4R32A

Crystal structure analysis of pyk2 and paxillin ld motifs
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
132
structure length
132
Chain Sequence
LDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 55
structure length 132
sequence length 132
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4r32A00
3RQFA 5F28E 1OW7A 3U0CA 1JOGA 1WOLA 1KNYA 1WTYA 3K7DA 2JX0A 4NQFA 3L8IA 3TULA 1K40A 2JPUA 2L6FA 3GM1A 2L6GA 3GM2A 3JYYA 1K04A 3JZ0A 4XEFA 3RQGA 3RQEA 1O3UA 1UFBA 3U3FA 1V4AA 2Q00A 3C8GD 3S9OA 1OW8A 2YWAA 3L8JA 1OW6A 3C8GA 4EBJA 3BRJA 1K05A 1PV3A 2LK4A 4XEKA 3B71A 2HSBA 4EBKA 2L6HA 3AJMA 1KTMA 1QVXA 3C8GB 3C18A 3GM3A 1ZZPA 4R32A 3MFNA 2PBEA 1WWPA 2KK1A 3O10A 4XEVA
chains in the Genus database with same CATH superfamily
3O39A 1FFHA 1R4TA 2A6EF 3G4XA 4WABA 4MTOA 3NG1A 1KU2A 4KNVA 4BJTA 1LKXA 3B9QA 4O7GA 5K0IA 4BG0A 1CPQA 1YARO 2Q3TA 3IEEA 1PD0A 2XLVA 1HY5A 4U5EE 1JPJA 2Q00A 3U2MA 3JCUQ 1QSPA 4GQHA 3DJNB 4MS2A 4KI2A 4Z9HA 1ZW2A 4N6CA 3GWLA 2G3KA 1YYJA 3GEIA 3T6JA 4CDAA 3EHMA 3SZRA 1M2OA 1NBBA 2QLAA 2VCAA 2R05A 4KC9A 4KNWA 4CIPA 4E7ZA 2R7SA 3FOOA 4K7BA 4U5DE 3HKKA 4BJ5C 5KYUB 5KYXB 1JRAA 3AGUA 3I4UA 4U5FE 3TJ6A 2XM0A 3S84A 4I3MA 1M2VA 3MFNA 5L0IA 3LLKA 5T3WA 3LJBA 3FOPA 3C8ZA 3EGDA 1L3PA 5F28E 3RQFA 4BPMA 2EPMX 1OCCC 3H2VA 3QVYA 1YA7O 4EWCA 4YT2A 1N1CA 4I44A 4A2NB 3ABLC 1K40A 3A11A 1M2VB 3OWTA 1GS9A 3FXHA 5E33A 4UDVA 3TQOA 3IQ5A 3EGDB 3DM9B 3KH2A 2D4UA 3L1MA 4JEBA 2UUIA 1JR8A 2LIGA 4K1OA 4Q4ZF 4NC3A 2OEXA 2YL1A 3EFOA 1OR3A 3BRJA 3K1IC 5BQGA 4NTFA 3IQCA 5EHHA 4DXWA 4MTFA 4QDLA 1U0BB 3FMSA 1BR4A 1VMAA 2YL0A 1Z5ZA 1KTMA 1OCZC 1IW7F 2YZSA 3EG9A 3S90A 2X51A 3NMKA 4O6NA 5F5FA 2DYRC 2OKUA 2ICWG 3O6XA 3DWWA 1ST6A 4AE4B 1TWAA 3O10A 4E0HA 4JCZA 1Z3IX 4JIOA 3GODA 1LPEA 4U9EA 4JJGA 3AG4C 3EH2A 3F47A 5JP7A 3TULA 1NU7D 2HUJA 5B1AC 3AG1C 4IB4A 1GGQA 2VC9A 4MVSA 3M15A 4PJJA 4DRJB 4CSAC 1YDIA 2YL3A 1YJGA 3EGXA 2WVNA 1T6UA 3DAFA 3DZAA 2TMVP 2WZFA 3E70C 3N24A 1V55C 2OQMA 2OJED 3JSEO 2XLOA 3KKBA 1MMDA 1Z6AA 4JCHA 3JRMO 3U8VA 5JLIA 2MYSA 2Q9AA 1ZHWA 3AQBA 5D91A 3RH3A 3MBGA 1J8YF 4OIQF 5DLJA 2XXAB 1QKRA 2R25A 4PFPA 3WAQA 4BJ1A 2IM8A 1VYKA 2LCHA 1A41A 1O87A 2LFDA 4PJNA 2AVKA 2XL4A 4EHPA 2JPUA 2L6FA 2OOCA 1NZEA 2HZ8A 2HJ3A 1TQGA 3TJ5A 5A6JA 3HJCA 1MMAA 2V3CC 2GA0A 1RJ9A 2Y39A 1BDJB 3HNKA 2IYLD 2Y3HA 4XQ1A 1OR2A 3JRTA 4J32B 3Q7LA 1V74B 2EIMC 2PF4E 2RSEB 3VYWA 3B0VC 1U89A 4XEKA 2Z15A 2HMQA 1WASA 3LS1A 1VK5A 2PP4A 2J45A 4QI2A 3MX3A 2HV6A 1YYXA 1RJ9B 2A1DD 3U9JA 3DI5A 4CJGA 3QTHA 4D4XA 4DJ9A 3NMIA 3EPVA 1M6TA 1C03A 2ZXRA 1D1BA 2HV7A 3RFYA 4P6IC 4ER9A 4O6MA 2O9XA 3A9CA 1D0ZA 2J7PA 2W4MA 3ZSUA 5D92A 4J30B 3U0CA 4CSAA 1J8MF 2VH3A 1AVOB 2G3VA 2J46A 2NSGA 3LEOA 4U5GA 3U8PA 1ZVZA 5JRAA 2Y3GA 2Q9BA 5JUAA 1Q0MA 1I4ZA 2L7AA 1QZXA 1T6QA 4LACB 3AGTA 3H2UA 1GM5A 2YWAA 3ABMC 2ZD9A 3ZQVA 1CGME 4DRIB 1B68A 2NUPB 2PX3A 4FX5A 3IQ6A 4I1OB 4MVRA 3B0UX 1Q0DA 1LS4A 3GORA 1Z63A 4EIYA 3KMIA 2H7BA 2KJGA 1YZAA 3RVZA 4JC7A 2NPUA 1LS1A 4O79A 1LI5A 2D5RB 3FDQA 3QW1A 5A6AA 1SZIA 4A4AA 4JTCB 2XM4A 3PCVA 2Y3DA 2NG1A 3O55A 4BJ6A 4O6YA 4PJLA 3KPHA 2YKZA 4DBQA 2GFHA 3B29A 4JEAA 3J06A 4OINF 4RBNA 1QLEC 1OXBA 2LQGA 1YZCA 4WGYA 3V5ZA 4WJ0A 2R03A 3ZG1A 5KYNA 4I1MA 2I15A 3R2PA 3ZIBA 3U3FA 1XZQA 4NTAA 1XWJA 2HSQA 4MVZA 5KYUA 5KYXA 4W8KA 1M57C 1TFOB 3DM5A 3HNJA 5DS6A 4G7ZF 2P1AA 2XSEA 2R7XA 1PV3A 1OCOC 2LK4A 4MVOA 2YLIA 5KYWB 4EBKA 4ZLDA 3EJNA 2C04A 3RIPA 3G50A 4NCQA 3ABKC 4CIHA 3UGOA 1MNDA 1PD1A 2FFHA 2LFFA 4Q7CA 4PACA 4JZAA 2J7PD 4XWJA 3IQTA 1V54C 1TWHA 4IARA 4P9TA 4XEVA 5HV9A 3ZVRA 4HFKB 4XTKA 4EBBA 2J9WA 4ONSA 4E18A 5L0HA 3SXZA 3QMKA 1EI7A 3JTLO 3SP1A 1T6IA 1V4AA 4CS9A 2GAQA 4Q5SF 3NYLA 2R7TA 5L0CA 4FAPB 2J8WA 5E2QA 3PHF2 1Z23A 3ZTZA 1OKKA 4GEHA 1D1CA 2HS5A 3LS0A 1LM3B 1LE4A 2OG2A 2XLMA 3B0PA 3N2ZB 4AE4A 4MW8A 1LE2A 1ZYRF 1BR1A 3GM3A 2A0UA 4OD4A 3U9MA 1TKNA 2R02A 5COMA 3RVYA 5JS5A 1EA8A 3KYJA 5L3QA 3U3BA 2KW3C 1C02A 2EPOA 3WG7C 5BQHA 2R9RB 2Y3BA 2YQYA 2PNOA 1OW7A 2BC5A 1JMWA 2BL2A 4U5BE 2F22A 2GDCA 4LERA 4BEMJ 4MTGA 1YA9A 4CS7A 1AEPA 5HSWA 1VLSA 3N0TA 3RF3A 3UGPA 3R7CA 3T6BA 3TOMA 2RD9A 3KL4A 1OQCA 3CAXA 5A6KA 5L0DA 2E87A 2HJMA 2VASA 4U5CE 3SEOA 3AG3C 3Q6NA 2G62A 2MWQA 2XXAA 4XPWA 2L6HA 1H9GA 3DJUB 3U5SA 4C3DA 3ASOC 4CDYA 2KK1A 2EILC 1BBHA 4G0HA 1I4YA 2ASRA 2L9JA 3V5YA 3EH1A 3LAYA 4EKWA 1EKYA 3W8IA 1FMVA 2CCYA 3RYLA 1WTYA 1WGWA 2EPNA 3K1HA 2WB7A 2XLHA 3MLGA 4X0RA 2W4BA 4ZLCA 1SF8A 1NG1A 2W45A 4OIOF 4HE8D 1E85A 4HFFB 1NSGB 2W9YA 4JJFA 3UMKA 2Q4FA 2Q7RA 3C63A 2IXPA 4YT5A 2IBFA 1QQ3A 4YT8A 4BJ6C 1IZMA 3M1CB 4JRZA 1TWCA 4K0DA 2A0BA 256BA 3W8HA 3LNRA 1HW1A 1OKKD 4L6RA 1E83A 3G4ZA 1A7VA 1FFTC 1RCPA 2XLDA 4MQ9F 4AK9A 4E0IA 4DBRA 1VTMP 3OEOA 3C8GB 3JYHA 4N6HA 3DKAA 4HEAJ 4C3BA 1Q0FA 3ITFA 2IXOA 2VCCA 3ZC4A 3CQZA 5JVEA 4RD9A 1OCRC 2YLGA 1TWGA 4AL0A 5DS4A 2KC3A 1A7DA 3L0IA 1YLMA 3S0XA 3RKOF 3HTKC 2VCBA 2QUPA 2ZXPA 4C3EA 4MVUA 2XL8A 2IXNA 1RKEA 2NUPA 4MNDA 1DOVA 1RXQA 2WZLA 1JPNA 1UFBA 2OEVA 2R7WA 4LDKA 3X2QC 2NUTB 3S9OA 3SXMA 1MMGA 1YVIA 1S7ZA 5CI9A 1D0XA 3RW0A 1OW6A 4OD5A 3VM6A 5BQIA 3K33A 1RKEB 2P61A 3AQCA 1YAUO 1MMNA 1HMOA 2HKVA 2ZXWC 3IPMO 1FNTc 2CNWD 2XLWA 4CS9C 3IHUA 3V7OA 2EINC 4J7YA 2M4EA 4LLEA 4XPYA 3NKEA 4R32A 2MHRA 5DQZA 2PBEA 4EUKB 4YWQA 2DGJA 4JURI 3JSZA 4F4BA 1FR0A 4N4WA 2HFIA 3T6GB 4B6IA 4C7OB 3HNLA 1QPUA 3L34A 4N06A 3NMJA 1EQ1A 3Q7GA 3GM1A 2L6GA 2J0XA 4QI0A 1SR2A 2A6HF 1K04A 5GPGB 3RQGA 2R7RA 1RMVA 2AWCA 4FESA 3GWNA 4NY3A 2LSEA 3LEVA 3MYIA 4NTBA 1BR2A 2C03A 3C8GD 3I5PA 4YL3A 3ZDLA 4DOZA 1H6GA 2ETSA 4DVZA 4E17A 1VLTA 5KYWA 3UNGC 2ZXOA 2CW0F 1HW2A 3C62A 2IXMA 2R7VA 3U2LA 5KYYB 3NDBB 1O5HA 1DOWA 1G5ZA 2AP3A 4G7HF 5EGYA 4GYTA 2B0HA 4KBLA 5FCLA 2XRHA 3C18A 3QZCA 1WWPA 4BEJA 3ASNC 3FAJA 3TOLA 2QE9A 3VAYA 4H54A 3QVZA 4W8PA 2QY9A 3DXJF 3K7DA 4OIPF 4JKVA 3L8IA 1G4WR 1OXKA 3WHNA 5E3AA 2WVQA 3JT1A 3LUTB 4XEFA 1LIHA 2EIJC 3PDMP 2EPLX 2OJQA 3FHDA 2X0CA 1T01A 3GEEA 1W2WA 2B0JA 3DD7A 5CIVA 3GEHA 1ZW3A 2YEVA 4CS8A 3LLIA 1MNEA 4PK4A 4U5HA 5A6BD 2LP4A 1ZHYA 2AWYA 5A69A 2A68F 1RKCA 2J9VA 2KGOA 1CPRA 1VB5A 4IRUA 1Q0GA 2Y69C 4MVQA 2XL6A 2LD6A 1NLXA 5TJ5E 2EIKC 4YT4A 5BUOA 1Q0KA 4JTDB 1ORJA 2Q9CA 1KNYA 1GQAA 2YL7A 2JX0A 3NYJA 4H4KC 4MVMA 4NQFA 5JSLA 1ZU4A 1NFNA 1WN0A 3FVYA 1E2XA 4JE9A 3JYYA 1LVKA 5COFA 3SYNA 3US6A 3NRHA 4IAOA 5DVWA 1ORSC 1OW8A 3BEHA 2HMZA 4U9DA 3ZWIA 4JTAB 4IAQA 3S27A 2DB4A 3LESA 1CGNA 3CSKA 3TD7A 4DVYP 2YHSA 1ORYA 1D0YA 1H9TA 1T5OA 1ZU5A 2XS1A 3AJMA 2OCCC 4D4NA 2PFDA 3VF0A 3DE9A 3EFOB 2KNHA 2FAPB 2CGEA 2WVOA 4XLNF 1ZZPA 2P0NA 2CNWA 1M56C 4LDQA 2H7OA 3ZQYA 4CJOA 4YL0A 3M4BA 4JW1A 3SNHA 4CX9A 5DS5A 2R7QA 3TK0A 3EQLF 4G7OF 2IOQA 3UMHA 5E3CA 3EG9B 5DQTA 4XLPF 1S05A 3M79A 1U6HA 1ZHTA 2EPKX 4Z9JA 1FAPB 3RQEA 4BJ5A 4YL1A 2KSFA 4MW3A 1G4US 1PCXA 2KYHA 2QNLA 2BE5F 3NYMA 4CDVA 1ZHZA 5JT4A 2UUHA 3ZTMA 2A69F 2H7VC 3C8GA 1NU9C 3DE8A 4LDRA 4ULWA 1UG7A 3EZHA 4Z9IA 3X1OA 2CDQA 3UMIA 4EBJA 5L0JA 4DRHB 1HE1A 5IY5C 2DI3A 5B1BC 2P7VA 5T3TA 3K6BA 3EZIA 1QVXA 3EGXB 1I5NA 3K66A 1TFKB 4P9FA 4XPXA 4RDAA 1JAFA 5L3VA 4AX2A 1Y4CA 1BZ4A 4JVSA 3T4RA 3KYIA 1HMDA 1SYQA 1APCA 3F46A 4ULVA 1MQVA 1JOGA 1XZPA 2YRFA 3K1IA 3Q6MA 4YJWA 5EK0A 5FZTA 2NUTA 3UR3C 3W2WA 5B3SC 4G78A 3M4CA 4ANJA 5AC5A 2J9BA 2WL8A 3JZ0A 1FTSA 2XS8A 4IWBA 3W4YA 4IJJA 3POVA 2OU6A 5T1DB 2KQ9A 3S29A 1Y6DA 3DMDA 3VRCA 3EHNA 3WODF 2FGYA 1HE9A 5L0FA 5F5HA 1ZHXA 1K05A 3I5QA 2P6VA 1D1AA 1A7EA 3NKDA 1G8XA 2H8AA 3AOUA 5A6BA 4E7SA 1LI7A 3ECSA 3QW0A 5AC4A 1NFOA 2QTVA 3OA1A 3SXYA 1H7IA 5L0GA 4C7OA 3DAGA 3LNMB 3H65A 2PX0A 4CS8C 2J0WA 3HNIA 5AGFA 3S28A 2R7OA 1L7CA 2YLDA 3AG2C 3PMRA 1Z7Qc 3SXKA 4YN0B 1T9KA 3CZ6A 3W2VA 1C17M 3HLZA 1WOLA 1A0BA 2GWWA 2CYDA 2L81A 2ZPAA 3MYFA 1TR2A 1E86A 5B3IA 3T9OA 3GM2A 2WZGA 1O3UA 2JD3A 2DYSC 2I8BA 1E84A 1FMWA 4PFOA 5KYYA 2R7UA 2NSFA 4CBEA 3L8JA 1R5ID 4J7TA 2VB6A 4IGGA 4WGZA 2AU5A 2M64A 3ATPA 3FAPB 1CGOA 4M63A 5COGA 5CI8A 1AUEA 2HSBA 3B71A 3E9VA 4OIRF 1SMYF 4PJMA 4YK5A 3CEXA 3GANA 4LLCA 1VYIA 3C7JA 1VOMA 4AL1A 4FWVA 4PR9A 1F1MA 2V26A 1WATA 2YVKA 2J9UA 3V5XA 2XLEA
chains in the Genus database with same CATH topology
3RQFA 5F28E 1OW7A 3U0CA 1JOGA 1WOLA 1KNYA 1WTYA 3K7DA 2JX0A 4NQFA 3L8IA 3TULA 1K40A 2JPUA 2L6FA 3GM1A 2L6GA 3GM2A 3JYYA 1K04A 3JZ0A 4XEFA 3RQGA 3RQEA 1O3UA 1UFBA 3U3FA 1V4AA 2Q00A 3C8GD 3S9OA 1OW8A 2YWAA 3L8JA 1OW6A 3C8GA 4EBJA 3BRJA 1K05A 1PV3A 2LK4A 4XEKA 3B71A 2HSBA 4EBKA 2L6HA 3AJMA 1KTMA 1QVXA 3C8GB 3C18A 3GM3A 1ZZPA 4R32A 3MFNA 2PBEA 1WWPA 2KK1A 3O10A 4XEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQF A;  5F28 E;  1OW7 A;  3U0C A;  1JOG A;  1WOL A;  1KNY A;  1WTY A;  3K7D A;  2JX0 A;  4NQF A;  3L8I A;  3TUL A;  1K40 A;  2JPU A;  2L6F A;  3GM1 A;  2L6G A;  3GM2 A;  3JYY A;  1K04 A;  3JZ0 A;  4XEF A;  3RQG A;  3RQE A;  1O3U A;  1UFB A;  3U3F A;  1V4A A;  2Q00 A;  3C8G D;  3S9O A;  1OW8 A;  2YWA A;  3L8J A;  1OW6 A;  3C8G A;  4EBJ A;  3BRJ A;  1K05 A;  1PV3 A;  2LK4 A;  4XEK A;  3B71 A;  2HSB A;  4EBK A;  2L6H A;  3AJM A;  1KTM A;  1QVX A;  3C8G B;  3C18 A;  3GM3 A;  1ZZP A;  4R32 A;  3MFN A;  2PBE A;  1WWP A;  2KK1 A;  3O10 A;  4XEV A; 
#chains in the Genus database with same CATH topology
 3O39 A;  1FFH A;  1R4T A;  2A6E F;  3G4X A;  4WAB A;  4MTO A;  3NG1 A;  1KU2 A;  4KNV A;  4BJT A;  1LKX A;  3B9Q A;  4O7G A;  5K0I A;  4BG0 A;  1CPQ A;  1YAR O;  2Q3T A;  3IEE A;  1PD0 A;  2XLV A;  1HY5 A;  4U5E E;  1JPJ A;  2Q00 A;  3U2M A;  3JCU Q;  1QSP A;  4GQH A;  3DJN B;  4MS2 A;  4KI2 A;  4Z9H A;  1ZW2 A;  4N6C A;  3GWL A;  2G3K A;  1YYJ A;  3GEI A;  3T6J A;  4CDA A;  3EHM A;  3SZR A;  1M2O A;  1NBB A;  2QLA A;  2VCA A;  2R05 A;  4KC9 A;  4KNW A;  4CIP A;  4E7Z A;  2R7S A;  3FOO A;  4K7B A;  4U5D E;  3HKK A;  4BJ5 C;  5KYU B;  5KYX B;  1JRA A;  3AGU A;  3I4U A;  4U5F E;  3TJ6 A;  2XM0 A;  3S84 A;  4I3M A;  1M2V A;  3MFN A;  5L0I A;  3LLK A;  5T3W A;  3LJB A;  3FOP A;  3C8Z A;  3EGD A;  1L3P A;  5F28 E;  3RQF A;  4BPM A;  2EPM X;  1OCC C;  3H2V A;  3QVY A;  1YA7 O;  4EWC A;  4YT2 A;  1N1C A;  4I44 A;  4A2N B;  3ABL C;  1K40 A;  3A11 A;  1M2V B;  3OWT A;  1GS9 A;  3FXH A;  5E33 A;  4UDV A;  3TQO A;  3IQ5 A;  3EGD B;  3DM9 B;  3KH2 A;  2D4U A;  3L1M A;  4JEB A;  2UUI A;  1JR8 A;  2LIG A;  4K1O A;  4Q4Z F;  4NC3 A;  2OEX A;  2YL1 A;  3EFO A;  1OR3 A;  3BRJ A;  3K1I C;  5BQG A;  4NTF A;  3IQC A;  5EHH A;  4DXW A;  4MTF A;  4QDL A;  1U0B B;  3FMS A;  1BR4 A;  1VMA A;  2YL0 A;  1Z5Z A;  1KTM A;  1OCZ C;  1IW7 F;  2YZS A;  3EG9 A;  3S90 A;  2X51 A;  3NMK A;  4O6N A;  5F5F A;  2DYR C;  2OKU A;  2ICW G;  3O6X A;  3DWW A;  1ST6 A;  4AE4 B;  1TWA A;  3O10 A;  4E0H A;  4JCZ A;  1Z3I X;  4JIO A;  3GOD A;  1LPE A;  4U9E A;  4JJG A;  3AG4 C;  3EH2 A;  3F47 A;  5JP7 A;  3TUL A;  1NU7 D;  2HUJ A;  5B1A C;  3AG1 C;  4IB4 A;  1GGQ A;  2VC9 A;  4MVS A;  3M15 A;  4PJJ A;  4DRJ B;  4CSA C;  1YDI A;  2YL3 A;  1YJG A;  3EGX A;  2WVN A;  1T6U A;  3DAF A;  3DZA A;  2TMV P;  2WZF A;  3E70 C;  3N24 A;  1V55 C;  2OQM A;  2OJE D;  3JSE O;  2XLO A;  3KKB A;  1MMD A;  1Z6A A;  4JCH A;  3JRM O;  3U8V A;  5JLI A;  2MYS A;  2Q9A A;  1ZHW A;  3AQB A;  5D91 A;  3RH3 A;  3MBG A;  1J8Y F;  4OIQ F;  5DLJ A;  2XXA B;  1QKR A;  2R25 A;  4PFP A;  3WAQ A;  4BJ1 A;  2IM8 A;  1VYK A;  2LCH A;  1A41 A;  1O87 A;  2LFD A;  4PJN A;  2AVK A;  2XL4 A;  4EHP A;  2JPU A;  2L6F A;  2OOC A;  1NZE A;  2HZ8 A;  2HJ3 A;  1TQG A;  3TJ5 A;  5A6J A;  3HJC A;  1MMA A;  2V3C C;  2GA0 A;  1RJ9 A;  2Y39 A;  1BDJ B;  3HNK A;  2IYL D;  2Y3H A;  4XQ1 A;  1OR2 A;  3JRT A;  4J32 B;  3Q7L A;  1V74 B;  2EIM C;  2PF4 E;  2RSE B;  3VYW A;  3B0V C;  1U89 A;  4XEK A;  2Z15 A;  2HMQ A;  1WAS A;  3LS1 A;  1VK5 A;  2PP4 A;  2J45 A;  4QI2 A;  3MX3 A;  2HV6 A;  1YYX A;  1RJ9 B;  2A1D D;  3U9J A;  3DI5 A;  4CJG A;  3QTH A;  4D4X A;  4DJ9 A;  3NMI A;  3EPV A;  1M6T A;  1C03 A;  2ZXR A;  1D1B A;  2HV7 A;  3RFY A;  4P6I C;  4ER9 A;  4O6M A;  2O9X A;  3A9C A;  1D0Z A;  2J7P A;  2W4M A;  3ZSU A;  5D92 A;  4J30 B;  3U0C A;  4CSA A;  1J8M F;  2VH3 A;  1AVO B;  2G3V A;  2J46 A;  2NSG A;  3LEO A;  4U5G A;  3U8P A;  1ZVZ A;  5JRA A;  2Y3G A;  2Q9B A;  5JUA A;  1Q0M A;  1I4Z A;  2L7A A;  1QZX A;  1T6Q A;  4LAC B;  3AGT A;  3H2U A;  1GM5 A;  2YWA A;  3ABM C;  2ZD9 A;  3ZQV A;  1CGM E;  4DRI B;  1B68 A;  2NUP B;  2PX3 A;  4FX5 A;  3IQ6 A;  4I1O B;  4MVR A;  3B0U X;  1Q0D A;  1LS4 A;  3GOR A;  1Z63 A;  4EIY A;  3KMI A;  2H7B A;  2KJG A;  1YZA A;  3RVZ A;  4JC7 A;  2NPU A;  1LS1 A;  4O79 A;  1LI5 A;  2D5R B;  3FDQ A;  3QW1 A;  5A6A A;  1SZI A;  4A4A A;  4JTC B;  2XM4 A;  3PCV A;  2Y3D A;  2NG1 A;  3O55 A;  4BJ6 A;  4O6Y A;  4PJL A;  3KPH A;  2YKZ A;  4DBQ A;  2GFH A;  3B29 A;  4JEA A;  3J06 A;  4OIN F;  4RBN A;  1QLE C;  1OXB A;  2LQG A;  1YZC A;  4WGY A;  3V5Z A;  4WJ0 A;  2R03 A;  3ZG1 A;  5KYN A;  4I1M A;  2I15 A;  3R2P A;  3ZIB A;  3U3F A;  1XZQ A;  4NTA A;  1XWJ A;  2HSQ A;  4MVZ A;  5KYU A;  5KYX A;  4W8K A;  1M57 C;  1TFO B;  3DM5 A;  3HNJ A;  5DS6 A;  4G7Z F;  2P1A A;  2XSE A;  2R7X A;  1PV3 A;  1OCO C;  2LK4 A;  4MVO A;  2YLI A;  5KYW B;  4EBK A;  4ZLD A;  3EJN A;  2C04 A;  3RIP A;  3G50 A;  4NCQ A;  3ABK C;  4CIH A;  3UGO A;  1MND A;  1PD1 A;  2FFH A;  2LFF A;  4Q7C A;  4PAC A;  4JZA A;  2J7P D;  4XWJ A;  3IQT A;  1V54 C;  1TWH A;  4IAR A;  4P9T A;  4XEV A;  5HV9 A;  3ZVR A;  4HFK B;  4XTK A;  4EBB A;  2J9W A;  4ONS A;  4E18 A;  5L0H A;  3SXZ A;  3QMK A;  1EI7 A;  3JTL O;  3SP1 A;  1T6I A;  1V4A A;  4CS9 A;  2GAQ A;  4Q5S F;  3NYL A;  2R7T A;  5L0C A;  4FAP B;  2J8W A;  5E2Q A;  3PHF 2;  1Z23 A;  3ZTZ A;  1OKK A;  4GEH A;  1D1C A;  2HS5 A;  3LS0 A;  1LM3 B;  1LE4 A;  2OG2 A;  2XLM A;  3B0P A;  3N2Z B;  4AE4 A;  4MW8 A;  1LE2 A;  1ZYR F;  1BR1 A;  3GM3 A;  2A0U A;  4OD4 A;  3U9M A;  1TKN A;  2R02 A;  5COM A;  3RVY A;  5JS5 A;  1EA8 A;  3KYJ A;  5L3Q A;  3U3B A;  2KW3 C;  1C02 A;  2EPO A;  3WG7 C;  5BQH A;  2R9R B;  2Y3B A;  2YQY A;  2PNO A;  1OW7 A;  2BC5 A;  1JMW A;  2BL2 A;  4U5B E;  2F22 A;  2GDC A;  4LER A;  4BEM J;  4MTG A;  1YA9 A;  4CS7 A;  1AEP A;  5HSW A;  1VLS A;  3N0T A;  3RF3 A;  3UGP A;  3R7C A;  3T6B A;  3TOM A;  2RD9 A;  3KL4 A;  1OQC A;  3CAX A;  5A6K A;  5L0D A;  2E87 A;  2HJM A;  2VAS A;  4U5C E;  3SEO A;  3AG3 C;  3Q6N A;  2G62 A;  2MWQ A;  2XXA A;  4XPW A;  2L6H A;  1H9G A;  3DJU B;  3U5S A;  4C3D A;  3ASO C;  4CDY A;  2KK1 A;  2EIL C;  1BBH A;  4G0H A;  1I4Y A;  2ASR A;  2L9J A;  3V5Y A;  3EH1 A;  3LAY A;  4EKW A;  1EKY A;  3W8I A;  1FMV A;  2CCY A;  3RYL A;  1WTY A;  1WGW A;  2EPN A;  3K1H A;  2WB7 A;  2XLH A;  3MLG A;  4X0R A;  2W4B A;  4ZLC A;  1SF8 A;  1NG1 A;  2W45 A;  4OIO F;  4HE8 D;  1E85 A;  4HFF B;  1NSG B;  2W9Y A;  4JJF A;  3UMK A;  2Q4F A;  2Q7R A;  3C63 A;  2IXP A;  4YT5 A;  2IBF A;  1QQ3 A;  4YT8 A;  4BJ6 C;  1IZM A;  3M1C B;  4JRZ A;  1TWC A;  4K0D A;  2A0B A;  256B A;  3W8H A;  3LNR A;  1HW1 A;  1OKK D;  4L6R A;  1E83 A;  3G4Z A;  1A7V A;  1FFT C;  1RCP A;  2XLD A;  4MQ9 F;  4AK9 A;  4E0I A;  4DBR A;  1VTM P;  3OEO A;  3C8G B;  3JYH A;  4N6H A;  3DKA A;  4HEA J;  4C3B A;  1Q0F A;  3ITF A;  2IXO A;  2VCC A;  3ZC4 A;  3CQZ A;  5JVE A;  4RD9 A;  1OCR C;  2YLG A;  1TWG A;  4AL0 A;  5DS4 A;  2KC3 A;  1A7D A;  3L0I A;  1YLM A;  3S0X A;  3RKO F;  3HTK C;  2VCB A;  2QUP A;  2ZXP A;  4C3E A;  4MVU A;  2XL8 A;  2IXN A;  1RKE A;  2NUP A;  4MND A;  1DOV A;  1RXQ A;  2WZL A;  1JPN A;  1UFB A;  2OEV A;  2R7W A;  4LDK A;  3X2Q C;  2NUT B;  3S9O A;  3SXM A;  1MMG A;  1YVI A;  1S7Z A;  5CI9 A;  1D0X A;  3RW0 A;  1OW6 A;  4OD5 A;  3VM6 A;  5BQI A;  3K33 A;  1RKE B;  2P61 A;  3AQC A;  1YAU O;  1MMN A;  1HMO A;  2HKV A;  2ZXW C;  3IPM O;  1FNT c;  2CNW D;  2XLW A;  4CS9 C;  3IHU A;  3V7O A;  2EIN C;  4J7Y A;  2M4E A;  4LLE A;  4XPY A;  3NKE A;  4R32 A;  2MHR A;  5DQZ A;  2PBE A;  4EUK B;  4YWQ A;  2DGJ A;  4JUR I;  3JSZ A;  4F4B A;  1FR0 A;  4N4W A;  2HFI A;  3T6G B;  4B6I A;  4C7O B;  3HNL A;  1QPU A;  3L34 A;  4N06 A;  3NMJ A;  1EQ1 A;  3Q7G A;  3GM1 A;  2L6G A;  2J0X A;  4QI0 A;  1SR2 A;  2A6H F;  1K04 A;  5GPG B;  3RQG A;  2R7R A;  1RMV A;  2AWC A;  4FES A;  3GWN A;  4NY3 A;  2LSE A;  3LEV A;  3MYI A;  4NTB A;  1BR2 A;  2C03 A;  3C8G D;  3I5P A;  4YL3 A;  3ZDL A;  4DOZ A;  1H6G A;  2ETS A;  4DVZ A;  4E17 A;  1VLT A;  5KYW A;  3UNG C;  2ZXO A;  2CW0 F;  1HW2 A;  3C62 A;  2IXM A;  2R7V A;  3U2L A;  5KYY B;  3NDB B;  1O5H A;  1DOW A;  1G5Z A;  2AP3 A;  4G7H F;  5EGY A;  4GYT A;  2B0H A;  4KBL A;  5FCL A;  2XRH A;  3C18 A;  3QZC A;  1WWP A;  4BEJ A;  3ASN C;  3FAJ A;  3TOL A;  2QE9 A;  3VAY A;  4H54 A;  3QVZ A;  4W8P A;  2QY9 A;  3DXJ F;  3K7D A;  4OIP F;  4JKV A;  3L8I A;  1G4W R;  1OXK A;  3WHN A;  5E3A A;  2WVQ A;  3JT1 A;  3LUT B;  4XEF A;  1LIH A;  2EIJ C;  3PDM P;  2EPL X;  2OJQ A;  3FHD A;  2X0C A;  1T01 A;  3GEE A;  1W2W A;  2B0J A;  3DD7 A;  5CIV A;  3GEH A;  1ZW3 A;  2YEV A;  4CS8 A;  3LLI A;  1MNE A;  4PK4 A;  4U5H A;  5A6B D;  2LP4 A;  1ZHY A;  2AWY A;  5A69 A;  2A68 F;  1RKC A;  2J9V A;  2KGO A;  1CPR A;  1VB5 A;  4IRU A;  1Q0G A;  2Y69 C;  4MVQ A;  2XL6 A;  2LD6 A;  1NLX A;  5TJ5 E;  2EIK C;  4YT4 A;  5BUO A;  1Q0K A;  4JTD B;  1ORJ A;  2Q9C A;  1KNY A;  1GQA A;  2YL7 A;  2JX0 A;  3NYJ A;  4H4K C;  4MVM A;  4NQF A;  5JSL A;  1ZU4 A;  1NFN A;  1WN0 A;  3FVY A;  1E2X A;  4JE9 A;  3JYY A;  1LVK A;  5COF A;  3SYN A;  3US6 A;  3NRH A;  4IAO A;  5DVW A;  1ORS C;  1OW8 A;  3BEH A;  2HMZ A;  4U9D A;  3ZWI A;  4JTA B;  4IAQ A;  3S27 A;  2DB4 A;  3LES A;  1CGN A;  3CSK A;  3TD7 A;  4DVY P;  2YHS A;  1ORY A;  1D0Y A;  1H9T A;  1T5O A;  1ZU5 A;  2XS1 A;  3AJM A;  2OCC C;  4D4N A;  2PFD A;  3VF0 A;  3DE9 A;  3EFO B;  2KNH A;  2FAP B;  2CGE A;  2WVO A;  4XLN F;  1ZZP A;  2P0N A;  2CNW A;  1M56 C;  4LDQ A;  2H7O A;  3ZQY A;  4CJO A;  4YL0 A;  3M4B A;  4JW1 A;  3SNH A;  4CX9 A;  5DS5 A;  2R7Q A;  3TK0 A;  3EQL F;  4G7O F;  2IOQ A;  3UMH A;  5E3C A;  3EG9 B;  5DQT A;  4XLP F;  1S05 A;  3M79 A;  1U6H A;  1ZHT A;  2EPK X;  4Z9J A;  1FAP B;  3RQE A;  4BJ5 A;  4YL1 A;  2KSF A;  4MW3 A;  1G4U S;  1PCX A;  2KYH A;  2QNL A;  2BE5 F;  3NYM A;  4CDV A;  1ZHZ A;  5JT4 A;  2UUH A;  3ZTM A;  2A69 F;  2H7V C;  3C8G A;  1NU9 C;  3DE8 A;  4LDR A;  4ULW A;  1UG7 A;  3EZH A;  4Z9I A;  3X1O A;  2CDQ A;  3UMI A;  4EBJ A;  5L0J A;  4DRH B;  1HE1 A;  5IY5 C;  2DI3 A;  5B1B C;  2P7V A;  5T3T A;  3K6B A;  3EZI A;  1QVX A;  3EGX B;  1I5N A;  3K66 A;  1TFK B;  4P9F A;  4XPX A;  4RDA A;  1JAF A;  5L3V A;  4AX2 A;  1Y4C A;  1BZ4 A;  4JVS A;  3T4R A;  3KYI A;  1HMD A;  1SYQ A;  1APC A;  3F46 A;  4ULV A;  1MQV A;  1JOG A;  1XZP A;  2YRF A;  3K1I A;  3Q6M A;  4YJW A;  5EK0 A;  5FZT A;  2NUT A;  3UR3 C;  3W2W A;  5B3S C;  4G78 A;  3M4C A;  4ANJ A;  5AC5 A;  2J9B A;  2WL8 A;  3JZ0 A;  1FTS A;  2XS8 A;  4IWB A;  3W4Y A;  4IJJ A;  3POV A;  2OU6 A;  5T1D B;  2KQ9 A;  3S29 A;  1Y6D A;  3DMD A;  3VRC A;  3EHN A;  3WOD F;  2FGY A;  1HE9 A;  5L0F A;  5F5H A;  1ZHX A;  1K05 A;  3I5Q A;  2P6V A;  1D1A A;  1A7E A;  3NKD A;  1G8X A;  2H8A A;  3AOU A;  5A6B A;  4E7S A;  1LI7 A;  3ECS A;  3QW0 A;  5AC4 A;  1NFO A;  2QTV A;  3OA1 A;  3SXY A;  1H7I A;  5L0G A;  4C7O A;  3DAG A;  3LNM B;  3H65 A;  2PX0 A;  4CS8 C;  2J0W A;  3HNI A;  5AGF A;  3S28 A;  2R7O A;  1L7C A;  2YLD A;  3AG2 C;  3PMR A;  1Z7Q c;  3SXK A;  4YN0 B;  1T9K A;  3CZ6 A;  3W2V A;  1C17 M;  3HLZ A;  1WOL A;  1A0B A;  2GWW A;  2CYD A;  2L81 A;  2ZPA A;  3MYF A;  1TR2 A;  1E86 A;  5B3I A;  3T9O A;  3GM2 A;  2WZG A;  1O3U A;  2JD3 A;  2DYS C;  2I8B A;  1E84 A;  1FMW A;  4PFO A;  5KYY A;  2R7U A;  2NSF A;  4CBE A;  3L8J A;  1R5I D;  4J7T A;  2VB6 A;  4IGG A;  4WGZ A;  2AU5 A;  2M64 A;  3ATP A;  3FAP B;  1CGO A;  4M63 A;  5COG A;  5CI8 A;  1AUE A;  2HSB A;  3B71 A;  3E9V A;  4OIR F;  1SMY F;  4PJM A;  4YK5 A;  3CEX A;  3GAN A;  4LLC A;  1VYI A;  3C7J A;  1VOM A;  4AL1 A;  4FWV A;  4PR9 A;  1F1M A;  2V26 A;  1WAT A;  2YVK A;  2J9U A;  3V5X A;  2XLE A; 
#chains in the Genus database with same CATH homology
 3RQF A;  5F28 E;  1OW7 A;  3U0C A;  1JOG A;  1WOL A;  1KNY A;  1WTY A;  3K7D A;  2JX0 A;  4NQF A;  3L8I A;  3TUL A;  1K40 A;  2JPU A;  2L6F A;  3GM1 A;  2L6G A;  3GM2 A;  3JYY A;  1K04 A;  3JZ0 A;  4XEF A;  3RQG A;  3RQE A;  1O3U A;  1UFB A;  3U3F A;  1V4A A;  2Q00 A;  3C8G D;  3S9O A;  1OW8 A;  2YWA A;  3L8J A;  1OW6 A;  3C8G A;  4EBJ A;  3BRJ A;  1K05 A;  1PV3 A;  2LK4 A;  4XEK A;  3B71 A;  2HSB A;  4EBK A;  2L6H A;  3AJM A;  1KTM A;  1QVX A;  3C8G B;  3C18 A;  3GM3 A;  1ZZP A;  4R32 A;  3MFN A;  2PBE A;  1WWP A;  2KK1 A;  3O10 A;  4XEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...