2GFHA

Crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
246
Chain Sequence
b'HHHMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKVSMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords haloacid dehalogenase-like hydrolase domain containing 4
publication title Crystal structure of Protein C20orf147 homolog (17391249) from Mus musculus at 1.90 A resolution
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 94
structure length 246
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2gfhA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2gfhA01
4Y3UA 3OCWA 2YJ4A 3GYGA 3S6JA 1YS9A 4Y2XA 3WKAA 5AVRA 1Q92A 2I7DA 3U7FB 3N07A 2DQSA 2R8ZA 4YIHA 2I33A 3NANA 3N5KA 4DWOA 1N9KA 5T41A 1SWVA 1CQZA 4KX5A 3R9KA 1ZD5A 2HSZA 3E58A 4BX2A 3QYPA 2Q4RA 2RARA 3QUTA 2EATA 1VJ5A 2ZXEA 3L5KA 2FPWA 4Y2UA 3HLTA 3NASA 3OTQA 5AKKA 5AVYA 1JUDA 2I34A 2OA0A 2FPSA 2BY4A 3ET5A 5AW7A 3U7HB 4JDPA 3EWIA 2B30A 1F5SA 3I1YA 2W11A 5AW9A 4Y2JA 2HX1A 3HYCA 3NAMA 4E88A 5ALVA 5AM3A 1T5SA 1RMYA 3SLRA 5ALQA 1Z4JA 5ALPA 3WKDA 3ZTYA 4F72A 3MN1A 2CFSA 1NNLA 1KYTA 2OBBA 1CR6A 4J2TA 4UM5A 3RFUA 3ZWKA 4Y2VA 2YJ6A 2RBKA 5ALLA 2YY6A 1WZCA 2YJ5A 3UMBA 5ALSA 3L8GA 4HGQA 3N8GA 1RLTA 2FDRA 4NABA 2QLTA 4KNWA 1TJ4A 2R8EA 1Z88A 1Z4NA 4I9GA 4FFDA 5AI8A 2WFAA 3AR5A 4IG4A 3WK8A 5AM4A 3L8HA 4NV0A 3FPSA 1PW5A 2OYCA 1L7NA 5AKGA 3ED5A 1L6RA 2C88A 2IOHA 2G08A 3A1EA 4GIBA 3WK5A 3I6BA 4XE5A 4UAVA 3QUQA 5ALUA 1O08A 5AVWA 2IOFK 2YFYA 2GMWA 2MSNA 2YMMA 3QGMA 5AK5A 1LTQA 1RLOA 4HGRA 2GO7A 1AQ6A 3A1CA 2B82A 4ZEVA 4HAIA 1SWWA 3FZQA 5IS2A 2ZBEA 2ZBDA 3QU4A 4BNDA 4C4RA 4UW9A 2YJ3A 2PQ0A 5ALDA 4I9FA 4UMDA 5AHXA 5A3RA 1RQNA 4J03A 1ZD2P 4YCLA 3QU7A 4OHFA 4O8CA 2B8JA 3AR4A 2EAUA 1ZRNA 3EPRA 4AP9A 1RKQA 3ZI4A 2HF7A 4DFDA 4HGOA 2GHQA 4MUMA 3D6JA 2B1RA 3R4CA 2AUTA 2WF6A 3PCTA 3U26A 5AVTA 3DV9A 3N28A 2CN1A 4L57A 2FPUA 4MWOA 2WHEA 3ZVLA 2JARA 3OCZA 4G9BA 1YMQA 2HCFA 3ET4A 3P96A 4NFLA 3L0CA 5ALXA 1ZS9A 4DCCA 3I76A 1ZOLA 2AH5A 2BDUA 2NO5A 3SHQA 4UASA 5AKIA 4XPZA 2PR7A 4CNQA 2FPRA 5ALEA 1XVIA 5AW0A 2C8KA 4RESA 5AW2A 2MU1A 3IJ5A 1TE2A 4UU0A 2R8XA 3EF1A 2FPXA 5AW8A 5ALJA 3KZXA 3VAYA 4AS3A 2JGAA 5ALNA 4KYTA 4EX7A 1TA0A 3WGUA 3ZVMA 2YMQA 4EELA 3QUBA 3B8EA 5AESA 1WPGA 1RPZA 5AK6A 3OCYA 3F9RA 2GHTA 2YMPA 1FEZA 4C4TA 2VKQA 5IT4A 3SKXA 2FUEA 3FVVA 3I28A 4EEKA 5AM5A 3AR9A 5ALMA 1Z4IA 3MPOA 2FI1A 2O9JA 5AK3A 5A3QA 4GXTA 2IA5A 1RRCA 3QLEA 4FE3A 4UU1A 5ALKA 5AM0A 4JB3A 1T9ZA 3AR3A 4EX6A 3IRUA 1XP5A 5E0OA 2FEAA 2C4NA 1K1EA 4QJBA 2WF9A 1RMQA 3WK9A 4BBJA 1N8NA 3K1ZA 3R09A 4BX3A 1J97A 2NO4A 5ALGA 2JAUA 2W43A 2HF2A 3W5AA 4YCMA 1QQ5A 2O2XA 1YJ5A 3WK7A 4KX3A 5AM2A 1QH9A 3WK4A 4H1WA 4UARA 3ONNA 1NRWA 2B8EA 2AGVA 5ALFA 1S8OA 3W5CA 2HDOA 4BKMA 3WKEA 2YBDA 4CE6A 1RDFA 1Z4PX 3E8MA 3ZX4A 1Z4OA 1RMTA 3FPBA 1Y8AA 3PDWA 3TLMA 2IOFA 3ESRA 1Q91A 3M9LA 3QU2A 2ZG6A 5AIBA 5AKXA 2RB5A 3DNPA 3QU5A 4UM7A 4Y2TA 2ZBGA 4UMFA 4OD0A 5AKLA 1IWOA 4IFTA 2C8LA 3QNMA 5ALIA 2HOQA 4KN8A 3L1UA 5ALYA 4KNVA 1QYIA 1YV9A 3CZ4A 3J7TA 5AVQA 2I55A 2BDEA 3UMCA 1U2SA 1RKVA 4YH1A 5AIAA 1Z4KA 1Z5GA 3AR2A 3EF0A 5AI4A 2WF7A 2R8YA 4F71A 3ZW7A 3E84A 3PGVA 1TJ5A 5AVSA 3N1UA 4NWIA 4HGPA 3NUQA 3OCXA 3L8EA 4EENA 1U7OA 5AKJA 5ALHA 5AICA 2G1AA 3QU9A 1EK2A 5AI9A 3DAOA 3OPXA 2ODAA 4UAUA 1Z5UA 2HEGA 5AKZA 1NF2A 1L8OA 5AVUA 4Y2YA 3NRJA 3MMZA 4BEWA 1J8DA 2OM6A 4Y2RA 2CFRA 3RF6A 1RKUA 3WKCA 4BX0A 3WK6A 4HGNA 4XOUA 5AKEA 1RQLA 2I54A 3MC1A 3OCVA 1ZD3A 2WM8A 1L7PA 1ZRMA 2P27A 2G0AA 1WR8A 2IYEA 5ALOA 2Q4TA 1RC8A 2FUCA 3KBBA 4L6CA 2G07A 4Y2SA 5AW3A 1WVIA 1VJRA 4YCNA 3SKYA 4BEVA 4RETA 4HYTA 2P69A 3KOOA 4OCZA 5AI0A 5AM1A 5AVXA 3L0YA 3U13A 2PKEA 1S2OA 2QYHA 3ZUPA 5A3SA 4CF3A 4Y2PA 4PNHA 1Z4QA 4UMVA 2HO4A 4CF5A 1T5TA 1QQ6A 4EZEA 4ZEWA 2NYVA 2C9MA 3NIWA 3ZU6A 3B9BA 3L7YA 4XQ0A 2WF5A 3M1YA 3KDPA 4UATA 1X42A 3U19A 1Z4LA 2JAOA 2EARA 5AI6A 2P9JA 3AR7A 3UMGA 2B0CA 3L8FA 3ESQA 3IB6A 3PGLA 4B6JA 5AK4A 3L1VA 1U7PA 2G09A 3QX7A 3FGOA 3E81A 3KC2A 3ZX5A 1O03A 4L6AA 1LVHA 5AW6A 4UMEA 4Y2QA 3WKBA 3SMVA 3SD7A 4BNDB 1EK1A 2WF8A 5AKYA 5AW4A 3UM9A 3B9RA 4YIKA 2ZBFA 3A3YA 2JAWA 1MH9A 1YNSA 3W5DA 2Q5EA 4DW8A 1VFPA 3BWVA 4ZEXA 3CNHA 3U7GA 4OFZA 2G80A 4CF4A 2D2VA 2GFHA 1L8LA 2X4DA 3A1DA 3BA6A 4C4SA 3OCUA 3FM9A 1Z4MA 2YN4A 3L0BA 5AW5A 1L7OA 1QQ7A 1SU4A 5AVZA 3QXGA 3ZVNA 5ALTA 5AVVA 1TJ3A 2AMYA 5ALRA 4AS2A 4YGYA 4BYGA 3DDHA 5ALWA 3ZTWA 3NALA 3ZWDA 2HHLA 5IT0A 3U7EB 1XPJA 2ZOSA 5AI5A 3WGVA 4NAVA 5JJBA 1YDFA 2YMLA 3AR6A 1L7MA 2G06A 2I6XA 2RAVA 3AR8A 1ZD4A 4FYPA 5FP0A 3W5BA 3KD3A 1ZJJA 5ALZA 3QUCA 5AKHA 2HI0A 4G63A 2P11A 1U2TA 2W4MA 3SF0A 2B1QA 2CFTA 4QQFA 1U02A 5AW1A 1RLMA
chains in the Genus database with same CATH superfamily
1JPJA 3OWOA 5ITWA 2C7VA 3TPFA 4JI1B 1IZZA 5IASA 2WHXA 2DCMA 4UHJA 1U65A 1HEYA 4CMIB 5JT4A 1Q7BA 1E1LA 4CIPA 3ANXA 5JNUA 1G5RA 4TZ6A 5AJUA 4DTCA 2C1EA 1JXQA 3I1YA 2NUBA 3D6NB 1QGZA 5JO9A 3W5JA 4AQ7A 3ZDXB 2C20A 3SCZA 4ZOLA 1ST3A 1AGRA 4HRVA 1ZBDA 4FFDA 3PUIA 5FH9A 4X3CA 3RFVA 4P6IC 1C8LA 4Y0VA 3QKWA 2YXDA 3DM5A 2AXNA 5G1PA 4RXTA 2AW3A 4NYMR 1XA3A 4KITB 3Q6IA 1ZH0A 1RLOA 2DUMA 4HV4A 4HAIA 1K8RA 3JQAD 4URYR 4R5HA 3TLEA 1X80B 1SOVA 3IBFA 3ORHA 3B36A 2XDQA 5E95A 4LTMA 1CRPA 4HLDA 2H5IA 4V0OA 1KFCB 2PH1A 3NTXA 1AUEA 3W6ZA 5I51A 1KH2A 1T0UA 5B1EA 4URXR 4Q4HA 5FF9A 5AUNB 1H66A 2WVHA 3L1JA 3ET4A 2Q1UA 4TTQA 2R8RA 5JCPA 2VHXA 2JIZA 2JLAA 1MJNA 2PUCA 4YJ2F 3ZC4A 4JI0B 2OEVA 4COOA 3GUZA 4AJ2A 3STXA 3V4PB 2CB0A 4WOPA 2PS9A 4LI0A 5HJEA 5DM70 2IYAA 5AOCA 4X54A 1V2GA 3EGOA 5AK6A 1P4HA 1P9LA 1D1AA 1I36A 3TW6A 1FEZA 3UCEA 1D0SA 3ZG1A 5LU9A 4D56A 3OIYA 1IONA 1BXRB 1EBUA 4ZDJA 3I04M 1U3WA 5L0CA 4XM0A 2EYUA 3PUKA 2DEUA 4NG5A 3ZZUA 3KKOA 2ZYVX 1RVDA 1YDWA 4R8KA 5HRUA 2WF9A 2ZU6A 3WK7A 2I87A 1VSVA 3VSDA 3BHNA 3E7WA 3BTOA 3O75A 2X15A 2FB9A 3NT2A 3DC7A 4ZA2A 4QVKA 3MQFA 1F4VA 1G8XA 2H8GA 5AIBA 1DEAA 2EZ8A 4G8DA 1I30A 4YPOA 3S9OA 1OASA 3OOJA 3MCZA 4YMIA 1RYFA 4CLOA 3KK0A 3H0CA 3D3QA 3BSFA 5CPBA 5K0CA 4JQSA 3BICA 2YV4A 1YB2A 3NC0C 3GBPA 3DPSA 4BTEA 4F71A 2B21A 4W7SA 3C63A 3L8EA 1CSEE 2AWNA 3DUWA 5JADA 2RK6A 3OX2A 5CXSA 3UPUA 4YUVA 4P31A 4KVAA 4AUKA 1L5KA 1GPH1 4RIHA 1RQLA 4JLVA 4ZAVA 1PQYA 3F7TA 4AY5A 1H3NA 4L6CA 2XR1A 4MWDA 3A3NA 3NYJA 4CDMA 3WP1B 4UU8A 1VBKA 3DTVD 3EUFA 4F5EA 4GE3A 5T6BA 4ENTA 3IQZA 4PJMA 1DKUA 4TX1A 1SIUA 3E9YA 4PX9A 2IRWA 4KFTA 3OZGA 5F98A 1UBSB 3TSAA 4KH1A 3KXPA 2DTEA 3L6DA 4OJNA 4OQXA 2XZPA 2GHRA 4ZK2A 4RPGA 4RYDA 4M1KA 1RRFA 2UZ1B 4KRYA 3N58A 2X0JA 3DFUA 2AR7A 4EK9A 3RUEA 3FCSB 4N0EA 2VJOA 4YRMA 1TU3A 4MYSA 5EEHA 3CXUA 2FKNA 2G88A 4GQAA 4CKCB 2DCUA 4XEHA 4MVUA 5D1NA 3EHMA 3RVNA 1BYIA 3KQOA 4RVSA 1KHTA 4OTZA 4U5EE 3VHXB 3C2QA 1XVUA 3BIWA 2CJWA 5CX1B 1SHUX 2HW8A 1UBJS 3TNFA 3NCHA 2J3IA 2UV8A 3F9IA 4CTOA 1UC8A 2WMYA 3GRFA 3NUZA 4V02A 1XRQA 3DEYX 3JQEA 4E5UA 3I6YA 5KKAA 1N9KA 1WSAA 4IDQA 3PPYA 1PL6A 4TSFD 3DWIA 3Q41A 5K3EA 2ROQA 5ESWA 1GPBA 3M3DA 2HMWA 1FK8A 4IV5A 5CM9C 1U3CA 4IDOA 1V5EA 1Y1TA 3OHPA 1DQZA 1ZL0A 3IV7A 2W71A 1IG0A 3PT5A 4BJHB 3U62A 2Y3GA 1DCKA 1B6GA 3IUEA 3UV7A 3N8GA 4ILKA 4MVJP 4LX0A 2F6RA 2QIOA 5DXFA 5KVAA 5CVVA 1WD7A 3PTLA 1SXGA 3PUWA 1GAWA 3NHMA 2IOHA 4GZ6A 4DF3A 1LF5A 1QOPB 3WIEA 1JNYA 4FOOA 2XUZA 2J4CA 3H2SA 4MR9B 3T1HB 1E0SA 3P9IA 3PJDA 2R7AA 2QUIA 4X1KA 4BKPA 1OE0A 1E5LA 2CVQA 5KJ6A 4D0RA 2G17A 3ABSB 1GVNB 5EHNA 2V9PA 2D3TA 1D0YA 3CYFA 5LDGA 3VISA 5E8JA 3QOYA 5CLHA 1U4SA 2GYUA 5AVTA 3Q87B 2V26A 4MQEB 3V4OA 1YRAA 1NW3A 3DHYA 3HB1A 4KYUA 4QNMA 3RRNA 2AH5A 2AC2A 3ABRB 2XNKA 2F8LA 3MTEA 2F9MA 2MU1A 4ZI5A 5C37A 3MUEA 4ZXFA 1Y42X 3O5AA 1ZIPA 4LYFA 2XXJA 4JBWA 4UQPA 3JQ9C 4XTRA 2OP1A 2IPMA 3LNCA 5IDYA 1KZ9A 2AZDA 3H5VA 1W47A 4PCVA 2BM8A 3FPFA 4IWXA 3B9QA 2KK1A 1D7AA 1KO1A 1B00A 2O50A 2NTEA 4L4SA 2Y3HA 2HGSA 2Y0BA 4FHFA 3CCCA 3IJRA 5F3DA 1KJWA 3ZZNA 1LDGA 1E59A 4UARA 3EVAA 4IIDA 3IVXA 3OHMA 2ES4A 2V54A 5CJ2A 4Q1FA 1NJ6A 2F64A 1ZSYA 2XTNA 5B6IA 5C5DA 4WN3A 4CQMA 3RFCA 3C3EA 4PSCA 3CSSA 4FC7A 4YRKA 5LMZA 2GEFA 3K8YA 1Y4CA 4L27A 1L5GB 2D5AA 2QROA 3SXKA 4OB7A 3ZWVA 1I6MA 4KQHA 3DE8A 1ZNYA 1GRRA 2P9QA 1TAHA 4M2LA 4L02A 1R37A 3KHKA 5AICA 2P9CA 2DY0A 4KV9A 2DH5A 1Z5UA 2HEGA 4DSTA 3TB4A 1QAOA 2V6MA 2QG4A 4H6PA 3LWDA 5IP5A 4XLLA 4HH4A 4D9BA 1U0LA 2IEZA 2BMDA 2LD4A 4CHGA 1CJSA 4BP8A 1I4TD 2Y0CA 2F3UA 2VNAA 3U13A 1HLGA 2B2XA 4MRVA 2CKDA 3T15A 4N0PA 1T8WA 2JJ2D 1BGVA 2EC5A 4XGNA 5FI5A 3TH5A 5D8DA 2VSYA 2QUBA 4I5IA 2ZJ8A 3MJSA 3E5NA 4C0JA 3VKFA 1SB9A 3JQQA 1F2TA 1Q0LA 4L4RA 2B4RO 1MB0A 2W83A 3BRCA 1GGJA 1F0YA 4KDEA 3LW7A 1ZCAA 3SXUA 3QI7A 1W52X 2ZXPA 3MGCA 1K7EB 1ULTA 3PDMP 5FBVB 2FOIA 1USUA 1J2JA 4U5DE 2HS5A 4FFSA 3RK0A 3QWFA 4MVWA 1TTQB 2B6NA 3GEIA 2H92A 2PRKA 2H2AA 1Y7IA 1QZTA 2X86A 1O0BA 3MCWA 1CZHA 3RGWS 1EAMA 1QG4A 5A7HA 3COVA 4J49A 5IT5A 1QHNA 1FX1A 2OCBA 2GKGA 2QLFA 3NANA 4RVDA 1YL5A 1QC5A 1Z3IX 4G0VA 2W0MA 4DJJA 3P0IA 4B46A 4DVYP 1TYZA 1E9RA 5AKKA 1A4RA 2OSVA 5FA8A 2IYTA 2W11A 2GCGA 3AVVA 3VH3A 4LHWA 3PCVA 3KZKA 4ZPXA 1QG2A 3C7JA 2CXSA 5JVEA 1I10A 3I9NA 5DIFA 3FOCA 1CKEA 3H8SA 4TTVA 5JSYA 4FYKA 1Z5PA 3QUAA 1QDLB 3K1AB 1GTG1 4CEJB 1LC0A 2ZR9A 3JPYA 1QK4A 4OQPA 1AGNA 1N5OX 5ADUS 2ZXWC 2ZROA 3KT6A 1AA9A 4BFWA 1L6RA 4TQUS 2G08A 3BQ9A 3ZOZA 3SOPA 4YV7A 4OI4A 4YAKA 1JPUA 1PDWA 3IKLA 4G97A 5HR5A 4YAOA 4BZZA 3F3MA 4RENA 3H9UA 4TRNA 2B82A 1GLNA 4DA8A 2BEVA 1Z0KA 4DRXA 3ITKA 4L3WA 1WCIB 4MLPA 1K8ZB 3T12A 2Q2NA 2FAPB 2H9AA 2FMFA 2E2WA 2I22A 2I6FA 4IIVA 5HNKA 3TAHA 4ZCQA 3DLIA 1SA0A 4Z99A 1HDRA 3PTZA 4JLOA 1AUPA 2EHDA 5JBNA 2R6ZA 3X1KA 1GL6A 3N6RA 4DEXA 3QVJA 3PFHA 4BVLA 2WB7A 2CXTA 3D4LA 5FNVA 1P7WA 1YDGA 3ZBQA 1U6KA 1ZITA 2YR0A 3ZDZB 4AW9A 4C0QC 2HDNB 1L0BA 4Z7NB 3BXZA 2A3RA 1RI5A 1K7CA 3ZY2A 2FMKA 1QDUA 1J33A 5A3VA 3D54D 1WV0A 4YLGA 2PJDA 4DCTA 5DN9A 1V3UA 1AB6A 1R16A 4LJ7A 2J9FB 2AEEA 2ZANA 1HE4A 1XCOA 4NR0A 4URUR 2Y99A 4L78A 4IOMA 2HN9A 2Z1DA 3K1ZA 3ZDFA 3TNJA 4AXBA 3HDJA 2O8CA 4MJXA 1NZFA 2QTNA 5ERYA 4N3AA 4QXQA 4MVJA 3KT8A 1QH9A 1DADA 3TN7A 1O9BA 1C1DB 5AHWA 1A1SA 1Z4PX 2WD9A 3DMHA 5H16A 3P1JA 5SV2A 3NHWA 2V7PA 2A78A 1TM1E 1CUEA 1UINA 2R9RB 3KG2A 4UMFA 2WTAA 1AN9A 1KJ8A 2WZCA 1YDEA 3WXBA 4HDRA 3R40A 2Y1GA 1IVSA 2FPLA 3P45A 4DR5B 3HKBB 2XWQA 4CV1A 2OCLA 2FTKE 3ZDYB 1VP9A 1R5ID 2GHIA 4E3ZA 4YUXA 1VYUA 3HSYA 5F28E 1IZ9A 3DAFA 3S7TA 1AV6A 4I1IA 2J6HA 2CEAA 1L1QA 3ELUA 1Q0UA 2YICA 3IHKA 4NMXB 3WRXA 4N39A 4M99A 1PV4A 3KB2A 3OMXA 2ASEA 4CRWB 3T7CA 2AZ4A 3NOQA 1GO2A 2XLHA 1MQVA 1D04A 1UBKS 5F52A 2VPQA 1ZISA 1BJKA 5EEGA 4BS9A 4X92A 1ST6A 4U9EA 2EZ9A 5EJAA 4XVUA 1P9OA 3TFOA 1EWRA 1GNQA 3OT1B 1ZHWA 2PGOA 1W0KA 1GLGA 4X91A 1PR1A 4HAOA 3G4ZA 3QG5A 1U9IC 3K0CA 4EDHA 2YV2A 5DNWA 2WSBA 1WMEA 2Y93A 4CLXA 1NWHA 4HL6A 4J32B 3TIGA 1WOLA 1NOIA 4HFMA 2HV8A 4ZQGA 3AKEA 3SYKA 1S8AA 1FYDA 4J0KA 5FFNA 1UKBA 2E4VA 2IHTA 1U0FA 4W9RA 5BOSA 2BVNA 2JB9A 2WWHA 4PGAA 2HQSA 2OOCA 2MT9A 4L6IA 4OIQF 1BR1A 3HSKA 1MW9X 2IUSA 3NS7A 1KI8A 5LZ9A 2V74B 1RM5A 1EWYA 3DT6A 4KNYA 3BWYA 3KEFA 3BRSA 1VJTA 3QUCA 2FG6C 3F67A 1FRZA 4AP6A 1SOWA 4EVQA 1T01A 5T3UA 3CTMA 4N0MA 4HG2A 2NYAA 1OGJA 4HFJA 1YR9A 3CUYA 3ZJYA 4UBNA 3AGTA 1XTRA 4LRSB 2G76A 4BV2A 1FUKA 1GWNA 3UKOA 4A1FA 4DZZA 1E1MA 2LFDA 3WQHA 5AW9A 2BFCB 3NW9A 1CDZA 1I7PA 2GBIA 4MMYB 3ZV4A 5ESXA 3CF6R 3CWCA 2KGOA 1CY2A 5AXDA 2ZYIA 3N2EA 1S6YA 4JC7A 2NO7A 4ZYLA 3BK1A 4LE1A 3DHEA 4LZPA 4FX2A 4ER6A 3G2MA 4WDQA 4D0NA 2DT5A 2CJXA 4UNNA 1DKQA 2H4JA 5BMVF 1FX0A 5H02A 4B4VA 4OHPA 1WXWA 3WK5A 4E4TA 3OFSA 4JYPA 4BVBA 5CITA 3K1IC 2YFYA 1UKEA 4HQKA 2D3WA 5GZ1A 3PIDA 4LCBA 4ZJZA 1DXHA 1CQWA 2VTVA 4PJNA 4QE3A 5CFLA 4Q4AB 4TMVA 4Y0NA 2WMDA 3GG9A 1PD0A 5B3IA 2XEDA 1PNQA 5MFZA 3HCFA 3AV3A 1IQRA 3Q8XB 1MNAA 2W4QA 3UTCA 4E08A 3E3LA 2WHPB 3P2JA 1A2OA 3SYRA 3IEEA 3WGOA 2H2GA 1B23P 2JFZA 4YFYA 4QM7A 2ACEA 5L4LA 2R7QA 1TLTA 1QKKA 2FLKA 4JGGA 4Q7KA 4EFNA 2OB2A 2O2GA 3WO1A 4MMXB 1CD5A 1I3NA 4OSEA 4XLZA 4IGIA 1IN8A 3INNA 4O4IB 2DJIA 2VN8A 1CUBA 2EGHA 3L02A 2X58A 3F6YA 4LS3A 4LTNA 3KVNA 4J29A 4UUBA 5EUBA 5JT1A 1O9GA 4H0CA 3UMIA 3GEBA 5DLDA 4Q9IA 3ZLVA 4M9QA 1SUCA 1N8NA 1B7GO 1QIIA 3OA1A 3PWTA 3MYYA 3AF6A 4QYIA 1UMCA 3VYUB 2IP1A 4PLYA 1Y6RA 5AM2A 1TMGE 4P0PB 1XYGA 1I2AA 4QOJA 4G0XA 4HEAJ 3NO4A 4RJJA 4UD2A 2BGGA 1E6WA 2ZUDA 4IHJF 3PE3A 3VSBA 4M8IA 2GJ4A 3K2QA 3JD2A 3R7WA 2C99A 4MRPA 4U00A 4D3DA 3E70C 2JEOA 4DJTA 3UMCA 1QYCA 3ODGA 4RHTA 3MJCA 1TZ2A 3NWEA 3C8DA 2WNSA 3I05A 3IBGA 1E18A 1A50B 4R1QA 1M7HA 4IOJA 1P1KA 1L7VC 3KWLA 3OO1A 3OPXA 1VIYA 1YOBA 4KACA 1RJEA 421PA 3LO5A 1GXSA 2HXGA 2N1BA 3DQQA 4JUCA 2E1RA 5A0VA 4A91A 3X44A 2PUAA 1MHPA 1KOJA 3SK0A 4KQMA 1M2EA 3MOIA 1F6WA 1QKRA 4BNMA 3CUSA 4D6PA 1E60A 4F5YA 3AXSA 2WY2D 4UM9D 3IB3A 1GGQA 1EE2A 1CVRA 4MARA 5AK4A 3KDAA 2NTNA 1IJFA 3H65A 5IFKA 3QOFA 3KHUA 3PQEA 1WPRA 2ZSFA 2ZUVA 3S2EA 1YH3A 5D51S 3IAXA 2W2PA 2WKQA 2PFSA 2IHBA 1XTBA 3ABMC 2ZBQA 1VHQA 2R4QA 2ZUCA 3UG6A 1ZCFA 4D4LA 3EVZA 1Q11A 5LB4A 2C82A 4YMHA 1AZWA 3ZIAA 5EHQA 3NAZA 1J2TA 1A04A 4OGGA 2RHRA 3HJAA 2GSWA 2V7QD 2LKDA 1TJNA 3U9LA 3DPUA 16PKA 1MV5A 2ZIFA 3HA2A 4BEBA 4CMKA 2W4MA 4M98A 4HNUA 3K0FA 4YK7A 5JRAA 4M1OA 3UHFA 4N54A 3ETCA 3OQOA 1F7UA 2FXIA 2HMUA 4HSGA 2C54A 3N0WA 4DJAA 1LQTA 3EOBI 2OEPA 3ZY5A 2XODA 5C53B 1APCA 2XLOA 4EF5A 4PG4A 3UGPA 3AVYA 1KSJA 5G4LA 5AVYA 5JSFA 3JRMO 4U0KA 5TPZD 3U7HB 1Y4DE 2WFZA 1YB5A 4E88A 4ENVA 2I3DA 5DCWA 5M2QA 2BR5A 4HDCA 3SF8A 1RMYA 2V98A 1T3HA 1G8PA 1ESEA 2RH8A 2JIDA 2C98A 3IIKA 1TR2A 3VI3B 3RE1A 1I4WA 3GM1A 2WB4A 3LI2A 4NMWA 4HTFB 4HH3C 4QFBA 3EFBA 4JYZA 2X14A 3CX8A 4QUBA 2DH6A 3O8OA 3DTNA 3G0CA 3W4YA 2J3LA 2BEKA 2JZOA 2IYVA 3K6SA 3B13B 3TX6A 1F3OA 3O83A 5L3VA 1LTQA 4FFWA 1T4BA 4GBED 1JKMA 1HMDA 1VCHA 2PGIA 3JQ9A 1G1MA 1YT5A 4JQCA 1GEGA 1JDPA 3DDNA 4O63O 5DLQC 5IAAA 4O4HF 3M0EA 4Q7LA 1TGVA 2B1RA 1G7SA 3ID6C 1E2HA 4IUBS 4FQ8A 5E2AA 1DKLA 2FLVA 1MR3F 1QF7A 2L7AA 2W5UA 4YFVA 2JHGA 3EZ6A 4BO2A 5EY5B 1J5XA 3ITEA 1X7DA 3ZY6A 4RBNA 3EDMA 2Q41A 3C7DB 4MS3B 4RDIA 2W93A 2BGMA 1DIOB 3M7IA 4JLWA 1C2TA 5KMGA 1DOWA 2CLKB 3TQTA 4NESA 4X5OA 2QYTA 1FDOA 1P91A 2A0YA 1BFDA 3A0RB 1UZMA 4P5DA 1H0SA 3O1JC 4G1CA 1J4AA 4XTKA 4GUAA 4NZOA 2HL6A 4OHUA 1M8KA 1CUXA 1L4KA 4HUQB 2LIPA 4FGSA 3D2CA 4N3NA 4R7TA 1RJDA 4PLZA 1KQFA 4BCBA 4PSKA 3GVXA 4JI5B 3RFFA 1HNNA 2BOVA 4RY8A 3DBHA 5D85A 4FWIB 4BLWA 1ECFA 2NU7B 3SHOA 1BQ3A 4PNPA 3OU2A 4J6FA 4BMDA 2OC9A 3MRXA 3X0DA 5G0TA 1YMUA 5T64A 2CCGA 1E66A 3WBKA 1YZYA 4Z2AA 3LKZA 1YVEI 4IM7A 5KTNA 2YRFA 3L7JA 1PI3A 3BH0A 1MVNA 2XITA 5EIXA 5L40A 4J43A 4B6SA 2QU7A 1T0PA 4NARA 3ZK7A 1SQ5A 2OM6A 3AYZB 3JZFA 1P7PA 3LC0A 5ALOA 4X8MA 1NJ2A 2W90A 3AERB 2NZ8A 4R32A 2EBUA 5EMJA 1KMMA 1MKYA 3S8EA 5M7EA 3SR0A 4Z9AA 3QKUA 2YKGA 3URKA 1YCHA 4XYMA 5LP6C 2QM3A 4IFEA 2II6A 2Y1LA 4B9AA 1U8TA 4I1SA 3THSA 4LVNA 3STWA 4BPBA 2G4LA 1R9GA 3DHVA 2H4FA 4ZYXA 1XWJA 4S1OA 4DZTA 1RPJA 3IP8A 2ZSDA 4L0QA 4ALJA 2ZBFA 3H87A 5DBHX 1EBFA 4MW0A 3C1UA 1KJJA 2FZVA 4RMHA 5LM3A 5F21A 2HCBA 1IRIA 4ESHA 4XVHA 4MO9A 1OR2A 5JWRA 1HQKA 1PX0A 4JJ8A 1V5IA 1JBEA 1JG2A 3EY4A 3KYJA 4HQNA 4MGZR 1MUUA 4JBIA 3F8TA 1E3WB 1RW4A 1AJEA 1XJ0A 3ONVA 2WICA 2HI0A 1SIOA 2MIIA 3QLUA 4Q7QA 4WKCA 3ZLTA 3ZVKA 4JCOA 5LQDA 1W44A 2X0IA 1SAYA 2BZ1A 3U7FB 3PC2A 4EBKA 1O6BA 3N5KA 1QGYA 1T5HX 1JHVA 2ANBA 2VQ6A 1LJLA 4KO2S 1FJGB 1WP4A 2QGFA 2FW9A 3QVKA 1TWHA 4OGLA 1JLRA 2ZZKA 4MW5A 1FP2A 3RYHB 4AC9A 1GQAA 3NNNA 1NVWQ 3DXZA 1Y6JA 3I42A 1Z34A 1RAAA 5ITZA 4K1LA 2P9HA 4GT1A 5A7GA 1LJUA 5GIPE 1LDNA 1OV6A 4LDQA 3TINA 4HGQA 3ZJ5A 3WL7A 1ZXXA 3ZE7A 4YUAA 1EX7A 1HY3A 3DT8A 1MOZA 4UDNA 1XQYA 3U5TA 3NBQA 4N03A 2OXIA 2VHWA 3LIPA 3T5BA 1G3RA 5TC4A 4LSZA 5TT0A 3R6DA 1W4ZA 4YRCA 3UTDA 3BWMA 2DPGA 3SEFA 1S3GA 3NV7A 3CIOA 4G5OA 5KYVA 1PW7A 4E5PA 2AF3C 4W5OA 4I9FA 4XGIA 1A9PA 1YE8A 4PYIA 2ZB7A 2VRNA 5FORA 4XFDA 4R7ZA 1TYEB 1YA9A 1XDDA 4DIEA 3E9ZA 2BJVA 2H1RA 2WHEA 5D7BA 1VGRA 2LDXA 4GMXA 1RAFA 1M75A 4X84A 4NONA 1ODTC 1WDTA 2MMGA 5EESA 4X8LA 5SYMA 2R8XA 4ND8A 1XELA 2XWSA 4PZCA 4TGLA 2XCOA 3L6CA 2DWOA 3WGUA 4BB0A 5EJ7A 2Z1NA 4FHGA 4KQEA 2PEYA 3V7OA 3GIWA 2QLAA 4ROTA 5I48A 4NU8X 4LVOA 4TRJA 1V9LA 3QSYA 4JX8A 2X0KA 1L7EA 4LC0A 3UHPA 4IEIA 2A6HF 4YAJA 3E9DA 2NM0A 3ZCXA 3RWBA 4BLOA 1C3XA 1Q0HA 4CGYA 4DBZA 2HRDA 1Z0JA 4K9QA 1NBIA 1VKZA 1IPHA 4YP5A 4FEGA 4ACAA 1KK1A 4TVSA 2C9DA 3PUXA 3VM6A 3T4EA 1JIKA 3IKVA 3NM4A 3DEFA 1B68A 1MA0A 1P39A 4F46A 1OFUA 5F35A 2ZG6A 1M1UA 4JY7A 2Q3BA 1ULAA 3T3GA 1QUEA 1VKJA 4RZHA 2HOQA 2ZDHA 5BV7A 1YVDA 3AJRA 3PX2A 3NHYA 4WAUA 5EWLB 4PAOA 1J8VA 4M1SA 1XHLA 1NT2A 3C8GD 2CHQA 1Y9ZA 1TJ5A 2ESRA 4OFXA 3LQ4A 2FQQA 1NX9A 5E33A 1JDNA 3EC1A 2E4WA 1VECA 1FQWA 1FRQA 4INZA 4N0DA 1IOZA 1TOAA 2LGJA 3LCJA 5FWDA 4DCPA 1ZXLA 4UFPA 2X4LA 4XWJA 5GONF 3LK7A 5TVGA 3VC7A 1OC2A 4EHPA 2ZSEA 3DZFA 4OBEA 4C01A 5D3ZA 4PZPA 1VE6A 5F1YA 5JQGA 1CQIB 1PLLA 4G01B 3DOEA 3W5SA 3ESQA 3L8YA 1U7XA 4AX2A 4BNIA 3IXQA 5K3BA 3QIVA 2ZETA 1MAUA 3ZX5A 1CR1A 5FOSA 3FFAA 2VP4A 3KB8A 4L4XA 4FGWA 2HPVA 2ECFA 3DJUB 4TMYA 4U7JA 5LYJF 1W46A 4GYWA 4ISCA 4TN1A 1PUJA 4WK0B 3L0BA 1QQ7A 1U3VA 2L2QA 4C7BA 1VCMA 3NEPX 4A3SA 3I92A 2HHLA 4R1UA 1HW1A 4X1IB 2Q2OA 3H1GA 3MYIA 1GITA 1SQ0A 3W5BA 1YRWA 2NYRA 4DC9A 4L07A 4KRXA 3K9NA 3VOSA 3IQEA 4I3FA 1VL5A 4YK5A 4XPWA 1M10A 4DLZA 4IIBA 3RT1A 4E30A 4GKJB 2B7CA 2JGKA 5AJVB 3CVVA 3VR3D 2PD4A 3W79A 1YRHA 1EFRA 3OQBA 4AZWA 1SG9A 4K6CA 2MSWA 3MMNA 5I5GA 5KYXA 3DH0A 1ZCZA 3OO0A 1QTRA 1XD2A 5A2QA 5EMNA 3OSZA 5A69A 4R3WA 4QA9A 3ABZA 4MQFA 4F2PA 3ZXIA 2B0HA 2DETA 1DG1G 4P93A 4JHLA 5AI8A 2ZIZA 5F51A 2ZYUX 5FTJA 1E3MA 4K6FA 3S81A 3VHLB 4C43A 2H51A 2JLSA 2GRJA 1AG9A 2POCA 2FGYA 3ZU3A 4XIFA 2BMJA 1XEWX 2GMWA 1E61A 3B12A 1H85A 1AUOA 4PAMA 5CLIA 2O3QA 4N8SA 1WAMA 1CERA 4DUZB 1REQA 5E7JA 2AVKA 4TSRA 3RVJA 5ADWA 1P8JA 2VOJA 3EAFA 2KC3A 5J23A 2C4UA 1RLJA 1JKXA 1E1QA 2RC5A 3SC2B 4QDLA 3GWNA 3PR3A 2Q27A 3OT5A 4AY6A 4B74A 3TZEA 5L3ZA 4NFHA 2PCLA 4BLRA 5HGXA 1QVWA 4ALIA 3TI9A 5C8ZA 5K8UA 2XCUA 5BXQC 3L6RA 4RU1A 5ILQA 4ZIRA 1ZP6A 4JEHA 3M5PA 1IOVA 1KJYA 1K08A 3AIMA 3C3AA 4FOTA 1FNCA 2R11A 5GTDA 2BEWA 3SXZA 4Z4HA 3P2KA 3BEDA 4L50A 5DYTA 2UKDA 2PUHA 1T9AA 1E6UA 2H63A 4QYXA 2AG1A 1A72A 4TROA 5ER9A 1KZHA 3C3MA 3N0TA 1ISSA 3RREA 1LDEA 3WDSA 4DLXA 3WRXC 3PTAA 2J9YB 2R751 4ZI7A 3LS0A 1QO7A 3GP3A 4KQJA 4K5QA 4CEIB 4CKYA 2GVDC 1M1NB 4FHCA 1CCWA 4KOAA 1PBTA 5M34A 3UMHA 4X41A 1IXZA 2VCCA 1E92A 1QVAA 2OXEA 4ANFA 4E0IA 2EFCB 4RD0A 3AGUA 4U39A 3E84A 3OU6A 2X5XA 4IV8A 4UDVA 1XEAA 2F1HA 5G4KB 1NQXA 3QEAZ 2CDNA 2Q07A 3E9CA 4H6VA 5L51A 4FZRA 4ARCA 2DU8A 1FMJA 3FXAA 3LHSA 4HBZA 3K70B 4I6GA 3LGAA 3K92A 3LCCA 1OFGA 4ZT7A 4MI9A 3IKJA 5FNZA 3GLGB 3BF8A 1I8TA 4DR1B 1TADA 2VYVA 3MHTA 2P2DA 4XDZA 3CGWA 3VGJA 4S3MA 5CB8A 1BMFA 4CLHA 1YVIA 5COGA 4RCVA 3CSKA 4B3XA 2H4XA 2UZAA 4G0MA 3JWPA 1EK1A 3K9GA 3RTBA 3GV0A 4Q3DA 4RPIA 3DMDA 4JP2A 1II8B 3GBSA 5C32A 1GNPA 4IDDA 3RJMA 1CZLA 3IRVA 3WL5A 5AVZA 2D5LA 5HSGA 3TUIC 1XDUA 5DQTA 1EUDA 1ZMBA 5BVHA 4Q19A 2IY8A 1N36B 3OIFA 5HKKD 3QTTA 1L7QA 2I6XA 1A9QA 4UTOA 3KOYA 1G98A 3W2EA 4A6EA 5IXSA 2D5BA 1MJGM 3AW8A 2WL8A 4LHYA 4PS0A 4PRLA 3LQYA 4G84A 1BCSA 3TJRA 4KQXA 3EVEA 3PC4A 1PR2A 1EZZA 5H3HA 3AHHA 2X8LA 4PLPA 3BXPA 4OL0A 4U5BE 1BS2A 1JU9A 2YL0A 2C1XA 1XNJA 3VR4D 2HIAA 4W1RA 3D6VA 1PJTA 2ORVA 1BCRB 1M6NA 3JCZA 4PZ9A 4Y18A 3B51X 1NNLA 2COUA 2H2IA 4KKVA 4JMLA 2WT8A 2DPYA 1NLZA 2WJGA 1HFKA 2VJMB 2HIGA 3GRYA 3Q9NA 5BN1A 1YFLA 1XTQA 3T3DA 1XEWY 4ARUA 4O1IA 3QOXA 1XKQA 5DMHA 1JHMA 2QUKA 3FSGA 4S35A 4CMHA 3ZGLA 4CIBA 3CEMA 3GF4A 1R3UA 3TIXB 3KJGA 1G5QA 3C3YA 2Q5HA 3L1KA 5I7WA 2EAUA 3GRVA 4EVRA 4DFDA 3GRPA 2WA1A 3WC4A 1NDQA 3Q11A 3EXHA 2IIPA 1E3QA 4MIKA 5DBFA 5KX5A 2ODEA 2J09A 3EEOA 1E58A 1GARA 5CFOA 4PAWA 2RBEA 3O84A 3L7AA 3GFBA 4KN6A 3TZ6A 1Z7BA 3T52A 4OLBA 1JQAA 4KYTA 4PWZA 4FFVA 2YVLA 2H59A 4RTQA 5J2TF 2UVPA 3HWRA 1Q0SA 3L7OA 5FJIA 5MF6A 5GP1A 4LXHA 3L7BA 5KNDD 2ZRFA 3VR0A 3TDNA 4DNOA 3RGGA 1E9FA 4KQIA 4RMIA 2HT1A 1ZW3A 4PV7A 1YNOA 2OC4A 5KSPA 2PUBA 3OEYA 4FFMA 2HA7A 4BBJA 3U1VA 3TZBA 3FSJX 1H05A 4EFKA 4AF7A 4BKMA 4ND2A 3FDZB 2XAUA 3O8RA 4R4JA 2RONA 2Q29A 1UK7A 3RS8A 1ULUA 5IM4A 2RI6A 1N75A 3L40A 1OIWA 1E85A 1GCGA 1D1PA 1V5GA 2ZB4A 1HL3A 1KC1A 4OL9A 2WYIA 5EKDA 4JJ6A 2IWRA 5LP6A 3SSOA 2VBGA 3TZHA 4FC6A 2QHXA 2GLTA 5AI9A 3LT5A 3CF4G 3K94A 4OIRF 3DDWA 3VMMA 2JPUA 4GFDA 5H80A 1QE3A 3WK6A 2CDBA 1E2KA 1XTPA 1KI3A 1XVVA 4YBRA 1CZKA 1RLIA 3MWEA 4UFNA 4WX2B 1UT6A 2I8BA 4D0SA 3ZDQA 3TPCA 1WL8A 3GW8A 3GMIA 2BL2A 2BHRA 1OYOA 3BTVA 4RAOA 2AWOA 1U8UA 2FSIA 1ONBA 1U1EA 4Y9UA 1J5PA 1EFVA 2YIJA 3T7EA 4A0QA 5LZ4A 3DKVA 1DX6A 5FWNA 4FBGA 2QP3A 4PO9A 5G2OA 5IW8A 4JL6A 4QU9A 3EUWA 2Q4FA 3BWBA 2K7ZA 3TRJA 1BXGA 1MHTA 4DPMA 2L0XA 3NORA 2VP5A 2Y0DA 5CH3A 3WE7A 1U94A 1S4QA 4WGFA 1FP1D 3M89A 4A8HA 3CLKA 5I7VA 1FSFA 2ZI5A 4EP1A 3BOSA 1DE0A 4D3FA 3K6RA 2QZ4A 5CHEA 3AY3A 1MO4A 1VLHA 5BT9A 2EYQA 1HX7A 1ZSNA 3OTQA 2YJZA 4I4TA 5CT4A 3V5XA 3KD2A 5HHTA 1NHGA 2NU9A 5D87A 5IBQA 2WZLA 1YJAA 5KYNA 4LX8A 2H18A 3ZTYA 1IZ0A 5LNK1 2DF8A 3JU3A 4OUDA 2A67A 1DBWA 4DDUA 5I4IA 3PUVA 2PX5A 2ILVA 3CUKA 2DWUA 4BFTA 4FAPB 2WUGA 1YA6A 5BRAA 2OU6A 2QRZA 1NAHA 3WK8A 3L8HA 5DEIA 1N33B 2OQMA 2JKYA 3GGSA 3WBBA 4CM8B 4KO3S 1VE7A 5AFSA 2OD9A 2WV7A 5ENVA 2ID4A 3BWDD 4JN6B 4KAXA 5AK5A 1WP9A 1VHLA 2Z9BA 2X5OA 3NBFA 3WI7A 1N0IA 5I9BA 1OV4A 2QNIA 2OFFA 2D0PB 4UE2A 1QLEC 1GADO 4HEA1 1V26A 4D43A 2ZM6B 1TTTA 4FGZA 1EXMA 4EUKB 4H7EA 3EPHA 2VDNB 1I2CA 2DG2A 3F5SA 2VA8A 1WHSB 5EKUA 1BDBA 2YV3A 4WVLA 2QSYA 2B25A 4Q48A 2YMQA 3VX4A 1ZKMA 1VM6A 5CFPA 3UUEA 4Z9JA 2BGLA 3TM4A 5JATA 2ZI6A 3RS2A 3W04A 1NMZA 3MYRA 4Z7JA 1CR2A 3GQBB 4DBVO 2YQZA 3NRCA 4P4LA 3UV6A 3RQIA 2XTJA 2ZXUA 1N57A 1N9GB 5BSUA 4OH7A 1SHJA 3HCBA 3VZCA 1RQPA 2RHGB 3P9PA 5EWJB 4AX4A 1R9NA 2CJPA 3MINB 5F9MA 3TL3A 3WGYA 1EDZA 2PKQO 2JBWA 3FPBA 3QXXA 2ZITA 5KCZA 4LXIA 1FFBA 2GWHA 2FPPB 4X60A 2WWXA 4M6WA 3I0ZA 4XRRA 5H0IA 3AL2A 1CUIA 5DQZA 4RPCA 3ZHYA 4KQGA 3KQWA 3SZ3A 2CLFB 3GLRA 5J63A 4EA7A 2BGWA 1KMHB 2H2WA 4PR9A 3JAMA 1Z36A 5CIYA 2IKSA 5BNTA 1NULA 4ID3A 1EJ6A 3U3OA 3BGSA 2GSDA 2I4TA 1CJKC 3OFNA 2JGMA 3X43A 5AK0A 5DBEX 4E15A 5FOQA 4L75A 4M1MA 1NR1A 1BU8A 1T26A 4I0WB 3NMJA 4HNRA 4XOUA 2CLIB 1QGUA 4DXWA 2P27A 4N9WA 4G09A 4D9NA 3O4IA 2JIOA 3I2KA 4FB5A 4MUHA 5ECYA 4QULA 4RXMA 2CDRA 1X1SA 1P3Y1 1R5OA 4C4YA 1JHUA 4KK3A 4CT0A 2XS1A 3WNDA 4DG9A 2PKEA 3UHOA 1PFKA 2H1SA 1L7DA 2Q5FA 3CHYA 1WPQA 3AKYA 1NT4A 2C9MA 4QATA 2N42A 1NUSA 3HU5A 1ZHHA 1JQ5A 1QS0A 3H1BA 2FFAA 4PRYA 3QLUC 4R8VA 2W48A 3MF4A 3L92A 4CM7A 4J0GA 4ANJA 1GOTA 1UPCA 1KRHA 4QXRA 3BE4A 4BGUA 2AWCA 4JTCB 1S3IA 5T4EA 3SM9A 3BJEA 4BZPA 2AK2A 4NZNA 3QFTA 1IAQA 2GCEA 5ALRA 3QLTA 1C9NA 3RUAA 5EJ4A 1QG6A 1XPRA 4EFLA 1D9ZA 1JG3A 2WKRA 3OVMA 2V6JA 3V4FA 2I6UA 3IESA 1PR4A 3DXFA 3N2IA 3WKAA 3GEDA 2OZEA 3FWZA 2NVUA 3U60B 3ZV6A 4UVEA 1ZD5A 1W0CA 1X8JA 2QB5A 1CFJA 2CK3D 5B53A 2BI7A 5A5DA 1H93A 1I0IA 1QFYA 1Q77A 1Q7EA 1IXKA 3S1SA 4TL9A 3TXXA 1E8MA 4BO5A 1JJBA 4N0QA 1TCVA 3K8ZA 3NH9A 1K5GA 1SC4A 4WZBB 1G6HA 2CXXA 1BE8A 2VHUA 3WGKA 4K05A 3OJXA 4OA8A 4YN0B 2HPHA 1Q84A 1MJHA 2F55A 1G60A 3H6GA 3V8RA 5IYZB 1XAIA 1VSBA 2J59A 4LJYA 1ZK0A 3BSYA 2PYZA 2UXCB 3ICWA 4ZICA 2C0CA 4YJ2A 1ENPA 2AG6A 2QVYX 4GLLA 4ZEVA 2FMIA 1JMKC 2ACWA 1N8SA 2FUNB 2C95A 3LFTA 2Z8ZA 1Z6PA 2A4KA 2WMOB 1RYNA 3BE8A 2VWHA 3L0CA 2PX8A 5JEEA 3R8CA 2HLNA 5BV0A 1IXSB 1ZUNB 3ZHXA 1SQSA 4MW2A 1K0FA 4ARAA 1K5PA 3ZHUA 3IFSA 1FVXA 4DGSA 1C02A 1CUAA 4YJDA 3W78A 1RYMA 4F56A 3AESB 1A5TA 3HXLA 4QTTB 4TMTA 2R7TA 1VJ1A 1U5BA 5LA6B 1UBOS 1IIBA 5LUAA 1EVKA 2VJQA 3NPMA 3ZWOA 4TZTA 5JAMA 3OKCA 2ATVA 3ND6A 5ES3A 1AKRA 5J47A 4HRYA 4R3UC 3M4NA 1P7YA 3DV0B 4AJOA 2CDAA 2GFQA 2BR3A 5ARBA 4YCMA 1RCTE 2GZRA 1XNHA 3LQRA 1LSUA 2A9OA 1YBMA 4JT9A 6ABPA 4H1WA 3HWSA 3B8HA 4URZR 3HRKA 4D9JA 3CV3A 4IG9A 1H0KA 2VT2A 3BH7A 4JR0A 3BMCA 3N70A 1PTKA 1RWOA 2XY4A 1V7QA 4Q1VA 2PBRA 2WHRA 2TYSB 2Q9BA 1C14A 3ST7A 1G5ZA 2BGRA 1JTEA 2WG1A 3MS2A 3SLKA 1Q16A 1LDMA 2WK1A 2Y68A 1XALA 2BP7B 4OD5A 1BX3A 3A6HA 4BO4A 5JECA 1OXKB 2NG1A 4MA5A 6PFKA 4DIUA 2V59A 4DNFA 1X92A 2F3QA 2GLXA 1P6QA 3UXHA 2A94A 2WUDA 4IDEA 2VWGA 4TKMA 1IL0A 1AKEA 4PPGA 3RBXA 4CCYB 1TNDA 5K0ZA 5DASA 3P27A 1ORYA 3PKJA 1D2AA 1NTOA 1CPRA 2VVTA 3R5TA 1SVIA 3KPHA 3E2MA 2FVXA 2CNOA 1H8EA 4WKGA 3DJYA 4K9MA 2H2FA 1ZN9A 4PE5B 5KYYA 1KH1A 3GZNA 1QBKC 4D9IA 3I9KA 1SURA 4QODA 3T5MA 2QT1A 2WIBA 5EHGA 3PRYA 1V5WA 1JDVA 1GZDA 3M4BA 2ENUA 1AHHA 4TMWA 4YXWA 1U2QA 2FF7A 4NENB 3BUSA 4HADA 3MT0A 4GXRA 5JD3A 3BXHA 3S44A 1CS0A 4OAOA 2LCQA 2JLCA 3PPWA 1M1ZA 3RSSA 1D8AA 3Q3IA 4XD2A 2XYVA 3UO8B 4I55F 3R3XA 3ENNA 4FMBB 1I0LA 5JC8A 3UMSA 4L5IA 3ZJTA 3ICPA 2X22A 1J8QA 1KY2A 4NXMB 1VE9A 2B1QA 3ZXUB 3SEOA 2KLBA 5SZIA 1GZSA 3DAHA 1V2HE 1DXQA 3M49A 1AVOB 4D4NA 1K6EA 1WS6A 4F4CA 4BN5A 2PNJA 1CGNA 2HFJA 1XRSB 3NYLA 4MR7A 1LY1A 1GGNA 2JL1A 2IW1A 3QENA 2F67A 2J3DA 2NU6B 4KGXA 5JH7F 3G2LA 4HWOA 4BMYA 5FTKA 1T2NA 4E6EA 1LK5A 3K6KA 3OM1A 5EIWA 1OH6A 1PZGA 1UPFA 2BFEB 2JDID 2IP2A 1M73E 1B1CA 4IXWA 4NABA 4XB1A 2MWQA 4B2IA 2HCJB 5A6BA 2Y27A 2YN2A 2A9KA 3UZUA 5A4IS 1P5FA 2ZSKA 2C88A 1WXXA 4OKNA 3OQ6A 4P7KA 3GJ8A 2IIQA 3A6GA 2NX2A 1D2CA 2B8NA 2OKUA 4P1ZA 3WB2A 2JFWA 3C1OA 2NSHA 4H15A 5FPYA 4YJ3B 2IZ6A 5KTKA 2KYRA 5A3RA 5ALDA 3Q3VA 4K0KB 2B8TA 3Q3EA 1HE2A 1UMBA 2CJFA 5KTRA 1LI7A 1A7UA 1KZ1A 3LUHA 2J0WA 2E5LB 3VI4B 3IA7A 1JG4A 1N78A 1YASA 4LBWA 2C5EA 3RVZA 4Q4LA 4RVUA 3JSAA 5FBWB 2VUUA 4J07A 1WZIA 4NJEB 4L5AA 1KI7A 3LQFA 1G9XA 1WQ4A 4DLKA 1C9DB 3QVZA 3OQPA 2AKAB 4J75A 4UHEA 5EPUA 2YJNA 5FWXB 4QXAA 1K98A 1QNFA 1XHEA 3D5EA 4FE3A 2W6IA 5T4BA 1EQAA 1NMEA 5IBPA 3JD4A 5BUZA 1V39A 1HLPA 3QMKA 1GPJA 1ISRA 2ZR8A 5C7LO 4RYLA 3H5OA 3UMMA 2JFGA 1U8FO 3FWPA 2HLDA 3K9CA 5HCNA 4H17A 4FEEA 2ZQ5A 1M2VB 2HF2A 4R1SA 2IZ1A 2ZBRA 1I6LA 1HA3A 3T7JA 3E05A 3TVYA 3L9WA 3P2IA 1ZUIA 4CFZA 2P9BA 2VHQA 1MZPA 1A9XA 4ZGWA 1JR8A 4PQGA 2EX1A 2ORIA 1DXOA 3VU0A 4I4NA 4OQYA 4CVNA 2L17A 1BOFA 3EDRA 2B34A 5T8KA 4RSGA 1WZ2A 4HGPA 3FNFA 2AOTA 1TU0A 2XQVA 3NWOA 2BMAA 3MBIA 1YB1A 5DX0A 3WX0A 2F00A 5IANA 2OGZA 3M1AA 1Q1BA 1KK2A 4KIJA 2KBEA 2WJWA 3V33A 2VQDA 1PE0A 2BTQB 4Q12A 1UJCA 2IT1A 2P9TA 3MTJA 2OHJA 1C0PA 1O6FA 4UNIA 4KR6A 2QPTA 5L0JA 1I3OA 2P65A 1YZLA 1OCCC 1KKLA 3S90A 2GF2A 1WSWA 1CNEA 1ZZGA 2AFHA 4PNHA 2WWIA 2GPTA 2QD4A 2A35A 4IARA 4LMPA 3KQSA 4YP1A 3PHF2 3U19A 1NQTA 1EA7A 4BJTA 3TLYA 1CV2A 3EQLF 3PXAA 5KSZA 1UFQA 3BK7A 3F97A 2CF5A 1NV9A 2GS9A 1TDJA 2ZJ0A 1JWAB 4YUZA 3JQ7B 1GD1O 4M83A 4OQNA 4D82A 5BWOA 1NJSA 3CZ9A 4C03A 4OHOA 4OYHA 4ND4A 4ZPJA 3K1HA 4EMTA 5B2EA 1K6JA 5BSVA 4TYWA 4P86A 1N0HA 1QP8A 2A86A 3LTEA 3I3SR 3FPHA 4OLJA 1KTVA 1NUTA 3G0BA 4QOGA 2FG7C 2AG0A 5LOVF 2NQTA 3COJA 4LXYA 3AXTA 2QAGA 2B4AA 4WZAB 4W7IA 3QKRB 3LDFA 1D2RA 4LHSA 1GQQA 2YJ4A 5H4HA 2NXWA 3CRQA 1NLUA 3ESZA 3NBXX 3DGFC 5B7PA 4KR7A 1T34A 1NNUA 4O59O 3LX4A 2AJBA 4B3MB 3HI4A 4Q05A 3TZQA 2Z4TA 5C0OE 1JEEA 3EGIA 1DTWB 3EXHC 2HTFA 1E77A 4S1VA 4B5KA 5K0BA 4MIOA 5KNLA 4M46A 2YNMA 2VH3A 1B0PA 2WA2A 1E64A 4TQAA 1D09A 3EXG2 2Z9DA 4KLCA 5D5QA 3BT7A 1OIXA 2V3CC 1CUSA 5TMDA 1S0UA 3EXEB 1IC6A 4D8VA 5IULC 1X1TA 4E5NA 1D2NA 4LC9A 5HEKA 2AEFA 3HDVA 4FYWA 1PQPA 3H19A 1FB5A 4YRFA 1Z82A 4C4RA 3Q7PA 4Q66C 5B2FA 4Q3BA 2VF7A 4NSNA 4D25A 1F8UA 4IGEA 1YJCA 4KJXA 2F1KA 1RQXA 4NCHA 3ER9A 3WNQA 1QIMA 1XLVA 2IVZA 4WESB 2NP6A 1Q19A 2NTVA 1F0PA 5CLQA 4ETNA 1QVZA 2V6FA 3N0VA 5AQ1A 2G3KA 2B5WA 3I8OA 2PGXA 2QRNA 3LCVB 2VH2A 4IX9A 1JAHA 3K0SA 4ZHSA 5F2OA 5IUKC 3STVA 4C4TA 2AXQA 3KKBA 1R0YA 2I2XB 2GN8A 4FFPA 3F46A 4QGHA 3N6VA 4UU1A 1E5TA 1H0RA 3H1FA 3Q72A 2CVFA 4HLCA 3A1VA 1R0ZA 4GQIA 4C07A 1VKOA 4HWGA 3LBIA 1CZUA 3NWJA 1EK6A 3HNLA 1Y4UA 3ZKAA 2VZLA 1U98A 1HF3A 5I7FA 3DI5A 1C7IA 1FU7A 3FWHA 1R6XA 2PSHA 4E21A 4P7FA 121PA 1ILEA 4DQLA 2WNIA 1JLHA 3WKEA 3RADC 1L5SA 3HM9A 5J4VA 1JLMA 3NM6B 1RWKA 5A4KA 2IPOA 5LVAA 5ALIA 5EXXA 1KU2A 2X9GA 4JBLA 3V4LA 1F06A 3T5DA 4OHKA 1HDEA 4HFFB 4GP6A 3O0TA 2CNLA 1L4EA 4KPUA 4B79A 3E3MA 4AN0A 1IRXA 4H3KB 4TQ9A 1LQ2A 4QDZA 4L7QA 2OP0A 5AVUA 1E1RA 3WAKA 5FTLA 4E17A 4IKPA 3TOVA 1EDEA 4JYBA 2A9QA 4F9EA 3VHQA 4GC5A 3OP1A 3FVTA 2CHEA 4O6NA 4KMSA 4YQEA 4ZCIA 1KPIA 4LZNA 4TT3D 4QT4A 3M9WA 3ZTMA 3L0YA 5FA6A 2J0SA 1GDHA 2OHGA 1T8PA 4CL2A 2I3AA 2XL4A 3TDKA 3IQGX 3KS9A 4K6OA 3KTOA 5E6RB 3GG2A 2Q3EA 4HNSA 4JXZA 1T91A 2O4CA 4WZ6A 1QE5A 2WUEA 3MWFA 1YKSA 3QEKA 5C8XA 3AHGA 1CRQA 1V74B 4I6JA 3A1DA 5B3AA 1DJNA 1A4XA 3QVSA 1XBTA 4YLYA 5LQCA 3FOWA 4Z7OB 3AG2C 4BYGA 1GKIA 3IDAA 2ZDGA 5BPHA 1XN4A 3IV6A 3E2PA 2BZSA 4BU0A 4L15A 1SHTX 4E6PA 5GV8A 1WW3A 4JD5A 2QRKA 3RWMB 5KYUB 5HRCA 3FX2A 4B47A 2EPNA 2HZBA 1FUIA 2VBCA 3LJKA 3RIGA 1Y3CE 1QHSA 4Y6LA 1TQHA 4IVNA 1AC5A 1EFAA 2ICAA 5AP9A 4HB2A 2I3GA 3RV3A 2RG1A 3FAZA 1CLEA 3VR2D 5I9IA 4GGMX 5BMVA 3G1WA 3AEQA 3BCRA 4BO1A 4NJMA 3HKEA 3E3NA 1WZEA 4F4IA 4MCAA 2MWMA 1ZD8A 5CFZA 4ZT2A 4I55A 1R18A 2BFAA 2R6HA 4U7GA 1X7WB 4CTKA 3L8GA 1J22A 1W49A 4YMLA 5JG7A 5DYWA 5J59A 4WINA 2QTLA 3WGZA 4DYVA 3TSWA 4FIDA 2QBYB 1WUIS 1J25A 3MK31 1ZIYA 5LWQA 1ZDMA 4IDFA 5TNXA 3RSFA 1AKUA 3Q7SA 4MV5A 3MFQA 1CPQA 3TLGB 2D0IA 4G7HF 3VVBA 1F5NA 621PA 3MJTA 1LV7A 1C3VA 3CU5A 3FFWA 3WISA 2O59A 4CEHA 2VF4X 5L6LB 4OGFA 2VK8A 1KOLA 1HSOA 1MNQA 2HF7A 4X6UA 2I8LA 4NK4A 1KR5A 5D5HA 1FS5A 2IHKA 4QRDA 4OYYA 1JLLA 2HA5A 3TTWA 4PIMA 3SXJA 4WEQA 4MQ6A 3RIEA 3VRCA 4EPTA 4FW8A 3AV0B 1E1KA 4M21A 3EY9A 1EM8B 4GMFA 3OY7A 1QOZA 3EZ9A 3KYBA 3RKOF 3P0HA 1MP0A 1KVUA 1XRLA 4MWTA 2VATA 1LJ8A 3O8LA 4B09A 5IAKA 1FYWA 4Z7QB 4U8HA 4KHZA 1CY7A 1GL9B 4IHJA 1K89A 2IA5A 1I3CA 2WJJA 3U4DA 4ECEA 3IQ6A 1KKUA 4M1QA 3PS9A 1WTYA 1JHPA 3E53A 3TOZA 3L79A 3G0IA 3BJMA 4QQRA 4OX9B 2WVNA 1GQYA 2O9XA 3KEOA 2RB4A 2W43A 3NFRA 3WMGA 2QYOA 3INYA 2XLVA 4DG5A 1RKEA 4Z9IA 2C2KA 1Q2UA 1EE9A 1H0HA 2TS1A 4AICA 3RVLA 3ZU4A 5LPNA 2VFAA 1N2EA 3MMPA 1W88B 3SJUA 1MAWA 4KN8A 3TCNA 1K3UB 2R87A 3HC7A 4V0QA 1RZUA 1V8FA 4YH1A 3VC2A 5DHRA 1FRFS 2Q8QA 3M6MD 4LNUA 1PZMA 3ZW7A 5CHYA 2UYYA 1ZW2A 1BU5A 3R0ZA 4BO7A 5CA1B 2CVZA 4X97A 1WDMA 1N2CA 2XHEA 3ZDRA 5AKZA 4MKRA 3MTQA 4XUDA 4YRTA 1E4VA 3LK6A 1H1TA 3CPEA 4IHAA 3UBMA 1ZD3A 1UP6A 3AOUA 1G19A 1TCUA 3T7RA 2OB1A 3C14C 3BMQB 4U5FE 1HNZB 3Q5GA 1RC8A 1WJGA 4II7A 4CU5A 3KOOA 4OCZA 2BGIA 5F78A 4EY5A 4U9HS 1EDBA 1T8YA 1VXOA 3HLYA 4AROA 2VOEA 5ECDA 5GJVC 3CFYA 4XJVA 1A95A 2J6BA 1QYVA 2PL5A 4E5YA 2RJ3A 1H94A 3K2EA 1MU0A 2R8BA 3KX2A 4NEHB 4DDVA 4WNYA 4QXMA 4LV6A 3H2HA 1LPBB 2ZRJA 1CT9A 2CFIA 2XBLA 4KUHA 1SXJD 3T6KA 2IGBA 2ODWA 4K28A 1YE5A 3I1IA 1Q74A 4PR0A 1JDZA 5DM0A 2SCUB 1ZMTA 2JRCA 1T8SA 5JARA 2G80A 3RO7A 5C9ZA 3OCUA 3RI3A 3IEPA 5DB4A 2J4FA 2Q1WA 1UDCA 1MFZA 4G0HA 2KB0A 2XGSA 5AVVA 4RD9A 1EHCA 3GC6A 4AS2A 5IDWA 2QZ9A 3U61B 2G67A 1HMPA 2ZCUA 3TAUA 5FDFA 2QN7A 3WYNA 1L7MA 2ECQA 4XJXA 3EMKA 3C15C 4MROA 1GA4A 3AHIA 3UPDA 4TTSA 1T36B 4G5RA 3G7SA 2G7MC 2P7HA 3O03A 5C35A 5MN5A 1YS9A 5CLJA 4L4YA 4QI2A 4O3FA 4V0KA 4KXXA 3ROEA 3K4QA 4OLHA 1QP0A 3V00A 1CQZA 5LIPA 4BX2A 2FSSA 4HNVA 4XQEA 1LPNA 4JLPA 1BQ4A 1KY3A 1PJ2A 3V4SA 2O5CA 4ASUA 4ACBA 3KPWA 3ILHA 2FPGA 5HS4A 4E5MA 1RKXA 2FA9A 1CHDA 5EUCA 2P9EA 1DINA 3KZCA 5I7UA 3HZZA 4FS3A 3I73A 4AL4A 1MCZA 2DWCA 3VJLA 3TTUA 5HMMA 1HFJA 2QM0A 2RIPA 5FV7A 4O4HA 1UBMS 2ZXOA 1BTOA 2JGJA 2OYCA 3NQ41 3ZD9A 4KZPA 1UDAA 1QSPA 1JBKA 3TQCA 2REQA 1JI3A 3KKQA 3NHBA 3H2UA 5HILA 1FAPB 1W8IA 3GROA 5TQ0A 2B98A 4DOMA 1LVGA 3HY3A 3OBBA 3NEYA 5BN3A 1BVHA 4CQLA 3AWDA 5DS5A 2XXAA 1AHNA 2HV9A 3N53A 1GTZA 4IAOA 1KOFA 3LKBA 4RS4A 4BNFA 3B1KA 1XVAA 3UPTA 4KXMA 5G02A 4JCZA 3LUFA 2AOUB 3BULA 4AS3A 4XYLA 4DCGA 4TTTS 4MK4A 2V55B 2EU8A 1HT1E 4BNXA 3FCUB 1JHAA 1VE3A 1KYWA 5FO1A 3GNLA 1ZGAA 4IH4A 1JZTA 1U0TA 4CSAA 3N2GB 4W4TA 1I0ZA 3RF3A 4LA4A 1MD9A 4HO1X 3FYUB 1F8XA 3OZCA 1MVOA 4TV9F 3HRIA 4QPZA 5B3LA 1UXOA 4LXUA 2BTOA 1E6EA 3VDMA 4GNRA 4YDQA 3W9SA 1TVMA 1W36C 4IF4A 3RC3A 2PZFA 2P2YA 4FGLA 2LFFA 2DFLA 3VMFA 3QU5A 3O7MA 2A5DA 3E15A 3ANMA 3OEWA 2VYND 4B3IA 1X7XB 2EPMX 4YY3B 5B7NA 2I55A 1XLWA 1EVQA 3DOUA 3EIXA 4IZHA 1MOSA 2WF7A 1N8KA 2VUSA 5FFFA 3MAAC 2WINI 4PQFA 4ICIA 4WN9B 5ALHA 1GG8A 1WY7A 5EZYF 4ZCPA 4MW8A 1UKCA 4V3BA 1C03A 5CT9A 3CLTD 3LY7A 4RM2A 4V2UA 2O6LA 2YRXA 1YKGA 2NXNA 1O5IA 3OZDA 5BR1A 1Q22A 4QBFA 2VC2B 4G0ZA 2IU0A 1N7JA 3EISA 3RANA 1B0AA 4RPJA 4Y2PA 2YQ4A 4CF5A 1Z7GA 5JDIC 3EIOA 3VSAA 4GR9A 3TVTA 1ZD9A 4BNWA 4FSHA 1JEYA 4ZV7A 3HJGA 1II0A 3U3DA 3V34A 1PYGA 3KYDA 2O8FB 5IJWA 4EB3A 1EFKA 1V37A 3LV8A 3A0UA 2WIAA 1ZLYA 5JNWA 3WYBA 3LXUX 3A6JA 3ZS9A 4WOJA 1SK9A 2F17A 4LCEA 2W8BB 3HVUA 2NSJA 3Q6MA 2FP4B 3L0DA 4A9AA 2HT6A 1CX9B 5A5GA 4JTAB 3OCCA 1CY8A 4N65A 1SYQA 3CURA 3CNLA 4D9CA 1PFUA 1RC1A 4E70A 3RSLA 1XR3A 2E87A 1P1CA 4B3CA 2OOKA 1C80A 2I2BA 2TRSB 1T5IA 3ANNA 3VJKA 1HQYE 3KKMA 1DTEA 3R6TA 3BIXA 3N2KA 2YUTA 3O26A 1ZJ4A 3HNIA 2IQ5A 1WDKA 2CFTA 5HS6A 1SXJE 3QMMA 5JZSA 1O0CA 2I7DA 1SVSA 5H82A 1ZH8A 3W3AD 2YZKA 1IEWA 4JBXA 4W99A 1M0EA 4CCWA 3U4AA 4DZRA 2XA1A 3U9TA 1DIAA 4NZPA 2CV1A 2QR3A 3LEOA 3EB9A 4X61A 2V1XA 4WXHA 2VJYA 1X0XA 1UWVA 2W22A 1ZGBA 2ET6A 3WIVA 3NLLA 2J45A 4PX2A 5JSKA 5K6AA 3ESYA 2O8BB 2FQYA 1F51E 4KIGA 3P2OA 4QGFA 2YJ5A 3EJ6A 1FQJA 4UQLA 2ZS9A 4M1ZA 3AEXA 4X0EA 4ZQIA 2BFNA 3DD5A 2QMOA 1KORA 2ZBVA 1XQXA 1P0QA 4XE5A 3UCFA 4BUJA 5HXAA 4Q9JA 2REOA 1WNFA 1NF8A 1XMVA 1NFNA 4H1HA 1JYFA 3IMEA 1LEHA 2FHPA 4U1RA 1PGNA 3PT9A 5F3RA 4C3EA 4DIBA 5CT8A 3KJHA 3U7QA 4IWYA 1OI7A 3DBOB 2JJ1D 3TCXB 3TW8B 2R96A 3CLVA 4J8PA 3VNRA 4GEHA 2IX9A 3LA8A 1C7JA 1F0KA 4Y9SA 3HB9A 4OM8A 2WSSA 4F96A 2JRLA 1VG1A 4IVPA 4CHTA 1L7XA 2QR5A 1AX9A 1Z7YA 2C4HA 3H84A 5B4UA 3V3KA 3CT4A 2IUFA 1HT0A 4O6VA 3TJMA 1ZH6A 3L7MA 5I7EA 2I71A 2GM3A 2CNBA 1GT6A 4IGAA 1QH0A 2A5YB 1OC4A 3WGJA 2WSYB 4J3JA 5T8KC 2IE0A 2WIDA 1APBA 1BJTA 1C1YA 4IS3A 2XS8A 1KDOA 2CVOA 2GD0A 4UBKA 1MB3A 2A1UA 1UM8A 5K3FA 5IZCC 3TUJC 4C3ZA 4J4HA 8ADHA 2AI3A 4KRFA 5EXDA 4Y2TA 5LQRA 4UHHA 2WDZA 2CCYA 4KFRA 4L4UA 4R2IA 5GONA 3R74A 3W9YA 3KALA 1UZUA 2V8BA 3ZWNA 4OB6A 4ESOA 3UKJA 5I5EA 2G36A 4WJZA 1SZCA 4LK2A 4OEHA 1MQSA 2OHFA 2QRVA 4F0JA 1VYTA 1P4AA 3RHZA 3TRDA 2OSBA 1XLUA 3LA6A 1TIBA 5KU1A 3ZHVA 4AKTA 1K4KA 2GWRA 4IDHA 2OTCA 3FNEA 4DIFA 2GZSA 1F38A 3FMFA 2WTXA 3KYCA 3QWBA 1QO9A 4K0RA 3WDMA 1L4MA 5AW3A 5BR7A 1M67A 1TI7A 3AUAA 2GK4A 2VWQA 2XNJA 5BYKA 1PKEA 5LYJA 3ZUPA 5C5EA 5LCXA 1SBIA 2UDPA 2LD6A 2QAGC 1HEIA 2AS0A 1KQNA 4E13A 3WHLA 4ABYA 4ONEA 1OXVA 5KSWB 2B3TA 3P20A 3GMTA 3T3MB 4OO3A 2A33A 2X5JO 2VZ0A 1B8PA 3PITA 4E46A 2X0RA 1LGYA 2A6PA 2YW9A 2QTVB 3WIOA 3LLCA 5CNKA 2Y4NA 3I58A 2J3JA 3QHPA 2EKLA 4P82A 5MGNA 4XD7A 4YNBA 2PRSA 3TZLA 2IDZA 1YR8A 3ELDA 1NR5A 2OCGA 4J4TA 3DYVA 5J1SB 4LECA 1ZK3A 3G5TA 3B3AA 1TUGA 1Z73A 4I19A 2ZOSA 3QFFA 2ZEJA 4H7HA 4FYPA 4Z53A 2OZLA 4C0HA 3O31A 4RK4A 1RJ9A 4AZTA 3C6YA 1W2GA 3EJNA 2RBGA 5C18A 3EIUA 4QZVA 1TU4A 3F9CA 3NDBB 1U9ZA 2YNMC 2FZGA 4WGGA 1RSZA 4YECA 3CKKA 2O3UA 3M3HA 4EY3A 1C29B 4DWOA 3UEOA 3JAKA 1LKXA 1K63A 2CNNA 2EATA 3EFOB 5HW0A 2PNOA 4KWHA 4Y2UA 2WWRA 4YR9A 5REQB 2UVQA 1COWA 1SR8A 1L8QA 3B2EA 2VDMB 3MQ4A 3RTCA 1T5SA 4YRSA 2R5WA 2BC5A 3DE4X 3AFOA 1WA5A 4LKRA 4MLZA 1XZJA 1LSSA 2PTHA 3ROTA 1PR6A 3C3PA 3EZXA 1KQ3A 3CNQS 2CUZA 1GZHB 3DLPX 2E6UX 4F21A 4EG8A 3PUYA 1C8BA 2A58A 4CKBA 5AVWA 2XIQA 1U2ZA 4P3KA 3GCGA 3NDJA 4AJHA 4Z4IA 5IJ9A 3ZTZA 3AEKB 5I8PA 1OWOA 4OREX 4PIVA 1Q3TA 2P4EA 3FZQA 3A37A 3D2BA 4UHBA 5AHXA 4D57A 4LHXA 5T5QA 2RGGA 5I6DA 3UWPA 3AR4A 3LL7A 3PHGA 5A6JA 5C51B 1E2NA 1OYYA 1G5HA 4QEKA 1GGHA 3PDJA 1JKJA 2XRHA 3MWKA 4C1BA 4GM4A 3K3PA 5DVZA 1KAQA 4AJ1A 2X3FA 3HJBA 5JVDB 2PUDA 3KAKA 4DQKA 3LT0A 3CE9A 3U81A 2WPDD 4KXYA 4P4SA 3AFGA 4R8SA 4C7MA 3E1KA 4QLAA 2DFPA 3RSHA 4GRIA 3NJ4A 3EHNA 2XCQA 3T9BA 2ZS8A 5AUQA 3TYXA 3CKYA 2AHOA 3U7JA 1NONA 3CSUA 2GA8A 2OLJA 3U4IA 1UH5A 4GYJA 2P91A 3OE5A 3TECE 5BNIA 1TT7A 2KLHA 3CWQA 2AV6A 4Q9DA 2B83A 2F43B 3E4DA 2O2XA 2X2OA 1I1QB 1VPTA 1EFPA 3WGHA 3GRCA 5E38A 4V3CA 4ND1A 1HYQA 5DFAA 2DKNA 2XWJI 2Q5QA 1WF6A 3WLAA 3QU2A 4JP3A 2GQ0A 5K20A 2L6GA 4LLCA 1K68A 4CG0A 3UG7A 4EKYA 1WXEA 3L1UA 4RFLA 1Z2EA 2P6OA 4BLSA 2O2DA 1D5CA 4PXAA 2F9LA 1O87A 4LVCA 4QKQA 1GQFA 1QO0D 2CNWD 5DZSA 1R4NB 1WLSA 1DIRA 1G2OA 1A8PA 4OSPA 1SU6A 1TFOB 3VZRA 1FVHA 3OQMA 1RM0A 3O10A 1C0LA 3KKZA 3QVGB 4BVKA 1UAAA 4BOYA 5HKOA 1KVTA 2IKQA 3MRVA 1QE0A 3DHWC 3S4YA 3WMWA 1LTKA 4WK6A 4HUTA 1VJRA 2CXNA 1DP4A 2R7KA 2M4EA 1YS7A 1MN6A 3OP4A 3R41A 3PDIB 3A9WA 7REQB 4N49A 4BYMA 4I1OB 1ZM2A 3UMFA 3W2TA 2FFBA 2P9JA 2JI8A 4Q03A 2DX7A 3JQAA 4LJSA 2O3SA 3PX3A 3TZCA 3VUEA 5HBRA 2OVBA 2JLVA 4DIDA 1Y8ZA 1RRPA 2GI4A 4MRMA 1AXRA 1Y3BE 2YQ5A 1R4AA 3WLSA 1WCV1 1PSWA 2NU8A 2D2VA 3QFRA 2D1TA 2WOJA 2BDTA 3GHYA 2VZ8A 4N5NA 3AUFA 3C85A 1IXYA 1BYUA 2SNIE 1E6KA 4ULVA 1I5RA 3WLKX 2G9RA 3AM5A 4NCKA 1I32A 3V32A 4IMIB 3WGGA 3AW9A 2WTMA 4PYJA 2QRHA 4IXNA 3ZJVA 4MVMA 3L34A 4A0SA 1DG9A 4E2YA 3DL4A 3LX6A 3LWBA 4ZVVA 4AMVA 1O57A 2AI2A 5G3ZA 2POQX 5IX8A 3X1DA 4Z4CA 3FOPA 4D46A 1KZYC 3AEZA 2OV6A 3EVGA 4XLTA 4NE9A 1NJGA 1J9ZA 3DJNB 2C5AA 2OMKA 1EVZA 1Y7HA 1JEQA 4I2VA 2VDVE 3QFCA 1A9OA 5EQJB 4QAQA 4GVLA 1G41A 4BECA 2FVYA 3AB3A 1OH7A 1U2GA 4MW1A 3M1CB 1JJIA 3IOYA 2JGDB 1VLSA 1WXDA 3KOWA 1K7YA 1C50A 3ZWKA 1MT0A 2UUAB 3ZR4B 1QR2A 3PVZA 4EG1A 5IY5C 2R03A 3R9WA 3JALB 4R68A 1R6AA 5CVJA 3I2JA 1G4US 4O5AA 1YFKA 2P4HX 2IYQA 1PU2A 2JBAB 3RC9A 3K9FC 3ZD6A 2G8LA 4B7UA 4NYIQ 2V3VA 4IRUA 1AS0A 4XA8A 4ARZB 2YH2A 4D4JA 3AU9A 1YJQA 3LPMA 2YWJA 1S2MA 2JD2A 3UT5A 4XX0B 4P92A 1K0UA 3VZBA 3SHWA 5DM4A 5J2TA 1QAMA 1EGVB 2MHRA 1UAGA 4NLLA 3B0VC 1FLVA 4HGZA 3DTVA 1X39A 3U26A 1ISJA 4L57A 4MWOA 3I32A 2PXHA 1XZEA 3ICCA 1Y5RA 1CEQA 3SDZA 2XMPA 2P5UA 3RIYA 4UASA 1E0DA 1Y6FA 3WVNA 3QTLA 2W6MA 1G4WR 1SZJG 2GTHA 3KCQA 3QUBA 1T5DX 2QN8A 3Q8WA 5TXGA 2I7XA 4CI0B 4MGHA 4OU5A 3GEHA 5AK3A 1VHJA 1YI8A 5FCDA 5LXTB 4XVRA 4RH0A 3IRUA 1QOQB 3OOEA 4KXVA 3IQ5A 5FPKA 3IHWA 5G40A 1ZUWA 1ZU5A 2PFDA 2VK2A 3LPDA 2AF4C 5KTYA 4YEDA 3GRKA 4E2FA 2R66A 3Q88A 4QDXA 2EFGA 2XW6A 2QENA 1XMOB 4N12A 2WYHA 4QFDA 1LBHA 2MYPA 3KJEA 4C4ZA 3OPYA 3QF4B 3KJZA 4WZZA 2QE9A 1N2XA 1OPRA 1XKLA 3OLXA 2GCOA 4K1XA 4JSRA 4TSFA 3I1JA 1T3GA 4QM6A 5A0TA 5JDIA 3JSZA 4N3CA 3ZG6A 3DBRA 3RJZA 1QLWA 2KQ9A 4MDEA 4PHTA 2H52A 3LDAA 4Z4FA 4O0LA 3E22B 1ZWKA 2G1AA 1EIWA 3VC3A 2QX7A 5EHIA 3HHEA 2FWIA 1Z12A 3B1XA 1KQOA 4R31A 3VGPA 1KRXA 1BVUA 3D3EA 3T3IA 5IKXA 5FWYB 2IYEA 4NOLA 3AFIA 1Z3CA 1ZI8A 3FFBA 1T4MA 3GUYA 4O2AB 1WVIA 4DBQA 2FR1A 2A9PA 3AI3A 2BM0A 4F12A 2J9BA 4MTLA 2JCXA 3LLKA 4RGQA 4XYGA 4MEAA 1JAZA 3D7RA 1X42A 1IY0A 3ZHCA 3NXSA 1T5OA 1I2BA 1RFGE 3I5UA 4XPIA 3P9YA 1Y48E 1WVGA 4MINA 1FNNA 5LU8A 1X1QA 1DJOA 2OECA 5B37A 4EHKA 3KHTA 2JHFA 3E9QA 2E48A 4LZOA 4UULA 2YC4C 5TS3A 2LWIA 1BN6A 4F5DA 4F84A 3CO0S 1WZUA 2ZI7A 2ZRHA 4IQ8A 3ZE8A 1KI6B 2VA9A 4NC3A 1I1HA 4GS5A 4NMLA 3MZ0A 1X7GA 3IEIA 1UG7A 2ZGVA 2FW0A 5KQGA 2JVJA 3IMFA 1VDZA 3QELB 5H81A 4IOKA 2P11A 4EY8A 1Z6XA 2IPXA 4YMGA 1T9KA 2EWWA 5CDFE 5C1DA 2SECE 1E2XA 4RTOA 4KE7A 3SIPA 1N8TA 4CUKA 3M8KA 3FFXA 4Q7JB 2R7LA 5BSTA 4C6HA 3W1VA 4MUJA 1VMEA 4MICA 3AG1C 2FPWA 1JHDA 2HA2A 2X1MA 1XX6A 2GBPA 4MMZB 5BN5B 4Q3OA 4FR0A 2WLSA 3TNDA 4Z4QA 2F62A 4LYGA 5FB3A 2XB8A 2EKPA 4E7OA 2CYBA 1FUUA 2G1UA 2DZDA 4AD8A 3EVNA 1VKHA 2DLDA 4R05A 1NXOA 4BDTA 4KIUA 1KDTA 2YCBA 1E1CB 5F5XA 3ADOA 2W4IA 4BTLA 1NQOA 2C77A 1AUXA 2QX6A 3SS9X 2H2DA 3ED1A 2SICE 5DLJA 4EYOA 4DIMA 3DB2A 3U0BA 2GO7A 3U80A 1M7GA 4DMKA 1XF9A 1EU1A 4CSAC 5EJFA 4C29A 1OH8A 4TT8A 4YV2A 2KWIA 2HNAA 5IWAB 3UFXA 4JBYA 4AP9A 4JMPA 5JW6A 1YR2A 1Z5WA 5DWDA 4FNAA 3LHKA 4EFMA 2ISSD 3FVYA 4DSUA 5DYGA 4MR8A 5THQA 2MJLA 4HAYA 1V6AA 2I1VB 2IDMA 3DCYA 3IUSA 1O2DA 5FPPA 5JSZB 1ZOLA 2JJ2A 4RF4A 2YY7A 1EBBA 1U1GA 2EJVA 1WXIA 3I6IA 1WU7A 5IZCA 4YJGA 4ZCTA 4PTLA 3LDGA 3RBVA 5HKLA 1B8VA 3TLCA 4D9FA 1TYBE 4HQOA 4AY2A 5E3AA 3JWJA 5CG1A 5BSFA 1T1EA 2XRMA 3ZBPA 3NGMA 4Q7MB 3LHFA 1EFHA 4O4JF 4M3NA 4EHDA 2HU7A 5GOZA 4TLCA 1HYHA 2QVLA 2OT3B 3O3NB 2MCFA 1HLDA 3AI1A 4J0JA 5E1OA 4CDGA 1RXUA 4R01A 1DC3A 3WIDA 2JD3A 1R8QA 2VNIA 1Z06A 2VZEA 4CFSA 1E2DA 4AG3A 2C0QA 2PGAA 4BNHA 3ZY3A 4TOIA 3S1LA 1U90A 4ZVUA 2P0YA 4K9DA 1P5HA 5A6AA 2ZUSA 4TXMA 1SUDA 3VU1A 1JFFB 3SP1A 4ZMRA 3RAEC 2DPHA 2PRJA 1JIVA 1W581 4GX1A 4KTVE 2BEUA 4NWIA 3A2MA 1AK1A 3CM0A 1AK9A 4ABTA 1FFHA 2ZJOA 1A2QA 2ODAA 3MTGA 4MUYA 3SBEA 2KSQA 4A2PA 3HKCB 4B34A 4KJZA 1OR8A 3MXOA 2HBZA 1NR7A 4JJIA 2OFWA 1YBVA 3JV7A 4RE5A 4LC1A 2BTEA 2YWCA 1MO2A 1E4OA 1XQVA 2VUHB 2AB0A 2GNAA 4PYOA 3K66A 1NWCA 4G0QA 4DWWA 2O7SA 4HFKB 2DFTA 2P5SA 1QYWA 4W8OA 4L28A 2JI6A 3WMXA 2Q0SA 1W87A 4W5NA 4RQTA 5EIAA 1ODKA 4Y2QA 3QP9A 1F9AA 1L5HB 3THXA 4H7KA 1CJMA 1JF8A 1XA0A 3HCWA 4FMPA 4X7PA 5IPFA 3NJ8A 4CM1A 4D98A 5EXEA 3FAJA 2E49A 4DC0A 1G4HA 1TF5A 3RROA 4D79A 2FFHA 4DA4A 2BHNA 4G7ZF 3LHIA 1XB2A 5K6AC 3HJFA 4DG8A 1TCBA 3DKRA 4YYZA 1OZGA 3PVCA 4GLBA 3KUDA 3BZWA 3GLQA 4TUYF 4QT0A 2XNSA 1ACJA 4FYYA 3HVJA 1V45E 1T2VA 5E7IA 3GLHB 5EGYA 3VVLA 4PTZA 2ZXEA 5FYQA 1ORVA 3T9OA 3HMQA 4BQNA 2W2KB 4J3FA 4N18A 5EP4A 5ICCA 4ZO9A 1NVBA 3IEXA 1AKYA 3D3WB 3LBNA 3F4KA 3UY4A 2A3NA 2DR0A 3WGLA 4DJEC 2Q0HA 4ZK6A 5L0HA 3L43A 3I9MA 1WZCA 1LBIA 1U3DA 1BFKA 4YI5A 4YQFA 4UTZA 1HEUA 4I9GA 3RUCA 4NV0A 4LYHA 1GQOA 4AKGA 1ND5A 5EXTA 3C3JA 4QYSA 3TL6A 4UPEA 1XTZA 1P0PA 4MITA 5THKA 1SKYE 2RH9B 4XAQA 1RWWA 3GFOA 1C7FA