4R32A

Crystal structure analysis of pyk2 and paxillin ld motifs
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
132
structure length
132
Chain Sequence
LDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
total genus 55
structure length 132
sequence length 132
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4r32A00
3C18A 3JZ0A 4EBJA 2JX0A 3K7DA 1V4AA 5F28E 3L8JA 1WWPA 1UFBA 4R32A 1ZZPA 1OW7A 2Q00A 3C8GB 3TULA 2PBEA 3C8GD 3U0CA 3AJMA 1WOLA 1O3UA 2L6GA 3GM1A 3GM2A 3JYYA 2KK1A 4EBKA 3U3FA 3B71A 1KNYA 2HSBA 1PV3A 1QVXA 1K40A 1JOGA 2LK4A 2YWAA 2L6FA 3RQFA 3L8IA 4XEKA 4NQFA 1KTMA 1OW6A 2JPUA 3BRJA 3RQGA 3RQEA 1K05A 2L6HA 3MFNA 1WTYA 3C8GA 4XEVA 4XEFA 1OW8A 3S9OA 3GM3A 3O10A 1K04A
chains in the Genus database with same CATH superfamily
3F46A 1WATA 1Z3IX 4KBLA 1LPEA 5L0JA 3EZHA 1M56C 4PJMA 3FOPA 4BJ1A 5KYUB 1EKYA 1TFKB 2ICWG 4QI2A 3AQBA 3UGOA 2OQMA 3U0CA 5T3WA 3DE8A 2BL2A 3M15A 1OCOC 2OJQA 2LCHA 1KNYA 2LP4A 1LM3B 4J7YA 4AL0A 5A6BD 5L0HA 1CPRA 3QVZA 2TMVP 1YYXA 3HNIA 3JRMO 3KYJA 4N6CA 4OD5A 2J9UA 3VM6A 5L0GA 5KYNA 1Q0GA 1FR0A 3US6A 4LLEA 3PDMP 3N2ZB 3TQOA 3WG7C 3PCVA 4MVOA 1LI7A 2XL6A 3FHDA 3MBGA 4XPXA 1TWHA 1MQVA 2LD6A 4CJOA 4U5EE 2EPKX 3C8GA 2VCBA 1H9TA 4LDRA 2GWWA 1VLTA 4AK9A 3LAYA 1ZHYA 1OR3A 2A1DD 2IOQA 3Q7LA 3UNGC 3ZSUA 4CDVA 1Q0FA 2OU6A 3SXKA 5KYWA 2QNLA 4CIHA 3ABMC 2Q7RA 1NU7D 3FVYA 2DYSC 2XLOA 2HJ3A 3DAGA 4PK4A 4RDAA 3S29A 2L6GA 1TR2A 2J9VA 5BUOA 2J0WA 4G7ZF 2OKUA 2NG1A 5AC5A 4PFPA 5T3TA 2J0XA 3LEOA 2ZPAA 3CAXA 1APCA 4ZLCA 1FFHA 3FAJA 3OWTA 1MMNA 2CW0F 1FAPB 3U8PA 3ZTZA 4AE4A 4X0RA 1NFNA 4IRUA 3ZDLA 2P6VA 3OEOA 3RQEA 4OIOF 1H9GA 1ZU4A 1JPJA 2NUPB 3MFNA 4I1MA 1RJ9B 1OKKD 2EPMX 2XS1A 3GORA 3IQTA 5KYWB 2J9WA 2G3VA 1QLEC 1OXKA 2PX3A 5DQTA 1UFBA 3E9VA 5TJ5E 4HFFB 2QE9A 1BR2A 2V26A 1RJ9A 2HV7A 4E7SA 3TULA 1QSPA 3H65A 3RFYA 4E18A 1ZU5A 3ASNC 4MW8A 2YZSA 3DKAA 3UMHA 3IQCA 2FGYA 5T1DB 5KYXA 4CSAC 5CI9A 1T6UA 3QMKA 3VF0A 5L3QA 3SXYA 1YA7O 3C63A 4NY3A 1F1MA 1SYQA 3LS1A 1RKEB 3DAFA 3FXHA 4DBRA 1V55C 3RQFA 3HNLA 5L0FA 5FCLA 1EA8A 2D4UA 3EH1A 3U2LA 3ABKC 1RMVA 5CI8A 2YL1A 3ZIBA 4C3DA 2C04A 4HEAJ 1JRAA 2XRHA 2XS8A 3HLZA 4LLCA 1SF8A 3CSKA 4YJWA 2L6HA 4WGZA 3X2QC 2WVOA 1FMWA 1O5HA 2KQ9A 4EIYA 4CBEA 3JZ0A 2R7TA 3DZAA 4JKVA 4NCQA 1TWGA 3W8HA 3U5SA 3PMRA 2XLVA 1VYIA 2XL4A 2XLMA 1SR2A 1T5OA 1VB5A 2B0JA 3HTKC 4Z9JA 2PF4E 1WOLA 3GM2A 4D4XA 1NLXA 2R7UA 3CQZA 3S84A 1U0BB 2AWCA 2Q9BA 2A0BA 3DMDA 2WZLA 3JYHA 2HS5A 3UMIA 4XTKA 5E3CA 4CS7A 1BR1A 1TQGA 5B3SC 2Y3GA 4I1OB 4HE8D 4YL3A 2OG2A 2A6EF 2L9JA 3EG9B 3L0IA 1NU9C 1TWAA 2KYHA 4MTFA 3RIPA 1YJGA 5L0IA 4JE9A 5DLJA 4Q5SF 1VLSA 5JP7A 3POVA 1BR4A 2XLWA 2YLIA 4NTBA 2NUTA 2CNWA 2BE5F 2A0UA 3DI5A 4B6IA 4EBJA 5IY5C 2H8AA 4BEMJ 5F28E 3SEOA 2QLAA 2HZ8A 2IYLD 3DM9B 4WABA 4U5CE 2GDCA 3NRHA 4E0HA 4IJJA 3DJUB 4F4BA 5JT4A 3C8GB 3K33A 3MYIA 3F47A 3H2VA 4IGGA 2EIJC 2VCCA 2AP3A 2ZXOA 2LIGA 4G0HA 3TJ5A 2HSBA 2PNOA 2R02A 3S0XA 2CNWD 3RYLA 1DOVA 4GYTA 3WAQA 2AWYA 4CSAA 4U5GA 1CPQA 2XM0A 3M79A 4WGYA 1AVOB 4XLNF 4JTCB 3V5ZA 3WHNA 3ZTMA 3KH2A 2YL7A 2XSEA 3K66A 4JRZA 1FTSA 3BRJA 4JVSA 3HNKA 2IXMA 4H4KC 5B1BC 5JS5A 1RXQA 1VOMA 2FFHA 2J7PD 4JEBA 2Y3DA 3GEIA 1TFOB 2WVQA 1XWJA 4W8KA 3ATPA 2A68F 5E2QA 3UR3C 4LACB 4YL1A 3T6GB 4G7OF 4YT4A 1OCZC 2Q4FA 3KMIA 3DM5A 4E0IA 1A41A 1I4ZA 4R32A 4L6RA 5COGA 1JPNA 3L34A 4O7GA 3I5QA 3IQ6A 3EGDB 2PFDA 3AJMA 1KU2A 2CCYA 3BEHA 4KI2A 3ZC4A 4IB4A 2LSEA 4P9FA 4C7OA 3TOMA 3FAPB 1Y4CA 5A6AA 5K0IA 3U9MA 5DS5A 1MNDA 3HKKA 1R4TA 2EIKC 2HUJA 2J45A 3JRTA 4KC9A 3VRCA 1ZHWA 1GGQA 3GWLA 4XEKA 5D92A 3MYFA 3T6JA 3KPHA 3AQCA 4MVQA 3MLGA 5JVEA 3AG1C 3SYNA 1J8YF 3SXMA 1JMWA 2JD3A 4BEJA 1WASA 4Z9IA 3G4XA 2R03A 4LDKA 4XWJA 3J06A 2G62A 2H7BA 4JZAA 2W45A 4YT2A 2EIMC 1E2XA 5F5FA 3LS0A 3TJ6A 1EQ1A 2RD9A 2YKZA 5L0DA 1M2OA 3QW1A 1D0YA 1OW7A 2HMQA 2YLDA 3N0TA 4CDAA 4D4NA 3H2UA 4J32B 1E83A 3M4BA 4MVRA 4PJNA 4A2NB 4AX2A 3CEXA 4IAOA 1UG7A 4FWVA 3S28A 3GANA 5HV9A 2LFFA 4MVZA 4J7TA 4OD4A 3EG9A 3PHF2 1S05A 1LIHA 3E70C 1JOGA 4CIPA 3Q7GA 2AVKA 1JAFA 5AC4A 3TOLA 2ASRA 1Z23A 1ZHZA 2OJED 3KKBA 1T6QA 4DBQA 4O6NA 2JPUA 3Q6MA 4BJ6C 3RQGA 3U2MA 1ORYA 5EHHA 1FNTc 4MQ9F 3T9OA 2KSFA 1CGOA 3U8VA 4U5BE 2I15A 5JLIA 3SZRA 1Z6AA 3EGXB 3R2PA 1YVIA 3LNMB 4P6IC 2RSEB 3VYWA 5CIVA 1YA9A 2XL8A 3IPMO 2CGEA 2LQGA 3K1HA 2OCCC 2OEXA 4MNDA 3EPVA 1Z63A 4K0DA 4O79A 1D1CA 3JYYA 3T6BA 3O55A 4DVYP 4MS2A 2KGOA 4RBNA 1QVXA 4J30B 3SXZA 1L7CA 2XLDA 2HMZA 1YZAA 5E3AA 3DD7A 1D0ZA 1N1CA 4NQFA 1RKEA 5B3IA 1LI5A 2VASA 4ZLDA 1G5ZA 2NUPA 4YK5A 3KYIA 2CYDA 3RF3A 2WB7A 3FMSA 4EHPA 4OIRF 5KYYB 2YVKA 2P0NA 5COMA 4ULVA 2DGJA 2EILC 1A0BA 5L3VA 1PD1A 1V4AA 2X51A 4I3MA 3W2WA 3NYLA 1U6HA 1GQAA 2KW3C 3OA1A 2EPLX 3GEEA 1YLMA 4E7ZA 4IARA 2O9XA 4DVZA 2W4MA 3C8GD 4P9TA 4QI0A 4EWCA 3L1MA 1PCXA 4N4WA 1OCCC 4QDLA 5BQGA 2EINC 3I5PA 1XZPA 4CDYA 2D5RB 4U9EA 4U9DA 1D1AA 1U89A 4XLPF 3C62A 4WJ0A 1HE1A 4BG0A 3S27A 3U3BA 3EHNA 3W2VA 3EQLF 1A7EA 2XLEA 2MHRA 3NKDA 4BPMA 4FX5A 2IXOA 3TD7A 2AU5A 1QKRA 4DRIB 1LE2A 3O10A 4CX9A 4CS8A 5DVWA 3LNRA 4BJ6A 1RCPA 3QW0A 4UDVA 1J8MF 3L8JA 3B0VC 3IQ5A 4N06A 1ZZPA 2WZGA 3JCUQ 4XPYA 3WODF 2X0CA 3IHUA 4C7OB 1D0XA 5KYXB 4U5FE 4EUKB 1T6IA 3EGDA 5JSLA 2Q9AA 2VH3A 4YL0A 3TK0A 4NTAA 3U3FA 4AE4B 4G7HF 2P61A 3RKOF 4H54A 4CS9C 1JR8A 4K7BA 4MVSA 2ZXPA 5L0CA 2YWAA 2L6FA 1SMYF 1VK5A 1DOWA 2EPOA 3NMJA 4I44A 1YZCA 2FAPB 4ONSA 3QTHA 3Q6NA 2UUHA 1LS4A 1PD0A 2H7VC 3ZG1A 5JUAA 1E86A 1HW2A 2XXAB 3ECSA 4XEVA 1MMAA 1WTYA 3IEEA 1Q0KA 1OW8A 4PJLA 1CGNA 1TWCA 2IXPA 2LFDA 3QVYA 3ABLC 3C18A 1CGME 3MX3A 2JX0A 3DXJF 1M2VA 2WZFA 2NPUA 2IXNA 3G4ZA 2L81A 1A7VA 1LVKA 2HSQA 4DJ9A 2NSFA 1YARO 2GAQA 2YL3A 3N24A 3QZCA 3EH2A 4MVMA 4DRHB 2IBFA 3ITFA 2QY9A 4Q7CA 3EZIA 5GPGB 4MVUA 1GM5A 2VC9A 1B68A 1PV3A 3LESA 5A69A 2Y3HA 3O39A 2R7WA 4OIQF 4NC3A 1S7ZA 2LK4A 4PJJA 3RVZA 4FAPB 3U9JA 1L3PA 1E85A 3ZVRA 2YHSA 2WVNA 3V7OA 3UMKA 5BQIA 3NG1A 2NSGA 3LUTB 4XEFA 2YEVA 2VB6A 3B9QA 4Q4ZF 4NTFA 3KL4A 1NSGB 4IAQA 2HFIA 3ZWIA 3NKEA 1E84A 3AGTA 2MWQA 2G3KA 2I8BA 4JW1A 4FESA 1OR2A 2WL8A 5KYYA 2J9BA 2R7OA 2KNHA 1O3UA 3GM1A 3RVYA 5HSWA 4OIPF 3I4UA 3K1IC 2R7VA 1VMAA 2OEVA 4W8PA 4PFOA 2Y69C 1ST6A 4Z9HA 2KJGA 4MTGA 4GEHA 2YQYA 5DS6A 1M2VB 1ORJA 1HMOA 2ZXWC 4RD9A 2YRFA 4JURI 4YN0B 2R7RA 1LS1A 1BBHA 5FZTA 4JIOA 1RKCA 1YYJA 2E87A 3EFOB 1SZIA 5BQHA 1OQCA 2PBEA 1A7DA 3SP1A 4JJGA 1TKNA 2R7SA 2H7OA 4U5HA 1HMDA 2Y3BA 3SNHA 1AEPA 3EHMA 3X1OA 2DI3A 4U5DE 1NG1A 1H7IA 4A4AA 1IZMA 1V74B 4XQ1A 1WGWA 3B0UX 1GS9A 2HV6A 3W8IA 1ORSC 1LE4A 1W2WA 2DB4A 5DS4A 5COFA 2J46A 1MMDA 3NYJA 2ETSA 4AL1A 1K40A 3S90A 3GODA 5D91A 4JJFA 3AG2C 1T9KA 4KNVA 1KTMA 3LLKA 3JSZA 2L7AA 2XM4A 1QPUA 3K6BA 3M1CB 1AUEA 3C8ZA 1V54C 1ZW3A 1ZYRF 4BJTA 1C17M 3ZQYA 2HKVA 3S9OA 2QTVA 1K04A 4ANJA 1VTMP 1R5ID 1WN0A 1ZHXA 3EGXA 3HNJA 3K7DA 4JCHA 4O6YA 4ULWA 5B1AC 3RH3A 3V5XA 3ZQVA 4BJ5A 2XLHA 1Q0DA 3DE9A 5A6JA 1NBBA 2ZXRA 3NMKA 2Q00A 1HY5A 1NZEA 3JT1A 3T4RA 1VYKA 4CJGA 3UGPA 4DOZA 4C3EA 1T01A 3NYMA 4EBKA 3AGUA 1OKKA 2VCAA 2IM8A 1G4US 1XZQA 3R7CA 1YDIA 1G8XA 1Y6DA 2A6HF 4YT8A 5A6BA 3FDQA 2ZD9A 2A69F 2GFHA 2CDQA 3L8IA 4LDQA 3V5YA 4GQHA 3HJCA 4N6HA 3A9CA 1D1BA 3JTLO 4C3BA 4XPWA 5DQZA 3ASOC 2Q3TA 1QZXA 2J8WA 3EJNA 4YT5A 1Z7Qc 4OINF 3VAYA 5JRAA 1HE9A 2R9RB 2YLGA 4CS8C 3A11A 3W4YA 1C03A 5F5HA 2QUPA 1BDJB 2HJMA 5KYUA 1YAUO 4MTOA 1G4WR 1WWPA 2B0HA 3M4CA 1FFTC 1M57C 2F22A 3B29A 5AGFA 2DYRC 2Q9CA 3AG3C 1M6TA 3NMIA 3NDBB 3RW0A 3FOOA 2GA0A 4CS9A 3O6XA 2BC5A 4DRJB 2KC3A 4BJ5C 3B0PA 3LLIA 2KK1A 256BA 2W9YA 1IW7F 4ER9A 2MYSA 5EGYA 1NFOA 1OXBA 2OOCA 4EKWA 4JTAB 5A6KA 2P1AA 4MW3A 5E33A 2P7VA 1FMVA 4JTDB 4HFKB 2C03A 4JEAA 2NUTB 4IWBA 1OW6A 3JSEO 4E17A 1MMGA 2W4BA 2Z15A 2PP4A 3GM3A 1MNEA 3LEVA 2R25A 3LJBA 1BZ4A 2V3CC 2Y39A 2PX0A 3K1IA 4G78A 4M63A 4YWQA 4PR9A 3DJNB 1ZVZA 1C02A 1Z5ZA 3G50A 4EBBA 1ZW2A 2R05A 2J7PA 3C7JA 1QQ3A 2M4EA 1H6GA 3B71A 3GWNA 2EPNA 3AG4C 4PACA 3DWWA 2R7QA 1ZHTA 2R7XA 4DXWA 4KNWA 4JC7A 1HW1A 2M64A 1I4YA 4O6MA 4JCZA 1EI7A 1LKXA 1O87A 2YL0A 3CZ6A 1I5NA 4K1OA 3AOUA 3GEHA 5EK0A 2XXAA 1OCRC 1K05A 3EFOA 4LERA 2UUIA 1Q0MA
chains in the Genus database with same CATH topology
3C18A 3JZ0A 4EBJA 2JX0A 3K7DA 1V4AA 5F28E 3L8JA 1WWPA 1UFBA 4R32A 1ZZPA 1OW7A 2Q00A 3C8GB 3TULA 2PBEA 3C8GD 3U0CA 3AJMA 1WOLA 1O3UA 2L6GA 3GM1A 3GM2A 3JYYA 2KK1A 4EBKA 3U3FA 3B71A 1KNYA 2HSBA 1PV3A 1QVXA 1K40A 1JOGA 2LK4A 2YWAA 2L6FA 3RQFA 3L8IA 4XEKA 4NQFA 1KTMA 1OW6A 2JPUA 3BRJA 3RQGA 3RQEA 1K05A 2L6HA 3MFNA 1WTYA 3C8GA 4XEVA 4XEFA 1OW8A 3S9OA 3GM3A 3O10A 1K04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C18 A;  3JZ0 A;  4EBJ A;  2JX0 A;  3K7D A;  1V4A A;  5F28 E;  3L8J A;  1WWP A;  1UFB A;  4R32 A;  1ZZP A;  1OW7 A;  2Q00 A;  3C8G B;  3TUL A;  2PBE A;  3C8G D;  3U0C A;  3AJM A;  1WOL A;  1O3U A;  2L6G A;  3GM1 A;  3GM2 A;  3JYY A;  2KK1 A;  4EBK A;  3U3F A;  3B71 A;  1KNY A;  2HSB A;  1PV3 A;  1QVX A;  1K40 A;  1JOG A;  2LK4 A;  2YWA A;  2L6F A;  3RQF A;  3L8I A;  4XEK A;  4NQF A;  1KTM A;  1OW6 A;  2JPU A;  3BRJ A;  3RQG A;  3RQE A;  1K05 A;  2L6H A;  3MFN A;  1WTY A;  3C8G A;  4XEV A;  4XEF A;  1OW8 A;  3S9O A;  3GM3 A;  3O10 A;  1K04 A; 
#chains in the Genus database with same CATH topology
 3F46 A;  1WAT A;  1Z3I X;  4KBL A;  1LPE A;  5L0J A;  3EZH A;  1M56 C;  4PJM A;  3FOP A;  4BJ1 A;  5KYU B;  1EKY A;  1TFK B;  2ICW G;  4QI2 A;  3AQB A;  3UGO A;  2OQM A;  3U0C A;  5T3W A;  3DE8 A;  2BL2 A;  3M15 A;  1OCO C;  2OJQ A;  2LCH A;  1KNY A;  2LP4 A;  1LM3 B;  4J7Y A;  4AL0 A;  5A6B D;  5L0H A;  1CPR A;  3QVZ A;  2TMV P;  1YYX A;  3HNI A;  3JRM O;  3KYJ A;  4N6C A;  4OD5 A;  2J9U A;  3VM6 A;  5L0G A;  5KYN A;  1Q0G A;  1FR0 A;  3US6 A;  4LLE A;  3PDM P;  3N2Z B;  3TQO A;  3WG7 C;  3PCV A;  4MVO A;  1LI7 A;  2XL6 A;  3FHD A;  3MBG A;  4XPX A;  1TWH A;  1MQV A;  2LD6 A;  4CJO A;  4U5E E;  2EPK X;  3C8G A;  2VCB A;  1H9T A;  4LDR A;  2GWW A;  1VLT A;  4AK9 A;  3LAY A;  1ZHY A;  1OR3 A;  2A1D D;  2IOQ A;  3Q7L A;  3UNG C;  3ZSU A;  4CDV A;  1Q0F A;  2OU6 A;  3SXK A;  5KYW A;  2QNL A;  4CIH A;  3ABM C;  2Q7R A;  1NU7 D;  3FVY A;  2DYS C;  2XLO A;  2HJ3 A;  3DAG A;  4PK4 A;  4RDA A;  3S29 A;  2L6G A;  1TR2 A;  2J9V A;  5BUO A;  2J0W A;  4G7Z F;  2OKU A;  2NG1 A;  5AC5 A;  4PFP A;  5T3T A;  2J0X A;  3LEO A;  2ZPA A;  3CAX A;  1APC A;  4ZLC A;  1FFH A;  3FAJ A;  3OWT A;  1MMN A;  2CW0 F;  1FAP B;  3U8P A;  3ZTZ A;  4AE4 A;  4X0R A;  1NFN A;  4IRU A;  3ZDL A;  2P6V A;  3OEO A;  3RQE A;  4OIO F;  1H9G A;  1ZU4 A;  1JPJ A;  2NUP B;  3MFN A;  4I1M A;  1RJ9 B;  1OKK D;  2EPM X;  2XS1 A;  3GOR A;  3IQT A;  5KYW B;  2J9W A;  2G3V A;  1QLE C;  1OXK A;  2PX3 A;  5DQT A;  1UFB A;  3E9V A;  5TJ5 E;  4HFF B;  2QE9 A;  1BR2 A;  2V26 A;  1RJ9 A;  2HV7 A;  4E7S A;  3TUL A;  1QSP A;  3H65 A;  3RFY A;  4E18 A;  1ZU5 A;  3ASN C;  4MW8 A;  2YZS A;  3DKA A;  3UMH A;  3IQC A;  2FGY A;  5T1D B;  5KYX A;  4CSA C;  5CI9 A;  1T6U A;  3QMK A;  3VF0 A;  5L3Q A;  3SXY A;  1YA7 O;  3C63 A;  4NY3 A;  1F1M A;  1SYQ A;  3LS1 A;  1RKE B;  3DAF A;  3FXH A;  4DBR A;  1V55 C;  3RQF A;  3HNL A;  5L0F A;  5FCL A;  1EA8 A;  2D4U A;  3EH1 A;  3U2L A;  3ABK C;  1RMV A;  5CI8 A;  2YL1 A;  3ZIB A;  4C3D A;  2C04 A;  4HEA J;  1JRA A;  2XRH A;  2XS8 A;  3HLZ A;  4LLC A;  1SF8 A;  3CSK A;  4YJW A;  2L6H A;  4WGZ A;  3X2Q C;  2WVO A;  1FMW A;  1O5H A;  2KQ9 A;  4EIY A;  4CBE A;  3JZ0 A;  2R7T A;  3DZA A;  4JKV A;  4NCQ A;  1TWG A;  3W8H A;  3U5S A;  3PMR A;  2XLV A;  1VYI A;  2XL4 A;  2XLM A;  1SR2 A;  1T5O A;  1VB5 A;  2B0J A;  3HTK C;  4Z9J A;  2PF4 E;  1WOL A;  3GM2 A;  4D4X A;  1NLX A;  2R7U A;  3CQZ A;  3S84 A;  1U0B B;  2AWC A;  2Q9B A;  2A0B A;  3DMD A;  2WZL A;  3JYH A;  2HS5 A;  3UMI A;  4XTK A;  5E3C A;  4CS7 A;  1BR1 A;  1TQG A;  5B3S C;  2Y3G A;  4I1O B;  4HE8 D;  4YL3 A;  2OG2 A;  2A6E F;  2L9J A;  3EG9 B;  3L0I A;  1NU9 C;  1TWA A;  2KYH A;  4MTF A;  3RIP A;  1YJG A;  5L0I A;  4JE9 A;  5DLJ A;  4Q5S F;  1VLS A;  5JP7 A;  3POV A;  1BR4 A;  2XLW A;  2YLI A;  4NTB A;  2NUT A;  2CNW A;  2BE5 F;  2A0U A;  3DI5 A;  4B6I A;  4EBJ A;  5IY5 C;  2H8A A;  4BEM J;  5F28 E;  3SEO A;  2QLA A;  2HZ8 A;  2IYL D;  3DM9 B;  4WAB A;  4U5C E;  2GDC A;  3NRH A;  4E0H A;  4IJJ A;  3DJU B;  4F4B A;  5JT4 A;  3C8G B;  3K33 A;  3MYI A;  3F47 A;  3H2V A;  4IGG A;  2EIJ C;  2VCC A;  2AP3 A;  2ZXO A;  2LIG A;  4G0H A;  3TJ5 A;  2HSB A;  2PNO A;  2R02 A;  3S0X A;  2CNW D;  3RYL A;  1DOV A;  4GYT A;  3WAQ A;  2AWY A;  4CSA A;  4U5G A;  1CPQ A;  2XM0 A;  3M79 A;  4WGY A;  1AVO B;  4XLN F;  4JTC B;  3V5Z A;  3WHN A;  3ZTM A;  3KH2 A;  2YL7 A;  2XSE A;  3K66 A;  4JRZ A;  1FTS A;  3BRJ A;  4JVS A;  3HNK A;  2IXM A;  4H4K C;  5B1B C;  5JS5 A;  1RXQ A;  1VOM A;  2FFH A;  2J7P D;  4JEB A;  2Y3D A;  3GEI A;  1TFO B;  2WVQ A;  1XWJ A;  4W8K A;  3ATP A;  2A68 F;  5E2Q A;  3UR3 C;  4LAC B;  4YL1 A;  3T6G B;  4G7O F;  4YT4 A;  1OCZ C;  2Q4F A;  3KMI A;  3DM5 A;  4E0I A;  1A41 A;  1I4Z A;  4R32 A;  4L6R A;  5COG A;  1JPN A;  3L34 A;  4O7G A;  3I5Q A;  3IQ6 A;  3EGD B;  2PFD A;  3AJM A;  1KU2 A;  2CCY A;  3BEH A;  4KI2 A;  3ZC4 A;  4IB4 A;  2LSE A;  4P9F A;  4C7O A;  3TOM A;  3FAP B;  1Y4C A;  5A6A A;  5K0I A;  3U9M A;  5DS5 A;  1MND A;  3HKK A;  1R4T A;  2EIK C;  2HUJ A;  2J45 A;  3JRT A;  4KC9 A;  3VRC A;  1ZHW A;  1GGQ A;  3GWL A;  4XEK A;  5D92 A;  3MYF A;  3T6J A;  3KPH A;  3AQC A;  4MVQ A;  3MLG A;  5JVE A;  3AG1 C;  3SYN A;  1J8Y F;  3SXM A;  1JMW A;  2JD3 A;  4BEJ A;  1WAS A;  4Z9I A;  3G4X A;  2R03 A;  4LDK A;  4XWJ A;  3J06 A;  2G62 A;  2H7B A;  4JZA A;  2W45 A;  4YT2 A;  2EIM C;  1E2X A;  5F5F A;  3LS0 A;  3TJ6 A;  1EQ1 A;  2RD9 A;  2YKZ A;  5L0D A;  1M2O A;  3QW1 A;  1D0Y A;  1OW7 A;  2HMQ A;  2YLD A;  3N0T A;  4CDA A;  4D4N A;  3H2U A;  4J32 B;  1E83 A;  3M4B A;  4MVR A;  4PJN A;  4A2N B;  4AX2 A;  3CEX A;  4IAO A;  1UG7 A;  4FWV A;  3S28 A;  3GAN A;  5HV9 A;  2LFF A;  4MVZ A;  4J7T A;  4OD4 A;  3EG9 A;  3PHF 2;  1S05 A;  1LIH A;  3E70 C;  1JOG A;  4CIP A;  3Q7G A;  2AVK A;  1JAF A;  5AC4 A;  3TOL A;  2ASR A;  1Z23 A;  1ZHZ A;  2OJE D;  3KKB A;  1T6Q A;  4DBQ A;  4O6N A;  2JPU A;  3Q6M A;  4BJ6 C;  3RQG A;  3U2M A;  1ORY A;  5EHH A;  1FNT c;  4MQ9 F;  3T9O A;  2KSF A;  1CGO A;  3U8V A;  4U5B E;  2I15 A;  5JLI A;  3SZR A;  1Z6A A;  3EGX B;  3R2P A;  1YVI A;  3LNM B;  4P6I C;  2RSE B;  3VYW A;  5CIV A;  1YA9 A;  2XL8 A;  3IPM O;  2CGE A;  2LQG A;  3K1H A;  2OCC C;  2OEX A;  4MND A;  3EPV A;  1Z63 A;  4K0D A;  4O79 A;  1D1C A;  3JYY A;  3T6B A;  3O55 A;  4DVY P;  4MS2 A;  2KGO A;  4RBN A;  1QVX A;  4J30 B;  3SXZ A;  1L7C A;  2XLD A;  2HMZ A;  1YZA A;  5E3A A;  3DD7 A;  1D0Z A;  1N1C A;  4NQF A;  1RKE A;  5B3I A;  1LI5 A;  2VAS A;  4ZLD A;  1G5Z A;  2NUP A;  4YK5 A;  3KYI A;  2CYD A;  3RF3 A;  2WB7 A;  3FMS A;  4EHP A;  4OIR F;  5KYY B;  2YVK A;  2P0N A;  5COM A;  4ULV A;  2DGJ A;  2EIL C;  1A0B A;  5L3V A;  1PD1 A;  1V4A A;  2X51 A;  4I3M A;  3W2W A;  3NYL A;  1U6H A;  1GQA A;  2KW3 C;  3OA1 A;  2EPL X;  3GEE A;  1YLM A;  4E7Z A;  4IAR A;  2O9X A;  4DVZ A;  2W4M A;  3C8G D;  4P9T A;  4QI0 A;  4EWC A;  3L1M A;  1PCX A;  4N4W A;  1OCC C;  4QDL A;  5BQG A;  2EIN C;  3I5P A;  1XZP A;  4CDY A;  2D5R B;  4U9E A;  4U9D A;  1D1A A;  1U89 A;  4XLP F;  3C62 A;  4WJ0 A;  1HE1 A;  4BG0 A;  3S27 A;  3U3B A;  3EHN A;  3W2V A;  3EQL F;  1A7E A;  2XLE A;  2MHR A;  3NKD A;  4BPM A;  4FX5 A;  2IXO A;  3TD7 A;  2AU5 A;  1QKR A;  4DRI B;  1LE2 A;  3O10 A;  4CX9 A;  4CS8 A;  5DVW A;  3LNR A;  4BJ6 A;  1RCP A;  3QW0 A;  4UDV A;  1J8M F;  3L8J A;  3B0V C;  3IQ5 A;  4N06 A;  1ZZP A;  2WZG A;  3JCU Q;  4XPY A;  3WOD F;  2X0C A;  3IHU A;  4C7O B;  1D0X A;  5KYX B;  4U5F E;  4EUK B;  1T6I A;  3EGD A;  5JSL A;  2Q9A A;  2VH3 A;  4YL0 A;  3TK0 A;  4NTA A;  3U3F A;  4AE4 B;  4G7H F;  2P61 A;  3RKO F;  4H54 A;  4CS9 C;  1JR8 A;  4K7B A;  4MVS A;  2ZXP A;  5L0C A;  2YWA A;  2L6F A;  1SMY F;  1VK5 A;  1DOW A;  2EPO A;  3NMJ A;  4I44 A;  1YZC A;  2FAP B;  4ONS A;  3QTH A;  3Q6N A;  2UUH A;  1LS4 A;  1PD0 A;  2H7V C;  3ZG1 A;  5JUA A;  1E86 A;  1HW2 A;  2XXA B;  3ECS A;  4XEV A;  1MMA A;  1WTY A;  3IEE A;  1Q0K A;  1OW8 A;  4PJL A;  1CGN A;  1TWC A;  2IXP A;  2LFD A;  3QVY A;  3ABL C;  3C18 A;  1CGM E;  3MX3 A;  2JX0 A;  3DXJ F;  1M2V A;  2WZF A;  2NPU A;  2IXN A;  3G4Z A;  2L81 A;  1A7V A;  1LVK A;  2HSQ A;  4DJ9 A;  2NSF A;  1YAR O;  2GAQ A;  2YL3 A;  3N24 A;  3QZC A;  3EH2 A;  4MVM A;  4DRH B;  2IBF A;  3ITF A;  2QY9 A;  4Q7C A;  3EZI A;  5GPG B;  4MVU A;  1GM5 A;  2VC9 A;  1B68 A;  1PV3 A;  3LES A;  5A69 A;  2Y3H A;  3O39 A;  2R7W A;  4OIQ F;  4NC3 A;  1S7Z A;  2LK4 A;  4PJJ A;  3RVZ A;  4FAP B;  3U9J A;  1L3P A;  1E85 A;  3ZVR A;  2YHS A;  2WVN A;  3V7O A;  3UMK A;  5BQI A;  3NG1 A;  2NSG A;  3LUT B;  4XEF A;  2YEV A;  2VB6 A;  3B9Q A;  4Q4Z F;  4NTF A;  3KL4 A;  1NSG B;  4IAQ A;  2HFI A;  3ZWI A;  3NKE A;  1E84 A;  3AGT A;  2MWQ A;  2G3K A;  2I8B A;  4JW1 A;  4FES A;  1OR2 A;  2WL8 A;  5KYY A;  2J9B A;  2R7O A;  2KNH A;  1O3U A;  3GM1 A;  3RVY A;  5HSW A;  4OIP F;  3I4U A;  3K1I C;  2R7V A;  1VMA A;  2OEV A;  4W8P A;  4PFO A;  2Y69 C;  1ST6 A;  4Z9H A;  2KJG A;  4MTG A;  4GEH A;  2YQY A;  5DS6 A;  1M2V B;  1ORJ A;  1HMO A;  2ZXW C;  4RD9 A;  2YRF A;  4JUR I;  4YN0 B;  2R7R A;  1LS1 A;  1BBH A;  5FZT A;  4JIO A;  1RKC A;  1YYJ A;  2E87 A;  3EFO B;  1SZI A;  5BQH A;  1OQC A;  2PBE A;  1A7D A;  3SP1 A;  4JJG A;  1TKN A;  2R7S A;  2H7O A;  4U5H A;  1HMD A;  2Y3B A;  3SNH A;  1AEP A;  3EHM A;  3X1O A;  2DI3 A;  4U5D E;  1NG1 A;  1H7I A;  4A4A A;  1IZM A;  1V74 B;  4XQ1 A;  1WGW A;  3B0U X;  1GS9 A;  2HV6 A;  3W8I A;  1ORS C;  1LE4 A;  1W2W A;  2DB4 A;  5DS4 A;  5COF A;  2J46 A;  1MMD A;  3NYJ A;  2ETS A;  4AL1 A;  1K40 A;  3S90 A;  3GOD A;  5D91 A;  4JJF A;  3AG2 C;  1T9K A;  4KNV A;  1KTM A;  3LLK A;  3JSZ A;  2L7A A;  2XM4 A;  1QPU A;  3K6B A;  3M1C B;  1AUE A;  3C8Z A;  1V54 C;  1ZW3 A;  1ZYR F;  4BJT A;  1C17 M;  3ZQY A;  2HKV A;  3S9O A;  2QTV A;  1K04 A;  4ANJ A;  1VTM P;  1R5I D;  1WN0 A;  1ZHX A;  3EGX A;  3HNJ A;  3K7D A;  4JCH A;  4O6Y A;  4ULW A;  5B1A C;  3RH3 A;  3V5X A;  3ZQV A;  4BJ5 A;  2XLH A;  1Q0D A;  3DE9 A;  5A6J A;  1NBB A;  2ZXR A;  3NMK A;  2Q00 A;  1HY5 A;  1NZE A;  3JT1 A;  3T4R A;  1VYK A;  4CJG A;  3UGP A;  4DOZ A;  4C3E A;  1T01 A;  3NYM A;  4EBK A;  3AGU A;  1OKK A;  2VCA A;  2IM8 A;  1G4U S;  1XZQ A;  3R7C A;  1YDI A;  1G8X A;  1Y6D A;  2A6H F;  4YT8 A;  5A6B A;  3FDQ A;  2ZD9 A;  2A69 F;  2GFH A;  2CDQ A;  3L8I A;  4LDQ A;  3V5Y A;  4GQH A;  3HJC A;  4N6H A;  3A9C A;  1D1B A;  3JTL O;  4C3B A;  4XPW A;  5DQZ A;  3ASO C;  2Q3T A;  1QZX A;  2J8W A;  3EJN A;  4YT5 A;  1Z7Q c;  4OIN F;  3VAY A;  5JRA A;  1HE9 A;  2R9R B;  2YLG A;  4CS8 C;  3A11 A;  3W4Y A;  1C03 A;  5F5H A;  2QUP A;  1BDJ B;  2HJM A;  5KYU A;  1YAU O;  4MTO A;  1G4W R;  1WWP A;  2B0H A;  3M4C A;  1FFT C;  1M57 C;  2F22 A;  3B29 A;  5AGF A;  2DYR C;  2Q9C A;  3AG3 C;  1M6T A;  3NMI A;  3NDB B;  3RW0 A;  3FOO A;  2GA0 A;  4CS9 A;  3O6X A;  2BC5 A;  4DRJ B;  2KC3 A;  4BJ5 C;  3B0P A;  3LLI A;  2KK1 A;  256B A;  2W9Y A;  1IW7 F;  4ER9 A;  2MYS A;  5EGY A;  1NFO A;  1OXB A;  2OOC A;  4EKW A;  4JTA B;  5A6K A;  2P1A A;  4MW3 A;  5E33 A;  2P7V A;  1FMV A;  4JTD B;  4HFK B;  2C03 A;  4JEA A;  2NUT B;  4IWB A;  1OW6 A;  3JSE O;  4E17 A;  1MMG A;  2W4B A;  2Z15 A;  2PP4 A;  3GM3 A;  1MNE A;  3LEV A;  2R25 A;  3LJB A;  1BZ4 A;  2V3C C;  2Y39 A;  2PX0 A;  3K1I A;  4G78 A;  4M63 A;  4YWQ A;  4PR9 A;  3DJN B;  1ZVZ A;  1C02 A;  1Z5Z A;  3G50 A;  4EBB A;  1ZW2 A;  2R05 A;  2J7P A;  3C7J A;  1QQ3 A;  2M4E A;  1H6G A;  3B71 A;  3GWN A;  2EPN A;  3AG4 C;  4PAC A;  3DWW A;  2R7Q A;  1ZHT A;  2R7X A;  4DXW A;  4KNW A;  4JC7 A;  1HW1 A;  2M64 A;  1I4Y A;  4O6M A;  4JCZ A;  1EI7 A;  1LKX A;  1O87 A;  2YL0 A;  3CZ6 A;  1I5N A;  4K1O A;  3AOU A;  3GEH A;  5EK0 A;  2XXA A;  1OCR C;  1K05 A;  3EFO A;  4LER A;  2UUI A;  1Q0M A; 
#chains in the Genus database with same CATH homology
 3C18 A;  3JZ0 A;  4EBJ A;  2JX0 A;  3K7D A;  1V4A A;  5F28 E;  3L8J A;  1WWP A;  1UFB A;  4R32 A;  1ZZP A;  1OW7 A;  2Q00 A;  3C8G B;  3TUL A;  2PBE A;  3C8G D;  3U0C A;  3AJM A;  1WOL A;  1O3U A;  2L6G A;  3GM1 A;  3GM2 A;  3JYY A;  2KK1 A;  4EBK A;  3U3F A;  3B71 A;  1KNY A;  2HSB A;  1PV3 A;  1QVX A;  1K40 A;  1JOG A;  2LK4 A;  2YWA A;  2L6F A;  3RQF A;  3L8I A;  4XEK A;  4NQF A;  1KTM A;  1OW6 A;  2JPU A;  3BRJ A;  3RQG A;  3RQE A;  1K05 A;  2L6H A;  3MFN A;  1WTY A;  3C8G A;  4XEV A;  4XEF A;  1OW8 A;  3S9O A;  3GM3 A;  3O10 A;  1K04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...