4R32A

Crystal structure analysis of pyk2 and paxillin ld motifs
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
132
structure length
132
Chain Sequence
LDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 132
sequence length 132
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4r32A00
1O3UA 2HSBA 1OW8A 3GM2A 3RQFA 3GM3A 2L6HA 1K04A 3K7DA 3C8GB 3JYYA 4EBJA 4EBKA 1OW6A 3AJMA 1V4AA 3S9OA 2L6GA 3C8GD 2KK1A 4NQFA 4XEFA 3C8GA 3L8IA 1KNYA 2PBEA 3C18A 3B71A 4R32A 3O10A 1OW7A 1WTYA 2LK4A 3JZ0A 5F28E 1UFBA 3RQEA 4XEKA 1JOGA 2JX0A 1WWPA 1ZZPA 3L8JA 3RQGA 1PV3A 3MFNA 1WOLA 2Q00A 3BRJA 3U3FA 3GM1A 1K05A 2L6FA 3U0CA 1QVXA 2YWAA 1KTMA 3TULA 1K40A 2JPUA 4XEVA
chains in the Genus database with same CATH superfamily
2CNWD 4JC7A 3ABMC 4NC3A 4BJ5A 1T6UA 1G5ZA 1NU7D 3LEVA 4XPXA 3NMKA 4LERA 2IOQA 1CPRA 1HE1A 5L0FA 1YDIA 1RKCA 2G3VA 3I5QA 2VCCA 4U5HA 2KK1A 3TJ6A 2ZXRA 4EBBA 5KYNA 2R7WA 2NUPA 3RF3A 4CDVA 3DKAA 3H65A 1KNYA 1O5HA 2OKUA 4JIOA 4H4KC 4U5EE 4KNWA 3FMSA 2CW0F 2R25A 4Z9JA 3U2LA 4CJOA 2HKVA 1NLXA 2PX3A 3GWLA 3JZ0A 4BEMJ 3S29A 5IY5C 1I5NA 1TKNA 2NUTA 5JSLA 3T4RA 2YHSA 1VMAA 2HSQA 1MNEA 2AP3A 2KQ9A 3L8JA 4U5DE 3RQGA 1LPEA 3R2PA 4BEJA 2PP4A 4H54A 4KNVA 4XPWA 3GEIA 1RJ9B 4DRJB 4C3BA 1R5ID 3NG1A 3QVYA 2PNOA 3TULA 4I44A 1XWJA 3CEXA 4A2NB 4DVZA 1BR1A 2QY9A 1Z23A 3AG4C 1RJ9A 3EPVA 3KMIA 4MVSA 4MVOA 2OJED 4A4AA 2V26A 4KC9A 1BBHA 3GORA 4CX9A 3RH3A 4XQ1A 4JURI 2EILC 3ASOC 1NFOA 4MVQA 3OEOA 4NQFA 5DVWA 4EUKB 2Y3GA 1CPQA 3E9VA 5DS6A 3CAXA 1H6GA 1S7ZA 3S90A 3TK0A 1D0ZA 5KYYA 1TFKB 1AEPA 1Q0MA 2R05A 3B71A 4JCHA 5AC4A 5L3VA 1VLTA 1QZXA 2JX0A 2GFHA 2AVKA 1LS4A 3FOPA 4O6MA 3V5XA 4B6IA 2Y69C 3L34A 3LUTB 4NY3A 4PJLA 3LS1A 5T3WA 1NZEA 5F5HA 3VF0A 1H9GA 4IAOA 2OQMA 2EPOA 1C17M 1N1CA 1HE9A 2R03A 3C62A 3U8PA 4CS8A 1A7DA 5KYUA 1T9KA 2GAQA 2MYSA 3VM6A 2HJMA 4C7OA 5F5FA 1ZHTA 1U89A 1GGQA 1YA9A 4PFOA 4XTKA 5KYXB 3PMRA 4XPYA 1V4AA 3SZRA 2KC3A 2GDCA 2LCHA 2O9XA 5L0DA 1RMVA 2EPNA 2OJQA 1YA7O 2YL1A 5K0IA 1YYXA 2VC9A 3IQ6A 2Q7RA 1JMWA 3J06A 2A6EF 4YN0B 5A6JA 3ZVRA 1VB5A 3AGTA 2I15A 2A0BA 2VH3A 3O39A 3QTHA 4NTBA 3U3BA 3G4XA 4ULWA 4G7OF 2UUHA 1G4WR 1WGWA 4JTDB 2CDQA 3HNIA 4XEKA 2R7TA 3T6JA 1YJGA 3WG7C 1Z6AA 4BJ6C 2BE5F 3ZIBA 2IXNA 1EKYA 2CCYA 2Q00A 3S27A 2P61A 3WHNA 1K05A 1HW1A 3EGDB 3S84A 3AOUA 5KYWB 1I4YA 3SP1A 4CS7A 1XZQA 2J9WA 3NMIA 3NDBB 3ZTZA 1O3UA 3LS0A 4WGYA 4ZLCA 1FR0A 5JLIA 4CSAC 3GM3A 1TQGA 3R7CA 4AE4B 2QE9A 4BG0A 3C8GB 5KYWA 4EBKA 1PCXA 3K66A 4YT4A 2YLGA 4DVYP 1QQ3A 3JSEO 3ZDLA 1MMGA 4YT8A 4YJWA 3MLGA 3ABKC 5HV9A 1EQ1A 4HEAJ 3TOLA 3EFOB 1M2OA 1S05A 2UUIA 2OCCC 1UFBA 3EH2A 3H2UA 2R9RB 3NYLA 3VAYA 4OIQF 2WL8A 1XZPA 4IWBA 3SXYA 3RKOF 1ST6A 2R7XA 1QKRA 4PACA 5JT4A 2Q9AA 2YL7A 3DE9A 2IYLD 1RKEB 2P7VA 4O6NA 1OCOC 4DBRA 4F4BA 5A6BD 1LKXA 4M63A 3ZG1A 1VYKA 2A0UA 4RD9A 5E2QA 3TOMA 4IGGA 5HSWA 1E85A 3EZHA 5AC5A 3UGPA 2WVOA 3ZQVA 2XXAA 5L0JA 2XSEA 3W4YA 4W8PA 2FGYA 2J0WA 3NKDA 3LNMB 1C03A 3ZWIA 3AG1C 1V54C 3EHNA 2FFHA 3SYNA 1G4US 3W2VA 4BJTA 3SEOA 4E17A 3AG2C 3U2MA 4OIPF 4WABA 4CJGA 1Z7Qc 1WWPA 3UGOA 2JD3A 1T6QA 3K6BA 3O6XA 1Z5ZA 3LLIA 3Q7LA 3UMHA 2HV6A 5D92A 4E7ZA 3UR3C 1E83A 1SYQA 4FWVA 1H9TA 2HSBA 4MQ9F 1OR2A 4D4NA 2CNWA 2XS1A 3PDMP 3MYFA 2YL0A 3DAGA 4HFKB 1TFOB 2W4MA 4LDRA 4RDAA 3NYMA 4WJ0A 4OINF 2PF4E 1AVOB 2L81A 4Z9HA 5JP7A 4WGZA 1I4ZA 1TWHA 1BDJB 2J8WA 4LLCA 1JPNA 1M2VB 2GA0A 2H7OA 2VASA 2W4BA 4DRIB 2NPUA 3FDQA 1FTSA 1H7IA 4G0HA 3TQOA 5F28E 3U9MA 3LLKA 1VOMA 5BUOA 2R7RA 1M2VA 3LNRA 4JKVA 3CSKA 2A6HF 5L0CA 2LSEA 4MW8A 3T6GB 1EI7A 5D91A 3M15A 4QI2A 2J7PA 2VCAA 256BA 2H8AA 3SXKA 4E0IA 3Q6MA 2FAPB 2XLMA 3CQZA 2OG2A 4U5GA 3V5YA 1Z63A 2XRHA 1ZYRF 2A68F 3DXJF 1J8MF 4OIRF 3S9OA 5JRAA 2OU6A 4AX2A 2HMZA 3Q6NA 4BJ1A 1GQAA 2Q9CA 3AGUA 1D0XA 2B0JA 2M64A 5BQGA 3IQTA 3GODA 4CIPA 4BPMA 3K1IC 4QI0A 4AL0A 1C02A 3DI5A 4MVMA 1JAFA 2J9BA 2WB7A 3U5SA 3X1OA 4CBEA 4DOZA 4EIYA 3AQBA 1TWGA 2D5RB 1F1MA 2EIKC 3MFNA 3RVZA 1Y4CA 3QW0A 2EPLX 2P0NA 2KNHA 2HJ3A 4JW1A 5L0GA 2I8BA 2IXPA 4LDKA 3NRHA 2ZXPA 2R7OA 4NTAA 4Q4ZF 4U5CE 1GM5A 4IJJA 4YL3A 4EWCA 4HE8D 1A41A 2A1DD 4O7GA 4XLNF 3B0UX 5TJ5E 1LI5A 4J7YA 1NU9C 4XEFA 4XLPF 3KL4A 5L0HA 2WZFA 4MVUA 3K1HA 1OKKA 4DRHB 5KYXA 1HMOA 5AGFA 4HFFB 4IRUA 1FMVA 3QMKA 1MMNA 5JS5A 2R7UA 3VRCA 4UDVA 1M56C 5B3SC 4GEHA 1V55C 1ZZPA 2Y3HA 3U3FA 4JEBA 3PHF2 3IQCA 4U9EA 1HW2A 3SNHA 2G62A 2HMQA 2YWAA 3RVYA 1D1BA 3CZ6A 4FAPB 3U9JA 2KJGA 1O87A 3MBGA 3NYJA 3X2QC 4IAQA 2H7BA 3JSZA 3EGDA 2XL6A 1WASA 2OOCA 1MNDA 3AJMA 2AU5A 2XL8A 3PCVA 4JEAA 3VYWA 2YL3A 5DS5A 4YK5A 1T01A 4K7BA 1OCCC 2DI3A 3LEOA 3QW1A 2YZSA 1HY5A 4AE4A 3FAPB 4J7TA 2KW3C 3C8GA 4G7ZF 1YLMA 1D1CA 2XM4A 2J46A 2NSGA 2LD6A 4ZLDA 2C04A 2YLDA 2Q9BA 5CI9A 1MMAA 2H7VC 4R32A 3A11A 3IQ5A 3RQEA 2IBFA 1VYIA 2BL2A 2Q4FA 1YYJA 2IXOA 1L7CA 2J9UA 1CGNA 4P9FA 1JR8A 3EFOA 5EHHA 3FAJA 3C63A 3FXHA 1K40A 2JPUA 4AL1A 1QLEC 3GM2A 4N6HA 4N4WA 4BJ5C 3ZTMA 3OWTA 3KYIA 4MW3A 2B0HA 2TMVP 5GPGB 1LE2A 3HNJA 3EHMA 3HLZA 3OA1A 3EG9B 1RKEA 5L0IA 1MQVA 3UNGC 2L6GA 1B68A 2OEVA 2VB6A 3TD7A 3F46A 4ONSA 4QDLA 1T5OA 2CGEA 3EG9A 3GEHA 1R4TA 1KU2A 4X0RA 1OW7A 1PD0A 4MNDA 1TR2A 2HS5A 2LIGA 3S28A 1NFNA 1ZW3A 2L7AA 3GWNA 1OXKA 3A9CA 5EK0A 1Q0DA 4BJ6A 1RXQA 2DB4A 2XM0A 2YVKA 4OIOF 4PJNA 1ZU5A 1EA8A 2C03A 3B29A 4IARA 4YL1A 3US6A 2EIJC 3O55A 2XLHA 3W8HA 1UG7A 1KTMA 4OD5A 2GWWA 1SMYF 1OW8A 4CSAA 3RQFA 4K0DA 3MX3A 3LESA 1Q0FA 4JRZA 4MVZA 2PX0A 1D1AA 3I4UA 4MTFA 1FMWA 4OD4A 3SXZA 2BC5A 1Q0GA 4FX5A 2VCBA 1Z3IX 4MVRA 2PBEA 1FFTC 1APCA 2OEXA 4JJFA 3FVYA 1YAUO 3GEEA 4AK9A 1WTYA 2WVNA 3U8VA 1JOGA 3V7OA 4N6CA 3POVA 1NBBA 4U5BE 2HFIA 2J45A 1TWAA 2CYDA 2XL4A 3T9OA 4ER9A 5DLJA 1LI7A 3L0IA 3W8IA 3RYLA 1QSPA 2ZD9A 4CS8C 4DJ9A 1GS9A 3SXMA 3E70C 2KSFA 1E84A 3IPMO 3JTLO 3G50A 4YL0A 1A0BA 2NUPB 2P1AA 3DMDA 1YVIA 1OQCA 5COFA 1G8XA 4DBQA 1LVKA 3FOOA 2R02A 1OXBA 2A69F 2EPKX 4P9TA 1ZHXA 1DOWA 3DJUB 2NUTB 4YT5A 5B1AC 3L8IA 1ZHZA 3IHUA 2HUJA 3RW0A 2DGJA 2LFDA 2XLDA 3ABLC 1CGOA 1WN0A 4XWJA 5T1DB 2X0CA 3B0VC 1OR3A 1OCZC 3JT1A 3ECSA 5E3CA 3M79A 4YWQA 1TWCA 3DD7A 3GANA 3F47A 5COMA 2AWYA 3ZC4A 4PJMA 5JVEA 1D0YA 3GM1A 3HNKA 4JJGA 2J7PD 2XLEA 2L6FA 5E33A 3L1MA 3EQLF 4PK4A 1M6TA 4U9DA 2ZXWC 5A6KA 5FZTA 4XEVA 3RIPA 1ORJA 3UMKA 1VLSA 4CDAA 1MMDA 3K7DA 1CGME 4Q5SF 1U0BB 1ORSC 1A7VA 1VTMP 5KYYB 2QTVA 4K1OA 3FHDA 3AQCA 3TJ5A 5EGYA 1V74B 4GYTA 3NMJA 4MTGA 1Y6DA 4C3DA 4N06A 5BQIA 3EZIA 2ZXOA 3N24A 4GQHA 4I1MA 3QZCA 4JTCB 3DE8A 1U6HA 4FESA 2KGOA 1ZHWA 2KYHA 4ULVA 3ZSUA 5DQTA 1IW7F 3ASNC 3N0TA 1W2WA 4CDYA 2HV7A 3B0PA 3DM9B 5KYUB 2RD9A 4C7OB 3BRJA 4JE9A 4G78A 4O6YA 1NSGB 4MTOA 3U0CA 1HMDA 1LM3B 2R7QA 2W9YA 1ZHYA 5CI8A 2X51A 2XS8A 3JRMO 3KYJA 2PFDA 2YQYA 4E7SA 1PD1A 2EIMC 5E3AA 4G7HF 1JPJA 3JYYA 4KI2A 3V5ZA 3EH1A 3DWWA 1NG1A 2NSFA 4DXWA 2ASRA 5CIVA 2V3CC 1OKKD 3KPHA 2YLIA 3K33A 4P6IC 2ICWG 4E18A 4J30B 2MWQA 3C18A 2YEVA 4CS9C 3EJNA 4JZAA 5BQHA 2LK4A 1VK5A 1ZVZA 3AG3C 1LIHA 3K1IA 3Q7GA 2QUPA 1WATA 2IXMA 2M4EA 3H2VA 5T3TA 1WOLA 5A6AA 1JRAA 2D4UA 2DYRC 3M4BA 4EKWA 2E87A 3NKEA 1YARO 5L3QA 3DJNB 2AWCA 4U5FE 1E86A 4C3EA 1LE4A 2XLOA 2RSEB 3QVZA 1SZIA 3WODF 2EPMX 4EBJA 5A6BA 1FAPB 4J32B 3HJCA 3KH2A 3JYHA 2IM8A 3WAQA 3C7JA 3C8GD 3BEHA 4KBLA 2LFFA 3B9QA 1BR4A 2WZLA 3DAFA 3KKBA 3I5PA 3W2WA 2HZ8A 1LS1A 1BR2A 3G4ZA 4O79A 4CIHA 3M1CB 1M57C 2WZGA 4L6RA 4JTAB 4LLEA 1DOVA 3O10A 4W8KA 2Y3BA 1RCPA 3RFYA 1A7EA 1ZW2A 2EINC 2F22A 4I1OB 4E0HA 2ETSA 5A69A 1FNTc 2R7SA 4MS2A 5DQZA 3MYIA 1PV3A 3ATPA 4Q7CA 3T6BA 2W45A 3C8ZA 1AUEA 1L3PA 5B3IA 1ORYA 2L9JA 3M4CA 2XXAB 2DYSC 2Q3TA 2MHRA 2YKZA 4NTFA 4PFPA 2J0XA 1OCRC 2LP4A 2G3KA 1BZ4A 2Z15A 1FFHA 4LACB 2QNLA 2L6HA 1K04A 4PR9A 5B1BC 2J9VA 3HKKA 1OW6A 4JCZA 3UMIA 3LAYA 4LDQA 4PJJA 4Z9IA 1YZAA 1ZU4A 4ANJA 3HNLA 2P6VA 3LJBA 1T6IA 4NCQA 4D4XA 2NG1A 4IB4A 4JVSA 2XLWA 3N2ZB 4CS9A 1E2XA 3JCUQ 3ZQYA 5DS4A 3S0XA 1QPUA 2ZPAA 2QLAA 1IZMA 5JUAA 2Y39A 2XLVA 4EHPA 3EGXB 3HTKC 1Q0KA 1SR2A 5COGA 2R7VA 3DM5A 3JRTA 4RBNA 2LQGA 3IEEA 1SF8A 3DZAA 5FCLA 3ITFA 2WVQA 1QVXA 2YRFA 1J8YF 3EGXA 4YT2A 4I3MA 1YZCA 2Y3DA
chains in the Genus database with same CATH topology
1O3UA 2HSBA 1OW8A 3GM2A 3RQFA 3GM3A 2L6HA 1K04A 3K7DA 3C8GB 3JYYA 4EBJA 4EBKA 1OW6A 3AJMA 1V4AA 3S9OA 2L6GA 3C8GD 2KK1A 4NQFA 4XEFA 3C8GA 3L8IA 1KNYA 2PBEA 3C18A 3B71A 4R32A 3O10A 1OW7A 1WTYA 2LK4A 3JZ0A 5F28E 1UFBA 3RQEA 4XEKA 1JOGA 2JX0A 1WWPA 1ZZPA 3L8JA 3RQGA 1PV3A 3MFNA 1WOLA 2Q00A 3BRJA 3U3FA 3GM1A 1K05A 2L6FA 3U0CA 1QVXA 2YWAA 1KTMA 3TULA 1K40A 2JPUA 4XEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3U A;  2HSB A;  1OW8 A;  3GM2 A;  3RQF A;  3GM3 A;  2L6H A;  1K04 A;  3K7D A;  3C8G B;  3JYY A;  4EBJ A;  4EBK A;  1OW6 A;  3AJM A;  1V4A A;  3S9O A;  2L6G A;  3C8G D;  2KK1 A;  4NQF A;  4XEF A;  3C8G A;  3L8I A;  1KNY A;  2PBE A;  3C18 A;  3B71 A;  4R32 A;  3O10 A;  1OW7 A;  1WTY A;  2LK4 A;  3JZ0 A;  5F28 E;  1UFB A;  3RQE A;  4XEK A;  1JOG A;  2JX0 A;  1WWP A;  1ZZP A;  3L8J A;  3RQG A;  1PV3 A;  3MFN A;  1WOL A;  2Q00 A;  3BRJ A;  3U3F A;  3GM1 A;  1K05 A;  2L6F A;  3U0C A;  1QVX A;  2YWA A;  1KTM A;  3TUL A;  1K40 A;  2JPU A;  4XEV A; 
#chains in the Genus database with same CATH topology
 2CNW D;  4JC7 A;  3ABM C;  4NC3 A;  4BJ5 A;  1T6U A;  1G5Z A;  1NU7 D;  3LEV A;  4XPX A;  3NMK A;  4LER A;  2IOQ A;  1CPR A;  1HE1 A;  5L0F A;  1YDI A;  1RKC A;  2G3V A;  3I5Q A;  2VCC A;  4U5H A;  2KK1 A;  3TJ6 A;  2ZXR A;  4EBB A;  5KYN A;  2R7W A;  2NUP A;  3RF3 A;  4CDV A;  3DKA A;  3H65 A;  1KNY A;  1O5H A;  2OKU A;  4JIO A;  4H4K C;  4U5E E;  4KNW A;  3FMS A;  2CW0 F;  2R25 A;  4Z9J A;  3U2L A;  4CJO A;  2HKV A;  1NLX A;  2PX3 A;  3GWL A;  3JZ0 A;  4BEM J;  3S29 A;  5IY5 C;  1I5N A;  1TKN A;  2NUT A;  5JSL A;  3T4R A;  2YHS A;  1VMA A;  2HSQ A;  1MNE A;  2AP3 A;  2KQ9 A;  3L8J A;  4U5D E;  3RQG A;  1LPE A;  3R2P A;  4BEJ A;  2PP4 A;  4H54 A;  4KNV A;  4XPW A;  3GEI A;  1RJ9 B;  4DRJ B;  4C3B A;  1R5I D;  3NG1 A;  3QVY A;  2PNO A;  3TUL A;  4I44 A;  1XWJ A;  3CEX A;  4A2N B;  4DVZ A;  1BR1 A;  2QY9 A;  1Z23 A;  3AG4 C;  1RJ9 A;  3EPV A;  3KMI A;  4MVS A;  4MVO A;  2OJE D;  4A4A A;  2V26 A;  4KC9 A;  1BBH A;  3GOR A;  4CX9 A;  3RH3 A;  4XQ1 A;  4JUR I;  2EIL C;  3ASO C;  1NFO A;  4MVQ A;  3OEO A;  4NQF A;  5DVW A;  4EUK B;  2Y3G A;  1CPQ A;  3E9V A;  5DS6 A;  3CAX A;  1H6G A;  1S7Z A;  3S90 A;  3TK0 A;  1D0Z A;  5KYY A;  1TFK B;  1AEP A;  1Q0M A;  2R05 A;  3B71 A;  4JCH A;  5AC4 A;  5L3V A;  1VLT A;  1QZX A;  2JX0 A;  2GFH A;  2AVK A;  1LS4 A;  3FOP A;  4O6M A;  3V5X A;  4B6I A;  2Y69 C;  3L34 A;  3LUT B;  4NY3 A;  4PJL A;  3LS1 A;  5T3W A;  1NZE A;  5F5H A;  3VF0 A;  1H9G A;  4IAO A;  2OQM A;  2EPO A;  1C17 M;  1N1C A;  1HE9 A;  2R03 A;  3C62 A;  3U8P A;  4CS8 A;  1A7D A;  5KYU A;  1T9K A;  2GAQ A;  2MYS A;  3VM6 A;  2HJM A;  4C7O A;  5F5F A;  1ZHT A;  1U89 A;  1GGQ A;  1YA9 A;  4PFO A;  4XTK A;  5KYX B;  3PMR A;  4XPY A;  1V4A A;  3SZR A;  2KC3 A;  2GDC A;  2LCH A;  2O9X A;  5L0D A;  1RMV A;  2EPN A;  2OJQ A;  1YA7 O;  2YL1 A;  5K0I A;  1YYX A;  2VC9 A;  3IQ6 A;  2Q7R A;  1JMW A;  3J06 A;  2A6E F;  4YN0 B;  5A6J A;  3ZVR A;  1VB5 A;  3AGT A;  2I15 A;  2A0B A;  2VH3 A;  3O39 A;  3QTH A;  4NTB A;  3U3B A;  3G4X A;  4ULW A;  4G7O F;  2UUH A;  1G4W R;  1WGW A;  4JTD B;  2CDQ A;  3HNI A;  4XEK A;  2R7T A;  3T6J A;  1YJG A;  3WG7 C;  1Z6A A;  4BJ6 C;  2BE5 F;  3ZIB A;  2IXN A;  1EKY A;  2CCY A;  2Q00 A;  3S27 A;  2P61 A;  3WHN A;  1K05 A;  1HW1 A;  3EGD B;  3S84 A;  3AOU A;  5KYW B;  1I4Y A;  3SP1 A;  4CS7 A;  1XZQ A;  2J9W A;  3NMI A;  3NDB B;  3ZTZ A;  1O3U A;  3LS0 A;  4WGY A;  4ZLC A;  1FR0 A;  5JLI A;  4CSA C;  3GM3 A;  1TQG A;  3R7C A;  4AE4 B;  2QE9 A;  4BG0 A;  3C8G B;  5KYW A;  4EBK A;  1PCX A;  3K66 A;  4YT4 A;  2YLG A;  4DVY P;  1QQ3 A;  3JSE O;  3ZDL A;  1MMG A;  4YT8 A;  4YJW A;  3MLG A;  3ABK C;  5HV9 A;  1EQ1 A;  4HEA J;  3TOL A;  3EFO B;  1M2O A;  1S05 A;  2UUI A;  2OCC C;  1UFB A;  3EH2 A;  3H2U A;  2R9R B;  3NYL A;  3VAY A;  4OIQ F;  2WL8 A;  1XZP A;  4IWB A;  3SXY A;  3RKO F;  1ST6 A;  2R7X A;  1QKR A;  4PAC A;  5JT4 A;  2Q9A A;  2YL7 A;  3DE9 A;  2IYL D;  1RKE B;  2P7V A;  4O6N A;  1OCO C;  4DBR A;  4F4B A;  5A6B D;  1LKX A;  4M63 A;  3ZG1 A;  1VYK A;  2A0U A;  4RD9 A;  5E2Q A;  3TOM A;  4IGG A;  5HSW A;  1E85 A;  3EZH A;  5AC5 A;  3UGP A;  2WVO A;  3ZQV A;  2XXA A;  5L0J A;  2XSE A;  3W4Y A;  4W8P A;  2FGY A;  2J0W A;  3NKD A;  3LNM B;  1C03 A;  3ZWI A;  3AG1 C;  1V54 C;  3EHN A;  2FFH A;  3SYN A;  1G4U S;  3W2V A;  4BJT A;  3SEO A;  4E17 A;  3AG2 C;  3U2M A;  4OIP F;  4WAB A;  4CJG A;  1Z7Q c;  1WWP A;  3UGO A;  2JD3 A;  1T6Q A;  3K6B A;  3O6X A;  1Z5Z A;  3LLI A;  3Q7L A;  3UMH A;  2HV6 A;  5D92 A;  4E7Z A;  3UR3 C;  1E83 A;  1SYQ A;  4FWV A;  1H9T A;  2HSB A;  4MQ9 F;  1OR2 A;  4D4N A;  2CNW A;  2XS1 A;  3PDM P;  3MYF A;  2YL0 A;  3DAG A;  4HFK B;  1TFO B;  2W4M A;  4LDR A;  4RDA A;  3NYM A;  4WJ0 A;  4OIN F;  2PF4 E;  1AVO B;  2L81 A;  4Z9H A;  5JP7 A;  4WGZ A;  1I4Z A;  1TWH A;  1BDJ B;  2J8W A;  4LLC A;  1JPN A;  1M2V B;  2GA0 A;  2H7O A;  2VAS A;  2W4B A;  4DRI B;  2NPU A;  3FDQ A;  1FTS A;  1H7I A;  4G0H A;  3TQO A;  5F28 E;  3U9M A;  3LLK A;  1VOM A;  5BUO A;  2R7R A;  1M2V A;  3LNR A;  4JKV A;  3CSK A;  2A6H F;  5L0C A;  2LSE A;  4MW8 A;  3T6G B;  1EI7 A;  5D91 A;  3M15 A;  4QI2 A;  2J7P A;  2VCA A;  256B A;  2H8A A;  3SXK A;  4E0I A;  3Q6M A;  2FAP B;  2XLM A;  3CQZ A;  2OG2 A;  4U5G A;  3V5Y A;  1Z63 A;  2XRH A;  1ZYR F;  2A68 F;  3DXJ F;  1J8M F;  4OIR F;  3S9O A;  5JRA A;  2OU6 A;  4AX2 A;  2HMZ A;  3Q6N A;  4BJ1 A;  1GQA A;  2Q9C A;  3AGU A;  1D0X A;  2B0J A;  2M64 A;  5BQG A;  3IQT A;  3GOD A;  4CIP A;  4BPM A;  3K1I C;  4QI0 A;  4AL0 A;  1C02 A;  3DI5 A;  4MVM A;  1JAF A;  2J9B A;  2WB7 A;  3U5S A;  3X1O A;  4CBE A;  4DOZ A;  4EIY A;  3AQB A;  1TWG A;  2D5R B;  1F1M A;  2EIK C;  3MFN A;  3RVZ A;  1Y4C A;  3QW0 A;  2EPL X;  2P0N A;  2KNH A;  2HJ3 A;  4JW1 A;  5L0G A;  2I8B A;  2IXP A;  4LDK A;  3NRH A;  2ZXP A;  2R7O A;  4NTA A;  4Q4Z F;  4U5C E;  1GM5 A;  4IJJ A;  4YL3 A;  4EWC A;  4HE8 D;  1A41 A;  2A1D D;  4O7G A;  4XLN F;  3B0U X;  5TJ5 E;  1LI5 A;  4J7Y A;  1NU9 C;  4XEF A;  4XLP F;  3KL4 A;  5L0H A;  2WZF A;  4MVU A;  3K1H A;  1OKK A;  4DRH B;  5KYX A;  1HMO A;  5AGF A;  4HFF B;  4IRU A;  1FMV A;  3QMK A;  1MMN A;  5JS5 A;  2R7U A;  3VRC A;  4UDV A;  1M56 C;  5B3S C;  4GEH A;  1V55 C;  1ZZP A;  2Y3H A;  3U3F A;  4JEB A;  3PHF 2;  3IQC A;  4U9E A;  1HW2 A;  3SNH A;  2G62 A;  2HMQ A;  2YWA A;  3RVY A;  1D1B A;  3CZ6 A;  4FAP B;  3U9J A;  2KJG A;  1O87 A;  3MBG A;  3NYJ A;  3X2Q C;  4IAQ A;  2H7B A;  3JSZ A;  3EGD A;  2XL6 A;  1WAS A;  2OOC A;  1MND A;  3AJM A;  2AU5 A;  2XL8 A;  3PCV A;  4JEA A;  3VYW A;  2YL3 A;  5DS5 A;  4YK5 A;  1T01 A;  4K7B A;  1OCC C;  2DI3 A;  3LEO A;  3QW1 A;  2YZS A;  1HY5 A;  4AE4 A;  3FAP B;  4J7T A;  2KW3 C;  3C8G A;  4G7Z F;  1YLM A;  1D1C A;  2XM4 A;  2J46 A;  2NSG A;  2LD6 A;  4ZLD A;  2C04 A;  2YLD A;  2Q9B A;  5CI9 A;  1MMA A;  2H7V C;  4R32 A;  3A11 A;  3IQ5 A;  3RQE A;  2IBF A;  1VYI A;  2BL2 A;  2Q4F A;  1YYJ A;  2IXO A;  1L7C A;  2J9U A;  1CGN A;  4P9F A;  1JR8 A;  3EFO A;  5EHH A;  3FAJ A;  3C63 A;  3FXH A;  1K40 A;  2JPU A;  4AL1 A;  1QLE C;  3GM2 A;  4N6H A;  4N4W A;  4BJ5 C;  3ZTM A;  3OWT A;  3KYI A;  4MW3 A;  2B0H A;  2TMV P;  5GPG B;  1LE2 A;  3HNJ A;  3EHM A;  3HLZ A;  3OA1 A;  3EG9 B;  1RKE A;  5L0I A;  1MQV A;  3UNG C;  2L6G A;  1B68 A;  2OEV A;  2VB6 A;  3TD7 A;  3F46 A;  4ONS A;  4QDL A;  1T5O A;  2CGE A;  3EG9 A;  3GEH A;  1R4T A;  1KU2 A;  4X0R A;  1OW7 A;  1PD0 A;  4MND A;  1TR2 A;  2HS5 A;  2LIG A;  3S28 A;  1NFN A;  1ZW3 A;  2L7A A;  3GWN A;  1OXK A;  3A9C A;  5EK0 A;  1Q0D A;  4BJ6 A;  1RXQ A;  2DB4 A;  2XM0 A;  2YVK A;  4OIO F;  4PJN A;  1ZU5 A;  1EA8 A;  2C03 A;  3B29 A;  4IAR A;  4YL1 A;  3US6 A;  2EIJ C;  3O55 A;  2XLH A;  3W8H A;  1UG7 A;  1KTM A;  4OD5 A;  2GWW A;  1SMY F;  1OW8 A;  4CSA A;  3RQF A;  4K0D A;  3MX3 A;  3LES A;  1Q0F A;  4JRZ A;  4MVZ A;  2PX0 A;  1D1A A;  3I4U A;  4MTF A;  1FMW A;  4OD4 A;  3SXZ A;  2BC5 A;  1Q0G A;  4FX5 A;  2VCB A;  1Z3I X;  4MVR A;  2PBE A;  1FFT C;  1APC A;  2OEX A;  4JJF A;  3FVY A;  1YAU O;  3GEE A;  4AK9 A;  1WTY A;  2WVN A;  3U8V A;  1JOG A;  3V7O A;  4N6C A;  3POV A;  1NBB A;  4U5B E;  2HFI A;  2J45 A;  1TWA A;  2CYD A;  2XL4 A;  3T9O A;  4ER9 A;  5DLJ A;  1LI7 A;  3L0I A;  3W8I A;  3RYL A;  1QSP A;  2ZD9 A;  4CS8 C;  4DJ9 A;  1GS9 A;  3SXM A;  3E70 C;  2KSF A;  1E84 A;  3IPM O;  3JTL O;  3G50 A;  4YL0 A;  1A0B A;  2NUP B;  2P1A A;  3DMD A;  1YVI A;  1OQC A;  5COF A;  1G8X A;  4DBQ A;  1LVK A;  3FOO A;  2R02 A;  1OXB A;  2A69 F;  2EPK X;  4P9T A;  1ZHX A;  1DOW A;  3DJU B;  2NUT B;  4YT5 A;  5B1A C;  3L8I A;  1ZHZ A;  3IHU A;  2HUJ A;  3RW0 A;  2DGJ A;  2LFD A;  2XLD A;  3ABL C;  1CGO A;  1WN0 A;  4XWJ A;  5T1D B;  2X0C A;  3B0V C;  1OR3 A;  1OCZ C;  3JT1 A;  3ECS A;  5E3C A;  3M79 A;  4YWQ A;  1TWC A;  3DD7 A;  3GAN A;  3F47 A;  5COM A;  2AWY A;  3ZC4 A;  4PJM A;  5JVE A;  1D0Y A;  3GM1 A;  3HNK A;  4JJG A;  2J7P D;  2XLE A;  2L6F A;  5E33 A;  3L1M A;  3EQL F;  4PK4 A;  1M6T A;  4U9D A;  2ZXW C;  5A6K A;  5FZT A;  4XEV A;  3RIP A;  1ORJ A;  3UMK A;  1VLS A;  4CDA A;  1MMD A;  3K7D A;  1CGM E;  4Q5S F;  1U0B B;  1ORS C;  1A7V A;  1VTM P;  5KYY B;  2QTV A;  4K1O A;  3FHD A;  3AQC A;  3TJ5 A;  5EGY A;  1V74 B;  4GYT A;  3NMJ A;  4MTG A;  1Y6D A;  4C3D A;  4N06 A;  5BQI A;  3EZI A;  2ZXO A;  3N24 A;  4GQH A;  4I1M A;  3QZC A;  4JTC B;  3DE8 A;  1U6H A;  4FES A;  2KGO A;  1ZHW A;  2KYH A;  4ULV A;  3ZSU A;  5DQT A;  1IW7 F;  3ASN C;  3N0T A;  1W2W A;  4CDY A;  2HV7 A;  3B0P A;  3DM9 B;  5KYU B;  2RD9 A;  4C7O B;  3BRJ A;  4JE9 A;  4G78 A;  4O6Y A;  1NSG B;  4MTO A;  3U0C A;  1HMD A;  1LM3 B;  2R7Q A;  2W9Y A;  1ZHY A;  5CI8 A;  2X51 A;  2XS8 A;  3JRM O;  3KYJ A;  2PFD A;  2YQY A;  4E7S A;  1PD1 A;  2EIM C;  5E3A A;  4G7H F;  1JPJ A;  3JYY A;  4KI2 A;  3V5Z A;  3EH1 A;  3DWW A;  1NG1 A;  2NSF A;  4DXW A;  2ASR A;  5CIV A;  2V3C C;  1OKK D;  3KPH A;  2YLI A;  3K33 A;  4P6I C;  2ICW G;  4E18 A;  4J30 B;  2MWQ A;  3C18 A;  2YEV A;  4CS9 C;  3EJN A;  4JZA A;  5BQH A;  2LK4 A;  1VK5 A;  1ZVZ A;  3AG3 C;  1LIH A;  3K1I A;  3Q7G A;  2QUP A;  1WAT A;  2IXM A;  2M4E A;  3H2V A;  5T3T A;  1WOL A;  5A6A A;  1JRA A;  2D4U A;  2DYR C;  3M4B A;  4EKW A;  2E87 A;  3NKE A;  1YAR O;  5L3Q A;  3DJN B;  2AWC A;  4U5F E;  1E86 A;  4C3E A;  1LE4 A;  2XLO A;  2RSE B;  3QVZ A;  1SZI A;  3WOD F;  2EPM X;  4EBJ A;  5A6B A;  1FAP B;  4J32 B;  3HJC A;  3KH2 A;  3JYH A;  2IM8 A;  3WAQ A;  3C7J A;  3C8G D;  3BEH A;  4KBL A;  2LFF A;  3B9Q A;  1BR4 A;  2WZL A;  3DAF A;  3KKB A;  3I5P A;  3W2W A;  2HZ8 A;  1LS1 A;  1BR2 A;  3G4Z A;  4O79 A;  4CIH A;  3M1C B;  1M57 C;  2WZG A;  4L6R A;  4JTA B;  4LLE A;  1DOV A;  3O10 A;  4W8K A;  2Y3B A;  1RCP A;  3RFY A;  1A7E A;  1ZW2 A;  2EIN C;  2F22 A;  4I1O B;  4E0H A;  2ETS A;  5A69 A;  1FNT c;  2R7S A;  4MS2 A;  5DQZ A;  3MYI A;  1PV3 A;  3ATP A;  4Q7C A;  3T6B A;  2W45 A;  3C8Z A;  1AUE A;  1L3P A;  5B3I A;  1ORY A;  2L9J A;  3M4C A;  2XXA B;  2DYS C;  2Q3T A;  2MHR A;  2YKZ A;  4NTF A;  4PFP A;  2J0X A;  1OCR C;  2LP4 A;  2G3K A;  1BZ4 A;  2Z15 A;  1FFH A;  4LAC B;  2QNL A;  2L6H A;  1K04 A;  4PR9 A;  5B1B C;  2J9V A;  3HKK A;  1OW6 A;  4JCZ A;  3UMI A;  3LAY A;  4LDQ A;  4PJJ A;  4Z9I A;  1YZA A;  1ZU4 A;  4ANJ A;  3HNL A;  2P6V A;  3LJB A;  1T6I A;  4NCQ A;  4D4X A;  2NG1 A;  4IB4 A;  4JVS A;  2XLW A;  3N2Z B;  4CS9 A;  1E2X A;  3JCU Q;  3ZQY A;  5DS4 A;  3S0X A;  1QPU A;  2ZPA A;  2QLA A;  1IZM A;  5JUA A;  2Y39 A;  2XLV A;  4EHP A;  3EGX B;  3HTK C;  1Q0K A;  1SR2 A;  5COG A;  2R7V A;  3DM5 A;  3JRT A;  4RBN A;  2LQG A;  3IEE A;  1SF8 A;  3DZA A;  5FCL A;  3ITF A;  2WVQ A;  1QVX A;  2YRF A;  1J8Y F;  3EGX A;  4YT2 A;  4I3M A;  1YZC A;  2Y3D A; 
#chains in the Genus database with same CATH homology
 1O3U A;  2HSB A;  1OW8 A;  3GM2 A;  3RQF A;  3GM3 A;  2L6H A;  1K04 A;  3K7D A;  3C8G B;  3JYY A;  4EBJ A;  4EBK A;  1OW6 A;  3AJM A;  1V4A A;  3S9O A;  2L6G A;  3C8G D;  2KK1 A;  4NQF A;  4XEF A;  3C8G A;  3L8I A;  1KNY A;  2PBE A;  3C18 A;  3B71 A;  4R32 A;  3O10 A;  1OW7 A;  1WTY A;  2LK4 A;  3JZ0 A;  5F28 E;  1UFB A;  3RQE A;  4XEK A;  1JOG A;  2JX0 A;  1WWP A;  1ZZP A;  3L8J A;  3RQG A;  1PV3 A;  3MFN A;  1WOL A;  2Q00 A;  3BRJ A;  3U3F A;  3GM1 A;  1K05 A;  2L6F A;  3U0C A;  1QVX A;  2YWA A;  1KTM A;  3TUL A;  1K40 A;  2JPU A;  4XEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...