 2C2MA 1BQ3A 2PU7A 5BVHB 4II7A 1PQ4A 4CEIA 3MINA 4GOXA 4TVKA 5HQ3A 5I8ZA 2IPMA 3WGIA 3FJOA 3FY4A 4KBFA 4QQNA 4JT2A 4M98A 1J22A 2G04A 3FYHA 1W19A 4J0HA 4MWGA 4IIDA 4LJYA 1NNUA 3I09A 4JYAB 1T15A 3VI4B 3U7FB 2PIAA 2DXIA 1JG3A 1SVMA 2GA9A 3QLTA 2X7JA 4F2PA 1Q7BA 1Z3IX 1N6IA 1UMBA 2GOYA 1QVXA 2V7BA 3AR2A 1OPXA 3ECCA 4RKYA 2NT4A 4FQ8A 3DE1X 2ZBDA 3SBXA 1ZGAA 2QK4A 1L8XA 1V1MB 3CZQA 5SZIA 5JS8A 1E2IA 4DV2B 1IOWA 2BTEA 5JZSA 1MG0A 2W90A 3DBIA 4ZO8A 3MWFA 3SEQA 4DW8A 4PFQA 3UQZA 2H7VC 1NYRA 5AW1A 3E05A 4BZQA 3ZCQA 2W6PA 3KETA 4FFWA 1LFDB 1RCFA 4Q4JB 2XEXA 3QWFA 2PH7A 1DIBA 2UUOA 2WWFA 4MVJF 5EL0A 4J1QA 3IHUA 1EVZA 4EHNA 1X9HA 2XMGA 1WN0A 4IZOA 4MW5A 4RTMA 3T1TA 4MIYA 4FR5A 4KUGA 3CUSA 4IVNA 3C8UA 1XCPA 4Z51A 3EFOB 1TLTA 5M04A 2UUCB 3KPJA 3COVA 3S28A 3BZWA 3H5IA 4RZSA 3MJVA 4BMOB 1Z6XA 3S44A 1U0EA 5BSWA 1AURA 1EJ2A 3AEKA 3IAS6 4TRRA 1G98A 3U3ZA 5C5DA 2M1ZA 1QX4A 4MCJA 3WDMA 3N2KA 5FBKA 1EVKA 1Z7WA 4KVZA 3K0AB 3TLBA 1XHEA 2YXBA 4R6XA 1EP2B 4C4OA 2JGJA 5JSZA 1R4NB 2LDBA 1J20A 3AF1A 1MEJA 1ID8A 1FRNA 3ICVA 5CVCA 3D6VA 2GEKA 2CNKA 2PR2A 4P7FA 3WJ7A 1AVTA 4JLPA 1L1FA 3MAJA 2ZB8A 4ZV7A 3QUSA 2GN6A 4OQPA 1T6QA 1SC3A 3L7MA 1C3LA 4KMRA 1Z35A 4LDQA 3JALB 2FLWA 3UOWA 7REQA 2WDZA 1II8B 2Q3EA 3MMXA 2AR0A 2W6ZA 3IXMA 1S8NA 3GFGA 3HDVA 3JQDA 3NH6A 4ZI5A 3TNFA 5IEJA 4EWLA 5CX1B 1XTRA 2Q1UA 5FI5A 5TJHA 3B20A 4EG8A 1PNTA 1QHHB 2DEUA 3DSRA 4HLDA 2G0TA 3MWGA 2WOJA 4D9MA 5EJ4A 1GPJA 2FPXA 2XRMA 5BYJA 3L79A 2A6PA 4UXIA 3JATA 5DV9A 2C2ZA 2H7BA 1E2JA 5IUKC 3FH0A 3SKYA 4DNQA 2FPGA 2OTCA 4M37A 1JR3D 1PFKA 2BDTA 2G8LA 3CWZA 3CR3C 1OXXK 1P74A 1TLFA 2CMDA 2JCSA 2QP9X 4G1EB 4K6FA 4LYJA 4QEKA 2VP6A 4Z2YA 3SJBA 4DIDA 4FQ7A 5T4EA 1B41A 4OG2A 2Z1NA 4O8ZA 4L9WA 2VN8A 4B8YA 5D3MB 3OZDA 1P5ZB 4NNPA 3WLOA 5J2UA 2WKRA 2WB4A 3COZA 3K16A 2A5LA 5IF9A 1BOOA 1JUDA 1PSWA 4JKOA 4QHYA 2NU7A 4J32B 3PDWA 4XWAA 4BO0A 2RAPA 4XUEA 5IVHA 3ZC3A 1B4DA 4MI3A 4HDMB 3RTGA 2C4HA 3OD5A 1HV8A 2CXTA 5KYKA 1C17M 3OUUA 1JPNA 4E5SA 4WOCA 2Y1DA 4NZYA 3V1KA 1IUOA 2ODQA 4ZALA 3ZYCA 1G7CA 3FUUA 3O3MB 1OSNA 1E6EA 1YFKA 2NU8B 5I4IA 4W5RA 2QVBA 1P31A 5HQJA 4EGCB 1IVNA 3AP3A 5CX4A 1OUMA 2HMZA 1UFQA 3UMMA 3I34X 1EFDN 3A1NA 1KEZA 5KOJB 2ZWPA 1SBCA 3WAJA 1GPBA 1SWWA 1RXUA 3WIUA 1U1IA 4YQYA 3EUWA 1ECJA 3Q3IA 1N0IA 4MKIA 2NVUA 5CIQA 5CLFA 1L8LA 3C6XA 3K0EA 1V71A 1APBA 3MUEA 4HLQB 3QMKA 4YN3A 1XHLA 4F4IA 2O2IA 1J90A 4M1KA 4F5DA 3HUEA 4GD3Q 3GAAA 3NT4A 3AJAA 2FZLA 3PC8A 4BQIA 4BXOA 3OFKA 4HXEB 4LGYA 3P9XA 1M5TA 1BG6A 4JBXA 3O73A 4RD2A 4KBLA 4TWAA 4ESEA 1Y42X 6PFKA 3M15A 3RIPA 4OSOA 2EFEB 4R8MA 4KLNA 1I94B 4P7GA 4U5BE 2GD6A 2YJGA 4K9RA 1QWSA 1ZGJA 4RYLA 1CY7A 2FKAA 1FNDA 2Q5OA 3Q3CA 2NP7A 3GJ8A 4MVJI 1S02A 2IF2A 1OXSC 2FPUA 2XJ9A 3O3CA 4QOGA 1CFZA 1DXOA 5K51A 1YR3A 2QWXA 3M5DA 2V8BA 1R8QA 4S2EA 2KWIA 1BX3A 4JFAA 1DCKA 3QBJA 1B6TA 4QI0A 1IN5A 3S70A 4D9FA 2QMYA 1UM8A 4KQKA 1FLNA 1VPLA 3DE8A 4JJZA 4ZXFA 4BCBA 1WO8A 5KSZA 2XHEA 1VLQA 1ARZA 4DN6A 3BXFA 3PHIA 2ZBQA 4UD2A 3R5KA 2H29A 2OLJA 4E5KA 3BMOB 4TGLA 4B73A 5U4XA 1UAAA 4L4XA 2C3PA 3I62A 1PIWA 2F55A 1ZO8A 4YRAA 5F5NA 1QZZA 4BRWA 2BE9A 1T1SA 1EGHA 1JU4A 2CD7A 5DK4A 4LE1A 1TKBA 4CKEA 3I9KA 4ZI3A 1P7VA 5KX5B 4Y1RB 3CWCA 1YFJA 1C3VA 1WWKA 3TW8A 3NGXA 3SC4A 1Y80A 3IPRA 4YJFB 3W1WA 3WHLA 3IXQA 1WW2A 3I5QA 1SAYA 3IIMA 3EMDA 3FVRA 1AS0A 3PX3A 2FFJA 1WGWA 2WG2A 5ICMA 2WWTA 421PA 1WXQA 2ZULA 1P5HA 1ZCZA 3HN7A 1V8OA 2P77A 3ADKA 4ZO7A 2XRYA 4LC0A 4JLUA 4D3SA 1W52X 4AXBA 1WNTA 5C37A 2IYAA 2PRZA 2FV8A 3W7BA 4O1MA 3JYPA 3PPWA 3KQTA 3ONNA 4EW6A 3UW3A 3C8ZA 2JFQA 2CJWB 2WIFA 4ILKA 3UATA 2C03A 4DLNA 4YRZA 4M7PA 2GFIA 4G7ZF 1A4IA 3KLBA 2QJOA 3WWDA 4D4KA 4C7VA 1N0UA 5DW3A 1E1RD 2X4DA 2Y2UA 2XIQA 2E7ZA 1KFCB 2NLOA 2DZDA 3K72B 2EGUA 1DJPA 5IVPA 4QWMA 3SSNA 1PT7A 3HE3A 2IVFA 3DB2A 4ZZ3A 4JL5A 1Y98A 3C8HA 4MOWA 2DYSC 2HV7A 4K46A 2RJOA 3HNKA 4YJHA 4E21A 3KS9A 3NDPA 3ONDA 1XYGA 4QUDA 1TFKB 1MF7A 4D56A 1M75A 5K0TA 4P80A 2GPNA 3QLUC 4PC1A 2FGJA 2IWHA 5IY5C 2J3JA 3OO1A 4P9TA 2D2VA 2IY8A 4IMJB 1PR9A 4CM8A 1W47A 3AFOA 4WBSA 1AMUA 1IJFA 1P2DA 3N6VA 4Q34A 3BXOA 3G2KA 4QOEA 3FDQA 2P3LA 2X3FA 1YOVB 3KFVA 3UB2A 3VU0A 4G23A 3S9OA 2ZTSA 1YB5A 4AZVA 4XXHA 1QTRA 1JDBB 1VSQA 2EFJA 2JCGA 2PS3A 3I0ZA 4X8MA 4EG5A 5EJ2A 3QE9Y 2YXDA 1RWPA 4WKOA 5DF1A 2LKCA 1A5BB 2V59A 4MDYA 2OV6A 3F9RA 1YQQA 4C21A 5L45A 3M4NA 2DPGA 5BYBA 4L0MA 3LK6A 4R98A 1F2TA 1NGSA 3T95A 4L95C 4BFYA 3KPVA 1PZNA 1X3LA 1CY0A 1CY6A 4GXNA 4W1SA 5KI6A 4BVHA 4C78A 1FIUA 3IALA 1OU4A 1GAJA 4MW4A 4NEGA 4PZDA 2I1WA 4HRAA 3QSGA 1X9IA 4D45A 4AI6A 4JU8A 5FDFA 4C6RA 5JZOA 2B98A 3MD0A 1GT6A 3TZHA 1IUKA 3PNQA 4Q47A 1QIEA 3O7MA 4O63O 2FFAA 1G5PA 1UM9B 1KMCA 2V9PA 1TUEA 1DT3A 4F2DA 3WLPA 1O5TA 4TN5A 3C1AA 1O6CA 2WJYA 3HI6A 5NLLA 3N2IA 1QANA 3CF4G 2IHNA 1O6BA 3I45A 2B20A 3EC7A 1J2TA 1E1RA 2XCOA 4EY4A 2OCCC 1OBCA 1RIFA 1NQUA 1UAYA 2PZFA 3EXFA 2FSUA 3ZYZA 3H4IA 1EP3B 1LS6A 1K04A 1TZ2A 1U2DC 2NU9A 2ZRKA 4RHUA 3ULKA 5A1TA 5BWNA 1W46A 3OTGA 3H1TA 3TD7A 1OGJA 5C3UA 2C31A 2VHYA 4I55B 4ENQA 3WE7A 1VSVA 6REQA 3OKFA 4M1OA 4QXMA 2H51A 1C7QA 4B79A 3JQRA 5THKA 3OEED 3KPHA 5ECGC 1GFZA 1PSDA 4JOBA 4C88A 1YDMA 1GTZA 1IDOA 1A41A 1UPTA 3LUHA 3IDFA 1PGNA 1JKJB 2TRSB 2R96A 3QA3E 4H7FA 4HB0A 1X80B 4JTCB 2NTEA 3ROGA 2PVPA 5K3SA 2Z9BA 5IM4F 1NL3A 4RVDA 4ZU1X 4FYIA 3TQIA 3QKUA 1MMNA 4MR9A 4RIFA 1WEKA 2PGAA 1PLKA 2ZE6A 4CHGA 3H8JA 4MQ6A 4MYCA 4TS4A 5K3FA 3RQIA 4N7MA 1U9IC 2ZAOA 3CH4B 2B9EA 2PR7A 4NBTA 1YXMA 2FPIA 1EWQA 1W1IA 1QRAA 1YBVA 4LNHA 4R6WA 3U7QA 1E4YA 3QZCA 1RD4A 1YCGA 5JS5A 5MN4A 5JCZA 1CJKC 1TKAA 1PJAA 1WR8A 4IOLA 2VK4A 1I7PA 1TZKA 4CJXA 3B1JA 2EBUA 4B3GA 4O7GA 2Q2NA 1QHIA 3MJ4A 3WRYA 5MN5A 3HJNA 4UZFA 4CF4A 1CK4A 4HK4A 1RPTA 2J45A 3SLKA 4Q1AA 1KOJA 3FB4A 1DUIA 1R18A 1CR0A 3KLMX 3KVRA 3MUFA 4GPEA 1VIAA 2FQXA 1UBSB 1HETA 5A5GA 1G6OA 5JNSA 3LUAA 1TPZA 3ZLTA 3BWDD 5A4MS 2MOKA 3PEVA 3I01A 1M74A 3UGOA 2FMFA 4X7RA 3HNOA 3HB7A 2GT1A 3N6XA 4BVGA 1KBOA 2WE7A 1P9NA 4HDSB 3UGKA 3N2LA 1UJMA 2HF9A 5EE3A 2QE6A 4PYNA 1W5SA 1KDYA 3QV1A 1Z0IA 2GS9A 4FCWA 1JMKC 4H27A 5K4AA 4KQ1A