4R32A

Crystal structure analysis of pyk2 and paxillin ld motifs
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
132
structure length
132
Chain Sequence
LDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
total genus 55
structure length 132
sequence length 132
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4r32A00
4EBKA 2LK4A 3GM1A 4R32A 3C8GB 2JX0A 1K40A 2PBEA 3TULA 1O3UA 3U0CA 2YWAA 3AJMA 3S9OA 1KTMA 3GM2A 3K7DA 3MFNA 3RQEA 1UFBA 3U3FA 1V4AA 1OW8A 1ZZPA 2HSBA 1WOLA 3JZ0A 3RQFA 4XEKA 2L6GA 3RQGA 1WWPA 4XEVA 1K04A 3JYYA 4XEFA 1OW7A 4NQFA 3GM3A 2KK1A 1WTYA 3BRJA 3L8JA 2Q00A 3C8GD 1QVXA 1JOGA 2L6HA 1K05A 1KNYA 1OW6A 5F28E 3C8GA 3B71A 2JPUA 2L6FA 3O10A 4EBJA 3L8IA 1PV3A 3C18A
chains in the Genus database with same CATH superfamily
3U2LA 2BE5F 1JPNA 2KYHA 2XLWA 1AEPA 1LE2A 3HLZA 3Q7LA 4N6CA 4NC3A 4R32A 3JTLO 1O3UA 4BJ6C 2KJGA 2PP4A 2WVQA 3GEHA 4I1OB 2LSEA 2ZXPA 3LEOA 3I5QA 2OJED 2QY9A 3WAQA 2ZD9A 2R7QA 2EIKC 1D1AA 1LS1A 2FGYA 3GEIA 1RKEB 3RQFA 2EIMC 2MYSA 1EI7A 2J0WA 3ABMC 3C7JA 3MYFA 1ZU5A 3T6JA 4EHPA 4G78A 1OW7A 2AP3A 3IHUA 1HMDA 4NQFA 4OIPF 1Z5ZA 5L0FA 2VCBA 1K05A 2YEVA 1H7IA 5JS5A 256BA 2AWCA 2NUTA 2EINC 3EZHA 4YK5A 5KYYA 2OKUA 1OCZC 2R7UA 1NFOA 2YLGA 2IBFA 4NTFA 3EGXB 4MNDA 1MNDA 2XLEA 4I1MA 4W8PA 1A41A 3K33A 3S90A 2HMQA 1TWHA 4U5EE 3X1OA 4DRIB 1VMAA 1YZCA 4RD9A 2HZ8A 4U5GA 3ABLC 3Q7GA 5BQHA 1ZZPA 4BJ5A 1CGNA 4KI2A 5AC4A 5A6BD 5JLIA 4MVSA 3S0XA 2HS5A 3QMKA 2L81A 4KBLA 3VM6A 4IARA 1FMWA 1IW7F 4Q4ZF 4JEAA 3HNJA 1HY5A 2HUJA 4D4NA 2LFFA 1M57C 2YLDA 3U3BA 4JTDB 1LIHA 1QQ3A 2HV7A 3ATPA 3QVYA 5L0HA 2UUHA 2OU6A 1KU2A 3C18A 2YRFA 2MWQA 3EHNA 2HSQA 3JSEO 3B0UX 4KC9A 3G4ZA 3C8GB 1N1CA 3LAYA 2I8BA 4IGGA 4NCQA 1FR0A 1HW1A 3JT1A 2OCCC 2OEVA 1EKYA 3AJMA 4BJ1A 2RD9A 4X0RA 3DD7A 2PFDA 1PD1A 2C04A 1NZEA 1Y6DA 2EIJC 5F5FA 4P9FA 3FOOA 3LS1A 2YZSA 2HKVA 3OA1A 3DM5A 4NY3A 4XPXA 2PX0A 1RXQA 3AGUA 2G3KA 3ITFA 4JEBA 1Z3IX 4ANJA 5CIVA 5CI9A 4NTAA 1E84A 4CIHA 4BJ5C 2A1DD 2F22A 2VC9A 2YL1A 2J45A 3LNRA 2VCCA 2M64A 2D5RB 1T6UA 3UMHA 3O39A 1C17M 1DOWA 1LI7A 4W8KA 2NG1A 3CAXA 1NU7D 3TULA 5AC5A 3U0CA 1WASA 1YJGA 4XPYA 1TWCA 2VB6A 2WZFA 4YT2A 3EZIA 2ICWG 2HSBA 3AOUA 1WOLA 3E70C 4BJTA 3U2MA 3IPMO 2KQ9A 4PR9A 4U5DE 3HNLA 1LI5A 2Y3BA 3X2QC 1M56C 3GM3A 5KYUB 1LPEA 1WTYA 3BRJA 4YT8A 1VTMP 3PCVA 4RBNA 5L0DA 4ONSA 2L6HA 1MMAA 4J30B 4CDYA 4YWQA 2W45A 3RFYA 3IQCA 2YL7A 2Y39A 3EGDA 1Z63A 5EHHA 4MW3A 3R7CA 1WN0A 3H2UA 2ZXWC 4JJGA 3DWWA 4LDRA 2CNWD 4RDAA 3RVZA 1YA7O 2ZXRA 4EBKA 5JUAA 3Q6MA 4QDLA 3QZCA 3SZRA 4WABA 2NUPB 2KC3A 3IQ6A 4XQ1A 4CS8C 4ER9A 4IJJA 4OIQF 3NYMA 4IRUA 1E86A 1J8MF 3GM2A 1HE1A 5L3VA 4HEAJ 3CEXA 4GYTA 3KH2A 1TWGA 4CBEA 2VH3A 1DOVA 1ZHZA 1I4ZA 2XRHA 1RKEA 3N24A 1M2VB 1H9GA 3ZIBA 2FFHA 1D0XA 1QLEC 2IOQA 4LERA 3OEOA 4PFOA 5BUOA 5E3CA 3Q6NA 4P6IC 4CJOA 1I5NA 1QVXA 3EH2A 4LDQA 1JOGA 1OW6A 4FESA 2QLAA 2DYSC 3KYJA 4KNWA 1NLXA 2JPUA 1T6QA 4JRZA 5KYWB 2LFDA 2NUTB 4OD4A 2AU5A 1VK5A 3ZQVA 4LACB 3C63A 4BJ6A 1Z6AA 3ABKC 3A9CA 2GAQA 2LP4A 4XPWA 2R7WA 1A0BA 3HNIA 2PNOA 3SYNA 5DS5A 1TKNA 4U5FE 3AG1C 4FWVA 4JVSA 1D0ZA 5BQIA 1BZ4A 2W4BA 4DRHB 1VOMA 4ULVA 3EJNA 4IB4A 3DKAA 4PJLA 3UMIA 4DVYP 3DI5A 2R7TA 2VCAA 3IEEA 3JZ0A 3N0TA 2J7PA 4MQ9F 3U8VA 1K04A 5E3AA 3RKOF 3GWLA 2J9UA 2IM8A 1YVIA 2R02A 3RYLA 1OCCC 2L9JA 1PCXA 1OXKA 5T3TA 5A6BA 2R7VA 2I15A 1H9TA 1FFHA 2YVKA 3S84A 1MMNA 4CS7A 1CPQA 1OKKA 2KW3C 3JYHA 5FCLA 1Q0DA 1S05A 3UMKA 5L0CA 2A0BA 2L6FA 3K1IC 3O10A 3QW1A 1HE9A 3U3FA 4MVQA 1SR2A 4C3DA 4E7ZA 1ZYRF 2KNHA 3LUTB 3MX3A 5JRAA 1ZW3A 2QTVA 5A6KA 2XXAA 4OINF 4OIRF 2P7VA 5FZTA 3WODF 1TFOB 4J7TA 1GM5A 4GEHA 2RSEB 2V26A 3GODA 2Q9AA 4WGZA 3RQEA 1HW2A 1VB5A 2LCHA 2GWWA 2Y3GA 3LNMB 3KYIA 1CPRA 1XZPA 3OWTA 4ZLDA 5L0IA 4Z9JA 5JVEA 5E33A 1XWJA 4WGYA 3KKBA 1C03A 3K6BA 2YQYA 3HTKC 5F28E 3C8GA 1JRAA 3DXJF 1I4YA 5DLJA 2FAPB 3TQOA 4CJGA 1PD0A 1TWAA 2Z15A 1D1BA 1BR1A 1SF8A 5GPGB 3UR3C 4Q5SF 1QSPA 1GGQA 3ZSUA 5A6AA 3EGDB 2XLHA 2XM4A 3DMDA 2EPNA 4YT4A 1SZIA 3DAFA 1RKCA 2YLIA 3TJ6A 2WZGA 1T5OA 1ZHXA 2WL8A 1GS9A 2J7PD 3K1IA 2P6VA 4JTCB 3ASOC 1O87A 2P0NA 4EIYA 2DI3A 2BL2A 1W2WA 2L6GA 4XEKA 1WGWA 4LLCA 3ZWIA 1Q0FA 3A11A 4UDVA 2Y3HA 1LS4A 2R25A 3M4BA 2XL8A 1OKKD 2CW0F 4DBRA 2TMVP 1VLSA 1ZHTA 2WZLA 3AQCA 3VAYA 5DQTA 4O6MA 2OEXA 2R03A 1D0YA 4ZLCA 2R7RA 3SP1A 1PV3A 5DS4A 2NSGA 3RH3A 3DJNB 1RCPA 3DM9B 3KL4A 3ZTZA 2R9RB 3NKDA 3POVA 2B0HA 1K40A 2GA0A 1LKXA 2A68F 4BPMA 5DQZA 3S9OA 2YKZA 1E85A 1J8YF 2XXAB 4PJMA 2H8AA 4Z9IA 3S27A 2V3CC 1UFBA 5JSLA 1G8XA 2CGEA 3RW0A 4J32B 1B68A 3GORA 1L3PA 1JMWA 3L0IA 1ORSC 5T3WA 1MNEA 1F1MA 1V55C 4JC7A 4I44A 2XL4A 3SXMA 3V5ZA 3QVZA 3J06A 1YA9A 2PX3A 4O6NA 3ZVRA 4N6HA 1APCA 1OR3A 2G62A 1G4WR 3B71A 4CS9A 4CSAA 4D4XA 4PJJA 2E87A 1G5ZA 4EBJA 2D4UA 1EA8A 2Y3DA 4YT5A 4GQHA 4Z9HA 3WHNA 2J9VA 3NMIA 4I3MA 4CS9C 3IQ5A 3WG7C 1E83A 2LIGA 4HFFB 4U5CE 4MTOA 2NPUA 2XLDA 3LLIA 2NSFA 3AG4C 3FAJA 4Q7CA 5L3QA 2AVKA 2LQGA 4MVRA 5D92A 4XLNF 3K7DA 5B1AC 3ZC4A 4JURI 3FXHA 1YLMA 1LE4A 3ECSA 3M79A 4JE9A 2NUPA 3SEOA 2H7BA 2IXPA 4EBBA 4CDAA 5BQGA 5KYNA 3T6BA 4XLPF 2R7OA 1M2VA 2A69F 4JCHA 1G4US 2J46A 2B0JA 1T6IA 2WVNA 2Y69C 2X51A 3C62A 5K0IA 3DZAA 1NG1A 1Q0GA 2A0UA 1OCRC 1RMVA 3G50A 3V5XA 1NBBA 4EWCA 4WJ0A 4K1OA 3EG9A 3QW0A 4MTFA 1GQAA 4BG0A 1MMDA 4L6RA 3MLGA 3JRTA 3SXZA 3EHMA 3GEEA 5JP7A 1L7CA 2OQMA 4YL0A 2P1AA 3ZG1A 3B0VC 2HFIA 4MS2A 1ZU4A 1OCOC 3AG2C 4MVOA 4AL0A 3U8PA 3NMKA 4CX9A 3LLKA 2Q3TA 3NMJA 5TJ5E 1QKRA 2IXMA 3AQBA 1OW8A 4DOZA 5B1BC 3JCUQ 5DS6A 5IY5C 4CS8A 1EQ1A 3B29A 1AVOB 1YDIA 2BC5A 3FHDA 4OD5A 3ZDLA 2R7XA 3TD7A 1BDJB 2G3VA 4O6YA 4C3BA 3GWNA 3HKKA 2YL3A 5B3IA 2EPLX 2KK1A 3HNKA 3NYJA 2Q00A 1NSGB 1KNYA 1AUEA 3EFOA 2P61A 4O79A 3UGPA 1LM3B 1SMYF 2DYRC 3G4XA 3L8IA 3GANA 1FTSA 3EPVA 3KMIA 2YL0A 1O5HA 2A6HF 2XS8A 4JW1A 3RIPA 2IXNA 5L0GA 5KYXA 2HMZA 1T9KA 1H6GA 3R2PA 4H4KC 1VLTA 3TOMA 2R7SA 1CGOA 4O7GA 4LDKA 4CDVA 3IQTA 1YYJA 3U9MA 3CZ6A 4DVZA 1WWPA 1NFNA 2LD6A 4KNVA 2QE9A 3H2VA 5A6JA 1ZHWA 4N06A 4BEJA 4LLEA 4G7ZF 3HJCA 2L7AA 1JR8A 4PK4A 4C7OB 3L8JA 3M1CB 2Q9BA 3ZQYA 4JKVA 2W4MA 4PFPA 3QTHA 1V54C 4G7OF 3K66A 3N2ZB 4P9TA 4AX2A 2GFHA 3O55A 2XLVA 1U89A 4C3EA 4OIOF 2XLOA 2YHSA 1BR4A 2IXOA 1ZHYA 3I4UA 3MBGA 5DVWA 5KYXB 3FDQA 1U6HA 2CNWA 3CQZA 1Q0KA 4YL3A 2H7OA 3L34A 4K0DA 2DB4A 1ZW2A 2HV6A 2Q9CA 1YAUO 1R5ID 2W9YA 3LS0A 4N4WA 4NTBA 3JRMO 2CDQA 3M4CA 3T6GB 3TJ5A 1VYKA 4PACA 4JJFA 4U9EA 4YJWA 2PF4E 4M63A 4ULWA 5A69A 1S7ZA 4U5BE 5JT4A 4EKWA 1MMGA 3FOPA 1C02A 1ORJA 4FX5A 1UG7A 3B0PA 4PJNA 4XEVA 2IYLD 5T1DB 4B6IA 3JYYA 4F4BA 2QUPA 4XWJA 2XL6A 3SNHA 2OG2A 4E18A 3AGTA 1A7VA 2XLMA 4MTGA 4AE4B 2MHRA 3I5PA 4JZAA 4E0IA 3SXKA 3US6A 3UGOA 1FAPB 3DAGA 4JIOA 2QNLA 2YWAA 1V74B 2EPMX 5KYYB 3B9QA 5E2QA 2ZXOA 3H65A 1D1CA 2XSEA 1XZQA 5KYWA 4E17A 1HMOA 2JX0A 1YARO 4XTKA 2AWYA 3FMSA 1VYIA 3MFNA 3LJBA 2X0CA 1FNTc 2HJ3A 3M15A 5D91A 1IZMA 4H54A 4U5HA 4YN0B 3RVYA 3RQGA 3SXYA 4A2NB 4DRJB 3KPHA 3O6XA 3PMRA 2GDCA 4MVUA 5HV9A 2H7VC 3JSZA 2C03A 4A4AA 1ZVZA 3AG3C 3W8HA 4AE4A 1Q0MA 3S29A 3K1HA 3DE9A 3W2VA 3E9VA 1ORYA 2Q7RA 2A6EF 2WVOA 1OR2A 2VASA 1MQVA 4MVMA 5CI8A 4U9DA 2WB7A 1R4TA 4K7BA 3V7OA 5HSWA 4G7HF 2LK4A 4E7SA 2J8WA 2EPKX 3EFOB 4IWBA 1U0BB 3EH1A 4HFKB 3W4YA 5AGFA 1RJ9A 3PHF2 1A7EA 3LESA 1TR2A 2KGOA 3W2WA 2J9WA 3DE8A 3NYLA 1RJ9B 5KYUA 3VRCA 1V4AA 3TK0A 3EGXA 3U5SA 1BBHA 1YZAA 4AL1A 5L0JA 4C7OA 2KSFA 1FFTC 1TQGA 3FVYA 4J7YA 1E2XA 1T01A 3T9OA 4BEMJ 4XEFA 1Y4CA 1OQCA 2O9XA 3DJUB 3CSKA 1A7DA 4JCZA 5COMA 5COGA 4DXWA 4CIPA 1CGME 1BR2A 2OJQA 3VYWA 2EPOA 3C8GD 4JTAB 1OXBA 1JAFA 3ASNC 3NDBB 2ETSA 1QPUA 1JPJA 2UUIA 3NRHA 5COFA 5F5HA 3TOLA 4EUKB 3EG9B 3ZTMA 3GM1A 2HJMA 3BEHA 2DGJA 3NG1A 4IAOA 3F46A 2PBEA 4CSAC 1QZXA 4G0HA 4FAPB 4QI0A 2XS1A 2EILC 2M4EA 1KTMA 2Q4FA 3FAPB 2XM0A 2OOCA 3F47A 3C8ZA 4HE8D 3U9JA 1Z7Qc 1YYXA 3PDMP 3LEVA 3NKEA 1WATA 4MW8A 1SYQA 2JD3A 4E0HA 3EQLF 1M2OA 3L1MA 2ZPAA 3RF3A 4DBQA 2CYDA 3MYIA 5EGYA 4DJ9A 3VF0A 3W8IA 4IAQA 2R05A 2J9BA 1ST6A 5EK0A 3S28A 4QI2A 1TFKB 1NU9C 2J0XA 1LVKA 2ASRA 4YL1A 5B3SC 1FMVA 1M6TA 4MVZA 3UNGC 3V5YA 3T4RA 2CCYA 1Z23A 4AK9A
chains in the Genus database with same CATH topology
4EBKA 2LK4A 3GM1A 4R32A 3C8GB 2JX0A 1K40A 2PBEA 3TULA 1O3UA 3U0CA 2YWAA 3AJMA 3S9OA 1KTMA 3GM2A 3K7DA 3MFNA 3RQEA 1UFBA 3U3FA 1V4AA 1OW8A 1ZZPA 2HSBA 1WOLA 3JZ0A 3RQFA 4XEKA 2L6GA 3RQGA 1WWPA 4XEVA 1K04A 3JYYA 4XEFA 1OW7A 4NQFA 3GM3A 2KK1A 1WTYA 3BRJA 3L8JA 2Q00A 3C8GD 1QVXA 1JOGA 2L6HA 1K05A 1KNYA 1OW6A 5F28E 3C8GA 3B71A 2JPUA 2L6FA 3O10A 4EBJA 3L8IA 1PV3A 3C18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBK A;  2LK4 A;  3GM1 A;  4R32 A;  3C8G B;  2JX0 A;  1K40 A;  2PBE A;  3TUL A;  1O3U A;  3U0C A;  2YWA A;  3AJM A;  3S9O A;  1KTM A;  3GM2 A;  3K7D A;  3MFN A;  3RQE A;  1UFB A;  3U3F A;  1V4A A;  1OW8 A;  1ZZP A;  2HSB A;  1WOL A;  3JZ0 A;  3RQF A;  4XEK A;  2L6G A;  3RQG A;  1WWP A;  4XEV A;  1K04 A;  3JYY A;  4XEF A;  1OW7 A;  4NQF A;  3GM3 A;  2KK1 A;  1WTY A;  3BRJ A;  3L8J A;  2Q00 A;  3C8G D;  1QVX A;  1JOG A;  2L6H A;  1K05 A;  1KNY A;  1OW6 A;  5F28 E;  3C8G A;  3B71 A;  2JPU A;  2L6F A;  3O10 A;  4EBJ A;  3L8I A;  1PV3 A;  3C18 A; 
#chains in the Genus database with same CATH topology
 3U2L A;  2BE5 F;  1JPN A;  2KYH A;  2XLW A;  1AEP A;  1LE2 A;  3HLZ A;  3Q7L A;  4N6C A;  4NC3 A;  4R32 A;  3JTL O;  1O3U A;  4BJ6 C;  2KJG A;  2PP4 A;  2WVQ A;  3GEH A;  4I1O B;  2LSE A;  2ZXP A;  3LEO A;  3I5Q A;  2OJE D;  2QY9 A;  3WAQ A;  2ZD9 A;  2R7Q A;  2EIK C;  1D1A A;  1LS1 A;  2FGY A;  3GEI A;  1RKE B;  3RQF A;  2EIM C;  2MYS A;  1EI7 A;  2J0W A;  3ABM C;  3C7J A;  3MYF A;  1ZU5 A;  3T6J A;  4EHP A;  4G78 A;  1OW7 A;  2AP3 A;  3IHU A;  1HMD A;  4NQF A;  4OIP F;  1Z5Z A;  5L0F A;  2VCB A;  1K05 A;  2YEV A;  1H7I A;  5JS5 A;  256B A;  2AWC A;  2NUT A;  2EIN C;  3EZH A;  4YK5 A;  5KYY A;  2OKU A;  1OCZ C;  2R7U A;  1NFO A;  2YLG A;  2IBF A;  4NTF A;  3EGX B;  4MND A;  1MND A;  2XLE A;  4I1M A;  4W8P A;  1A41 A;  3K33 A;  3S90 A;  2HMQ A;  1TWH A;  4U5E E;  3X1O A;  4DRI B;  1VMA A;  1YZC A;  4RD9 A;  2HZ8 A;  4U5G A;  3ABL C;  3Q7G A;  5BQH A;  1ZZP A;  4BJ5 A;  1CGN A;  4KI2 A;  5AC4 A;  5A6B D;  5JLI A;  4MVS A;  3S0X A;  2HS5 A;  3QMK A;  2L81 A;  4KBL A;  3VM6 A;  4IAR A;  1FMW A;  1IW7 F;  4Q4Z F;  4JEA A;  3HNJ A;  1HY5 A;  2HUJ A;  4D4N A;  2LFF A;  1M57 C;  2YLD A;  3U3B A;  4JTD B;  1LIH A;  1QQ3 A;  2HV7 A;  3ATP A;  3QVY A;  5L0H A;  2UUH A;  2OU6 A;  1KU2 A;  3C18 A;  2YRF A;  2MWQ A;  3EHN A;  2HSQ A;  3JSE O;  3B0U X;  4KC9 A;  3G4Z A;  3C8G B;  1N1C A;  3LAY A;  2I8B A;  4IGG A;  4NCQ A;  1FR0 A;  1HW1 A;  3JT1 A;  2OCC C;  2OEV A;  1EKY A;  3AJM A;  4BJ1 A;  2RD9 A;  4X0R A;  3DD7 A;  2PFD A;  1PD1 A;  2C04 A;  1NZE A;  1Y6D A;  2EIJ C;  5F5F A;  4P9F A;  3FOO A;  3LS1 A;  2YZS A;  2HKV A;  3OA1 A;  3DM5 A;  4NY3 A;  4XPX A;  2PX0 A;  1RXQ A;  3AGU A;  2G3K A;  3ITF A;  4JEB A;  1Z3I X;  4ANJ A;  5CIV A;  5CI9 A;  4NTA A;  1E84 A;  4CIH A;  4BJ5 C;  2A1D D;  2F22 A;  2VC9 A;  2YL1 A;  2J45 A;  3LNR A;  2VCC A;  2M64 A;  2D5R B;  1T6U A;  3UMH A;  3O39 A;  1C17 M;  1DOW A;  1LI7 A;  4W8K A;  2NG1 A;  3CAX A;  1NU7 D;  3TUL A;  5AC5 A;  3U0C A;  1WAS A;  1YJG A;  4XPY A;  1TWC A;  2VB6 A;  2WZF A;  4YT2 A;  3EZI A;  2ICW G;  2HSB A;  3AOU A;  1WOL A;  3E70 C;  4BJT A;  3U2M A;  3IPM O;  2KQ9 A;  4PR9 A;  4U5D E;  3HNL A;  1LI5 A;  2Y3B A;  3X2Q C;  1M56 C;  3GM3 A;  5KYU B;  1LPE A;  1WTY A;  3BRJ A;  4YT8 A;  1VTM P;  3PCV A;  4RBN A;  5L0D A;  4ONS A;  2L6H A;  1MMA A;  4J30 B;  4CDY A;  4YWQ A;  2W45 A;  3RFY A;  3IQC A;  2YL7 A;  2Y39 A;  3EGD A;  1Z63 A;  5EHH A;  4MW3 A;  3R7C A;  1WN0 A;  3H2U A;  2ZXW C;  4JJG A;  3DWW A;  4LDR A;  2CNW D;  4RDA A;  3RVZ A;  1YA7 O;  2ZXR A;  4EBK A;  5JUA A;  3Q6M A;  4QDL A;  3QZC A;  3SZR A;  4WAB A;  2NUP B;  2KC3 A;  3IQ6 A;  4XQ1 A;  4CS8 C;  4ER9 A;  4IJJ A;  4OIQ F;  3NYM A;  4IRU A;  1E86 A;  1J8M F;  3GM2 A;  1HE1 A;  5L3V A;  4HEA J;  3CEX A;  4GYT A;  3KH2 A;  1TWG A;  4CBE A;  2VH3 A;  1DOV A;  1ZHZ A;  1I4Z A;  2XRH A;  1RKE A;  3N24 A;  1M2V B;  1H9G A;  3ZIB A;  2FFH A;  1D0X A;  1QLE C;  2IOQ A;  4LER A;  3OEO A;  4PFO A;  5BUO A;  5E3C A;  3Q6N A;  4P6I C;  4CJO A;  1I5N A;  1QVX A;  3EH2 A;  4LDQ A;  1JOG A;  1OW6 A;  4FES A;  2QLA A;  2DYS C;  3KYJ A;  4KNW A;  1NLX A;  2JPU A;  1T6Q A;  4JRZ A;  5KYW B;  2LFD A;  2NUT B;  4OD4 A;  2AU5 A;  1VK5 A;  3ZQV A;  4LAC B;  3C63 A;  4BJ6 A;  1Z6A A;  3ABK C;  3A9C A;  2GAQ A;  2LP4 A;  4XPW A;  2R7W A;  1A0B A;  3HNI A;  2PNO A;  3SYN A;  5DS5 A;  1TKN A;  4U5F E;  3AG1 C;  4FWV A;  4JVS A;  1D0Z A;  5BQI A;  1BZ4 A;  2W4B A;  4DRH B;  1VOM A;  4ULV A;  3EJN A;  4IB4 A;  3DKA A;  4PJL A;  3UMI A;  4DVY P;  3DI5 A;  2R7T A;  2VCA A;  3IEE A;  3JZ0 A;  3N0T A;  2J7P A;  4MQ9 F;  3U8V A;  1K04 A;  5E3A A;  3RKO F;  3GWL A;  2J9U A;  2IM8 A;  1YVI A;  2R02 A;  3RYL A;  1OCC C;  2L9J A;  1PCX A;  1OXK A;  5T3T A;  5A6B A;  2R7V A;  2I15 A;  1H9T A;  1FFH A;  2YVK A;  3S84 A;  1MMN A;  4CS7 A;  1CPQ A;  1OKK A;  2KW3 C;  3JYH A;  5FCL A;  1Q0D A;  1S05 A;  3UMK A;  5L0C A;  2A0B A;  2L6F A;  3K1I C;  3O10 A;  3QW1 A;  1HE9 A;  3U3F A;  4MVQ A;  1SR2 A;  4C3D A;  4E7Z A;  1ZYR F;  2KNH A;  3LUT B;  3MX3 A;  5JRA A;  1ZW3 A;  2QTV A;  5A6K A;  2XXA A;  4OIN F;  4OIR F;  2P7V A;  5FZT A;  3WOD F;  1TFO B;  4J7T A;  1GM5 A;  4GEH A;  2RSE B;  2V26 A;  3GOD A;  2Q9A A;  4WGZ A;  3RQE A;  1HW2 A;  1VB5 A;  2LCH A;  2GWW A;  2Y3G A;  3LNM B;  3KYI A;  1CPR A;  1XZP A;  3OWT A;  4ZLD A;  5L0I A;  4Z9J A;  5JVE A;  5E33 A;  1XWJ A;  4WGY A;  3KKB A;  1C03 A;  3K6B A;  2YQY A;  3HTK C;  5F28 E;  3C8G A;  1JRA A;  3DXJ F;  1I4Y A;  5DLJ A;  2FAP B;  3TQO A;  4CJG A;  1PD0 A;  1TWA A;  2Z15 A;  1D1B A;  1BR1 A;  1SF8 A;  5GPG B;  3UR3 C;  4Q5S F;  1QSP A;  1GGQ A;  3ZSU A;  5A6A A;  3EGD B;  2XLH A;  2XM4 A;  3DMD A;  2EPN A;  4YT4 A;  1SZI A;  3DAF A;  1RKC A;  2YLI A;  3TJ6 A;  2WZG A;  1T5O A;  1ZHX A;  2WL8 A;  1GS9 A;  2J7P D;  3K1I A;  2P6V A;  4JTC B;  3ASO C;  1O87 A;  2P0N A;  4EIY A;  2DI3 A;  2BL2 A;  1W2W A;  2L6G A;  4XEK A;  1WGW A;  4LLC A;  3ZWI A;  1Q0F A;  3A11 A;  4UDV A;  2Y3H A;  1LS4 A;  2R25 A;  3M4B A;  2XL8 A;  1OKK D;  2CW0 F;  4DBR A;  2TMV P;  1VLS A;  1ZHT A;  2WZL A;  3AQC A;  3VAY A;  5DQT A;  4O6M A;  2OEX A;  2R03 A;  1D0Y A;  4ZLC A;  2R7R A;  3SP1 A;  1PV3 A;  5DS4 A;  2NSG A;  3RH3 A;  3DJN B;  1RCP A;  3DM9 B;  3KL4 A;  3ZTZ A;  2R9R B;  3NKD A;  3POV A;  2B0H A;  1K40 A;  2GA0 A;  1LKX A;  2A68 F;  4BPM A;  5DQZ A;  3S9O A;  2YKZ A;  1E85 A;  1J8Y F;  2XXA B;  4PJM A;  2H8A A;  4Z9I A;  3S27 A;  2V3C C;  1UFB A;  5JSL A;  1G8X A;  2CGE A;  3RW0 A;  4J32 B;  1B68 A;  3GOR A;  1L3P A;  1JMW A;  3L0I A;  1ORS C;  5T3W A;  1MNE A;  1F1M A;  1V55 C;  4JC7 A;  4I44 A;  2XL4 A;  3SXM A;  3V5Z A;  3QVZ A;  3J06 A;  1YA9 A;  2PX3 A;  4O6N A;  3ZVR A;  4N6H A;  1APC A;  1OR3 A;  2G62 A;  1G4W R;  3B71 A;  4CS9 A;  4CSA A;  4D4X A;  4PJJ A;  2E87 A;  1G5Z A;  4EBJ A;  2D4U A;  1EA8 A;  2Y3D A;  4YT5 A;  4GQH A;  4Z9H A;  3WHN A;  2J9V A;  3NMI A;  4I3M A;  4CS9 C;  3IQ5 A;  3WG7 C;  1E83 A;  2LIG A;  4HFF B;  4U5C E;  4MTO A;  2NPU A;  2XLD A;  3LLI A;  2NSF A;  3AG4 C;  3FAJ A;  4Q7C A;  5L3Q A;  2AVK A;  2LQG A;  4MVR A;  5D92 A;  4XLN F;  3K7D A;  5B1A C;  3ZC4 A;  4JUR I;  3FXH A;  1YLM A;  1LE4 A;  3ECS A;  3M79 A;  4JE9 A;  2NUP A;  3SEO A;  2H7B A;  2IXP A;  4EBB A;  4CDA A;  5BQG A;  5KYN A;  3T6B A;  4XLP F;  2R7O A;  1M2V A;  2A69 F;  4JCH A;  1G4U S;  2J46 A;  2B0J A;  1T6I A;  2WVN A;  2Y69 C;  2X51 A;  3C62 A;  5K0I A;  3DZA A;  1NG1 A;  1Q0G A;  2A0U A;  1OCR C;  1RMV A;  3G50 A;  3V5X A;  1NBB A;  4EWC A;  4WJ0 A;  4K1O A;  3EG9 A;  3QW0 A;  4MTF A;  1GQA A;  4BG0 A;  1MMD A;  4L6R A;  3MLG A;  3JRT A;  3SXZ A;  3EHM A;  3GEE A;  5JP7 A;  1L7C A;  2OQM A;  4YL0 A;  2P1A A;  3ZG1 A;  3B0V C;  2HFI A;  4MS2 A;  1ZU4 A;  1OCO C;  3AG2 C;  4MVO A;  4AL0 A;  3U8P A;  3NMK A;  4CX9 A;  3LLK A;  2Q3T A;  3NMJ A;  5TJ5 E;  1QKR A;  2IXM A;  3AQB A;  1OW8 A;  4DOZ A;  5B1B C;  3JCU Q;  5DS6 A;  5IY5 C;  4CS8 A;  1EQ1 A;  3B29 A;  1AVO B;  1YDI A;  2BC5 A;  3FHD A;  4OD5 A;  3ZDL A;  2R7X A;  3TD7 A;  1BDJ B;  2G3V A;  4O6Y A;  4C3B A;  3GWN A;  3HKK A;  2YL3 A;  5B3I A;  2EPL X;  2KK1 A;  3HNK A;  3NYJ A;  2Q00 A;  1NSG B;  1KNY A;  1AUE A;  3EFO A;  2P61 A;  4O79 A;  3UGP A;  1LM3 B;  1SMY F;  2DYR C;  3G4X A;  3L8I A;  3GAN A;  1FTS A;  3EPV A;  3KMI A;  2YL0 A;  1O5H A;  2A6H F;  2XS8 A;  4JW1 A;  3RIP A;  2IXN A;  5L0G A;  5KYX A;  2HMZ A;  1T9K A;  1H6G A;  3R2P A;  4H4K C;  1VLT A;  3TOM A;  2R7S A;  1CGO A;  4O7G A;  4LDK A;  4CDV A;  3IQT A;  1YYJ A;  3U9M A;  3CZ6 A;  4DVZ A;  1WWP A;  1NFN A;  2LD6 A;  4KNV A;  2QE9 A;  3H2V A;  5A6J A;  1ZHW A;  4N06 A;  4BEJ A;  4LLE A;  4G7Z F;  3HJC A;  2L7A A;  1JR8 A;  4PK4 A;  4C7O B;  3L8J A;  3M1C B;  2Q9B A;  3ZQY A;  4JKV A;  2W4M A;  4PFP A;  3QTH A;  1V54 C;  4G7O F;  3K66 A;  3N2Z B;  4P9T A;  4AX2 A;  2GFH A;  3O55 A;  2XLV A;  1U89 A;  4C3E A;  4OIO F;  2XLO A;  2YHS A;  1BR4 A;  2IXO A;  1ZHY A;  3I4U A;  3MBG A;  5DVW A;  5KYX B;  3FDQ A;  1U6H A;  2CNW A;  3CQZ A;  1Q0K A;  4YL3 A;  2H7O A;  3L34 A;  4K0D A;  2DB4 A;  1ZW2 A;  2HV6 A;  2Q9C A;  1YAU O;  1R5I D;  2W9Y A;  3LS0 A;  4N4W A;  4NTB A;  3JRM O;  2CDQ A;  3M4C A;  3T6G B;  3TJ5 A;  1VYK A;  4PAC A;  4JJF A;  4U9E A;  4YJW A;  2PF4 E;  4M63 A;  4ULW A;  5A69 A;  1S7Z A;  4U5B E;  5JT4 A;  4EKW A;  1MMG A;  3FOP A;  1C02 A;  1ORJ A;  4FX5 A;  1UG7 A;  3B0P A;  4PJN A;  4XEV A;  2IYL D;  5T1D B;  4B6I A;  3JYY A;  4F4B A;  2QUP A;  4XWJ A;  2XL6 A;  3SNH A;  2OG2 A;  4E18 A;  3AGT A;  1A7V A;  2XLM A;  4MTG A;  4AE4 B;  2MHR A;  3I5P A;  4JZA A;  4E0I A;  3SXK A;  3US6 A;  3UGO A;  1FAP B;  3DAG A;  4JIO A;  2QNL A;  2YWA A;  1V74 B;  2EPM X;  5KYY B;  3B9Q A;  5E2Q A;  2ZXO A;  3H65 A;  1D1C A;  2XSE A;  1XZQ A;  5KYW A;  4E17 A;  1HMO A;  2JX0 A;  1YAR O;  4XTK A;  2AWY A;  3FMS A;  1VYI A;  3MFN A;  3LJB A;  2X0C A;  1FNT c;  2HJ3 A;  3M15 A;  5D91 A;  1IZM A;  4H54 A;  4U5H A;  4YN0 B;  3RVY A;  3RQG A;  3SXY A;  4A2N B;  4DRJ B;  3KPH A;  3O6X A;  3PMR A;  2GDC A;  4MVU A;  5HV9 A;  2H7V C;  3JSZ A;  2C03 A;  4A4A A;  1ZVZ A;  3AG3 C;  3W8H A;  4AE4 A;  1Q0M A;  3S29 A;  3K1H A;  3DE9 A;  3W2V A;  3E9V A;  1ORY A;  2Q7R A;  2A6E F;  2WVO A;  1OR2 A;  2VAS A;  1MQV A;  4MVM A;  5CI8 A;  4U9D A;  2WB7 A;  1R4T A;  4K7B A;  3V7O A;  5HSW A;  4G7H F;  2LK4 A;  4E7S A;  2J8W A;  2EPK X;  3EFO B;  4IWB A;  1U0B B;  3EH1 A;  4HFK B;  3W4Y A;  5AGF A;  1RJ9 A;  3PHF 2;  1A7E A;  3LES A;  1TR2 A;  2KGO A;  3W2W A;  2J9W A;  3DE8 A;  3NYL A;  1RJ9 B;  5KYU A;  3VRC A;  1V4A A;  3TK0 A;  3EGX A;  3U5S A;  1BBH A;  1YZA A;  4AL1 A;  5L0J A;  4C7O A;  2KSF A;  1FFT C;  1TQG A;  3FVY A;  4J7Y A;  1E2X A;  1T01 A;  3T9O A;  4BEM J;  4XEF A;  1Y4C A;  1OQC A;  2O9X A;  3DJU B;  3CSK A;  1A7D A;  4JCZ A;  5COM A;  5COG A;  4DXW A;  4CIP A;  1CGM E;  1BR2 A;  2OJQ A;  3VYW A;  2EPO A;  3C8G D;  4JTA B;  1OXB A;  1JAF A;  3ASN C;  3NDB B;  2ETS A;  1QPU A;  1JPJ A;  2UUI A;  3NRH A;  5COF A;  5F5H A;  3TOL A;  4EUK B;  3EG9 B;  3ZTM A;  3GM1 A;  2HJM A;  3BEH A;  2DGJ A;  3NG1 A;  4IAO A;  3F46 A;  2PBE A;  4CSA C;  1QZX A;  4G0H A;  4FAP B;  4QI0 A;  2XS1 A;  2EIL C;  2M4E A;  1KTM A;  2Q4F A;  3FAP B;  2XM0 A;  2OOC A;  3F47 A;  3C8Z A;  4HE8 D;  3U9J A;  1Z7Q c;  1YYX A;  3PDM P;  3LEV A;  3NKE A;  1WAT A;  4MW8 A;  1SYQ A;  2JD3 A;  4E0H A;  3EQL F;  1M2O A;  3L1M A;  2ZPA A;  3RF3 A;  4DBQ A;  2CYD A;  3MYI A;  5EGY A;  4DJ9 A;  3VF0 A;  3W8I A;  4IAQ A;  2R05 A;  2J9B A;  1ST6 A;  5EK0 A;  3S28 A;  4QI2 A;  1TFK B;  1NU9 C;  2J0X A;  1LVK A;  2ASR A;  4YL1 A;  5B3S C;  1FMV A;  1M6T A;  4MVZ A;  3UNG C;  3V5Y A;  3T4R A;  2CCY A;  1Z23 A;  4AK9 A; 
#chains in the Genus database with same CATH homology
 4EBK A;  2LK4 A;  3GM1 A;  4R32 A;  3C8G B;  2JX0 A;  1K40 A;  2PBE A;  3TUL A;  1O3U A;  3U0C A;  2YWA A;  3AJM A;  3S9O A;  1KTM A;  3GM2 A;  3K7D A;  3MFN A;  3RQE A;  1UFB A;  3U3F A;  1V4A A;  1OW8 A;  1ZZP A;  2HSB A;  1WOL A;  3JZ0 A;  3RQF A;  4XEK A;  2L6G A;  3RQG A;  1WWP A;  4XEV A;  1K04 A;  3JYY A;  4XEF A;  1OW7 A;  4NQF A;  3GM3 A;  2KK1 A;  1WTY A;  3BRJ A;  3L8J A;  2Q00 A;  3C8G D;  1QVX A;  1JOG A;  2L6H A;  1K05 A;  1KNY A;  1OW6 A;  5F28 E;  3C8G A;  3B71 A;  2JPU A;  2L6F A;  3O10 A;  4EBJ A;  3L8I A;  1PV3 A;  3C18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...