3BEHA

Structure of a bacterial cyclic nucleotide regulated ion channel
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
222
structure length
222
Chain Sequence
LRIYAPLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Mll3241 protein
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
total genus 80
structure length 222
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3behA02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 3behA01
3FB8C 4JTCB 2BOCC 2P7TC 3SPIA 3E8GA 3FB7C 4GX1A 4JTAB 3SYOA 1ORQC 2ITCC 3VOUA 3OR6C 4GX0A 1OCZC 4MVQA 5B1AC 4X89A 2K1EA 2Q69A 4RAIA 4R6ZA 5CBHA 3E8FA 3SPHA 4X88A 1M56C 2A79B 4I9WA 1XL4A 4GX2A 4MVUA 5IY5C 4LBEC 2WLIA 4PA9A 5B3SC 4G27B 4EKWA 4MS2A 4UUJC 2A9HA 4H33A 4P9PA 4J9YB 2JK5C 4G28B 3T1CA 2IH1C 3RW0A 1R3JC 3T2MA 4WFFA 4HZ3A 4XDJA 3OR7C 2X6BA 3LDCA 1OCRC 3AG2C 4J9ZB 3STLC 2X6AA 4MW8A 2X6CA 1S5HC 3F7VC 2DWDC 5KUMA 2WLLB 2BOBC 3SPJA 3TCUA 4MSWC 3ZJZA 5KUKA 2R9RB 4WFEA 3R65A 3OUFA 4MW3A 3EFFK 4TWKA 1K4CC 3IFXA 2HJFC 1M57C 3E89A 4RO2A 4QE7A 4XDKA 5J9PC 3IGAC 3K0GA 3K08A 3K03A 4BW5A 2W0FC 3LUTB 5EBMC 3T4ZA 4QE9A 2EIJC 2AHYA 2AHZA 2WLMA 4MVSA 2EIKC 4WFHA 1LNQA 3JYCA 3PJSK 3T4DA 3E86A 5B1BC 2KB1A 3K04A 3E8BA 4RUFA 4PA4A 3F5WC 4MTOA 5EK0A 4GX5A 3ABLC 1ZWIC 2QTOA 2Q6AA 3HPLC 4PDRA 4P2ZA 5EBLC 1KKDA 2EILC 2YEVA 4P9OA 2Q68A 5CBGA 1R3IC 2HVKC 5BZBA 3AG3C 4MVZA 4MVRA 5EBWC 4DXWA 2HVJC 3LDEA 4LP8A 4KFMA 3UM7A 3RVZA 4MVMA 4R7CA 3X2QC 2ZD9A 2ITDC 3SYCA 2ATKC 1OCCC 5E1AC 5CBFA 2EIMC 2OCCC 1R3LC 4MTGA 3GB7C 4R8CA 1JVMA 1V54C 2HFEC 3ASOC 2DYSC 3KG2A 4MTFA 3SYQA 2EINC 1G4YB 3ASNC 4H37A 2Q67A 3E83A 3E8HA 2WLLA 3SPCA 2H8PC 4PA7A 3ABMC 3SPGA 2A0LA 3BEHA 3SJQC 3SYAA 3ZRSA 3AG1C 2WLJA 4PA6A 3UKMA 3TETA 2WLNA 1BL8A 3K0DA 3LNMB 3FB6C 4PDVA 4LCUC 4F4LA 4R50A 1P7BA 3K06A 3ABKC 3RVYA 1R3KC 3F7YC 4HYOA 5EC2C 4QNHB 1XL6A 4PDMA 1J95A 3OGCC 4OXSA 2WLHA 4JTDB 3LDDA 2QKSA 5EC1C 3STZC 4X8AA 3SYPA 4MVOA 4P30A 1QLEC 1K4DC 2ZXWC 2IH3C 1OCOC 2DWEC 3FB5C 3RBZA 2DYRC 3WG7C 4ZBMA 3OUSA 2Y69C 2WLIB 4PDLA 4CBCA 2WLKA 4WFGA 4RUEA 3AG4C 1V55C 2NLJC 2HG5C 4PA3A 4XDLA
chains in the Genus database with same CATH superfamily
2LQGA 1K9MW 2P6JA 2W6IG 2FFHA 4JI8O 3GM2A 3L71H 1S76D 2C2AA 2A3QA 2F1MA 4GLXA 3HKBA 2O9XA 2X51A 4PA9A 2ZKOA 1BQZA 4RDAA 3AG2B 1XILA 2XS8A 2N74A 1HR0B 1M6TA 1YYXA 3VAYA 2XLDA 2PFDA 4X66O 3L8IA 3JSNA 1HNXO 1I08A 3ZS8C 1XNQO 1J8MF 4IRUA 4LF8O 4GZRB 5JS5A 1W2WA 1W0JG 4UCUA 1B6QA 5IY5B 4J32B 2LSEA 1AI4A 3KMIA 2JVDA 1K4CC 2HJFC 4HE8D 4J10A 2JD3A 4XDKA 1GRJA 5LYJA 2Z15A 2LK4A 3I56V 1B68A 3K6BA 3KPHA 5HV9A 2EIKC 2BSKB 1LNQA 4DR1O 2LFSA 3ZHQA 4WCEV 3MBGA 5F5FA 4LF6B 5JQGB 3N2GA 3WB0A 3O55A 2LGWA 1JFFA 2OQMA 2Z0AA 3Q7GA 3AEIA 1WPBA 3A0BZ 5JLIA 3CQZA 3P3NA 4YJ3A 3HKEA 3GORA 4CS7A 4C7OB 3QMKA 4R7CA 1M2OA 4U5GA 1M2VB 2ZPAA 3QZCA 4LF5B 2R70A 4AILC 3PN1A 4OX9O 3SYQA 2YICA 1T5OA 3DE9A 3CXHF 1QR8A 1JPJA 4I55A 4YXWG 3CC7V 4KBLA 1S72V 3A0HZ 1K92A 1Z63A 5CN0A 2IM9A 1TUBB 5AGFA 2CNWD 1HWYA 4DRXB 3B0PA 3ZTMA 5A9GA 1QQCA 1QSPA 2MW2B 4JTDB 1KUQA 3DWWA 2PNOA 5CI9A 5KYNA 1WGWA 3ZIAG 1JOYA 3OTOB 1I5YA 1HW1A 3OA1A 4PJLA 4GYTA 3N2KA 5B1AB 1YJWV 1L1FA 3LS1A 1EFRG 4GKJO 1Q90D 3DC6A 4O6MA 4CH5A 3E8GA 4J41A 4F6RB 2KJGA 4JTAB 1N32O 1J8YF 2R25A 3QVYA 4ZKIA 3UCSC 4MVQA 3E35A 5EYPB 4AE4A 1IXMA 3JAKA 2PZSA 4YT5A 3GANA 3JATB 3VQWA 1KD1W 1K04A 5B1OA 3RT3C 2IXPA 2GA0A 4EKWA 1I4ZA 1FKAO 4YIOA 1TVKA 4JI1B 5T3TA 3CCSV 1VQ4V 2IH1C 2E87A 3RW0A 2CNWA 5LMUO 1R3JC 2NNUA 5FPRA 3SXYA 1BS3A 5LGNA 3JASA 3JTLO 2EJRA 1WP7A 2IW5A 5L0JA 3D3QA 2DE0X 2QDOA 2X6CA 2P5OA 1CXZB 2RNBA 3C18A 4O4LB 4DR7O 3VF0A 4PV1B 4PHZA 5DECA 2WVOA 1QNMA 1GKFA 2XLHA 1BZ4A 3G50A 1QKRA 2OJQA 1RKEA 4RO2A 3IGAC 1HDJA 3H1IH 2JGDA 3EHNA 1MZFA 3CYOA 3OFNG 4JEAA 2YHSA 2M6YA 4BG0A 1VQ9V 1HMDA 1A41A 2BTQB 3B40A 4G7HF 4P6IC 2KB1A 3KCXA 1SC5B 3LSQA 4LR3A 2B9ZA 1C02A 1WN0A 3ABLC 2ZDIA 5K1XA 2YZSA 5JCOC 4CIPA 2DYSB 4LC1A 4ZHQB 1V9PA 2HVJC 2XAHA 5H6QA 4DV1B 1GM9A 4KHPB 3QNEA 4Z1VA 4I9QA 4O4IA 1YYJA 4CSAA 1MMAA 1JRAA 1O5HA 1FFXA 1G4YB 3H2VA 2P0NA 5L3DA 3SR2C 3NRHA 3JSZA 1O87A 3E8HA 2TMVP 3T1HO 3HKCB 5KA5A 4EHPA 3X2QB 1TUEB 5LMNO 1G5ZA 4B6IA 3ETDA 1ENVA 2QNLA 5D91A 4CJGA 3M15A 1SKVA 4F6EA 3ABKC 3OMNB 4DUYB 3BAAA 1JMKC 2P90A 4N6CA 3ZRWA 3M79A 3FOPA 3Q4HA 3AJMA 1E83A 1N4CA 4OIPF 1VLSA 4U5FE 2OIEA 4OD5A 4BAYA 3F5TA 3VBBA 1HNZO 2ZE5A 5EIBD 3NYLA 2X0LA 4Z9HA 1Y76B 3FB8C 1HMOA 1Q0MA 2NSFA 3C8ZA 4IJJA 3RQGA 4J7YA 1QVFU 3NYJA 1T9KA 2F22A 1AP5A 1M9NA 1QLEB 3JRTA 1SERA 2BTOA 1P84F 2KG7A 1DF5A 1QLNA 1LVKA 1L7CA 2ASRA 3CAXA 4JW1A 2Q8VA 3L0IA 3U8VA 2LW7A 3TGUH 2DQ3A 5HFMA 4Q7CA 1SETA 3AK2A 5KYWA 1GGQA 4PFPA 2JPUA 5KAIZ 3QTHA 1CEZA 2CW0F 2J9BA 3STLC 1IBKB 3BVOA 3A0RA 3ZHRA 4MW8A 1S05A 4M63A 4E0HA 3TXQA 3HNIA 2HEPA 2RDCA 1WA8A 3BPZA 5L3CA 2Q9BA 3CZ6A 5KUKA 4MTXA 3IQ5A 1BMFG 3LJBA 1MMDA 3L74H 4CH4A 5DN6G 1YSCA 4TV9A 1N8RW 4LNUA 4QE7A 3K0GA 5KYUA 4TSFG 3MX3A 5B1BB 1EBOA 4CC5A 3UQ8A 4CDVA 2WLMA 2AWYA 1GM5A 4DRIB 1I0HA 4I3MA 5IJ0B 4I50A 4JC7A 3S0XA 2IJIA 5BR8B 3CE2A 3U10A 1NH2B 1D5AA 4DR2B 1KKDA 1PNKA 3B09A 4U3JA 2EILC 5CBGA 4X62O 3MD0A 2LD6A 1TWAA 1TGOA 1VLTA 2PBEA 1NR1A 3W7UA 1LI7A 4EBJA 2DN9A 1U6HA 1Y66A 4IWBA 3EFOA 3JARA 5KMGB 1JOGA 3T4RA 1K7DA 3CMAV 4UCSA 2B5UA 1Q6HA 2G38A 2NR5A 3RYFB 5IYCO 3SXMA 4LWSB 1G4WR 1ZHZA 2KYHA 2OG2A 5EGYA 1AI7A 1H2KA 1EZVH 4JZGA 1FAFA 2VCAA 1HNWB 3AG3B 5JVEA 5JSLA 3LNMB 3GM1A 1YTFD 4F4LA 3I55V 4DV3O 1JA8A 4FLYA 1KNYA 5BMVA 4U7NA 1V54B 2HP8A 3IQ6A 1Z2GA 4PDMA 2YIBD 5FZTA 3E2EA 3ATPA 2ZXPA 2ZNJA 3AG4B 4JI8B 2P1AA 4X9QA 2D5RB 4LDQA 4ER9A 2DYRC 4FM2A 5D5PA 1TFKB 4O4JB 2YWAA 4IGGA 4PDLA 3RYCA 5IWAO 2OKUA 4LERA 3FAVB 2IJKA 2FGYA 4FJCC 1RSOA 3RYHB 3VQYA 1LI5A 4G2KA 4HEAJ 4BJ6A 1KYOF 2M7WA 2P7TC 3U9MA 3SYOA 3K9SA 4PI2A 3WB1A 1HNXB 1YZAA 1BHBA 1XNQB 3EG9A 4RBNA 1QZXA 2HJ3A 4RAIA 4LFAO 4E0IA 5A6AA 5T3WA 1XNRO 2KW3C 1ZX3A 4CS9C 1T6IA 5FNVB 3PHF2 1BBHA 3T1CA 3JAWB 1VQOV 4GKKB 5A6JA 5J2UA 1AVMA 1VB5A 1XREA 1N1CA 5FCLA 2P6VA 4JE9A 2YIBA 4N23A 3RKOF 2HKVA 1S5HC 5KX5A 4OGQB 4ASUG 4I4TB 2VH3A 4LDRA 4DR5O 2DGJA 1OV9A 3DXRB 4LFCB 3BY6A 2Q4FA 3ZX6A 1Q86W 3ZRXA 4TWKA 4DV5B 4JURI 5DQTA 1Q6IA 3RYIB 4B3SO 1M90W 4ONSA 4BW5A 3QO5A 1GTOA 4O2BB 4LF7B 1TAEA 3K66A 3B8NA 4NXMB 4IHJB 4BJTA 1QBZA 4TV8B 4DV6O 1G8MA 3JALA 4DR6O 1XMQO 1F23A 2OEXA 2QWPB 3FFQA 4X1IB 4OX9B 4JJGA 1NVPD 3JSLA 3E8BA 4YK5A 1Y4MA 2R03A 2LP7A 5K1PA 4MTOA 3J81N 3EGDA 3W7TA 1JCHA 5C93A 4NCQA 2EIJB 1R3IC 4QJFB 3C8GA 2WZFA 1XMOB 4IL6Z 1D0ZA 2B1GA 4DVYP 5B5EZ 4D7TA 2HHHO 1IBLO 4IIJB 4GQHA 3DTUB 2Q7HA 1BGYH 4A4AA 4BJ1A 2FYUH 2RSEB 3TULA 5JRAA 5KYYB 2RD9A 1R5ID 3US6A 3CS5A 5F28E 3DM9B 4E7ZA 4JI5B 4CS4A 5TISZ 4NTYA 1MABG 3LEVA 4QPJA 4I1OB 5DS5A 2YI8A 1XZPA 5BQIA 4W4KA 5CMUA 1VQNV 1RFYA 4L87A 1WP8A 4EUKB 4ULVA 2OCCB 3IAYA 3WG7B 1GQAA 4GKJB 3GWOA 1ZZPA 5IYZB 1RCPA 4YL0A 3DGEA 4FIPC 3STZC 1KKCA 4MVOA 4O2AB 1ZHYA 3ZMZA 3S27A 1T6QA 3CCJV 2ZXWC 4JI0O 2ZR3A 4ABMA 4ZOLB 2PX3A 3RQEA 4K0KB 3DM5A 3JZ0A 4C3DA 2VWKA 1U96A 1VF7A 5H5NA 3ETQA 2Q4PA 2CH7A 2F23A 2PF4E 2NLJC 4JI4B 4PA3A 4JI6O 2MWQA 5KHIA 3I5PA 4H4KC 2R7QA 2R7WA 3L73H 1R73A 2QR4A 4GX1A 5LMUB 4LF4O 3RH3A 2HSQA 3B71A 3JT1A 4X89A 1YHQV 2YRFA 1Q0DA 4NKGB 4DR4O 1FXKB 2WB7A 5GONB 3DZAA 4R32A 3UO2A 5DM6V 2YXYA 5B3SC 4UUJC 2XAGA 4J9YB 3UNGC 4NTBA 4I1MA 2ZDIC 4TUYA 3PCVA 1PV0A 4IAOA 2VCCA 5KUMA 1NSGB 1QHTA 4O4HB 4D4XA 4WFAV 4NB5A 1L0LH 4XEKA 3S29A 4CSAC 4JPRA 1CGOA 3ZSUA 1C03A 1PNLA 4XEVA 4O6NA 1LPEA 3IFXA 2BE5F 1HP8A 2EIKB 4EB6A 5LOVB 3E89A 4LDKA 4PACA 1SA0A 4J42A 3W7SA 4Q4ZF 4NTAA 4YT4A 2AHYA 4RD9A 4KP4A 3CRCA 2VQFO 2BL2A 2Y3BA 2M64A 3CP1A 4PJMA 1D1BA 2L7AA 5L0HA 2EPMX 1PPJH 3JRMO 3AK1A 4BIUA 1X59A 1O9GA 2Q6AA 1SQQH 3CC2V 4N6HA 2YEVA 2E5LO 2UXBO 3T6GB 4A2NB 4JI7O 2OEVA 2LW1A 3BRJA 3NKDA 2BSKA 1OCCC 5D92A 3B0UX 4JVSA 2UXCO 1NBBA 1BSMA 4UCRA 5JVDA 2D2CB 1AJNA 3CRAA 4NYKA 4LACB 4LLCA 3W2WA 3ETEA 4X64O 2G3VA 4B7KA 4FZ1A 2YIDA 1K3EA 4UXNA 1URFA 4PDVA 2IYLD 1YIJV 1NLXA 2JIZG 2X0CA 1Q7YW 5K0IA 1M2VA 3W2VA 4E17A 1HNZB 2YL1A 3G6EV 3CSKA 2R7TA 2C03A 4YJ2A 1FXHA 1XZQA 5COFA 4CBEA 1PNMA 2Y48A 2DWEC 3K58A 5DEDA 3RF3A 1KP2A 5BY1A 1NT2B 2PGGA 4PFOA 3F46A 3UR3C 1TUBA 4PD4F 5AC4A 2UUBB 3U9JA 1Y67A 4DRXA 5IYDO 3C3TA 4LLEA 4GYCB 5EIBC 1KBHA 4C3EA 3VOUA 4B7EA 1ZHTA 3E22B 4XLNF 2DMXA 3QG5A 2ZXRA 4ZI7B 2IJJA 3EZIA 3ECSA 2A79B 1WOLA 2AZ0A 3TOLA 4G27B 3PMRA 4MS2A 2Q3TA 3NR7A 4H33A 4GT1A 2YI9A 4YHHB 3GODA 1N0JA 2ADQB 4F6RA 3QW1A 2KKWA 4DBQA 2XOKG 3H01A 5EYPA 5IJ9B 1M5IA 1Q82W 2CCYA 3GWLA 3G67A 3JATA 1KP3A 1SS3A 2WAMA 4OIRF 2RN9A 4GCZA 3SXKA 2PTMA 3EFFK 3SXZA 4I0XB 5GTIZ 3K3WA 2Q0AA 1YA9A 2GDCA 4O79A 1VIBA 4K3AA 1M57C 2Q9CA 2R7OA 5CA0B 3SJCC 1IZ3A 2ADPA 4DW0A 2HJMA 2YL3A 5EZYA 5L0IA 5FPOA 3ZHTA 4X62B 1VQ6V 1HW2A 4DOZA 4P9TA 1H8EG 4WFHA 3ABLB 4JASA 5EHHA 3ZEDA 4BEMJ 1BR1A 3P30A 3JCUZ 5FL7G 4FZ0A 2HJDA 4OD4A 1N0NA 5AC5A 1I7FA 1Q81W 3ABTA 4PELA 4YIPA 2J7PD 4D6TH 1MNGA 3MLGA 3T6JA 3NXSA 1FS0G 1KECA 4X1YA 4JYYA 4AQYO 5C8YB 2XSEA 3LDEA 4ICGA 5GW7A 4YL1A 5LGUA 2ATKC 4BJ6C 1R3LC 4LF9O 5AG2A 3KL4A 1SQBH 4DV7O 4IAQA 2JEXA 4JCHA 1H2MA 3G4XA 2WLLA 2OOCA 4CS9A 3CJHA 1VQ8V 3H1LH 4FFKA 3SJQC 4DV4O 3AG1C 1JR9A 5BQGA 1YARO 1EN5A 5IWAB 4FLZA 1FJGO 1EQ1A 1P7BA 1Y74A 4HYOA 1EZJA 2ARHA 1V74B 1NI8A 1NU7D 2A7WA 1YXBA 4JYAB 1QCEA 5J2TB 3B77A 5COGA 2JGUA 4CDAA 4RQEA 2VQEB 1IXBA 1PKXA 1YA7O 2J7PA 3HKCA 4X1KB 2ICWG 1D0YA 3X1OA 3LS0A 2R72A 2HG5C 1TQGA 5KAFZ 4DV2B 3H1HH 3FB7C 1OR3A 2Y3HA 1WTYA 2GTSA 1OCZC 4B08A 3BFRA 3K7DA 4N21A 4EBKA 3NYMA 1K05A 1PP9H 3JCZA 3TD7A 3P32A 1GAXA 2HUJA 3B8MA 2XS1A 1JQ0A 2UUIA 2FTKA 4DK1A 1H2SB 5L3EA 1IW7F 3LSUA 4B3SB 3DJUB 3LDCA 1K5SA 1OCRC 4JI2B 2ZE8A 2O57A 4X20B 2X6AA 1J5EO 3IJ4A 1D2DA 2EX3A 2QJ1A 4DV6B 2LCHA 4BPMA 2YDEA 1SQPH 1NH2D 1H7IA 1MQVA 1BT8A 4UB8Z 3VM6A 1Q8IA 3CB2A 4ULWA 2Y39A 2GV9A 3CRRA 3K03A 5LP6A 2XAJA 3QF7A 1ZL8B 4QE9A 4NTFA 1MOFA 1XDCA 1YZBA 1M93A 2LQTA 2W4BA 3UT5A 2EPLX 1DK1A 2HV6A 2EILB 4JIOA 1HW7A 2HHHB 3UO3A 1WN7A 4G7ZF 3U3BA 1RPRA 2PY5A 3EXAA 5H2FZ 4RUFA 4BIZA 3BABA 4TOIA 3MDSA 2G3KA 2Y3DA 5DS6A 3FD9A 5A6KA 2A06H 1V4AA 1QU7A 4YT8A 4KFMA 2XM0A 3ZMSA 1SF8A 3HKDB 1ST6A 2VS0A 4DYLA 5LHGA 2F4VB 2NUTB 2OJED 3BEHA 2F66C 2H7OA 4PA6A 4KUMA 3ZMTA 5GPGB 2WVNA 3TJ5A 4DVZA 5E79Z 2DYRB 5JUAA 2XAFA 3N0TA 1MSDA 4QNHB 4UVBA 2KSFA 5HSWA 3J7AU 4YWQA 1N36O 5EC1C 2IBFA 3UGPA 2MYSA 4LWSA 3N24A 2Q5ZA 3DXJF 4FK5C 2IH3C 4IB4A 2QLAA 3ABMB 1RJ9B 1NFOA 1Q0KA 2YIAA 3DI5A 2YL0A 1IVSA 4CJOA 3V5YA 2A6EF 3L75H 3U0CA 1H2GA 2FB5A 3G6BA 1YJGA 3S90A 1OW6A 5B3IA 4J7JA 4DV0O 2Y0PA 3N27A 3E9VA 3FXHA 2HMQA 1M4UA 3OR6C 3V5ZA 4YT2A 3CCMV 3W7WA 1G6UA 1AR4A 1JFFB 4O4JA 2CUGA 5IY5C 4PJNA 2IXOA 3HKEB 3RYHA 1YJNV 2A9HA 2XL8A 3AQCA 1NQTA 5L3FA 4BJ5A 3T2MA 3L8JA 1XOUA 2ZR2A 4G0HA 3OR7C 2UUAO 3T1YO 1YI2V 2A0BA 2YSUB 4QPKA 5ITZA 3A2FA 3OM3B 2BC5A 4FFBA 2HKOA 1APCA 4X65O 2VQFB 4B3RO 3ZJZA 3G80A 3R65A 5CA1A 2VB6A 2AWCA 5E3AA 2CGNA 3K9AA 4P9FA 1TWGA 4XPWA 3K5LA 2P22C 1GS9A 1OW8A 3M1CB 2PI5A 3LEOA 1FR0A 2AHZA 3Q6MA 3ZN1A 4FAPB 3WB2A 4JI7B 1O9HA 2PP4A 3CC4V 1W0KG 2GTAA 3ZBHA 2JX0A 1H2LA 3MHHC 1GN3A 1OHHG 4PA4A 3F5WC 1AJQA 3EH1A 4JJFA 3RYIA 1I5NA 4WBNA 4N06A 5LL6Y 1GN2A 4X64B 4ZLCA 1Z5WA 4DXWA 3IC9A 2UUCO 4JRZA 4AE4B 1N33O 1JJOA 3K57A 3JAKB 4TV8A 4DUZB 2R02A 4MTGA 2R7XA 2GAQA 3OAAG 3GB7C 1ORJA 2BCCH 3EGXB 1Z6AA 3TOMA 5IE9A 3U2LA 4JI3O 1SRYA 2ZM6B 2A68F 2WLJA 3LSSA 3JASB 1D1CA 2WLNA 3K0DA 4U7OA 2FMLA 2CDQA 3OW2U 2XUMA 2EIMB 2LJ2A 4KL1A 4HNAB 4IIJA 4KXRA 1R3KC 5EC2C 2DOSA 1J95A 2WA3A 2E76B 1NU9C 2C04A 2E75B 5KYYA 3SYPA 4LFBB 4N4WA 3L70H 1R1BA 1X4TA 2HV7A 1VYKA 2L9JA 1Y6XA 5JJNB 1OCOC 3I5QA 4YL3A 4QI2A 2AU5A 4ZBMA 3DAFA 3V7OA 2YXLA 4U5BE 2JGDB 2CE4A 4UFZA 1N34B 3FYEB 5KLVH 4WFGA 4JV5B 4RUEA 2KQ9A 1PD0A 2QTSA 4XDLA 1UG7A 3C62A 2NN4A 2XNDG 4MNDA 2YUAA 1HR0O 4H0LB 4O2AA 1Q0FA 2R7UA 1VARA 4XEFA 2YLIA 3D36A 4J30B 3E8FA 1FMWA 2Y69B 4ZOLA 5E2QA 1DOWA 4OINF 4E7SA 4KI2A 1V55B 4Q6GA 4E2LA 2JS5A 2OWOA 2J46A 2PX0A 1VQ7V 1OR2A 3FX7A 1BE3H 3H9VA 1NZ6A 4YN0B 3IQTA 1HE1A 2DWDC 1DGSA 1BCCH 1LE2A 4HFKB 1FXKA 4X66B 5GONA 4DR3O 4BW9A 1UFBA 1EN6A 1HE9A 1I4YA 4LF8B 2LFFA 5J9PC 3EH2A 3K1HA 3M4CA 1SQVH 5KHGA 5EBMC 4K0DA 4AQYB 4UV9A 3ZRWB 4EFBA 2QM4A 2R9IA 3JYCA 1NU1H 3DD7A 3T4DA 5CA3A 2PI4A 4OPHA 3H1JH 2V26A 2W45A 4LF5O 1FNTc 1OCCB 1ZWIC 3EHMA 4DR1B 4PDRA 4IT5A 1CPYA 2DQ0A 3QTCA 3ZQYA 2LFRA 3AGTA 3VYWA 1AEPA 3C3SA 1OXBA 3L34A 1FFHA 1ZYRF 3X2QC 2B0HA 1D1AA 2Q7RA 4MT8A 2GUZB 2P06A 2AW9A 4CDYA 1K8AW 4FMTA 4WGYA 2QEXV 1QR9A 3O39A 2UUHA 4R8CA 1JVMA 4EIYA 1FFTB 3RWRD 1H38A 5A6BD 4FM0A 1ZLZA 1SESA 3OTFA 3SPCA 3HTKC 1NS1A 3KYIA 3OEOA 5KYWB 1NKDA 3ZRSA 2QGNA 1A7EA 5L0FA 4DO2A 1L3PA 3MHSC 3BHPA 2F93B 2ODMA 3EJNA 1QVXA 1LS1A 1SZIA 4YY3O 4P30A 2JDIG 1QLEC 4AI8A 2CGEA 3LLKA 3OEEG 5D5QA 4TV9B 2Q73A 4LNUB 3ITFA 1ZSPA 4JYCA 1YITV 3FVYA 1MSWD 1T01A 3UMIA 3QW0A 5FLXN 3KZIZ 4CBCA 2HZ8A 1FXVA 3VQVA 3CMEV 2CTRA 2HMZA 3GWNA 1E85A 4JTCB 4I50B 2RCVA 5LP6C 3DAGA 1NTMH 2NUPA 4JAUA 2N05A 2E3CA 4JI1O 3UMHA 1U89A 4EEQA 4PJJA 5CBHA 1J5EB 1XEQA 2BE3A 4UVCA 4XWJA 1OW7A 3JD1A 3CEXA 4KNWA 1N32B 1GK9A 4W4LA 5B1NA 3ZIBA 3EFOB 4Z9JA 1CP9A 3JARB 3IPMO 3V5XA 2LFDA 2H3OA 3JD3A 3KH2A 3CCLV 4E18A 3E22A 2R7RA 1OKKD 5L0CA 5B66Z 4OIOF 2DJVA 2KQXA 4XQ1A 4MW3A 2JEUA 2UXDO 4NXNO 2NSGA 2YL7A 4KC9A 2R7SA 5BMVB 2XL6A 4DR7B 5CI8A 4JCZA 1B3QA 2WVQA 3N2ZB 1RKCA 5IJ9A 2YQYA 2GHYA 5LXTA 2WZGA 3TXSA 3S84A 5DQZA 3B9QA 2FKXA 3K04A 4QDLA 3RYCB 1KB9F 4DV1O 2EPNA 4KHPO 1QQ3A 4L6RA 3HPLC 3LNNA 5LA6B 3EHBB 2Q68A 2HVKC 1YAUO 1SF9A 3AG3C 1T5EA 4MVZA 5LHIA 1LIHA 2J9WA 2CK3G 1MMNA 3C7JA 1OKKA 1Y4CA 1V54C 3ASOC 2PUSA 1VF6A 1D0XA 1N36B 1PV3A 4O7GA 1LS4A 2Q7GA 1YTFB 3AG7A 5HFLA 4RQFA 1OZ0A 1NR7A 3RIPA 3D8CA 4Q5SF 5C8YA 4LH7A 5T1DB 5KX5B 4PR9A 4BJ5C 1KTMA 3T1HB 2QM8A 3U5SA 3OGCC 4OXSA 1JAFA 1QPUA 1OJHA 1HY5A 1NTZH 5LMNB 3ZC4A 3A11A 4FLTA 3APQA 5JH7B 1A0BA 2J0XA 2KK1A 1MMGA 1E1QG 1F1MA 5JQGA 1OCZB 3ICXA 5L3GA 3F47A 1VF5B 1XHZA 1E84A 2VC9A 5KYXB 3LLIA 2CTPA 5L3VA 3RFYA 4C7OA 4UVAA 4CS8A 3ABUA 4GX0A 4UCVA 2YVKA 1IBMO 2K1EA 3B29A 1US6A 1S7ZA 3JSEO 3EGDB 4FX5A 1M56C 4MVUA 3JYYA 2QKAA 4LBEC 3C8GB 1OCRB 4B3RB 4X1KA 1IBKO 4NTWA 5L0DA 2ZT9B 1PCXA 2JK5C 1AJPA 4D7SA 3FAPB 4XDJA 3SGIA 5L3BA 2X7RB 5L0GA 1UFIA 4Z1MG 4B3MO 2M4EA 3JYHA 2AP3A 3HNJA 3ZDLA 4YJWA 1S3JA 1KC8W 2F43G 1XHXA 3M7MX 3OMAB 1U97A 4MSWC 3CCQV 2J0WA 3OD4A 2RJZA 4GEHA 1RM1C 4OPAA 2J8WA 4DW1A 3FKSG 2DW4A 2ZIMA 4W8KA 2EIJC 3K33A 5CB4B 4E4EA 3SEOA 2YXHA 3W7XA 4DR2O 4F4BA 3L9DA 1N33B 3J06A 1THZA 1DOVA 1WB8A 4K35A 1W2BU 4JZAA 1XBLA 5EBLC 2QTOA 2KGOA 4JI3B 3CCRV 1Z23A 3G4ZA 1TWHA 2L6LA 1GN6A 4MVRA 4LH6A 3RVZA 1EM1A 2ZD9A 4JGSA 1HNWO 2UU9O 1EN4A 2OCCC 1AVOB 2XRHA 5KA6A 2ZINA 1AILA 3ZWIA 1EI7A 3SJAC 4O4LA 3ZVRA 3D36C 1YCIA 4UV8A 3SYAA 1WLEA 4TUYB 5GTHZ 5F2VO 2R9AA 3M4BA 4IYIA 1G8XA 1MZEA 3HKDA 4WFBV 1LR1A 5BQHA 4FPPA 2QWRB 2IXNA 3PDMP 4X0RA 2CDYA 4JAVA 2I15A 4MQ9F 4CH6A 3K5MA 2NUTA 5LGTA 3WHNA 2W0XA 2L81A 4G7OF 4EB6B 3CHXA 2XLEA 4U5EE 1SA0B 3JD2A 4DV3B 1YDIA 2BTQA 3APOA 5JP7A 4AX2A 1FXKC 1SZXA 2XT9A 2WLIB 3M99B 1Z5ZA 1FPOA 1GH6A 2QWQB 3ABKB 2ZCEA 1FAPB 2ZIOA 1IDSA 4ZHQA 3FAJA 4AK9A 1CGME 2MHRA 1DTOA 4GKKO 2L6FA 1RJ9A 4CS3A 4TQDA 2YEVB 3UGOA 3G71V 3VRCA 2Y0IA 4DR3B 4LFAB 3RYLA 4DJ9A 2L6HA 1RXQA 4JF3A 4LFCO 1XNRB 2D4UA 4QI0A 2X6BA 1ZVZA 5JVDB 4DV5O 2JS3A 3T6BA 1F51A 4HFFB 2YLDA 2OCHA 1G1XB 5A69A 3QO7A 4LF7O 2R9RB 3TJTA 4NXMO 3D3IA 2GFHA 4CIHA 4FWVA 2XXAB 1VQMV 3Q6NA 1ZHXA 4I44A 4DR5B 1F4NA 3OT7A 3T4ZA 4YJ2B 3AGUA 2HR3A 3U2MA 1PD1A 2IU0A 2L6GA 4XPYA 1Y76A 2NG1A 3K5OA 1XMOO 3AK3A 3S3XA 4JYBA 3NG1A 3FYIB 4GX5A 2RQ6A 2WWWA 5IT9N 2OT5A 4DR6B 1XMQB 3TQOA 3FOOA 1GMGA 5BZBA 4XPXA 1FD9A 4J7KA 1YVWA 4WABA 4DRHB 1L8DA 1SQXH 4FLXA 3UM7A 4U9DA 1C17M 4D4NA 3NDBB 4JI5O 2EBOA 2ITDC 1WNSA 1B06A 3KKYA 4NTXA 2EINC 2XLOA 2GDSA 3IC7A 1IZMA 4YY3B 3ASNC 3SP1A 4Z2WA 1MMMA 2ZQMA 1IBLB 3EPVA 5DS4A 5CIVA 3SZRA 1BL8A 4J7ZA 1OCOB 2A1DD 2XM4A 2J45A 4K0KO 1XL6A 4HAMA 3S9OA 3EGXA 2WLHA 3LDDA 3S3WA 1E79G 4JI4O 2QSAA 3RBZA 5IJ0A 2I8BA 1XQ8A 1Q3EA 1LKXA 3OUSA 2QWNB 5EZYB 3HKBB 3JAMN 1AR1B 1S77D 3ZCCA 4K1OA 2V3CC 1P49A 1MNEA 4HNAA 2EZPA 2ETSA 3ZHUA 4JI0B 2BOCC 1VQLV 3DJNB 2L35A 1R6TA 2EPOA 3U3FA 3ZQVA 4TQFA 1JJ2U 2D3OW 2EPKX 3RN4A 5KMGA 3SPHA 3B2EE 3CSXA 1M1KW 2WZLA 3TJ6A 2CGOA 2QWOB 4JI6B 5KHHA 5IDJA 4NC3A 4CX9A 5JT4A 1VYIA 4X1YB 1VP7A 3OMIB 3RYFA 2CYDA 4LF4B 1ORSC 2Q9AA 4U5CE 2J9VA 1SZTA 1VQPV 3EZHA 2UXDB 4NXNB 1NBMG 4WFFA 5LYJB 4DR4B 1UPGA 2XTAA 3KCYA 3I4UA 4Q20A 1FTSA 3AG2C 3K5NA 1FYJA 3GEIA 4FM1A 2WLLB 2BOBC 2B0JA 1AROP 1JX9A 3CJHB 1E2XA 1NTKH 4BIOA 2GWWA 3OUFA 2LP4A 2QM7A 3ML0A 1H6GA 1VF6C 3N2GB 2CTQA 5KHKA 1WASA 3CRQA 1P4RA 3ZHVA 2VWJA 3WODF 2B1IA 1L0NH 1Y74B 3K08A 3WU2Z 5JWPA 2AVKA 2W0FC 3K1IC 3A9CA 3FAVA 4YJ3B 3DSQA 2OTLV 3P3PA 3BA8A 4MVSA 3W8HA 5JJJB 2R05A 2CAZC 3PJSK 4DK0A 3CXCU 3POVA 2WL8A 1AR5A 1SQGA 2VRZA 4AHCA 3T9OA 3M8AA 4I55B 3OE7G 4CZZA 1PM9A 1PD3A 3DC5A 5FNVA 3U8PA 3HNLA 1GN4A 1TA8A 4MVMA 4EBBA 3JAWA 3THOA 2AXTZ 1AI6A 3SYCA 1Q0GA 1YVIA 2HLDG 3G4SV 3R66A 4MTFA 2ZNIA 2E5LB 2UXBB 3FHDA 3SNHA 4FLVA 2LIGA 2AZ2A 4CS8C 5BUOA 1T6UA 1YF2A 4I4TA 1UJWB 3AQBA 2OIGA 1K40A 2V4DA 1SMYF 3DXRA 4XTKA 1I94O 2JJ1G 2UXCB 1DF4A 3N2KB 2XAQA 4QGPA 1IURA 2GUZA 2UXNA 2IU3A 3K06A 2IJHA 4O2BA 5BXZA 3GEEA 4IHJA 3OGIB 1Q43A 2UUBO 4J80A 1Z7Qc 1IBMB 2NPUA 1ZTEA 4B3TO 3LAYA 5LP6B 2VCBA 2QE7G 4X1IA 1GM7A 3CX5F 1R6NA 3JD0A 2Y3GA 1SYQA 3UT5B 1TVKB 4CC6A 3J80N 2P67A 2E74B 3BRCA 1TFOB 1ORQC 2YS8A 5B1AC 2ZXWB 4B3MB 2Q69A 4R6ZA 3CCEV 4YHHO 1S5JA 2QE9A 4I9WA 1XL4A 1BZKA 2CTWA 4U3FH 5E33A 1FMVA 1YDXA 1RKEB 4G78A 4HZ3A 4U5DE 2WPDG 3CCUV 3DKAA 2EJ7A 4I5SA 3QVZA 3GVMA 1A7VA 3CRMA 2QTVA 3B4SA 5IYZA 5B3SB 3SDLA 4JAAA 2V1DA 4GUNA 4FVMA 2P4VA 1QVGU 3NKEA 1ZHWA 3U11A 2OU6A 3U0ZA 1H9GA 5F5HA 4EWCA 1E86A 3W8IA 4W8PA 3ZG1A 2IM8A 3WAQA 5DLJA 4FLWA 4O4IB 3H2UA 2YC0A 1XWJA 4J7TA 2UU9B 2P61A 1VMGA 1K34A 3QVNA 1FFXB 2ETNA 4AL1A 4J11A 2JJ2G 4UCOA 3MAQA 2EULA 4JZ2A 3HJCA 3ZHSA 2Q00A 1GM8A 2A0UA 1OXKA 1H8HG 3ASOB 4AL0A 1B04A 4LP8A 2IXMA 4OIQF 1D5NA 1PL4A 4LF6O 3O6XA 3HKKA 2DYSC 3DMDA 4WJ0A 4O4HA 3Q4HB 4CS2A 5LA6A 3ABMC 3SPGA 4LF9B 4K7BA 3LNRA 2Y4TA 4JYAO 2QY9A 3TETA 1S5LZ 4DV7B 1ZW2A 2W9YA 2F95B 5LOVA 4PK4A 3C90A 5ITZB 3HB3B 3JD4A 4R50A 2VQEO 3S28A 4UDVA 2H8AA 3CD6V 4FFBB 2RMKB 3RFRA 3RVYA 2YKZA 4DV4B 2OTJV 2QKSA 5CA1B 4X8AA 4XLPF 4K8ZA 1K4DC 1KQSU 2KG7B 1FJGB 3FB5C 3VQXA 3C8GD 1ZAUA 4DV2O 3O10A 1H2NA 1JPXA 5LHHA 2WSSG 3ZRVA 2WLKA 3K79A 5L3QA 1JR8A 3GEHA 5H9CA 1WPXA 1ORYA 1M56B 2Z5UA 2ITCC 1PL0A 2ILMA 5JH7A 3OTOO 4X88A 1WA8B 4NQFA 4WBNB 4GX2A 4ZLDA 4JI2O 5A2QN 1YEWA 1I5XA 1YJ9V 4BR6A 2ZE6A 1LUVA 4O6YA 4UB6Z 3IHUA 3SJBC 2Q7EA 1RMVA 5KYUB 2HFIA 3ZTZA 5KYXA 2G62A 1VQKV 3GWKC 1R4TA 1Y6DA 2A6HF 4J9ZB 1U0BB 1YLMA 2R7VA 4H54A 2XLMA 5H6RA 1RM1B 3F7VC 3TCUA 3SPJA 3ZN0A 5TJ5E 5COMA 5DVWA 4WF9V 2YLGA 4WFEA 5IYBO 1JMWA 2W6JG 2OYQA 4DBRA 4A5UB 5A6BA 3DE8A 5E3CA 4DRJB 2GSMB 4U3JB 3LUTB 4BWAA 3B0VC 2V7QG 4FLUA 1VK5A 1AP6A 2KNHA 1VTMP 3L1MA 3CEIA 3E86A 5B1BC 3CPWU 1ZU5A 2GBOA 1M57B 2Q0OC 5EK0A 3H1KH 4ZI7A 4P9OA 1K5QA 2F4VO 1NFNA 1VEWA 4H44B 1OQCA 1IX9A 1KU9A 1P7GA 5EBWC 4IARA 4JEBA 4TT3G 4ZIBA 1NJIW 3RQFA 3CCVV 3UMKA 2JRIA 5CB4A 1WATA 2H7VC 5CBFA 4U9EA 2EIMC 3C63A 1VMAA 1ZUQA 2HFEC 3KG2A 3SYNA 2Q9LA 1BHAA 3AOUA 4FESA 1BDJB 2UXXA 4UCTA 3E83A 3EVKA 3K59A 4PJ0Z 1EA8A 2H8PC 1EKYA 4PA7A 2A0LA 1BQ0A 4I0XA 2XL4A 1RSOB 3MYIA 4NVPA 4LCUC 1A32A 5CA0A 1LE4A 3I5DA 4PI0A 3F7YC 3KKBA 3TK0A 3O65A 2HSBA 1AB3A 1BR4A 1JPNA 3EG9B 5LBQA 4U5HA 4NY3A 1W59A 3R2PA 2LGQA 2IBZH 1VQ5V 5JCOA 3OWTA 3NMKA 2Y4UA 2Y69C 3AG1B 3WFVA 2PYJA 4BEJA 2DB4A 2MK3A 1K97A 3AG4C 1V55C 2QUPA 3TK1A 4DUYO 1KU2A 5J2UB 1F7YA 3K1IA 3SPIA 1SQFA 3W4YA 1NZEA 2J9UA 3BA9A 3IQCA 2P4KA 1A7DA 1XUQA 4K8XA 3E70C 2IOQA 3NMJA 3A8TA 1NG1A 5KHJA 1Q6UA 1H9TA 1LM3B 2WA4A 2WLIA 4EFEA 4DV0B 4P9PA 1GO3F 4G28B 3ETGA 1Z5VA 4L8JA 3MYFA 1AI5A 1K33A 1WWPA 1ZU4A 1WB7A 3L72H 2Z3YA 256BA 4C7UA 3HR0A 3JALB 5JJEB 1SR2A 3H65A 4I7ZB 4HBNA 2P7VA 2N04A 3R7CA 3FMSA 3O9OA 2UUAB 1KMIZ 3ZMVA 5J2TA 3T1YB 1WJZA 2DI3A 1YZCA 2XLWA 1BR2A 3GM3A 4C3BA 4IYHA 4X65B 4QIWF 2KSDA 1G4US 1ROPA 1S0VA 1VOMA 1MNDA 2XHBA 4RWUA 3HLZA 2HS5A 1FFTC 1F4MA 2XLVA 2XXAA 2QA4V 2H7BA 3NMIA 4DUZO 4ANJA 1TR2A 4P2ZA 2FAPB 1DLBA 1TKNA 4KNVA 1LUWA 3RGBA 4CH3A 2XASA 2EINB 2NUPB 1AUEA 4H13B 1I94B 3ASNB 2PYLA 3LESA 3MFNA 1O3UA 4Z9IA 1WAZA 3EQLF 1MA1A 2FL4A 5E1AC 2ZM6O 5BR8O 3KYJA 2KC3A 1Q5OA 1K73W 1CGNA 1CPRA 1TWCA 4X20A 1Z3IX 4H37A 2UUCB 2Q67A 2ZXOA 1NVPB 1R6KA 2EZOA 1RP3B 2A69F 4WGZA 2K9PA 3HNKA 4XBFA 3UKMA 4B3TB 4LFBO 2AGAA 3FB6C 3QO8A 2CH7B 1MG1A 3IEEA 2QKCA 2ZE7A 1RPOA 1ZL8A 2W4MA 1N34O 3JCUQ 4JV5O 1COWG 2H94A 3CWBH 3WG7C 3ZMUA 3Q7LA 3OEHG 1ZW3A 4NR1A 1E1RG 4JKVA 3FDQA 3BCCH 1CPQA 1XI1A 2VASA 5LXTB 2LO1A
chains in the Genus database with same CATH topology
2BOCC 1VQLV 1K9MW 1R73A 4GX1A 2P6JA 2W6IG 2XNDG 4X89A 1S76D 1JJ2U 2D3OW 1YHQV 2C2AA 3D36A 3E8FA 3SPHA 2Y69B 1FXKB 1M1KW 5IDJA 3OMIB 4PA9A 5B3SC 5DM6V 3AG2B 4UUJC 1V55B 2XAGA 4E2LA 1SZTA 4J9YB 1VQPV 1VQ7V 1NBMG 4WFFA 2ZDIC 4Q20A 4XDLA 3AG2C 5KUMA 2DWDC 2WLLB 2BOBC 4WFAV 1W0JG 1AROP 1B6QA 1FXKA 5IY5B 1JX9A 4JPRA 1AI4A 1PNLA 3OUFA 2QM7A 3ML0A 1K4CC 3IFXA 2HJFC 2EIKB 1P4RA 3E89A 2B1IA 4XDKA 5J9PC 3W7SA 3K08A 2W0FC 5EBMC 3I56V 2OTLV 2AHYA 4UV9A 3ZRWB 4MVSA 2R9IA 2EIKC 4KP4A 1LNQA 2LFSA 3JYCA 4WCEV 3PJSK 3T4DA 3CXCU 5CA3A 2PI4A 3CP1A 4BIUA 1OCCB 1ZWIC 3CC2V 2Q6AA 4PDRA 1CPYA 2DQ0A 2YEVA 3OE7G 3AEIA 4CZZA 2LFRA 1PD3A 3X2QC 4MVMA 4R7CA 4MT8A 1AI6A 3SYCA 1OCCC 1K8AW 4FMTA 2QEXV 1QR9A 2HLDG 4R8CA 1JVMA 3G4SV 4MTFA 1FFTB 3SYQA 1H38A 1AJNA 1QR8A 1SESA 3SPCA 3ETEA 4YXWG 1UJWB 3CC7V 1S72V 1K92A 1NKDA 3ZRSA 2JJ1G 5CN0A 1DF4A 1K3EA 4UXNA 4PDVA 2XAQA 4DO2A 1YIJV 3MHSC 2JIZG 1Q7YW 2UXNA 1HWYA 2IU3A 3K06A 3G6EV 2IJHA 1FXHA 4JTDB 1PNMA 4P30A 2JDIG 1QLEC 3OEEG 2Y48A 2DWEC 4JYCA 3ZIAG 1YITV 1JOYA 1KP2A 1I5YA 1MSWD 2QE7G 1GM7A 5B1AB 4CBCA 1R6NA 1FXVA 3JD0A 1YJWV 1L1FA 3CMEV 1EFRG 5IYDO 4JTCB 3E8GA 2P67A 4JTAB 1ORQC 3VOUA 4JAUA 4ZKIA 5B1AC 4MVQA 2ZXWB 3E35A 1IXMA 2Q69A 4R6ZA 3CCEV 5CBHA 2IJJA 1KD1W 4UVCA 2A79B 5B1OA 4I9WA 1XL4A 3JD1A 4G27B 4EKWA 4MS2A 1GK9A 4H33A 3CCSV 4GT1A 2IH1C 5B1NA 3RW0A 1VQ4V 1CP9A 1R3JC 2NNUA 4HZ3A 5LGNA 3JD3A 2EJRA 2WPDG 2IW5A 3CCLV 3CCUV 4I5SA 2XOKG 3H01A 1Q82W 2X6CA 1KP3A 2WAMA 1GKFA 5B3SB 4GCZA 4MW3A 3EFFK 2JEUA 2V1DA 3K3WA 1M57C 4RO2A 1QVGU 3IGAC 1VQ6V 3CYOA 3OFNG 1H8EG 2GHYA 4WFHA 3ABLB 1VQ9V 4JASA 3P30A 5FL7G 1K34A 2KB1A 3K04A 3LSQA 1Q81W 2JJ2G 3ABTA 4PELA 3ABLC 3HPLC 1GM8A 2ZDIA 3EHBB 3NXSA 1H8HG 2Q68A 1FS0G 3ASOB 1KECA 2DYSB 2HVKC 4LC1A 3AG3C 4MVZA 5LHIA 2HVJC 2XAHA 3LDEA 4LP8A 5GW7A 5H6QA 1GM9A 2CK3G 3QNEA 5LGUA 2ATKC 1R3LC 1V54C 3ASOC 2DYSC 2JEXA 1G4YB 5L3DA 3E8HA 2WLLA 1YTFB 5HFLA 3ABMC 3SPGA 1OZ0A 4RQFA 1NR7A 1VQ8V 3SJQC 3AG1C 5KA5A 3X2QB 1TUEB 3TETA 3ETDA 1ENVA 3HB3B 3JD4A 4R50A 1P7BA 3CD6V 3ABKC 3RVYA 3OMNB 1EZJA 4HYOA 2QM8A 3OGCC 4OXSA 2P90A 2QKSA 2OTJV 1QCEA 4X8AA 3ZRWA 3B77A 1K4DC 1KQSU 3FB5C 4RQEA 1PKXA 1JPXA 5LHHA 2WSSG 1E1QG 4BAYA 1OCZB 3ZRVA 5L3GA 2WLKA 3K79A 3VBBA 5H9CA 2HG5C 2X0LA 1WPXA 1M56B 3FB8C 2Z5UA 1QVFU 3FB7C 1M9NA 2ITCC 1QLEB 1PL0A 4UVAA 1SERA 3ABUA 1OCZC 4GX0A 2K1EA 4N21A 1DF5A 4X88A 1QLNA 1M56C 3JCZA 4GX2A 4MVUA 4LBEC 1OCRB 1I5XA 3P32A 1YJ9V 3B8MA 2DQ3A 1JQ0A 5HFMA 2FTKA 2JK5C 1AJPA 1SETA 5L3EA 4XDJA 5L3BA 2X7RB 3LDCA 1K5SA 4Z1MG 1VQKV 1OCRC 1CEZA 4J9ZB 3STLC 2X6AA 5H6RA 3A0RA 1RM1B 4MW8A 3F7VC 3TCUA 3SPJA 3ZN0A 1S3JA 1KC8W 2F43G 3OMAB 5L3CA 4WF9V 4MSWC 5KUKA 4MTXA 4WFEA 3CCQV 5IYBO 1BMFG 1NH2D 2W6JG 5DN6G 1YSCA 1RM1C 2GSMB 1N8RW 4QE7A 3K0GA 3K03A 4TSFG 2XAJA 3FKSG 2DW4A 3LUTB 5B1BB 4QE9A 2EIJC 1EBOA 2V7QG 1MOFA 2WLMA 3W7XA 2EILB 1THZA 3E86A 5B1BC 3CPWU 1RPRA 2IJIA 1W2BU 4RUFA 4BIZA 1M57B 1NH2B 5EK0A 5EBLC 2QTOA 1KKDA 1PNKA 3CCRV 2EILC 4P9OA 1K5QA 5CBGA 3MD0A 4MVRA 5EBWC 4TT3G 1NR1A 4KFMA 3RVZA 3W7UA 3ZMSA 3CCVV 1NJIW 2ZD9A 1Y66A 4JGSA 5CBFA 2EIMC 2OCCC 1K7DA 2HFEC 3KG2A 5KA6A 5LHGA 3CMAV 2B5UA 1BHAA 5IYCO 2UXXA 1AI7A 3E83A 2H8PC 4PA7A 2A0LA 3AG3B 3BEHA 4UV8A 3SYAA 4PA6A 1WLEA 4KUMA 3LNMB 3ZMTA 4LCUC 1YTFD 4F4LA 3I55V 4WFBV 2DYRB 2XAFA 4FPPA 3F7YC 4U7NA 1V54B 4QNHB 4UVBA 4PDMA 4JAVA 3E2EA 5EC1C 5LGTA 5LBQA 3AG4B 4FK5C 2IH3C 1VQ5V 3ABMB 2DYRC 3JD2A 2Y69C 3AG1B 1FXKC 2WLIB 4PDLA 2IJKA 3WFVA 1H2GA 3M99B 4FJCC 2MK3A 4G2KA 1K97A 3AG4C 1V55C 3ABKB 3TK1A 2M7WA 2P7TC 3SPIA 3SYOA 1DTOA 1BHBA 3OR6C 3CCMV 4RAIA 3W7WA 2YEVB 5IY5C 3G71V 2WLIA 1YJNV 2A9HA 4P9PA 1GO3F 1NQTA 4G28B 3T1CA 5L3FA 1VQOV 3T2MA 3ETGA 2ZR2A 4JF3A 3OR7C 2X6BA 1YI2V 1AI5A 1K33A 2YSUB 4N23A 4QPKA 3OM3B 2Z3YA 1F51A 1S5HC 4ASUG 2HKOA 3QO7A 3ZJZA 2R9RB 3BY6A 3D3IA 3R65A 3ZMVA 1Q86W 3ZRXA 4TWKA 1VQMV 3K9AA 1M90W 4BW5A 3QO5A 4QIWF 1F4NA 1GTOA 3T4ZA 3B8NA 1ROPA 2PI5A 2AHZA 2HR3A 1S0VA 3ZN1A 1QBZA 2IU0A 1G8MA 1F23A 3CC4V 1W0KG 1NVPD 1F4MA 3E8BA 1Y4MA 3MHHC 1OHHG 4JYBA 4PA4A 3F5WC 1AJQA 2LP7A 4MTOA 2QA4V 3FYIB 4GX5A 2WWWA 2OT5A 4P2ZA 3W7TA 1JCHA 5C93A 1DLBA 1GMGA 1R3IC 2EIJB 4QJFB 5BZBA 2XASA 2EINB 4DXWA 3UM7A 3ASNB 2B1GA 2EBOA 2ITDC 5E1AC 3DTUB 4MTGA 3OAAG 3GB7C 1K73W 2EINC 3IC7A 3ASNC 4H37A 2Q67A 1NVPB 1R6KA 2EZOA 1SRYA 2ZQMA 1MABG 4QPJA 4XBFA 5CMUA 2WLJA 3LSSA 3UKMA 1VQNV 2WLNA 1BL8A 3K0DA 4L87A 4U7OA 3FB6C 3QO8A 1MG1A 3OW2U 1OCOB 2EIMB 2OCCB 3WG7B 1R3KC 5EC2C 1XL6A 3GWOA 1RPOA 1J95A 4HAMA 2WLHA 3DGEA 3LDDA 4FIPC 3STZC 3SYPA 1E79G 4MVOA 3ZMZA 3CCJV 2ZXWC 1COWG 1OCOC 3RBZA 2H94A 2ZR3A 3WG7C 3ZMUA 4ZBMA 3OUSA 3OEHG 1E1RG 1AR1B 1S77D 3ZCCA 3FYEB 4WFGA 4RUEA 2NLJC 4PA3A 2EZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB8 C;  4JTC B;  2BOC C;  2P7T C;  3SPI A;  3E8G A;  3FB7 C;  4GX1 A;  4JTA B;  3SYO A;  1ORQ C;  2ITC C;  3VOU A;  3OR6 C;  4GX0 A;  1OCZ C;  4MVQ A;  5B1A C;  4X89 A;  2K1E A;  2Q69 A;  4RAI A;  4R6Z A;  5CBH A;  3E8F A;  3SPH A;  4X88 A;  1M56 C;  2A79 B;  4I9W A;  1XL4 A;  4GX2 A;  4MVU A;  5IY5 C;  4LBE C;  2WLI A;  4PA9 A;  5B3S C;  4G27 B;  4EKW A;  4MS2 A;  4UUJ C;  2A9H A;  4H33 A;  4P9P A;  4J9Y B;  2JK5 C;  4G28 B;  3T1C A;  2IH1 C;  3RW0 A;  1R3J C;  3T2M A;  4WFF A;  4HZ3 A;  4XDJ A;  3OR7 C;  2X6B A;  3LDC A;  1OCR C;  3AG2 C;  4J9Z B;  3STL C;  2X6A A;  4MW8 A;  2X6C A;  1S5H C;  3F7V C;  2DWD C;  5KUM A;  2WLL B;  2BOB C;  3SPJ A;  3TCU A;  4MSW C;  3ZJZ A;  5KUK A;  2R9R B;  4WFE A;  3R65 A;  3OUF A;  4MW3 A;  3EFF K;  4TWK A;  1K4C C;  3IFX A;  2HJF C;  1M57 C;  3E89 A;  4RO2 A;  4QE7 A;  4XDK A;  5J9P C;  3IGA C;  3K0G A;  3K08 A;  3K03 A;  4BW5 A;  2W0F C;  3LUT B;  5EBM C;  3T4Z A;  4QE9 A;  2EIJ C;  2AHY A;  2AHZ A;  2WLM A;  4MVS A;  2EIK C;  4WFH A;  1LNQ A;  3JYC A;  3PJS K;  3T4D A;  3E86 A;  5B1B C;  2KB1 A;  3K04 A;  3E8B A;  4RUF A;  4PA4 A;  3F5W C;  4MTO A;  5EK0 A;  4GX5 A;  3ABL C;  1ZWI C;  2QTO A;  2Q6A A;  3HPL C;  4PDR A;  4P2Z A;  5EBL C;  1KKD A;  2EIL C;  2YEV A;  4P9O A;  2Q68 A;  5CBG A;  1R3I C;  2HVK C;  5BZB A;  3AG3 C;  4MVZ A;  4MVR A;  5EBW C;  4DXW A;  2HVJ C;  3LDE A;  4LP8 A;  4KFM A;  3UM7 A;  3RVZ A;  4MVM A;  4R7C A;  3X2Q C;  2ZD9 A;  2ITD C;  3SYC A;  2ATK C;  1OCC C;  5E1A C;  5CBF A;  2EIM C;  2OCC C;  1R3L C;  4MTG A;  3GB7 C;  4R8C A;  1JVM A;  1V54 C;  2HFE C;  3ASO C;  2DYS C;  3KG2 A;  4MTF A;  3SYQ A;  2EIN C;  1G4Y B;  3ASN C;  4H37 A;  2Q67 A;  3E83 A;  3E8H A;  2WLL A;  3SPC A;  2H8P C;  4PA7 A;  3ABM C;  3SPG A;  2A0L A;  3BEH A;  3SJQ C;  3SYA A;  3ZRS A;  3AG1 C;  2WLJ A;  4PA6 A;  3UKM A;  3TET A;  2WLN A;  1BL8 A;  3K0D A;  3LNM B;  3FB6 C;  4PDV A;  4LCU C;  4F4L A;  4R50 A;  1P7B A;  3K06 A;  3ABK C;  3RVY A;  1R3K C;  3F7Y C;  4HYO A;  5EC2 C;  4QNH B;  1XL6 A;  4PDM A;  1J95 A;  3OGC C;  4OXS A;  2WLH A;  4JTD B;  3LDD A;  2QKS A;  5EC1 C;  3STZ C;  4X8A A;  3SYP A;  4MVO A;  4P30 A;  1QLE C;  1K4D C;  2ZXW C;  2IH3 C;  1OCO C;  2DWE C;  3FB5 C;  3RBZ A;  2DYR C;  3WG7 C;  4ZBM A;  3OUS A;  2Y69 C;  2WLI B;  4PDL A;  4CBC A;  2WLK A;  4WFG A;  4RUE A;  3AG4 C;  1V55 C;  2NLJ C;  2HG5 C;  4PA3 A;  4XDL A; 
#chains in the Genus database with same CATH topology
 2LQG A;  1K9M W;  2P6J A;  2W6I G;  2FFH A;  4JI8 O;  3GM2 A;  3L71 H;  1S76 D;  2C2A A;  2A3Q A;  2F1M A;  4GLX A;  3HKB A;  2O9X A;  2X51 A;  4PA9 A;  2ZKO A;  1BQZ A;  4RDA A;  3AG2 B;  1XIL A;  2XS8 A;  2N74 A;  1HR0 B;  1M6T A;  1YYX A;  3VAY A;  2XLD A;  2PFD A;  4X66 O;  3L8I A;  3JSN A;  1HNX O;  1I08 A;  3ZS8 C;  1XNQ O;  1J8M F;  4IRU A;  4LF8 O;  4GZR B;  5JS5 A;  1W2W A;  1W0J G;  4UCU A;  1B6Q A;  5IY5 B;  4J32 B;  2LSE A;  1AI4 A;  3KMI A;  2JVD A;  1K4C C;  2HJF C;  4HE8 D;  4J10 A;  2JD3 A;  4XDK A;  1GRJ A;  5LYJ A;  2Z15 A;  2LK4 A;  3I56 V;  1B68 A;  3K6B A;  3KPH A;  5HV9 A;  2EIK C;  2BSK B;  1LNQ A;  4DR1 O;  2LFS A;  3ZHQ A;  4WCE V;  3MBG A;  5F5F A;  4LF6 B;  5JQG B;  3N2G A;  3WB0 A;  3O55 A;  2LGW A;  1JFF A;  2OQM A;  2Z0A A;  3Q7G A;  3AEI A;  1WPB A;  3A0B Z;  5JLI A;  3CQZ A;  3P3N A;  4YJ3 A;  3HKE A;  3GOR A;  4CS7 A;  4C7O B;  3QMK A;  4R7C A;  1M2O A;  4U5G A;  1M2V B;  2ZPA A;  3QZC A;  4LF5 B;  2R70 A;  4AIL C;  3PN1 A;  4OX9 O;  3SYQ A;  2YIC A;  1T5O A;  3DE9 A;  3CXH F;  1QR8 A;  1JPJ A;  4I55 A;  4YXW G;  3CC7 V;  4KBL A;  1S72 V;  3A0H Z;  1K92 A;  1Z63 A;  5CN0 A;  2IM9 A;  1TUB B;  5AGF A;  2CNW D;  1HWY A;  4DRX B;  3B0P A;  3ZTM A;  5A9G A;  1QQC A;  1QSP A;  2MW2 B;  4JTD B;  1KUQ A;  3DWW A;  2PNO A;  5CI9 A;  5KYN A;  1WGW A;  3ZIA G;  1JOY A;  3OTO B;  1I5Y A;  1HW1 A;  3OA1 A;  4PJL A;  4GYT A;  3N2K A;  5B1A B;  1YJW V;  1L1F A;  3LS1 A;  1EFR G;  4GKJ O;  1Q90 D;  3DC6 A;  4O6M A;  4CH5 A;  3E8G A;  4J41 A;  4F6R B;  2KJG A;  4JTA B;  1N32 O;  1J8Y F;  2R25 A;  3QVY A;  4ZKI A;  3UCS C;  4MVQ A;  3E35 A;  5EYP B;  4AE4 A;  1IXM A;  3JAK A;  2PZS A;  4YT5 A;  3GAN A;  3JAT B;  3VQW A;  1KD1 W;  1K04 A;  5B1O A;  3RT3 C;  2IXP A;  2GA0 A;  4EKW A;  1I4Z A;  1FKA O;  4YIO A;  1TVK A;  4JI1 B;  5T3T A;  3CCS V;  1VQ4 V;  2IH1 C;  2E87 A;  3RW0 A;  2CNW A;  5LMU O;  1R3J C;  2NNU A;  5FPR A;  3SXY A;  1BS3 A;  5LGN A;  3JAS A;  3JTL O;  2EJR A;  1WP7 A;  2IW5 A;  5L0J A;  3D3Q A;  2DE0 X;  2QDO A;  2X6C A;  2P5O A;  1CXZ B;  2RNB A;  3C18 A;  4O4L B;  4DR7 O;  3VF0 A;  4PV1 B;  4PHZ A;  5DEC A;  2WVO A;  1QNM A;  1GKF A;  2XLH A;  1BZ4 A;  3G50 A;  1QKR A;  2OJQ A;  1RKE A;  4RO2 A;  3IGA C;  1HDJ A;  3H1I H;  2JGD A;  3EHN A;  1MZF A;  3CYO A;  3OFN G;  4JEA A;  2YHS A;  2M6Y A;  4BG0 A;  1VQ9 V;  1HMD A;  1A41 A;  2BTQ B;  3B40 A;  4G7H F;  4P6I C;  2KB1 A;  3KCX A;  1SC5 B;  3LSQ A;  4LR3 A;  2B9Z A;  1C02 A;  1WN0 A;  3ABL C;  2ZDI A;  5K1X A;  2YZS A;  5JCO C;  4CIP A;  2DYS B;  4LC1 A;  4ZHQ B;  1V9P A;  2HVJ C;  2XAH A;  5H6Q A;  4DV1 B;  1GM9 A;  4KHP B;  3QNE A;  4Z1V A;  4I9Q A;  4O4I A;  1YYJ A;  4CSA A;  1MMA A;  1JRA A;  1O5H A;  1FFX A;  1G4Y B;  3H2V A;  2P0N A;  5L3D A;  3SR2 C;  3NRH A;  3JSZ A;  1O87 A;  3E8H A;  2TMV P;  3T1H O;  3HKC B;  5KA5 A;  4EHP A;  3X2Q B;  1TUE B;  5LMN O;  1G5Z A;  4B6I A;  3ETD A;  1ENV A;  2QNL A;  5D91 A;  4CJG A;  3M15 A;  1SKV A;  4F6E A;  3ABK C;  3OMN B;  4DUY B;  3BAA A;  1JMK C;  2P90 A;  4N6C A;  3ZRW A;  3M79 A;  3FOP A;  3Q4H A;  3AJM A;  1E83 A;  1N4C A;  4OIP F;  1VLS A;  4U5F E;  2OIE A;  4OD5 A;  4BAY A;  3F5T A;  3VBB A;  1HNZ O;  2ZE5 A;  5EIB D;  3NYL A;  2X0L A;  4Z9H A;  1Y76 B;  3FB8 C;  1HMO A;  1Q0M A;  2NSF A;  3C8Z A;  4IJJ A;  3RQG A;  4J7Y A;  1QVF U;  3NYJ A;  1T9K A;  2F22 A;  1AP5 A;  1M9N A;  1QLE B;  3JRT A;  1SER A;  2BTO A;  1P84 F;  2KG7 A;  1DF5 A;  1QLN A;  1LVK A;  1L7C A;  2ASR A;  3CAX A;  4JW1 A;  2Q8V A;  3L0I A;  3U8V A;  2LW7 A;  3TGU H;  2DQ3 A;  5HFM A;  4Q7C A;  1SET A;  3AK2 A;  5KYW A;  1GGQ A;  4PFP A;  2JPU A;  5KAI Z;  3QTH A;  1CEZ A;  2CW0 F;  2J9B A;  3STL C;  1IBK B;  3BVO A;  3A0R A;  3ZHR A;  4MW8 A;  1S05 A;  4M63 A;  4E0H A;  3TXQ A;  3HNI A;  2HEP A;  2RDC A;  1WA8 A;  3BPZ A;  5L3C A;  2Q9B A;  3CZ6 A;  5KUK A;  4MTX A;  3IQ5 A;  1BMF G;  3LJB A;  1MMD A;  3L74 H;  4CH4 A;  5DN6 G;  1YSC A;  4TV9 A;  1N8R W;  4LNU A;  4QE7 A;  3K0G A;  5KYU A;  4TSF G;  3MX3 A;  5B1B B;  1EBO A;  4CC5 A;  3UQ8 A;  4CDV A;  2WLM A;  2AWY A;  1GM5 A;  4DRI B;  1I0H A;  4I3M A;  5IJ0 B;  4I50 A;  4JC7 A;  3S0X A;  2IJI A;  5BR8 B;  3CE2 A;  3U10 A;  1NH2 B;  1D5A A;  4DR2 B;  1KKD A;  1PNK A;  3B09 A;  4U3J A;  2EIL C;  5CBG A;  4X62 O;  3MD0 A;  2LD6 A;  1TWA A;  1TGO A;  1VLT A;  2PBE A;  1NR1 A;  3W7U A;  1LI7 A;  4EBJ A;  2DN9 A;  1U6H A;  1Y66 A;  4IWB A;  3EFO A;  3JAR A;  5KMG B;  1JOG A;  3T4R A;  1K7D A;  3CMA V;  4UCS A;  2B5U A;  1Q6H A;  2G38 A;  2NR5 A;  3RYF B;  5IYC O;  3SXM A;  4LWS B;  1G4W R;  1ZHZ A;  2KYH A;  2OG2 A;  5EGY A;  1AI7 A;  1H2K A;  1EZV H;  4JZG A;  1FAF A;  2VCA A;  1HNW B;  3AG3 B;  5JVE A;  5JSL A;  3LNM B;  3GM1 A;  1YTF D;  4F4L A;  3I55 V;  4DV3 O;  1JA8 A;  4FLY A;  1KNY A;  5BMV A;  4U7N A;  1V54 B;  2HP8 A;  3IQ6 A;  1Z2G A;  4PDM A;  2YIB D;  5FZT A;  3E2E A;  3ATP A;  2ZXP A;  2ZNJ A;  3AG4 B;  4JI8 B;  2P1A A;  4X9Q A;  2D5R B;  4LDQ A;  4ER9 A;  2DYR C;  4FM2 A;  5D5P A;  1TFK B;  4O4J B;  2YWA A;  4IGG A;  4PDL A;  3RYC A;  5IWA O;  2OKU A;  4LER A;  3FAV B;  2IJK A;  2FGY A;  4FJC C;  1RSO A;  3RYH B;  3VQY A;  1LI5 A;  4G2K A;  4HEA J;  4BJ6 A;  1KYO F;  2M7W A;  2P7T C;  3U9M A;  3SYO A;  3K9S A;  4PI2 A;  3WB1 A;  1HNX B;  1YZA A;  1BHB A;  1XNQ B;  3EG9 A;  4RBN A;  1QZX A;  2HJ3 A;  4RAI A;  4LFA O;  4E0I A;  5A6A A;  5T3W A;  1XNR O;  2KW3 C;  1ZX3 A;  4CS9 C;  1T6I A;  5FNV B;  3PHF 2;  1BBH A;  3T1C A;  3JAW B;  1VQO V;  4GKK B;  5A6J A;  5J2U A;  1AVM A;  1VB5 A;  1XRE A;  1N1C A;  5FCL A;  2P6V A;  4JE9 A;  2YIB A;  4N23 A;  3RKO F;  2HKV A;  1S5H C;  5KX5 A;  4OGQ B;  4ASU G;  4I4T B;  2VH3 A;  4LDR A;  4DR5 O;  2DGJ A;  1OV9 A;  3DXR B;  4LFC B;  3BY6 A;  2Q4F A;  3ZX6 A;  1Q86 W;  3ZRX A;  4TWK A;  4DV5 B;  4JUR I;  5DQT A;  1Q6I A;  3RYI B;  4B3S O;  1M90 W;  4ONS A;  4BW5 A;  3QO5 A;  1GTO A;  4O2B B;  4LF7 B;  1TAE A;  3K66 A;  3B8N A;  4NXM B;  4IHJ B;  4BJT A;  1QBZ A;  4TV8 B;  4DV6 O;  1G8M A;  3JAL A;  4DR6 O;  1XMQ O;  1F23 A;  2OEX A;  2QWP B;  3FFQ A;  4X1I B;  4OX9 B;  4JJG A;  1NVP D;  3JSL A;  3E8B A;  4YK5 A;  1Y4M A;  2R03 A;  2LP7 A;  5K1P A;  4MTO A;  3J81 N;  3EGD A;  3W7T A;  1JCH A;  5C93 A;  4NCQ A;  2EIJ B;  1R3I C;  4QJF B;  3C8G A;  2WZF A;  1XMO B;  4IL6 Z;  1D0Z A;  2B1G A;  4DVY P;  5B5E Z;  4D7T A;  2HHH O;  1IBL O;  4IIJ B;  4GQH A;  3DTU B;  2Q7H A;  1BGY H;  4A4A A;  4BJ1 A;  2FYU H;  2RSE B;  3TUL A;  5JRA A;  5KYY B;  2RD9 A;  1R5I D;  3US6 A;  3CS5 A;  5F28 E;  3DM9 B;  4E7Z A;  4JI5 B;  4CS4 A;  5TIS Z;  4NTY A;  1MAB G;  3LEV A;  4QPJ A;  4I1O B;  5DS5 A;  2YI8 A;  1XZP A;  5BQI A;  4W4K A;  5CMU A;  1VQN V;  1RFY A;  4L87 A;  1WP8 A;  4EUK B;  4ULV A;  2OCC B;  3IAY A;  3WG7 B;  1GQA A;  4GKJ B;  3GWO A;  1ZZP A;  5IYZ B;  1RCP A;  4YL0 A;  3DGE A;  4FIP C;  3STZ C;  1KKC A;  4MVO A;  4O2A B;  1ZHY A;  3ZMZ A;  3S27 A;  1T6Q A;  3CCJ V;  2ZXW C;  4JI0 O;  2ZR3 A;  4ABM A;  4ZOL B;  2PX3 A;  3RQE A;  4K0K B;  3DM5 A;  3JZ0 A;  4C3D A;  2VWK A;  1U96 A;  1VF7 A;  5H5N A;  3ETQ A;  2Q4P A;  2CH7 A;  2F23 A;  2PF4 E;  2NLJ C;  4JI4 B;  4PA3 A;  4JI6 O;  2MWQ A;  5KHI A;  3I5P A;  4H4K C;  2R7Q A;  2R7W A;  3L73 H;  1R73 A;  2QR4 A;  4GX1 A;  5LMU B;  4LF4 O;  3RH3 A;  2HSQ A;  3B71 A;  3JT1 A;  4X89 A;  1YHQ V;  2YRF A;  1Q0D A;  4NKG B;  4DR4 O;  1FXK B;  2WB7 A;  5GON B;  3DZA A;  4R32 A;  3UO2 A;  5DM6 V;  2YXY A;  5B3S C;  4UUJ C;  2XAG A;  4J9Y B;  3UNG C;  4NTB A;  4I1M A;  2ZDI C;  4TUY A;  3PCV A;  1PV0 A;  4IAO A;  2VCC A;  5KUM A;  1NSG B;  1QHT A;  4O4H B;  4D4X A;  4WFA V;  4NB5 A;  1L0L H;  4XEK A;  3S29 A;  4CSA C;  4JPR A;  1CGO A;  3ZSU A;  1C03 A;  1PNL A;  4XEV A;  4O6N A;  1LPE A;  3IFX A;  2BE5 F;  1HP8 A;  2EIK B;  4EB6 A;  5LOV B;  3E89 A;  4LDK A;  4PAC A;  1SA0 A;  4J42 A;  3W7S A;  4Q4Z F;  4NTA A;  4YT4 A;  2AHY A;  4RD9 A;  4KP4 A;  3CRC A;  2VQF O;  2BL2 A;  2Y3B A;  2M64 A;  3CP1 A;  4PJM A;  1D1B A;  2L7A A;  5L0H A;  2EPM X;  1PPJ H;  3JRM O;  3AK1 A;  4BIU A;  1X59 A;  1O9G A;  2Q6A A;  1SQQ H;  3CC2 V;  4N6H A;  2YEV A;  2E5L O;  2UXB O;  3T6G B;  4A2N B;  4JI7 O;  2OEV A;  2LW1 A;  3BRJ A;  3NKD A;  2BSK A;  1OCC C;  5D92 A;  3B0U X;  4JVS A;  2UXC O;  1NBB A;  1BSM A;  4UCR A;  5JVD A;  2D2C B;  1AJN A;  3CRA A;  4NYK A;  4LAC B;  4LLC A;  3W2W A;  3ETE A;  4X64 O;  2G3V A;  4B7K A;  4FZ1 A;  2YID A;  1K3E A;  4UXN A;  1URF A;  4PDV A;  2IYL D;  1YIJ V;  1NLX A;  2JIZ G;  2X0C A;  1Q7Y W;  5K0I A;  1M2V A;  3W2V A;  4E17 A;  1HNZ B;  2YL1 A;  3G6E V;  3CSK A;  2R7T A;  2C03 A;  4YJ2 A;  1FXH A;  1XZQ A;  5COF A;  4CBE A;  1PNM A;  2Y48 A;  2DWE C;  3K58 A;  5DED A;  3RF3 A;  1KP2 A;  5BY1 A;  1NT2 B;  2PGG A;  4PFO A;  3F46 A;  3UR3 C;  1TUB A;  4PD4 F;  5AC4 A;  2UUB B;  3U9J A;  1Y67 A;  4DRX A;  5IYD O;  3C3T A;  4LLE A;  4GYC B;  5EIB C;  1KBH A;  4C3E A;  3VOU A;  4B7E A;  1ZHT A;  3E22 B;  4XLN F;  2DMX A;  3QG5 A;  2ZXR A;  4ZI7 B;  2IJJ A;  3EZI A;  3ECS A;  2A79 B;  1WOL A;  2AZ0 A;  3TOL A;  4G27 B;  3PMR A;  4MS2 A;  2Q3T A;  3NR7 A;  4H33 A;  4GT1 A;  2YI9 A;  4YHH B;  3GOD A;  1N0J A;  2ADQ B;  4F6R A;  3QW1 A;  2KKW A;  4DBQ A;  2XOK G;  3H01 A;  5EYP A;  5IJ9 B;  1M5I A;  1Q82 W;  2CCY A;  3GWL A;  3G67 A;  3JAT A;  1KP3 A;  1SS3 A;  2WAM A;  4OIR F;  2RN9 A;  4GCZ A;  3SXK A;  2PTM A;  3EFF K;  3SXZ A;  4I0X B;  5GTI Z;  3K3W A;  2Q0A A;  1YA9 A;  2GDC A;  4O79 A;  1VIB A;  4K3A A;  1M57 C;  2Q9C A;  2R7O A;  5CA0 B;  3SJC C;  1IZ3 A;  2ADP A;  4DW0 A;  2HJM A;  2YL3 A;  5EZY A;  5L0I A;  5FPO A;  3ZHT A;  4X62 B;  1VQ6 V;  1HW2 A;  4DOZ A;  4P9T A;  1H8E G;  4WFH A;  3ABL B;  4JAS A;  5EHH A;  3ZED A;  4BEM J;  1BR1 A;  3P30 A;  3JCU Z;  5FL7 G;  4FZ0 A;  2HJD A;  4OD4 A;  1N0N A;  5AC5 A;  1I7F A;  1Q81 W;  3ABT A;  4PEL A;  4YIP A;  2J7P D;  4D6T H;  1MNG A;  3MLG A;  3T6J A;  3NXS A;  1FS0 G;  1KEC A;  4X1Y A;  4JYY A;  4AQY O;  5C8Y B;  2XSE A;  3LDE A;  4ICG A;  5GW7 A;  4YL1 A;  5LGU A;  2ATK C;  4BJ6 C;  1R3L C;  4LF9 O;  5AG2 A;  3KL4 A;  1SQB H;  4DV7 O;  4IAQ A;  2JEX A;  4JCH A;  1H2M A;  3G4X A;  2WLL A;  2OOC A;  4CS9 A;  3CJH A;  1VQ8 V;  3H1L H;  4FFK A;  3SJQ C;  4DV4 O;  3AG1 C;  1JR9 A;  5BQG A;  1YAR O;  1EN5 A;  5IWA B;  4FLZ A;  1FJG O;  1EQ1 A;  1P7B A;  1Y74 A;  4HYO A;  1EZJ A;  2ARH A;  1V74 B;  1NI8 A;  1NU7 D;  2A7W A;  1YXB A;  4JYA B;  1QCE A;  5J2T B;  3B77 A;  5COG A;  2JGU A;  4CDA A;  4RQE A;  2VQE B;  1IXB A;  1PKX A;  1YA7 O;  2J7P A;  3HKC A;  4X1K B;  2ICW G;  1D0Y A;  3X1O A;  3LS0 A;  2R72 A;  2HG5 C;  1TQG A;  5KAF Z;  4DV2 B;  3H1H H;  3FB7 C;  1OR3 A;  2Y3H A;  1WTY A;  2GTS A;  1OCZ C;  4B08 A;  3BFR A;  3K7D A;  4N21 A;  4EBK A;  3NYM A;  1K05 A;  1PP9 H;  3JCZ A;  3TD7 A;  3P32 A;  1GAX A;  2HUJ A;  3B8M A;  2XS1 A;  1JQ0 A;  2UUI A;  2FTK A;  4DK1 A;  1H2S B;  5L3E A;  1IW7 F;  3LSU A;  4B3S B;  3DJU B;  3LDC A;  1K5S A;  1OCR C;  4JI2 B;  2ZE8 A;  2O57 A;  4X20 B;  2X6A A;  1J5E O;  3IJ4 A;  1D2D A;  2EX3 A;  2QJ1 A;  4DV6 B;  2LCH A;  4BPM A;  2YDE A;  1SQP H;  1NH2 D;  1H7I A;  1MQV A;  1BT8 A;  4UB8 Z;  3VM6 A;  1Q8I A;  3CB2 A;  4ULW A;  2Y39 A;  2GV9 A;  3CRR A;  3K03 A;  5LP6 A;  2XAJ A;  3QF7 A;  1ZL8 B;  4QE9 A;  4NTF A;  1MOF A;  1XDC A;  1YZB A;  1M93 A;  2LQT A;  2W4B A;  3UT5 A;  2EPL X;  1DK1 A;  2HV6 A;  2EIL B;  4JIO A;  1HW7 A;  2HHH B;  3UO3 A;  1WN7 A;  4G7Z F;  3U3B A;  1RPR A;  2PY5 A;  3EXA A;  5H2F Z;  4RUF A;  4BIZ A;  3BAB A;  4TOI A;  3MDS A;  2G3K A;  2Y3D A;  5DS6 A;  3FD9 A;  5A6K A;  2A06 H;  1V4A A;  1QU7 A;  4YT8 A;  4KFM A;  2XM0 A;  3ZMS A;  1SF8 A;  3HKD B;  1ST6 A;  2VS0 A;  4DYL A;  5LHG A;  2F4V B;  2NUT B;  2OJE D;  3BEH A;  2F66 C;  2H7O A;  4PA6 A;  4KUM A;  3ZMT A;  5GPG B;  2WVN A;  3TJ5 A;  4DVZ A;  5E79 Z;  2DYR B;  5JUA A;  2XAF A;  3N0T A;  1MSD A;  4QNH B;  4UVB A;  2KSF A;  5HSW A;  3J7A U;  4YWQ A;  1N36 O;  5EC1 C;  2IBF A;  3UGP A;  2MYS A;  4LWS A;  3N24 A;  2Q5Z A;  3DXJ F;  4FK5 C;  2IH3 C;  4IB4 A;  2QLA A;  3ABM B;  1RJ9 B;  1NFO A;  1Q0K A;  2YIA A;  3DI5 A;  2YL0 A;  1IVS A;  4CJO A;  3V5Y A;  2A6E F;  3L75 H;  3U0C A;  1H2G A;  2FB5 A;  3G6B A;  1YJG A;  3S90 A;  1OW6 A;  5B3I A;  4J7J A;  4DV0 O;  2Y0P A;  3N27 A;  3E9V A;  3FXH A;  2HMQ A;  1M4U A;  3OR6 C;  3V5Z A;  4YT2 A;  3CCM V;  3W7W A;  1G6U A;  1AR4 A;  1JFF B;  4O4J A;  2CUG A;  5IY5 C;  4PJN A;  2IXO A;  3HKE B;  3RYH A;  1YJN V;  2A9H A;  2XL8 A;  3AQC A;  1NQT A;  5L3F A;  4BJ5 A;  3T2M A;  3L8J A;  1XOU A;  2ZR2 A;  4G0H A;  3OR7 C;  2UUA O;  3T1Y O;  1YI2 V;  2A0B A;  2YSU B;  4QPK A;  5ITZ A;  3A2F A;  3OM3 B;  2BC5 A;  4FFB A;  2HKO A;  1APC A;  4X65 O;  2VQF B;  4B3R O;  3ZJZ A;  3G80 A;  3R65 A;  5CA1 A;  2VB6 A;  2AWC A;  5E3A A;  2CGN A;  3K9A A;  4P9F A;  1TWG A;  4XPW A;  3K5L A;  2P22 C;  1GS9 A;  1OW8 A;  3M1C B;  2PI5 A;  3LEO A;  1FR0 A;  2AHZ A;  3Q6M A;  3ZN1 A;  4FAP B;  3WB2 A;  4JI7 B;  1O9H A;  2PP4 A;  3CC4 V;  1W0K G;  2GTA A;  3ZBH A;  2JX0 A;  1H2L A;  3MHH C;  1GN3 A;  1OHH G;  4PA4 A;  3F5W C;  1AJQ A;  3EH1 A;  4JJF A;  3RYI A;  1I5N A;  4WBN A;  4N06 A;  5LL6 Y;  1GN2 A;  4X64 B;  4ZLC A;  1Z5W A;  4DXW A;  3IC9 A;  2UUC O;  4JRZ A;  4AE4 B;  1N33 O;  1JJO A;  3K57 A;  3JAK B;  4TV8 A;  4DUZ B;  2R02 A;  4MTG A;  2R7X A;  2GAQ A;  3OAA G;  3GB7 C;  1ORJ A;  2BCC H;  3EGX B;  1Z6A A;  3TOM A;  5IE9 A;  3U2L A;  4JI3 O;  1SRY A;  2ZM6 B;  2A68 F;  2WLJ A;  3LSS A;  3JAS B;  1D1C A;  2WLN A;  3K0D A;  4U7O A;  2FML A;  2CDQ A;  3OW2 U;  2XUM A;  2EIM B;  2LJ2 A;  4KL1 A;  4HNA B;  4IIJ A;  4KXR A;  1R3K C;  5EC2 C;  2DOS A;  1J95 A;  2WA3 A;  2E76 B;  1NU9 C;  2C04 A;  2E75 B;  5KYY A;  3SYP A;  4LFB B;  4N4W A;  3L70 H;  1R1B A;  1X4T A;  2HV7 A;  1VYK A;  2L9J A;  1Y6X A;  5JJN B;  1OCO C;  3I5Q A;  4YL3 A;  4QI2 A;  2AU5 A;  4ZBM A;  3DAF A;  3V7O A;  2YXL A;  4U5B E;  2JGD B;  2CE4 A;  4UFZ A;  1N34 B;  3FYE B;  5KLV H;  4WFG A;  4JV5 B;  4RUE A;  2KQ9 A;  1PD0 A;  2QTS A;  4XDL A;  1UG7 A;  3C62 A;  2NN4 A;  2XND G;  4MND A;  2YUA A;  1HR0 O;  4H0L B;  4O2A A;  1Q0F A;  2R7U A;  1VAR A;  4XEF A;  2YLI A;  3D36 A;  4J30 B;  3E8F A;  1FMW A;  2Y69 B;  4ZOL A;  5E2Q A;  1DOW A;  4OIN F;  4E7S A;  4KI2 A;  1V55 B;  4Q6G A;  4E2L A;  2JS5 A;  2OWO A;  2J46 A;  2PX0 A;  1VQ7 V;  1OR2 A;  3FX7 A;  1BE3 H;  3H9V A;  1NZ6 A;  4YN0 B;  3IQT A;  1HE1 A;  2DWD C;  1DGS A;  1BCC H;  1LE2 A;  4HFK B;  1FXK A;  4X66 B;  5GON A;  4DR3 O;  4BW9 A;  1UFB A;  1EN6 A;  1HE9 A;  1I4Y A;  4LF8 B;  2LFF A;  5J9P C;  3EH2 A;  3K1H A;  3M4C A;  1SQV H;  5KHG A;  5EBM C;  4K0D A;  4AQY B;  4UV9 A;  3ZRW B;  4EFB A;  2QM4 A;  2R9I A;  3JYC A;  1NU1 H;  3DD7 A;  3T4D A;  5CA3 A;  2PI4 A;  4OPH A;  3H1J H;  2V26 A;  2W45 A;  4LF5 O;  1FNT c;  1OCC B;  1ZWI C;  3EHM A;  4DR1 B;  4PDR A;  4IT5 A;  1CPY A;  2DQ0 A;  3QTC A;  3ZQY A;  2LFR A;  3AGT A;  3VYW A;  1AEP A;  3C3S A;  1OXB A;  3L34 A;  1FFH A;  1ZYR F;  3X2Q C;  2B0H A;  1D1A A;  2Q7R A;  4MT8 A;  2GUZ B;  2P06 A;  2AW9 A;  4CDY A;  1K8A W;  4FMT A;  4WGY A;  2QEX V;  1QR9 A;  3O39 A;  2UUH A;  4R8C A;  1JVM A;  4EIY A;  1FFT B;  3RWR D;  1H38 A;  5A6B D;  4FM0 A;  1ZLZ A;  1SES A;  3OTF A;  3SPC A;  3HTK C;  1NS1 A;  3KYI A;  3OEO A;  5KYW B;  1NKD A;  3ZRS A;  2QGN A;  1A7E A;  5L0F A;  4DO2 A;  1L3P A;  3MHS C;  3BHP A;  2F93 B;  2ODM A;  3EJN A;  1QVX A;  1LS1 A;  1SZI A;  4YY3 O;  4P30 A;  2JDI G;  1QLE C;  4AI8 A;  2CGE A;  3LLK A;  3OEE G;  5D5Q A;  4TV9 B;  2Q73 A;  4LNU B;  3ITF A;  1ZSP A;  4JYC A;  1YIT V;  3FVY A;  1MSW D;  1T01 A;  3UMI A;  3QW0 A;  5FLX N;  3KZI Z;  4CBC A;  2HZ8 A;  1FXV A;  3VQV A;  3CME V;  2CTR A;  2HMZ A;  3GWN A;  1E85 A;  4JTC B;  4I50 B;  2RCV A;  5LP6 C;  3DAG A;  1NTM H;  2NUP A;  4JAU A;  2N05 A;  2E3C A;  4JI1 O;  3UMH A;  1U89 A;  4EEQ A;  4PJJ A;  5CBH A;  1J5E B;  1XEQ A;  2BE3 A;  4UVC A;  4XWJ A;  1OW7 A;  3JD1 A;  3CEX A;  4KNW A;  1N32 B;  1GK9 A;  4W4L A;  5B1N A;  3ZIB A;  3EFO B;  4Z9J A;  1CP9 A;  3JAR B;  3IPM O;  3V5X A;  2LFD A;  2H3O A;  3JD3 A;  3KH2 A;  3CCL V;  4E18 A;  3E22 A;  2R7R A;  1OKK D;  5L0C A;  5B66 Z;  4OIO F;  2DJV A;  2KQX A;  4XQ1 A;  4MW3 A;  2JEU A;  2UXD O;  4NXN O;  2NSG A;  2YL7 A;  4KC9 A;  2R7S A;  5BMV B;  2XL6 A;  4DR7 B;  5CI8 A;  4JCZ A;  1B3Q A;  2WVQ A;  3N2Z B;  1RKC A;  5IJ9 A;  2YQY A;  2GHY A;  5LXT A;  2WZG A;  3TXS A;  3S84 A;  5DQZ A;  3B9Q A;  2FKX A;  3K04 A;  4QDL A;  3RYC B;  1KB9 F;  4DV1 O;  2EPN A;  4KHP O;  1QQ3 A;  4L6R A;  3HPL C;  3LNN A;  5LA6 B;  3EHB B;  2Q68 A;  2HVK C;  1YAU O;  1SF9 A;  3AG3 C;  1T5E A;  4MVZ A;  5LHI A;  1LIH A;  2J9W A;  2CK3 G;  1MMN A;  3C7J A;  1OKK A;  1Y4C A;  1V54 C;  3ASO C;  2PUS A;  1VF6 A;  1D0X A;  1N36 B;  1PV3 A;  4O7G A;  1LS4 A;  2Q7G A;  1YTF B;  3AG7 A;  5HFL A;  4RQF A;  1OZ0 A;  1NR7 A;  3RIP A;  3D8C A;  4Q5S F;  5C8Y A;  4LH7 A;  5T1D B;  5KX5 B;  4PR9 A;  4BJ5 C;  1KTM A;  3T1H B;  2QM8 A;  3U5S A;  3OGC C;  4OXS A;  1JAF A;  1QPU A;  1OJH A;  1HY5 A;  1NTZ H;  5LMN B;  3ZC4 A;  3A11 A;  4FLT A;  3APQ A;  5JH7 B;  1A0B A;  2J0X A;  2KK1 A;  1MMG A;  1E1Q G;  1F1M A;  5JQG A;  1OCZ B;  3ICX A;  5L3G A;  3F47 A;  1VF5 B;  1XHZ A;  1E84 A;  2VC9 A;  5KYX B;  3LLI A;  2CTP A;  5L3V A;  3RFY A;  4C7O A;  4UVA A;  4CS8 A;  3ABU A;  4GX0 A;  4UCV A;  2YVK A;  1IBM O;  2K1E A;  3B29 A;  1US6 A;  1S7Z A;  3JSE O;  3EGD B;  4FX5 A;  1M56 C;  4MVU A;  3JYY A;  2QKA A;  4LBE C;  3C8G B;  1OCR B;  4B3R B;  4X1K A;  1IBK O;  4NTW A;  5L0D A;  2ZT9 B;  1PCX A;  2JK5 C;  1AJP A;  4D7S A;  3FAP B;  4XDJ A;  3SGI A;  5L3B A;  2X7R B;  5L0G A;  1UFI A;  4Z1M G;  4B3M O;  2M4E A;  3JYH A;  2AP3 A;  3HNJ A;  3ZDL A;  4YJW A;  1S3J A;  1KC8 W;  2F43 G;  1XHX A;  3M7M X;  3OMA B;  1U97 A;  4MSW C;  3CCQ V;  2J0W A;  3OD4 A;  2RJZ A;  4GEH A;  1RM1 C;  4OPA A;  2J8W A;  4DW1 A;  3FKS G;  2DW4 A;  2ZIM A;  4W8K A;  2EIJ C;  3K33 A;  5CB4 B;  4E4E A;  3SEO A;  2YXH A;  3W7X A;  4DR2 O;  4F4B A;  3L9D A;  1N33 B;  3J06 A;  1THZ A;  1DOV A;  1WB8 A;  4K35 A;  1W2B U;  4JZA A;  1XBL A;  5EBL C;  2QTO A;  2KGO A;  4JI3 B;  3CCR V;  1Z23 A;  3G4Z A;  1TWH A;  2L6L A;  1GN6 A;  4MVR A;  4LH6 A;  3RVZ A;  1EM1 A;  2ZD9 A;  4JGS A;  1HNW O;  2UU9 O;  1EN4 A;  2OCC C;  1AVO B;  2XRH A;  5KA6 A;  2ZIN A;  1AIL A;  3ZWI A;  1EI7 A;  3SJA C;  4O4L A;  3ZVR A;  3D36 C;  1YCI A;  4UV8 A;  3SYA A;  1WLE A;  4TUY B;  5GTH Z;  5F2V O;  2R9A A;  3M4B A;  4IYI A;  1G8X A;  1MZE A;  3HKD A;  4WFB V;  1LR1 A;  5BQH A;  4FPP A;  2QWR B;  2IXN A;  3PDM P;  4X0R A;  2CDY A;  4JAV A;  2I15 A;  4MQ9 F;  4CH6 A;  3K5M A;  2NUT A;  5LGT A;  3WHN A;  2W0X A;  2L81 A;  4G7O F;  4EB6 B;  3CHX A;  2XLE A;  4U5E E;  1SA0 B;  3JD2 A;  4DV3 B;  1YDI A;  2BTQ A;  3APO A;  5JP7 A;  4AX2 A;  1FXK C;  1SZX A;  2XT9 A;  2WLI B;  3M99 B;  1Z5Z A;  1FPO A;  1GH6 A;  2QWQ B;  3ABK B;  2ZCE A;  1FAP B;  2ZIO A;  1IDS A;  4ZHQ A;  3FAJ A;  4AK9 A;  1CGM E;  2MHR A;  1DTO A;  4GKK O;  2L6F A;  1RJ9 A;  4CS3 A;  4TQD A;  2YEV B;  3UGO A;  3G71 V;  3VRC A;  2Y0I A;  4DR3 B;  4LFA B;  3RYL A;  4DJ9 A;  2L6H A;  1RXQ A;  4JF3 A;  4LFC O;  1XNR B;  2D4U A;  4QI0 A;  2X6B A;  1ZVZ A;  5JVD B;  4DV5 O;  2JS3 A;  3T6B A;  1F51 A;  4HFF B;  2YLD A;  2OCH A;  1G1X B;  5A69 A;  3QO7 A;  4LF7 O;  2R9R B;  3TJT A;  4NXM O;  3D3I A;  2GFH A;  4CIH A;  4FWV A;  2XXA B;  1VQM V;  3Q6N A;  1ZHX A;  4I44 A;  4DR5 B;  1F4N A;  3OT7 A;  3T4Z A;  4YJ2 B;  3AGU A;  2HR3 A;  3U2M A;  1PD1 A;  2IU0 A;  2L6G A;  4XPY A;  1Y76 A;  2NG1 A;  3K5O A;  1XMO O;  3AK3 A;  3S3X A;  4JYB A;  3NG1 A;  3FYI B;  4GX5 A;  2RQ6 A;  2WWW A;  5IT9 N;  2OT5 A;  4DR6 B;  1XMQ B;  3TQO A;  3FOO A;  1GMG A;  5BZB A;  4XPX A;  1FD9 A;  4J7K A;  1YVW A;  4WAB A;  4DRH B;  1L8D A;  1SQX H;  4FLX A;  3UM7 A;  4U9D A;  1C17 M;  4D4N A;  3NDB B;  4JI5 O;  2EBO A;  2ITD C;  1WNS A;  1B06 A;  3KKY A;  4NTX A;  2EIN C;  2XLO A;  2GDS A;  3IC7 A;  1IZM A;  4YY3 B;  3ASN C;  3SP1 A;  4Z2W A;  1MMM A;  2ZQM A;  1IBL B;  3EPV A;  5DS4 A;  5CIV A;  3SZR A;  1BL8 A;  4J7Z A;  1OCO B;  2A1D D;  2XM4 A;  2J45 A;  4K0K O;  1XL6 A;  4HAM A;  3S9O A;  3EGX A;  2WLH A;  3LDD A;  3S3W A;  1E79 G;  4JI4 O;  2QSA A;  3RBZ A;  5IJ0 A;  2I8B A;  1XQ8 A;  1Q3E A;  1LKX A;  3OUS A;  2QWN B;  5EZY B;  3HKB B;  3JAM N;  1AR1 B;  1S77 D;  3ZCC A;  4K1O A;  2V3C C;  1P49 A;  1MNE A;  4HNA A;  2EZP A;  2ETS A;  3ZHU A;  4JI0 B;  2BOC C;  1VQL V;  3DJN B;  2L35 A;  1R6T A;  2EPO A;  3U3F A;  3ZQV A;  4TQF A;  1JJ2 U;  2D3O W;  2EPK X;  3RN4 A;  5KMG A;  3SPH A;  3B2E E;  3CSX A;  1M1K W;  2WZL A;  3TJ6 A;  2CGO A;  2QWO B;  4JI6 B;  5KHH A;  5IDJ A;  4NC3 A;  4CX9 A;  5JT4 A;  1VYI A;  4X1Y B;  1VP7 A;  3OMI B;  3RYF A;  2CYD A;  4LF4 B;  1ORS C;  2Q9A A;  4U5C E;  2J9V A;  1SZT A;  1VQP V;  3EZH A;  2UXD B;  4NXN B;  1NBM G;  4WFF A;  5LYJ B;  4DR4 B;  1UPG A;  2XTA A;  3KCY A;  3I4U A;  4Q20 A;  1FTS A;  3AG2 C;  3K5N A;  1FYJ A;  3GEI A;  4FM1 A;  2WLL B;  2BOB C;  2B0J A;  1ARO P;  1JX9 A;  3CJH B;  1E2X A;  1NTK H;  4BIO A;  2GWW A;  3OUF A;  2LP4 A;  2QM7 A;  3ML0 A;  1H6G A;  1VF6 C;  3N2G B;  2CTQ A;  5KHK A;  1WAS A;  3CRQ A;  1P4R A;  3ZHV A;  2VWJ A;  3WOD F;  2B1I A;  1L0N H;  1Y74 B;  3K08 A;  3WU2 Z;  5JWP A;  2AVK A;  2W0F C;  3K1I C;  3A9C A;  3FAV A;  4YJ3 B;  3DSQ A;  2OTL V;  3P3P A;  3BA8 A;  4MVS A;  3W8H A;  5JJJ B;  2R05 A;  2CAZ C;  3PJS K;  4DK0 A;  3CXC U;  3POV A;  2WL8 A;  1AR5 A;  1SQG A;  2VRZ A;  4AHC A;  3T9O A;  3M8A A;  4I55 B;  3OE7 G;  4CZZ A;  1PM9 A;  1PD3 A;  3DC5 A;  5FNV A;  3U8P A;  3HNL A;  1GN4 A;  1TA8 A;  4MVM A;  4EBB A;  3JAW A;  3THO A;  2AXT Z;  1AI6 A;  3SYC A;  1Q0G A;  1YVI A;  2HLD G;  3G4S V;  3R66 A;  4MTF A;  2ZNI A;  2E5L B;  2UXB B;  3FHD A;  3SNH A;  4FLV A;  2LIG A;  2AZ2 A;  4CS8 C;  5BUO A;  1T6U A;  1YF2 A;  4I4T A;  1UJW B;  3AQB A;  2OIG A;  1K40 A;  2V4D A;  1SMY F;  3DXR A;  4XTK A;  1I94 O;  2JJ1 G;  2UXC B;  1DF4 A;  3N2K B;  2XAQ A;  4QGP A;  1IUR A;  2GUZ A;  2UXN A;  2IU3 A;  3K06 A;  2IJH A;  4O2B A;  5BXZ A;  3GEE A;  4IHJ A;  3OGI B;  1Q43 A;  2UUB O;  4J80 A;  1Z7Q c;  1IBM B;  2NPU A;  1ZTE A;  4B3T O;  3LAY A;  5LP6 B;  2VCB A;  2QE7 G;  4X1I A;  1GM7 A;  3CX5 F;  1R6N A;  3JD0 A;  2Y3G A;  1SYQ A;  3UT5 B;  1TVK B;  4CC6 A;  3J80 N;  2P67 A;  2E74 B;  3BRC A;  1TFO B;  1ORQ C;  2YS8 A;  5B1A C;  2ZXW B;  4B3M B;  2Q69 A;  4R6Z A;  3CCE V;  4YHH O;  1S5J A;  2QE9 A;  4I9W A;  1XL4 A;  1BZK A;  2CTW A;  4U3F H;  5E33 A;  1FMV A;  1YDX A;  1RKE B;  4G78 A;  4HZ3 A;  4U5D E;  2WPD G;  3CCU V;  3DKA A;  2EJ7 A;  4I5S A;  3QVZ A;  3GVM A;  1A7V A;  3CRM A;  2QTV A;  3B4S A;  5IYZ A;  5B3S B;  3SDL A;  4JAA A;  2V1D A;  4GUN A;  4FVM A;  2P4V A;  1QVG U;  3NKE A;  1ZHW A;  3U11 A;  2OU6 A;  3U0Z A;  1H9G A;  5F5H A;  4EWC A;  1E86 A;  3W8I A;  4W8P A;  3ZG1 A;  2IM8 A;  3WAQ A;  5DLJ A;  4FLW A;  4O4I B;  3H2U A;  2YC0 A;  1XWJ A;  4J7T A;  2UU9 B;  2P61 A;  1VMG A;  1K34 A;  3QVN A;  1FFX B;  2ETN A;  4AL1 A;  4J11 A;  2JJ2 G;  4UCO A;  3MAQ A;  2EUL A;  4JZ2 A;  3HJC A;  3ZHS A;  2Q00 A;  1GM8 A;  2A0U A;  1OXK A;  1H8H G;  3ASO B;  4AL0 A;  1B04 A;  4LP8 A;  2IXM A;  4OIQ F;  1D5N A;  1PL4 A;  4LF6 O;  3O6X A;  3HKK A;  2DYS C;  3DMD A;  4WJ0 A;  4O4H A;  3Q4H B;  4CS2 A;  5LA6 A;  3ABM C;  3SPG A;  4LF9 B;  4K7B A;  3LNR A;  2Y4T A;  4JYA O;  2QY9 A;  3TET A;  1S5L Z;  4DV7 B;  1ZW2 A;  2W9Y A;  2F95 B;  5LOV A;  4PK4 A;  3C90 A;  5ITZ B;  3HB3 B;  3JD4 A;  4R50 A;  2VQE O;  3S28 A;  4UDV A;  2H8A A;  3CD6 V;  4FFB B;  2RMK B;  3RFR A;  3RVY A;  2YKZ A;  4DV4 B;  2OTJ V;  2QKS A;  5CA1 B;  4X8A A;  4XLP F;  4K8Z A;  1K4D C;  1KQS U;  2KG7 B;  1FJG B;  3FB5 C;  3VQX A;  3C8G D;  1ZAU A;  4DV2 O;  3O10 A;  1H2N A;  1JPX A;  5LHH A;  2WSS G;  3ZRV A;  2WLK A;  3K79 A;  5L3Q A;  1JR8 A;  3GEH A;  5H9C A;  1WPX A;  1ORY A;  1M56 B;  2Z5U A;  2ITC C;  1PL0 A;  2ILM A;  5JH7 A;  3OTO O;  4X88 A;  1WA8 B;  4NQF A;  4WBN B;  4GX2 A;  4ZLD A;  4JI2 O;  5A2Q N;  1YEW A;  1I5X A;  1YJ9 V;  4BR6 A;  2ZE6 A;  1LUV A;  4O6Y A;  4UB6 Z;  3IHU A;  3SJB C;  2Q7E A;  1RMV A;  5KYU B;  2HFI A;  3ZTZ A;  5KYX A;  2G62 A;  1VQK V;  3GWK C;  1R4T A;  1Y6D A;  2A6H F;  4J9Z B;  1U0B B;  1YLM A;  2R7V A;  4H54 A;  2XLM A;  5H6R A;  1RM1 B;  3F7V C;  3TCU A;  3SPJ A;  3ZN0 A;  5TJ5 E;  5COM A;  5DVW A;  4WF9 V;  2YLG A;  4WFE A;  5IYB O;  1JMW A;  2W6J G;  2OYQ A;  4DBR A;  4A5U B;  5A6B A;  3DE8 A;  5E3C A;  4DRJ B;  2GSM B;  4U3J B;  3LUT B;  4BWA A;  3B0V C;  2V7Q G;  4FLU A;  1VK5 A;  1AP6 A;  2KNH A;  1VTM P;  3L1M A;  3CEI A;  3E86 A;  5B1B C;  3CPW U;  1ZU5 A;  2GBO A;  1M57 B;  2Q0O C;  5EK0 A;  3H1K H;  4ZI7 A;  4P9O A;  1K5Q A;  2F4V O;  1NFN A;  1VEW A;  4H44 B;  1OQC A;  1IX9 A;  1KU9 A;  1P7G A;  5EBW C;  4IAR A;  4JEB A;  4TT3 G;  4ZIB A;  1NJI W;  3RQF A;  3CCV V;  3UMK A;  2JRI A;  5CB4 A;  1WAT A;  2H7V C;  5CBF A;  4U9E A;  2EIM C;  3C63 A;  1VMA A;  1ZUQ A;  2HFE C;  3KG2 A;  3SYN A;  2Q9L A;  1BHA A;  3AOU A;  4FES A;  1BDJ B;  2UXX A;  4UCT A;  3E83 A;  3EVK A;  3K59 A;  4PJ0 Z;  1EA8 A;  2H8P C;  1EKY A;  4PA7 A;  2A0L A;  1BQ0 A;  4I0X A;  2XL4 A;  1RSO B;  3MYI A;  4NVP A;  4LCU C;  1A32 A;  5CA0 A;  1LE4 A;  3I5D A;  4PI0 A;  3F7Y C;  3KKB A;  3TK0 A;  3O65 A;  2HSB A;  1AB3 A;  1BR4 A;  1JPN A;  3EG9 B;  5LBQ A;  4U5H A;  4NY3 A;  1W59 A;  3R2P A;  2LGQ A;  2IBZ H;  1VQ5 V;  5JCO A;  3OWT A;  3NMK A;  2Y4U A;  2Y69 C;  3AG1 B;  3WFV A;  2PYJ A;  4BEJ A;  2DB4 A;  2MK3 A;  1K97 A;  3AG4 C;  1V55 C;  2QUP A;  3TK1 A;  4DUY O;  1KU2 A;  5J2U B;  1F7Y A;  3K1I A;  3SPI A;  1SQF A;  3W4Y A;  1NZE A;  2J9U A;  3BA9 A;  3IQC A;  2P4K A;  1A7D A;  1XUQ A;  4K8X A;  3E70 C;  2IOQ A;  3NMJ A;  3A8T A;  1NG1 A;  5KHJ A;  1Q6U A;  1H9T A;  1LM3 B;  2WA4 A;  2WLI A;  4EFE A;  4DV0 B;  4P9P A;  1GO3 F;  4G28 B;  3ETG A;  1Z5V A;  4L8J A;  3MYF A;  1AI5 A;  1K33 A;  1WWP A;  1ZU4 A;  1WB7 A;  3L72 H;  2Z3Y A;  256B A;  4C7U A;  3HR0 A;  3JAL B;  5JJE B;  1SR2 A;  3H65 A;  4I7Z B;  4HBN A;  2P7V A;  2N04 A;  3R7C A;  3FMS A;  3O9O A;  2UUA B;  1KMI Z;  3ZMV A;  5J2T A;  3T1Y B;  1WJZ A;  2DI3 A;  1YZC A;  2XLW A;  1BR2 A;  3GM3 A;  4C3B A;  4IYH A;  4X65 B;  4QIW F;  2KSD A;  1G4U S;  1ROP A;  1S0V A;  1VOM A;  1MND A;  2XHB A;  4RWU A;  3HLZ A;  2HS5 A;  1FFT C;  1F4M A;  2XLV A;  2XXA A;  2QA4 V;  2H7B A;  3NMI A;  4DUZ O;  4ANJ A;  1TR2 A;  4P2Z A;  2FAP B;  1DLB A;  1TKN A;  4KNV A;  1LUW A;  3RGB A;  4CH3 A;  2XAS A;  2EIN B;  2NUP B;  1AUE A;  4H13 B;  1I94 B;  3ASN B;  2PYL A;  3LES A;  3MFN A;  1O3U A;  4Z9I A;  1WAZ A;  3EQL F;  1MA1 A;  2FL4 A;  5E1A C;  2ZM6 O;  5BR8 O;  3KYJ A;  2KC3 A;  1Q5O A;  1K73 W;  1CGN A;  1CPR A;  1TWC A;  4X20 A;  1Z3I X;  4H37 A;  2UUC B;  2Q67 A;  2ZXO A;  1NVP B;  1R6K A;  2EZO A;  1RP3 B;  2A69 F;  4WGZ A;  2K9P A;  3HNK A;  4XBF A;  3UKM A;  4B3T B;  4LFB O;  2AGA A;  3FB6 C;  3QO8 A;  2CH7 B;  1MG1 A;  3IEE A;  2QKC A;  2ZE7 A;  1RPO A;  1ZL8 A;  2W4M A;  1N34 O;  3JCU Q;  4JV5 O;  1COW G;  2H94 A;  3CWB H;  3WG7 C;  3ZMU A;  3Q7L A;  3OEH G;  1ZW3 A;  4NR1 A;  1E1R G;  4JKV A;  3FDQ A;  3BCC H;  1CPQ A;  1XI1 A;  2VAS A;  5LXT B;  2LO1 A; 
#chains in the Genus database with same CATH homology
 2BOC C;  1VQL V;  1K9M W;  1R73 A;  4GX1 A;  2P6J A;  2W6I G;  2XND G;  4X89 A;  1S76 D;  1JJ2 U;  2D3O W;  1YHQ V;  2C2A A;  3D36 A;  3E8F A;  3SPH A;  2Y69 B;  1FXK B;  1M1K W;  5IDJ A;  3OMI B;  4PA9 A;  5B3S C;  5DM6 V;  3AG2 B;  4UUJ C;  1V55 B;  2XAG A;  4E2L A;  1SZT A;  4J9Y B;  1VQP V;  1VQ7 V;  1NBM G;  4WFF A;  2ZDI C;  4Q20 A;  4XDL A;  3AG2 C;  5KUM A;  2DWD C;  2WLL B;  2BOB C;  4WFA V;  1W0J G;  1ARO P;  1B6Q A;  1FXK A;  5IY5 B;  1JX9 A;  4JPR A;  1AI4 A;  1PNL A;  3OUF A;  2QM7 A;  3ML0 A;  1K4C C;  3IFX A;  2HJF C;  2EIK B;  1P4R A;  3E89 A;  2B1I A;  4XDK A;  5J9P C;  3W7S A;  3K08 A;  2W0F C;  5EBM C;  3I56 V;  2OTL V;  2AHY A;  4UV9 A;  3ZRW B;  4MVS A;  2R9I A;  2EIK C;  4KP4 A;  1LNQ A;  2LFS A;  3JYC A;  4WCE V;  3PJS K;  3T4D A;  3CXC U;  5CA3 A;  2PI4 A;  3CP1 A;  4BIU A;  1OCC B;  1ZWI C;  3CC2 V;  2Q6A A;  4PDR A;  1CPY A;  2DQ0 A;  2YEV A;  3OE7 G;  3AEI A;  4CZZ A;  2LFR A;  1PD3 A;  3X2Q C;  4MVM A;  4R7C A;  4MT8 A;  1AI6 A;  3SYC A;  1OCC C;  1K8A W;  4FMT A;  2QEX V;  1QR9 A;  2HLD G;  4R8C A;  1JVM A;  3G4S V;  4MTF A;  1FFT B;  3SYQ A;  1H38 A;  1AJN A;  1QR8 A;  1SES A;  3SPC A;  3ETE A;  4YXW G;  1UJW B;  3CC7 V;  1S72 V;  1K92 A;  1NKD A;  3ZRS A;  2JJ1 G;  5CN0 A;  1DF4 A;  1K3E A;  4UXN A;  4PDV A;  2XAQ A;  4DO2 A;  1YIJ V;  3MHS C;  2JIZ G;  1Q7Y W;  2UXN A;  1HWY A;  2IU3 A;  3K06 A;  3G6E V;  2IJH A;  1FXH A;  4JTD B;  1PNM A;  4P30 A;  2JDI G;  1QLE C;  3OEE G;  2Y48 A;  2DWE C;  4JYC A;  3ZIA G;  1YIT V;  1JOY A;  1KP2 A;  1I5Y A;  1MSW D;  2QE7 G;  1GM7 A;  5B1A B;  4CBC A;  1R6N A;  1FXV A;  3JD0 A;  1YJW V;  1L1F A;  3CME V;  1EFR G;  5IYD O;  4JTC B;  3E8G A;  2P67 A;  4JTA B;  1ORQ C;  3VOU A;  4JAU A;  4ZKI A;  5B1A C;  4MVQ A;  2ZXW B;  3E35 A;  1IXM A;  2Q69 A;  4R6Z A;  3CCE V;  5CBH A;  2IJJ A;  1KD1 W;  4UVC A;  2A79 B;  5B1O A;  4I9W A;  1XL4 A;  3JD1 A;  4G27 B;  4EKW A;  4MS2 A;  1GK9 A;  4H33 A;  3CCS V;  4GT1 A;  2IH1 C;  5B1N A;  3RW0 A;  1VQ4 V;  1CP9 A;  1R3J C;  2NNU A;  4HZ3 A;  5LGN A;  3JD3 A;  2EJR A;  2WPD G;  2IW5 A;  3CCL V;  3CCU V;  4I5S A;  2XOK G;  3H01 A;  1Q82 W;  2X6C A;  1KP3 A;  2WAM A;  1GKF A;  5B3S B;  4GCZ A;  4MW3 A;  3EFF K;  2JEU A;  2V1D A;  3K3W A;  1M57 C;  4RO2 A;  1QVG U;  3IGA C;  1VQ6 V;  3CYO A;  3OFN G;  1H8E G;  2GHY A;  4WFH A;  3ABL B;  1VQ9 V;  4JAS A;  3P30 A;  5FL7 G;  1K34 A;  2KB1 A;  3K04 A;  3LSQ A;  1Q81 W;  2JJ2 G;  3ABT A;  4PEL A;  3ABL C;  3HPL C;  1GM8 A;  2ZDI A;  3EHB B;  3NXS A;  1H8H G;  2Q68 A;  1FS0 G;  3ASO B;  1KEC A;  2DYS B;  2HVK C;  4LC1 A;  3AG3 C;  4MVZ A;  5LHI A;  2HVJ C;  2XAH A;  3LDE A;  4LP8 A;  5GW7 A;  5H6Q A;  1GM9 A;  2CK3 G;  3QNE A;  5LGU A;  2ATK C;  1R3L C;  1V54 C;  3ASO C;  2DYS C;  2JEX A;  1G4Y B;  5L3D A;  3E8H A;  2WLL A;  1YTF B;  5HFL A;  3ABM C;  3SPG A;  1OZ0 A;  4RQF A;  1NR7 A;  1VQ8 V;  3SJQ C;  3AG1 C;  5KA5 A;  3X2Q B;  1TUE B;  3TET A;  3ETD A;  1ENV A;  3HB3 B;  3JD4 A;  4R50 A;  1P7B A;  3CD6 V;  3ABK C;  3RVY A;  3OMN B;  1EZJ A;  4HYO A;  2QM8 A;  3OGC C;  4OXS A;  2P90 A;  2QKS A;  2OTJ V;  1QCE A;  4X8A A;  3ZRW A;  3B77 A;  1K4D C;  1KQS U;  3FB5 C;  4RQE A;  1PKX A;  1JPX A;  5LHH A;  2WSS G;  1E1Q G;  4BAY A;  1OCZ B;  3ZRV A;  5L3G A;  2WLK A;  3K79 A;  3VBB A;  5H9C A;  2HG5 C;  2X0L A;  1WPX A;  1M56 B;  3FB8 C;  2Z5U A;  1QVF U;  3FB7 C;  1M9N A;  2ITC C;  1QLE B;  1PL0 A;  4UVA A;  1SER A;  3ABU A;  1OCZ C;  4GX0 A;  2K1E A;  4N21 A;  1DF5 A;  4X88 A;  1QLN A;  1M56 C;  3JCZ A;  4GX2 A;  4MVU A;  4LBE C;  1OCR B;  1I5X A;  3P32 A;  1YJ9 V;  3B8M A;  2DQ3 A;  1JQ0 A;  5HFM A;  2FTK A;  2JK5 C;  1AJP A;  1SET A;  5L3E A;  4XDJ A;  5L3B A;  2X7R B;  3LDC A;  1K5S A;  4Z1M G;  1VQK V;  1OCR C;  1CEZ A;  4J9Z B;  3STL C;  2X6A A;  5H6R A;  3A0R A;  1RM1 B;  4MW8 A;  3F7V C;  3TCU A;  3SPJ A;  3ZN0 A;  1S3J A;  1KC8 W;  2F43 G;  3OMA B;  5L3C A;  4WF9 V;  4MSW C;  5KUK A;  4MTX A;  4WFE A;  3CCQ V;  5IYB O;  1BMF G;  1NH2 D;  2W6J G;  5DN6 G;  1YSC A;  1RM1 C;  2GSM B;  1N8R W;  4QE7 A;  3K0G A;  3K03 A;  4TSF G;  2XAJ A;  3FKS G;  2DW4 A;  3LUT B;  5B1B B;  4QE9 A;  2EIJ C;  1EBO A;  2V7Q G;  1MOF A;  2WLM A;  3W7X A;  2EIL B;  1THZ A;  3E86 A;  5B1B C;  3CPW U;  1RPR A;  2IJI A;  1W2B U;  4RUF A;  4BIZ A;  1M57 B;  1NH2 B;  5EK0 A;  5EBL C;  2QTO A;  1KKD A;  1PNK A;  3CCR V;  2EIL C;  4P9O A;  1K5Q A;  5CBG A;  3MD0 A;  4MVR A;  5EBW C;  4TT3 G;  1NR1 A;  4KFM A;  3RVZ A;  3W7U A;  3ZMS A;  3CCV V;  1NJI W;  2ZD9 A;  1Y66 A;  4JGS A;  5CBF A;  2EIM C;  2OCC C;  1K7D A;  2HFE C;  3KG2 A;  5KA6 A;  5LHG A;  3CMA V;  2B5U A;  1BHA A;  5IYC O;  2UXX A;  1AI7 A;  3E83 A;  2H8P C;  4PA7 A;  2A0L A;  3AG3 B;  3BEH A;  4UV8 A;  3SYA A;  4PA6 A;  1WLE A;  4KUM A;  3LNM B;  3ZMT A;  4LCU C;  1YTF D;  4F4L A;  3I55 V;  4WFB V;  2DYR B;  2XAF A;  4FPP A;  3F7Y C;  4U7N A;  1V54 B;  4QNH B;  4UVB A;  4PDM A;  4JAV A;  3E2E A;  5EC1 C;  5LGT A;  5LBQ A;  3AG4 B;  4FK5 C;  2IH3 C;  1VQ5 V;  3ABM B;  2DYR C;  3JD2 A;  2Y69 C;  3AG1 B;  1FXK C;  2WLI B;  4PDL A;  2IJK A;  3WFV A;  1H2G A;  3M99 B;  4FJC C;  2MK3 A;  4G2K A;  1K97 A;  3AG4 C;  1V55 C;  3ABK B;  3TK1 A;  2M7W A;  2P7T C;  3SPI A;  3SYO A;  1DTO A;  1BHB A;  3OR6 C;  3CCM V;  4RAI A;  3W7W A;  2YEV B;  5IY5 C;  3G71 V;  2WLI A;  1YJN V;  2A9H A;  4P9P A;  1GO3 F;  1NQT A;  4G28 B;  3T1C A;  5L3F A;  1VQO V;  3T2M A;  3ETG A;  2ZR2 A;  4JF3 A;  3OR7 C;  2X6B A;  1YI2 V;  1AI5 A;  1K33 A;  2YSU B;  4N23 A;  4QPK A;  3OM3 B;  2Z3Y A;  1F51 A;  1S5H C;  4ASU G;  2HKO A;  3QO7 A;  3ZJZ A;  2R9R B;  3BY6 A;  3D3I A;  3R65 A;  3ZMV A;  1Q86 W;  3ZRX A;  4TWK A;  1VQM V;  3K9A A;  1M90 W;  4BW5 A;  3QO5 A;  4QIW F;  1F4N A;  1GTO A;  3T4Z A;  3B8N A;  1ROP A;  2PI5 A;  2AHZ A;  2HR3 A;  1S0V A;  3ZN1 A;  1QBZ A;  2IU0 A;  1G8M A;  1F23 A;  3CC4 V;  1W0K G;  1NVP D;  1F4M A;  3E8B A;  1Y4M A;  3MHH C;  1OHH G;  4JYB A;  4PA4 A;  3F5W C;  1AJQ A;  2LP7 A;  4MTO A;  2QA4 V;  3FYI B;  4GX5 A;  2WWW A;  2OT5 A;  4P2Z A;  3W7T A;  1JCH A;  5C93 A;  1DLB A;  1GMG A;  1R3I C;  2EIJ B;  4QJF B;  5BZB A;  2XAS A;  2EIN B;  4DXW A;  3UM7 A;  3ASN B;  2B1G A;  2EBO A;  2ITD C;  5E1A C;  3DTU B;  4MTG A;  3OAA G;  3GB7 C;  1K73 W;  2EIN C;  3IC7 A;  3ASN C;  4H37 A;  2Q67 A;  1NVP B;  1R6K A;  2EZO A;  1SRY A;  2ZQM A;  1MAB G;  4QPJ A;  4XBF A;  5CMU A;  2WLJ A;  3LSS A;  3UKM A;  1VQN V;  2WLN A;  1BL8 A;  3K0D A;  4L87 A;  4U7O A;  3FB6 C;  3QO8 A;  1MG1 A;  3OW2 U;  1OCO B;  2EIM B;  2OCC B;  3WG7 B;  1R3K C;  5EC2 C;  1XL6 A;  3GWO A;  1RPO A;  1J95 A;  4HAM A;  2WLH A;  3DGE A;  3LDD A;  4FIP C;  3STZ C;  3SYP A;  1E79 G;  4MVO A;  3ZMZ A;  3CCJ V;  2ZXW C;  1COW G;  1OCO C;  3RBZ A;  2H94 A;  2ZR3 A;  3WG7 C;  3ZMU A;  4ZBM A;  3OUS A;  3OEH G;  1E1R G;  1AR1 B;  1S77 D;  3ZCC A;  3FYE B;  4WFG A;  4RUE A;  2NLJ C;  4PA3 A;  2EZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...