4R32A

Crystal structure analysis of pyk2 and paxillin ld motifs
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
132
structure length
132
Chain Sequence
b'LDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 55
structure length 132
sequence length 132
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4r32A00
1ZZPA 3K7DA 3L8JA 1QVXA 4XEFA 4EBKA 4NQFA 3BRJA 3RQGA 1KNYA 3RQFA 2KK1A 3RQEA 1OW7A 3C8GB 4EBJA 3C8GA 1OW6A 2YWAA 4XEKA 1V4AA 4XEVA 2L6GA 3S9OA 4R32A 1K04A 1UFBA 2PBEA 1KTMA 3GM1A 1PV3A 3AJMA 3U0CA 2Q00A 3U3FA 1WOLA 2L6FA 3MFNA 3L8IA 3TULA 3C8GD 5F28E 1K05A 3C18A 3GM2A 2L6HA 1O3UA 2JX0A 1OW8A 3JZ0A 3B71A 3JYYA 3GM3A 1JOGA 1K40A 2JPUA 1WTYA 1WWPA 2HSBA 2LK4A 3O10A
chains in the Genus database with same CATH superfamily
2W4MA 4PJNA 5A6JA 4NTAA 4D4XA 3RQGA 1Q0FA 1ZHYA 2Q9BA 1OW7A 1J8YF 5B1AC 1MMNA 2WVNA 4LLEA 1U6HA 1HMOA 4PJMA 4NC3A 4YJWA 3TK0A 2CGEA 2JD3A 2YWAA 2H7BA 3LEOA 4FESA 4HEAJ 2XL6A 3U9MA 2OKUA 1Z63A 2LD6A 4KI2A 4NCQA 1TKNA 4ER9A 5DLJA 2AP3A 1JAFA 2L81A 2Q00A 2ZXRA 3DM5A 3F46A 4MTFA 4Z9IA 4W8PA 4MTGA 3L8IA 4O6YA 4BEJA 4DXWA 2WZLA 1VTMP 2J9UA 2OU6A 3LNRA 1VLTA 2A69F 1K05A 1TR2A 2I15A 2IYLD 3C8GD 3M15A 5HSWA 4CSAC 2BC5A 2JX0A 3JZ0A 4A4AA 2R7VA 1AEPA 4DRJB 1Q0DA 1K40A 3KH2A 4XLPF 2H8AA 1PD1A 2EPKX 4MVRA 3B0VC 2QLAA 3IEEA 1TFKB 2DYSC 4NTFA 4MVSA 1FNTc 1OR3A 2MYSA 3HNJA 2KNHA 1YLMA 2GA0A 4CIPA 3N2ZB 3RQFA 3T9OA 2AWCA 2EPMX 3K1IA 1EI7A 1OQCA 3LS0A 4KBLA 4LDKA 1H7IA 2AVKA 3E70C 4IRUA 3TOMA 1YYJA 1U89A 2ZD9A 3DE8A 5AC4A 1I4ZA 1AUEA 4LLCA 3W8IA 4BJ1A 1CGOA 2IXNA 3B0PA 3PHF2 3S28A 3BEHA 3OEOA 2ZPAA 3U0CA 3TJ5A 1VMAA 3KPHA 1Z3IX 1ZVZA 2A68F 5CI8A 2PNOA 1NFOA 3L34A 1JMWA 5D92A 1FTSA 4C3BA 1VYIA 1D1CA 4GQHA 3RH3A 5JUAA 3LEVA 1M56C 2YL3A 3AG2C 3HKKA 3SZRA 2LQGA 4GYTA 3T6JA 3AQBA 1RMVA 5F5HA 4C7OB 3NYJA 2XSEA 4JEAA 2PFDA 1D1BA 1WASA 2NSFA 3HNLA 5L0JA 1C03A 3AG3C 5BQIA 5AC5A 4WABA 3EGXA 4RDAA 3VM6A 1VOMA 3MLGA 3LNMB 3H2UA 4AK9A 1FFTC 2J0XA 4C3EA 4G7OF 2L9JA 3DKAA 4MW3A 3RYLA 4LACB 4AL1A 4BJTA 2PP4A 5DS4A 2CW0F 1PV3A 3J06A 3AJMA 4JW1A 3V5XA 3O55A 4OIQF 2V3CC 1TFOB 4FAPB 1ZW3A 4PFPA 3C18A 4IARA 3K66A 2CNWA 2L6HA 1ORJA 4OD5A 2B0HA 1EA8A 3ECSA 4WJ0A 3DJUB 4CDAA 3S0XA 2YL7A 1MMGA 2HFIA 1W2WA 3L0IA 1LI5A 3QW0A 4KNWA 3TD7A 2RD9A 3DMDA 3I5PA 4EKWA 1OKKD 1QLEC 4E0HA 4YT2A 4QDLA 5KYWA 2R7WA 2J9WA 3B9QA 1BZ4A 1NSGB 2J45A 3ABMC 4JJFA 4BJ6C 3T6BA 4CS9C 5A6BA 2O9XA 3Q7LA 1ZHXA 4JIOA 1KU2A 3MBGA 1HE1A 1C02A 4JRZA 3T6GB 3U3BA 3U8PA 3SEOA 4BPMA 3JSEO 4MVQA 3LS1A 2LFFA 3S29A 4E17A 3NYMA 1LIHA 1D0XA 4JCZA 3KYJA 2A6EF 2H7OA 4P6IC 4ULWA 2YVKA 4YT5A 3FAJA 4YK5A 2IOQA 1PCXA 2EIJC 3CEXA 4I1MA 5CIVA 2W9YA 5A6KA 1JOGA 1SMYF 4EBBA 1RKEA 2XS1A 2WL8A 4JC7A 2WB7A 1YARO 2HS5A 1YA7O 4DBRA 3DI5A 1CGME 5EHHA 1YA9A 3CAXA 2E87A 1L7CA 4NQFA 1KNYA 2QE9A 1M6TA 1MNDA 2XLDA 1O5HA 3VRCA 3C8GA 2P1AA 2CNWD 1NFNA 4ANJA 2KJGA 3K1HA 2Q9AA 3DJNB 3ZVRA 1J8MF 2OEXA 2Q7RA 4G0HA 3TOLA 1JRAA 1SZIA 2BL2A 2YLIA 3MX3A 1QPUA 4ZLDA 3NKDA 1G8XA 1OXKA 2AWYA 3E9VA 4YN0B 3C63A 4MQ9F 2HSQA 3FXHA 4N4WA 2QY9A 1N1CA 2Y3HA 2XLVA 3JYYA 3EJNA 2XL8A 1MNEA 1D1AA 1M2OA 1WWPA 1L3PA 4IWBA 3U8VA 1CPRA 1SF8A 4G7ZF 1EKYA 1ZW2A 2ZXPA 1VK5A 1LI7A 3U2LA 2Q4FA 2Q9CA 2QUPA 2NUPA 2R25A 2XM4A 1LKXA 1RJ9A 3EGXB 3AGTA 2P6VA 3SXMA 2PX0A 3G4ZA 3Q7GA 4EIYA 1LE2A 2YHSA 3TQOA 3NMKA 2G3VA 2KQ9A 2P61A 4XEKA 1MMAA 3LESA 1NZEA 2ETSA 3ZG1A 4WGZA 1SYQA 4R32A 5T3WA 1YZCA 1ZHTA 2DI3A 2OCCC 2OQMA 2VCCA 1G4WR 3K1IC 4D4NA 2EPNA 4CDYA 2YLDA 3NRHA 3X2QC 3W2WA 1TQGA 4IGGA 4DVZA 3GORA 1E86A 4WGYA 3VAYA 3HNIA 4YL0A 3X1OA 4I3MA 5EK0A 2R7SA 2HJMA 1ZU5A 2EINC 4MVZA 3AG4C 5KYWB 3Q6MA 4HFKB 3JSZA 3NG1A 5JLIA 1TWAA 3C8ZA 1ZHWA 4MVOA 4KNVA 3M79A 3JT1A 2HMQA 1V4AA 1VLSA 2KYHA 3S84A 1HY5A 2L7AA 4XQ1A 3GEHA 4DBQA 1KTMA 3GM1A 5T1DB 1Y4CA 2ICWG 3UGPA 3EG9A 1OKKA 1WOLA 2C03A 5COFA 3C7JA 2R9RB 2CCYA 3DD7A 3HTKC 4N06A 4U5GA 5E3CA 1DOWA 2VB6A 3S90A 4MTOA 1RCPA 1RKEB 2EPLX 1ZHZA 2VC9A 3WODF 5L0FA 4PJJA 4PJLA 5AGFA 1HMDA 3I5QA 3DZAA 1OR2A 2J0WA 3K7DA 1QQ3A 4E7SA 4CJGA 4O6NA 2VCAA 4G78A 2KK1A 4RBNA 2YL0A 3C8GB 1LPEA 1T6QA 3LUTB 3KL4A 2BE5F 3AGUA 4K7BA 4XPWA 2CDQA 4CSAA 1OCOC 5DQZA 2PX3A 3EZHA 5JS5A 1MQVA 3QVZA 4XEVA 4JTAB 3HLZA 4P9FA 4O6MA 4OIRF 1DOVA 1S7ZA 1SR2A 1NU9C 3FOPA 4CBEA 3ZWIA 2I8BA 4EWCA 1OCZC 2DYRC 2P7VA 1BR4A 2Z15A 3O6XA 4AE4A 3B0UX 1ST6A 3QTHA 3SXKA 1OW8A 3WG7C 4M63A 2WVOA 4CS8A 2XRHA 4YL3A 2D4UA 3LJBA 4IJJA 2OJED 3NMJA 2GWWA 1H6GA 4FWVA 1ZZPA 4CDVA 2NUPB 2WVQA 1CPQA 1RJ9B 3JRTA 3OA1A 4Z9JA 3SNHA 2OOCA 2KSFA 1OW6A 1A7DA 3VF0A 2XXAA 2R03A 1YJGA 2ZXOA 3IHUA 3L1MA 1RKCA 4JCHA 3AOUA 3DWWA 4U5HA 1A41A 2ZXWC 3RVZA 4BJ5A 4K1OA 1FMWA 1OCRC 2UUIA 2XL4A 3MFNA 2VCBA 4JTDB 2X51A 2YLGA 1H9GA 2IXPA 2J9VA 4Q7CA 1NG1A 1XZQA 1UG7A 5A6AA 3QVYA 1T6UA 3M4CA 2NPUA 4DVYP 1ZU4A 3A11A 3RF3A 2EILC 2H7VC 2FFHA 2YQYA 2Q3TA 1Y6DA 4U5FE 1IZMA 1G4US 2WZGA 2OEVA 3W8HA 4PACA 2HZ8A 1Z6AA 3G50A 3PCVA 1T6IA 2LIGA 3K33A 4IAQA 3A9CA 4PK4A 1ORYA 2XLHA 1FMVA 3GWLA 4XPXA 4A2NB 4OIPF 4JJGA 3S9OA 4H4KC 4JVSA 4RD9A 2X0CA 2IXMA 5B1BC 3EG9B 3EZIA 1NU7D 3KMIA 4JEBA 4ONSA 4LDQA 3RW0A 3W2VA 2L6FA 1FFHA 4XTKA 1CGNA 2Y69C 3FHDA 3NYLA 3DE9A 3T4RA 2QNLA 3SP1A 1WTYA 3EFOA 1FAPB 4J32B 1MMDA 2MWQA 1HW2A 1S05A 2HKVA 2LCHA 1TWGA 2IM8A 3FAPB 4N6HA 4XEFA 4W8KA 2PF4E 2WZFA 3BRJA 4XWJA 4Z9HA 5FZTA 3RQEA 1JR8A 5JSLA 3ZTZA 2ASRA 1O87A 1RXQA 5E2QA 5E33A 256BA 3NDBB 3Q6NA 2UUHA 5CI9A 3TJ6A 1A7VA 1D0ZA 1QZXA 4J7TA 1V54C 3ASNC 3IQCA 3KYIA 4XPYA 1UFBA 3UMIA 4OIOF 1TWHA 2KC3A 2HMZA 3FVYA 3U9JA 5GPGB 3U3FA 4DJ9A 1GGQA 3CSKA 2YKZA 3POVA 3JTLO 5L0CA 1ZYRF 2LFDA 2A0BA 3O39A 3V7OA 4HFFB 4AE4B 2NUTA 2DB4A 1C17M 2J7PA 2B0JA 1VB5A 3MYIA 3GANA 2A0UA 3ABKC 1QKRA 5E3AA 3EGDA 2IBFA 3DXJF 3L8JA 3NKEA 4FX5A 2VH3A 2DGJA 4H54A 3SYNA 3ZQYA 4E18A 5KYXA 1HW1A 3R2PA 1T9KA 4ZLCA 3EHNA 5HV9A 3UGOA 4EBJA 1WGWA 3ZSUA 1D0YA 3KKBA 4U5EE 4XLNF 3VYWA 4EUKB 2R7TA 2XXAB 1E83A 1WATA 2W45A 1TWCA 3GODA 4ULVA 4CIHA 2L6GA 3HNKA 4LERA 3QZCA 3F47A 3ATPA 2V26A 4U9EA 2Y3GA 4BG0A 2R7UA 4HE8D 5B3IA 3EPVA 4QI2A 3IQ5A 1R4TA 5T3TA 3ZIBA 1Q0MA 3R7CA 2R7XA 5B3SC 3JRMO 4J30B 3MYFA 3EH2A 1Q0KA 2R02A 2W4BA 3DM9B 3HJCA 4PR9A 2P0NA 1APCA 5KYUA 3SXZA 4P9TA 5L3VA 5L3QA 4J7YA 1PD0A 4DRHB 3PDMP 5IY5C 2EPOA 4YT4A 3WHNA 3C62A 2M64A 5TJ5E 4YWQA 1VYKA 1JPNA 3FMSA 4EBKA 1BR2A 3EH1A 4U5CE 1XZPA 4L6RA 4CS8C 4F4BA 5KYYA 1E85A 4Q4ZF 1BDJB 3IPMO 4E7ZA 2J7PD 2NSGA 3RIPA 5L0IA 4G7HF 1YZAA 4DOZA 3WAQA 2RSEB 2Y39A 3NMIA 3EQLF 2HV7A 2NG1A 2YRFA 1Z7Qc 1I5NA 1BBHA 1M57C 1BR1A 3N24A 1V74B 2GDCA 2CYDA 3TULA 3IQ6A 3ZQVA 3H65A 4MS2A 3CZ6A 2D5RB 2HV6A 1E2XA 1M2VA 2LSEA 2XLMA 1V55C 3B71A 5DS6A 4PFOA 2JPUA 3EFOB 2KGOA 4OINF 4JE9A 4Q5SF 1F1MA 4O79A 5F5FA 4I44A 4BJ5C 2HSBA 2LK4A 1QSPA 4N6CA 2J46A 2R7QA 1ORSC 2MHRA 1YAUO 3RVYA 4NY3A 5JT4A 4IAOA 4LDRA 5L0DA 2OG2A 2R05A 4JKVA 4CX9A 4EHPA 3EHMA 1OCCC 4U5DE 3M1CB 4AL0A 3IQTA 5BQHA 3UR3C 1GQAA 3H2VA 3DAFA 1K04A 2PBEA 5D91A 4YL1A 1T01A 1A7EA 3I4UA 4JTCB 4MVUA 3W4YA 4QI0A 3DAGA 3M4BA 3ZC4A 3QMKA 2HUJA 4U5BE 2HJ3A 5F28E 1FR0A 3GM2A 2NUTB 3G4XA 4CS7A 3OWTA 5DVWA 3LAYA 4IB4A 3ZTMA 3GM3A 4CJOA 1GS9A 1NBBA 3JCUQ 3SXYA 4B6IA 5L0GA 3ASOC 5L0HA 3EGDB 4AX2A 2OJQA 1G5ZA 3LLIA 1OXBA 5EGYA 2IXOA 1QVXA 5KYXB 5BUOA 3FOOA 3RKOF 2Y3BA 3GWNA 1LM3B 3U5SA 3AQCA 2QTVA 4O7GA 1T5OA 1H9TA 4MVMA 1R5ID 1WN0A 1HE9A 1Q0GA 1AVOB 2XS8A 2F22A 2M4EA 4NTBA 2FGYA 5JVEA 5FCLA 2G62A 3GEEA 2R7OA 3JYHA 3PMRA 2XLOA 3LLKA 3V5ZA 1A0BA 3UNGC 2A6HF 4JURI 3ABLC 4I1OB 4UDVA 3CQZA 3AG1C 4BJ6A 3FDQA 4DRIB 4CS9A 5KYUB 3GEIA 3ITFA 1LE4A 5JRAA 1LS4A 2AU5A 1YVIA 2J9BA 2R7RA 4C7OA 2EIMC 1EQ1A 3UMHA 2KW3C 1JPJA 4KC9A 2GFHA 3US6A 3ZDLA 2XLEA 3QW1A 5KYYB 2G3KA 4MNDA 4E0IA 4YT8A 4JZAA 2GAQA 1NLXA 2EIKC 1YDIA 2XLWA 4MW8A 1B68A 1I4YA 2YL1A 4BEMJ 1Z5ZA 5COGA 2TMVP 1Z23A 3RFYA 2YZSA 3B29A 3V5YA 5KYNA 3K6BA 2A1DD 2XM0A 1XWJA 2LP4A 2VASA 4OD4A 5JP7A 1E84A 3UMKA 5A6BD 5BQGA 5DQTA 4C3DA 2C04A 1M2VB 2YEVA 1O3UA 4GEHA 2FAPB 1YYXA 1U0BB 5COMA 1LS1A 2Y3DA 1IW7F 4U9DA 5A69A 3U2MA 4K0DA 4X0RA 5DS5A 1GM5A 3S27A 3O10A 1LVKA 5K0IA 2J8WA 3N0TA
chains in the Genus database with same CATH topology
1ZZPA 3K7DA 3L8JA 1QVXA 4XEFA 4EBKA 4NQFA 3BRJA 3RQGA 1KNYA 3RQFA 2KK1A 3RQEA 1OW7A 3C8GB 4EBJA 3C8GA 1OW6A 2YWAA 4XEKA 1V4AA 4XEVA 2L6GA 3S9OA 4R32A 1K04A 1UFBA 2PBEA 1KTMA 3GM1A 1PV3A 3AJMA 3U0CA 2Q00A 3U3FA 1WOLA 2L6FA 3MFNA 3L8IA 3TULA 3C8GD 5F28E 1K05A 3C18A 3GM2A 2L6HA 1O3UA 2JX0A 1OW8A 3JZ0A 3B71A 3JYYA 3GM3A 1JOGA 1K40A 2JPUA 1WTYA 1WWPA 2HSBA 2LK4A 3O10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZP A;  3K7D A;  3L8J A;  1QVX A;  4XEF A;  4EBK A;  4NQF A;  3BRJ A;  3RQG A;  1KNY A;  3RQF A;  2KK1 A;  3RQE A;  1OW7 A;  3C8G B;  4EBJ A;  3C8G A;  1OW6 A;  2YWA A;  4XEK A;  1V4A A;  4XEV A;  2L6G A;  3S9O A;  4R32 A;  1K04 A;  1UFB A;  2PBE A;  1KTM A;  3GM1 A;  1PV3 A;  3AJM A;  3U0C A;  2Q00 A;  3U3F A;  1WOL A;  2L6F A;  3MFN A;  3L8I A;  3TUL A;  3C8G D;  5F28 E;  1K05 A;  3C18 A;  3GM2 A;  2L6H A;  1O3U A;  2JX0 A;  1OW8 A;  3JZ0 A;  3B71 A;  3JYY A;  3GM3 A;  1JOG A;  1K40 A;  2JPU A;  1WTY A;  1WWP A;  2HSB A;  2LK4 A;  3O10 A; 
#chains in the Genus database with same CATH topology
 2W4M A;  4PJN A;  5A6J A;  4NTA A;  4D4X A;  3RQG A;  1Q0F A;  1ZHY A;  2Q9B A;  1OW7 A;  1J8Y F;  5B1A C;  1MMN A;  2WVN A;  4LLE A;  1U6H A;  1HMO A;  4PJM A;  4NC3 A;  4YJW A;  3TK0 A;  2CGE A;  2JD3 A;  2YWA A;  2H7B A;  3LEO A;  4FES A;  4HEA J;  2XL6 A;  3U9M A;  2OKU A;  1Z63 A;  2LD6 A;  4KI2 A;  4NCQ A;  1TKN A;  4ER9 A;  5DLJ A;  2AP3 A;  1JAF A;  2L81 A;  2Q00 A;  2ZXR A;  3DM5 A;  3F46 A;  4MTF A;  4Z9I A;  4W8P A;  4MTG A;  3L8I A;  4O6Y A;  4BEJ A;  4DXW A;  2WZL A;  1VTM P;  2J9U A;  2OU6 A;  3LNR A;  1VLT A;  2A69 F;  1K05 A;  1TR2 A;  2I15 A;  2IYL D;  3C8G D;  3M15 A;  5HSW A;  4CSA C;  2BC5 A;  2JX0 A;  3JZ0 A;  4A4A A;  2R7V A;  1AEP A;  4DRJ B;  1Q0D A;  1K40 A;  3KH2 A;  4XLP F;  2H8A A;  1PD1 A;  2EPK X;  4MVR A;  3B0V C;  2QLA A;  3IEE A;  1TFK B;  2DYS C;  4NTF A;  4MVS A;  1FNT c;  1OR3 A;  2MYS A;  3HNJ A;  2KNH A;  1YLM A;  2GA0 A;  4CIP A;  3N2Z B;  3RQF A;  3T9O A;  2AWC A;  2EPM X;  3K1I A;  1EI7 A;  1OQC A;  3LS0 A;  4KBL A;  4LDK A;  1H7I A;  2AVK A;  3E70 C;  4IRU A;  3TOM A;  1YYJ A;  1U89 A;  2ZD9 A;  3DE8 A;  5AC4 A;  1I4Z A;  1AUE A;  4LLC A;  3W8I A;  4BJ1 A;  1CGO A;  2IXN A;  3B0P A;  3PHF 2;  3S28 A;  3BEH A;  3OEO A;  2ZPA A;  3U0C A;  3TJ5 A;  1VMA A;  3KPH A;  1Z3I X;  1ZVZ A;  2A68 F;  5CI8 A;  2PNO A;  1NFO A;  3L34 A;  1JMW A;  5D92 A;  1FTS A;  4C3B A;  1VYI A;  1D1C A;  4GQH A;  3RH3 A;  5JUA A;  3LEV A;  1M56 C;  2YL3 A;  3AG2 C;  3HKK A;  3SZR A;  2LQG A;  4GYT A;  3T6J A;  3AQB A;  1RMV A;  5F5H A;  4C7O B;  3NYJ A;  2XSE A;  4JEA A;  2PFD A;  1D1B A;  1WAS A;  2NSF A;  3HNL A;  5L0J A;  1C03 A;  3AG3 C;  5BQI A;  5AC5 A;  4WAB A;  3EGX A;  4RDA A;  3VM6 A;  1VOM A;  3MLG A;  3LNM B;  3H2U A;  4AK9 A;  1FFT C;  2J0X A;  4C3E A;  4G7O F;  2L9J A;  3DKA A;  4MW3 A;  3RYL A;  4LAC B;  4AL1 A;  4BJT A;  2PP4 A;  5DS4 A;  2CW0 F;  1PV3 A;  3J06 A;  3AJM A;  4JW1 A;  3V5X A;  3O55 A;  4OIQ F;  2V3C C;  1TFO B;  4FAP B;  1ZW3 A;  4PFP A;  3C18 A;  4IAR A;  3K66 A;  2CNW A;  2L6H A;  1ORJ A;  4OD5 A;  2B0H A;  1EA8 A;  3ECS A;  4WJ0 A;  3DJU B;  4CDA A;  3S0X A;  2YL7 A;  1MMG A;  2HFI A;  1W2W A;  3L0I A;  1LI5 A;  3QW0 A;  4KNW A;  3TD7 A;  2RD9 A;  3DMD A;  3I5P A;  4EKW A;  1OKK D;  1QLE C;  4E0H A;  4YT2 A;  4QDL A;  5KYW A;  2R7W A;  2J9W A;  3B9Q A;  1BZ4 A;  1NSG B;  2J45 A;  3ABM C;  4JJF A;  4BJ6 C;  3T6B A;  4CS9 C;  5A6B A;  2O9X A;  3Q7L A;  1ZHX A;  4JIO A;  1KU2 A;  3MBG A;  1HE1 A;  1C02 A;  4JRZ A;  3T6G B;  3U3B A;  3U8P A;  3SEO A;  4BPM A;  3JSE O;  4MVQ A;  3LS1 A;  2LFF A;  3S29 A;  4E17 A;  3NYM A;  1LIH A;  1D0X A;  4JCZ A;  3KYJ A;  2A6E F;  2H7O A;  4P6I C;  4ULW A;  2YVK A;  4YT5 A;  3FAJ A;  4YK5 A;  2IOQ A;  1PCX A;  2EIJ C;  3CEX A;  4I1M A;  5CIV A;  2W9Y A;  5A6K A;  1JOG A;  1SMY F;  4EBB A;  1RKE A;  2XS1 A;  2WL8 A;  4JC7 A;  2WB7 A;  1YAR O;  2HS5 A;  1YA7 O;  4DBR A;  3DI5 A;  1CGM E;  5EHH A;  1YA9 A;  3CAX A;  2E87 A;  1L7C A;  4NQF A;  1KNY A;  2QE9 A;  1M6T A;  1MND A;  2XLD A;  1O5H A;  3VRC A;  3C8G A;  2P1A A;  2CNW D;  1NFN A;  4ANJ A;  2KJG A;  3K1H A;  2Q9A A;  3DJN B;  3ZVR A;  1J8M F;  2OEX A;  2Q7R A;  4G0H A;  3TOL A;  1JRA A;  1SZI A;  2BL2 A;  2YLI A;  3MX3 A;  1QPU A;  4ZLD A;  3NKD A;  1G8X A;  1OXK A;  2AWY A;  3E9V A;  4YN0 B;  3C63 A;  4MQ9 F;  2HSQ A;  3FXH A;  4N4W A;  2QY9 A;  1N1C A;  2Y3H A;  2XLV A;  3JYY A;  3EJN A;  2XL8 A;  1MNE A;  1D1A A;  1M2O A;  1WWP A;  1L3P A;  4IWB A;  3U8V A;  1CPR A;  1SF8 A;  4G7Z F;  1EKY A;  1ZW2 A;  2ZXP A;  1VK5 A;  1LI7 A;  3U2L A;  2Q4F A;  2Q9C A;  2QUP A;  2NUP A;  2R25 A;  2XM4 A;  1LKX A;  1RJ9 A;  3EGX B;  3AGT A;  2P6V A;  3SXM A;  2PX0 A;  3G4Z A;  3Q7G A;  4EIY A;  1LE2 A;  2YHS A;  3TQO A;  3NMK A;  2G3V A;  2KQ9 A;  2P61 A;  4XEK A;  1MMA A;  3LES A;  1NZE A;  2ETS A;  3ZG1 A;  4WGZ A;  1SYQ A;  4R32 A;  5T3W A;  1YZC A;  1ZHT A;  2DI3 A;  2OCC C;  2OQM A;  2VCC A;  1G4W R;  3K1I C;  4D4N A;  2EPN A;  4CDY A;  2YLD A;  3NRH A;  3X2Q C;  3W2W A;  1TQG A;  4IGG A;  4DVZ A;  3GOR A;  1E86 A;  4WGY A;  3VAY A;  3HNI A;  4YL0 A;  3X1O A;  4I3M A;  5EK0 A;  2R7S A;  2HJM A;  1ZU5 A;  2EIN C;  4MVZ A;  3AG4 C;  5KYW B;  3Q6M A;  4HFK B;  3JSZ A;  3NG1 A;  5JLI A;  1TWA A;  3C8Z A;  1ZHW A;  4MVO A;  4KNV A;  3M79 A;  3JT1 A;  2HMQ A;  1V4A A;  1VLS A;  2KYH A;  3S84 A;  1HY5 A;  2L7A A;  4XQ1 A;  3GEH A;  4DBQ A;  1KTM A;  3GM1 A;  5T1D B;  1Y4C A;  2ICW G;  3UGP A;  3EG9 A;  1OKK A;  1WOL A;  2C03 A;  5COF A;  3C7J A;  2R9R B;  2CCY A;  3DD7 A;  3HTK C;  4N06 A;  4U5G A;  5E3C A;  1DOW A;  2VB6 A;  3S90 A;  4MTO A;  1RCP A;  1RKE B;  2EPL X;  1ZHZ A;  2VC9 A;  3WOD F;  5L0F A;  4PJJ A;  4PJL A;  5AGF A;  1HMD A;  3I5Q A;  3DZA A;  1OR2 A;  2J0W A;  3K7D A;  1QQ3 A;  4E7S A;  4CJG A;  4O6N A;  2VCA A;  4G78 A;  2KK1 A;  4RBN A;  2YL0 A;  3C8G B;  1LPE A;  1T6Q A;  3LUT B;  3KL4 A;  2BE5 F;  3AGU A;  4K7B A;  4XPW A;  2CDQ A;  4CSA A;  1OCO C;  5DQZ A;  2PX3 A;  3EZH A;  5JS5 A;  1MQV A;  3QVZ A;  4XEV A;  4JTA B;  3HLZ A;  4P9F A;  4O6M A;  4OIR F;  1DOV A;  1S7Z A;  1SR2 A;  1NU9 C;  3FOP A;  4CBE A;  3ZWI A;  2I8B A;  4EWC A;  1OCZ C;  2DYR C;  2P7V A;  1BR4 A;  2Z15 A;  3O6X A;  4AE4 A;  3B0U X;  1ST6 A;  3QTH A;  3SXK A;  1OW8 A;  3WG7 C;  4M63 A;  2WVO A;  4CS8 A;  2XRH A;  4YL3 A;  2D4U A;  3LJB A;  4IJJ A;  2OJE D;  3NMJ A;  2GWW A;  1H6G A;  4FWV A;  1ZZP A;  4CDV A;  2NUP B;  2WVQ A;  1CPQ A;  1RJ9 B;  3JRT A;  3OA1 A;  4Z9J A;  3SNH A;  2OOC A;  2KSF A;  1OW6 A;  1A7D A;  3VF0 A;  2XXA A;  2R03 A;  1YJG A;  2ZXO A;  3IHU A;  3L1M A;  1RKC A;  4JCH A;  3AOU A;  3DWW A;  4U5H A;  1A41 A;  2ZXW C;  3RVZ A;  4BJ5 A;  4K1O A;  1FMW A;  1OCR C;  2UUI A;  2XL4 A;  3MFN A;  2VCB A;  4JTD B;  2X51 A;  2YLG A;  1H9G A;  2IXP A;  2J9V A;  4Q7C A;  1NG1 A;  1XZQ A;  1UG7 A;  5A6A A;  3QVY A;  1T6U A;  3M4C A;  2NPU A;  4DVY P;  1ZU4 A;  3A11 A;  3RF3 A;  2EIL C;  2H7V C;  2FFH A;  2YQY A;  2Q3T A;  1Y6D A;  4U5F E;  1IZM A;  1G4U S;  2WZG A;  2OEV A;  3W8H A;  4PAC A;  2HZ8 A;  1Z6A A;  3G50 A;  3PCV A;  1T6I A;  2LIG A;  3K33 A;  4IAQ A;  3A9C A;  4PK4 A;  1ORY A;  2XLH A;  1FMV A;  3GWL A;  4XPX A;  4A2N B;  4OIP F;  4JJG A;  3S9O A;  4H4K C;  4JVS A;  4RD9 A;  2X0C A;  2IXM A;  5B1B C;  3EG9 B;  3EZI A;  1NU7 D;  3KMI A;  4JEB A;  4ONS A;  4LDQ A;  3RW0 A;  3W2V A;  2L6F A;  1FFH A;  4XTK A;  1CGN A;  2Y69 C;  3FHD A;  3NYL A;  3DE9 A;  3T4R A;  2QNL A;  3SP1 A;  1WTY A;  3EFO A;  1FAP B;  4J32 B;  1MMD A;  2MWQ A;  1HW2 A;  1S05 A;  2HKV A;  2LCH A;  1TWG A;  2IM8 A;  3FAP B;  4N6H A;  4XEF A;  4W8K A;  2PF4 E;  2WZF A;  3BRJ A;  4XWJ A;  4Z9H A;  5FZT A;  3RQE A;  1JR8 A;  5JSL A;  3ZTZ A;  2ASR A;  1O87 A;  1RXQ A;  5E2Q A;  5E33 A;  256B A;  3NDB B;  3Q6N A;  2UUH A;  5CI9 A;  3TJ6 A;  1A7V A;  1D0Z A;  1QZX A;  4J7T A;  1V54 C;  3ASN C;  3IQC A;  3KYI A;  4XPY A;  1UFB A;  3UMI A;  4OIO F;  1TWH A;  2KC3 A;  2HMZ A;  3FVY A;  3U9J A;  5GPG B;  3U3F A;  4DJ9 A;  1GGQ A;  3CSK A;  2YKZ A;  3POV A;  3JTL O;  5L0C A;  1ZYR F;  2LFD A;  2A0B A;  3O39 A;  3V7O A;  4HFF B;  4AE4 B;  2NUT A;  2DB4 A;  1C17 M;  2J7P A;  2B0J A;  1VB5 A;  3MYI A;  3GAN A;  2A0U A;  3ABK C;  1QKR A;  5E3A A;  3EGD A;  2IBF A;  3DXJ F;  3L8J A;  3NKE A;  4FX5 A;  2VH3 A;  2DGJ A;  4H54 A;  3SYN A;  3ZQY A;  4E18 A;  5KYX A;  1HW1 A;  3R2P A;  1T9K A;  4ZLC A;  3EHN A;  5HV9 A;  3UGO A;  4EBJ A;  1WGW A;  3ZSU A;  1D0Y A;  3KKB A;  4U5E E;  4XLN F;  3VYW A;  4EUK B;  2R7T A;  2XXA B;  1E83 A;  1WAT A;  2W45 A;  1TWC A;  3GOD A;  4ULV A;  4CIH A;  2L6G A;  3HNK A;  4LER A;  3QZC A;  3F47 A;  3ATP A;  2V26 A;  4U9E A;  2Y3G A;  4BG0 A;  2R7U A;  4HE8 D;  5B3I A;  3EPV A;  4QI2 A;  3IQ5 A;  1R4T A;  5T3T A;  3ZIB A;  1Q0M A;  3R7C A;  2R7X A;  5B3S C;  3JRM O;  4J30 B;  3MYF A;  3EH2 A;  1Q0K A;  2R02 A;  2W4B A;  3DM9 B;  3HJC A;  4PR9 A;  2P0N A;  1APC A;  5KYU A;  3SXZ A;  4P9T A;  5L3V A;  5L3Q A;  4J7Y A;  1PD0 A;  4DRH B;  3PDM P;  5IY5 C;  2EPO A;  4YT4 A;  3WHN A;  3C62 A;  2M64 A;  5TJ5 E;  4YWQ A;  1VYK A;  1JPN A;  3FMS A;  4EBK A;  1BR2 A;  3EH1 A;  4U5C E;  1XZP A;  4L6R A;  4CS8 C;  4F4B A;  5KYY A;  1E85 A;  4Q4Z F;  1BDJ B;  3IPM O;  4E7Z A;  2J7P D;  2NSG A;  3RIP A;  5L0I A;  4G7H F;  1YZA A;  4DOZ A;  3WAQ A;  2RSE B;  2Y39 A;  3NMI A;  3EQL F;  2HV7 A;  2NG1 A;  2YRF A;  1Z7Q c;  1I5N A;  1BBH A;  1M57 C;  1BR1 A;  3N24 A;  1V74 B;  2GDC A;  2CYD A;  3TUL A;  3IQ6 A;  3ZQV A;  3H65 A;  4MS2 A;  3CZ6 A;  2D5R B;  2HV6 A;  1E2X A;  1M2V A;  2LSE A;  2XLM A;  1V55 C;  3B71 A;  5DS6 A;  4PFO A;  2JPU A;  3EFO B;  2KGO A;  4OIN F;  4JE9 A;  4Q5S F;  1F1M A;  4O79 A;  5F5F A;  4I44 A;  4BJ5 C;  2HSB A;  2LK4 A;  1QSP A;  4N6C A;  2J46 A;  2R7Q A;  1ORS C;  2MHR A;  1YAU O;  3RVY A;  4NY3 A;  5JT4 A;  4IAO A;  4LDR A;  5L0D A;  2OG2 A;  2R05 A;  4JKV A;  4CX9 A;  4EHP A;  3EHM A;  1OCC C;  4U5D E;  3M1C B;  4AL0 A;  3IQT A;  5BQH A;  3UR3 C;  1GQA A;  3H2V A;  3DAF A;  1K04 A;  2PBE A;  5D91 A;  4YL1 A;  1T01 A;  1A7E A;  3I4U A;  4JTC B;  4MVU A;  3W4Y A;  4QI0 A;  3DAG A;  3M4B A;  3ZC4 A;  3QMK A;  2HUJ A;  4U5B E;  2HJ3 A;  5F28 E;  1FR0 A;  3GM2 A;  2NUT B;  3G4X A;  4CS7 A;  3OWT A;  5DVW A;  3LAY A;  4IB4 A;  3ZTM A;  3GM3 A;  4CJO A;  1GS9 A;  1NBB A;  3JCU Q;  3SXY A;  4B6I A;  5L0G A;  3ASO C;  5L0H A;  3EGD B;  4AX2 A;  2OJQ A;  1G5Z A;  3LLI A;  1OXB A;  5EGY A;  2IXO A;  1QVX A;  5KYX B;  5BUO A;  3FOO A;  3RKO F;  2Y3B A;  3GWN A;  1LM3 B;  3U5S A;  3AQC A;  2QTV A;  4O7G A;  1T5O A;  1H9T A;  4MVM A;  1R5I D;  1WN0 A;  1HE9 A;  1Q0G A;  1AVO B;  2XS8 A;  2F22 A;  2M4E A;  4NTB A;  2FGY A;  5JVE A;  5FCL A;  2G62 A;  3GEE A;  2R7O A;  3JYH A;  3PMR A;  2XLO A;  3LLK A;  3V5Z A;  1A0B A;  3UNG C;  2A6H F;  4JUR I;  3ABL C;  4I1O B;  4UDV A;  3CQZ A;  3AG1 C;  4BJ6 A;  3FDQ A;  4DRI B;  4CS9 A;  5KYU B;  3GEI A;  3ITF A;  1LE4 A;  5JRA A;  1LS4 A;  2AU5 A;  1YVI A;  2J9B A;  2R7R A;  4C7O A;  2EIM C;  1EQ1 A;  3UMH A;  2KW3 C;  1JPJ A;  4KC9 A;  2GFH A;  3US6 A;  3ZDL A;  2XLE A;  3QW1 A;  5KYY B;  2G3K A;  4MND A;  4E0I A;  4YT8 A;  4JZA A;  2GAQ A;  1NLX A;  2EIK C;  1YDI A;  2XLW A;  4MW8 A;  1B68 A;  1I4Y A;  2YL1 A;  4BEM J;  1Z5Z A;  5COG A;  2TMV P;  1Z23 A;  3RFY A;  2YZS A;  3B29 A;  3V5Y A;  5KYN A;  3K6B A;  2A1D D;  2XM0 A;  1XWJ A;  2LP4 A;  2VAS A;  4OD4 A;  5JP7 A;  1E84 A;  3UMK A;  5A6B D;  5BQG A;  5DQT A;  4C3D A;  2C04 A;  1M2V B;  2YEV A;  1O3U A;  4GEH A;  2FAP B;  1YYX A;  1U0B B;  5COM A;  1LS1 A;  2Y3D A;  1IW7 F;  4U9D A;  5A69 A;  3U2M A;  4K0D A;  4X0R A;  5DS5 A;  1GM5 A;  3S27 A;  3O10 A;  1LVK A;  5K0I A;  2J8W A;  3N0T A; 
#chains in the Genus database with same CATH homology
 1ZZP A;  3K7D A;  3L8J A;  1QVX A;  4XEF A;  4EBK A;  4NQF A;  3BRJ A;  3RQG A;  1KNY A;  3RQF A;  2KK1 A;  3RQE A;  1OW7 A;  3C8G B;  4EBJ A;  3C8G A;  1OW6 A;  2YWA A;  4XEK A;  1V4A A;  4XEV A;  2L6G A;  3S9O A;  4R32 A;  1K04 A;  1UFB A;  2PBE A;  1KTM A;  3GM1 A;  1PV3 A;  3AJM A;  3U0C A;  2Q00 A;  3U3F A;  1WOL A;  2L6F A;  3MFN A;  3L8I A;  3TUL A;  3C8G D;  5F28 E;  1K05 A;  3C18 A;  3GM2 A;  2L6H A;  1O3U A;  2JX0 A;  1OW8 A;  3JZ0 A;  3B71 A;  3JYY A;  3GM3 A;  1JOG A;  1K40 A;  2JPU A;  1WTY A;  1WWP A;  2HSB A;  2LK4 A;  3O10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...