3BEHA

Structure of a bacterial cyclic nucleotide regulated ion channel
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
222
structure length
222
Chain Sequence
LRIYAPLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mll3241 protein
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
total genus 80
structure length 222
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3behA02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 3behA01
4MS2A 1OCCC 2HJFC 3FB5C 4PDLA 3SPHA 5E1AC 2HVJC 2WLHA 3FB7C 4MW8A 2ITCC 3SPGA 3ZJZA 3OUFA 3LDCA 4LBEC 4MVUA 5EBMC 3PJSK 3E86A 4G27B 2IH1C 4WFGA 3RVYA 3SJQC 4LCUC 4WFHA 3SPJA 5EBLC 4F4LA 2DWDC 2WLLB 3LUTB 1S5HC 4HZ3A 3T2MA 1BL8A 2X6CA 1KKDA 3K03A 2WLKA 5KUKA 3F7YC 4G28B 5BZBA 3ABMC 1OCRC 2WLJA 5CBFA 4RAIA 4H33A 3SPCA 3E89A 4P30A 2ATKC 3E83A 2ITDC 2X6AA 3OR6C 3SPIA 4GX0A 3ABKC 2QKSA 3AG3C 3BEHA 1ORQC 3K08A 5B1AC 3STZC 3VOUA 5KUMA 4HYOA 3LNMB 4GX5A 2KB1A 4KFMA 4XDLA 2ZD9A 3IFXA 1OCOC 2DWEC 4PA3A 3STLC 4MTFA 2DYSC 3RBZA 2HFEC 1R3KC 4MTGA 2JK5C 3R65A 2W0FC 2BOCC 4JTDB 3AG4C 3K0DA 4CBCA 1ZWIC 1R3JC 3KG2A 4RUFA 3RW0A 3UKMA 3ABLC 3E8FA 5EC2C 4MVQA 2EINC 2R9RB 4MVRA 1V54C 4TWKA 4WFFA 1XL6A 4H37A 2WLLA 2OCCC 4I9WA 3AG2C 4MVSA 2IH3C 3SYPA 4P9PA 3K06A 4UUJC 3ASOC 1K4CC 1XL4A 2YEVA 1QLEC 2Q6AA 4GX1A 4OXSA 2Y69C 3FB6C 3GB7C 3IGAC 3UM7A 4MW3A 4XDKA 2EILC 4R6ZA 3OR7C 3WG7C 4X89A 4PA7A 3HPLC 4MTOA 1M57C 2NLJC 3T4ZA 3AG1C 3T1CA 4X8AA 5CBHA 1LNQA 2A0LA 2WLNA 5J9PC 4XDJA 2HVKC 4JTAB 1M56C 3ZRSA 4RO2A 4MVZA 4QNHB 3E8HA 5EBWC 4WFEA 1R3IC 4PA4A 2BOBC 2P7TC 4QE9A 2HG5C 4PA6A 4LP8A 4MVMA 2H8PC 4GX2A 3SYCA 1G4YB 2Q69A 3RVZA 4PDMA 4PA9A 4R8CA 3SYOA 5EK0A 4J9YB 2WLIB 2X6BA 4MVOA 2EIJC 3JYCA 4QE7A 3E8BA 4DXWA 5IY5C 3FB8C 4X88A 3F7VC 1V55C 3SYQA 4BW5A 4J9ZB 1J95A 1P7BA 4R7CA 1R3LC 4PDRA 3TETA 4ZBMA 3K0GA 3LDDA 2WLIA 3F5WC 4JTCB 2WLMA 4PDVA 2K1EA 5B1BC 5B3SC 3T4DA 4P2ZA 5CBGA 2EIMC 4P9OA 4EKWA 3OGCC 4R50A 2Q68A 1K4DC 3EFFK 3OUSA 2DYRC 3E8GA 1OCZC 3SYAA 3X2QC 2EIKC 2A79B 3LDEA 3TCUA 2ZXWC 2Q67A 1JVMA 3K04A 2QTOA 2A9HA 2AHZA 3ASNC 4MSWC 4RUEA 2AHYA 5EC1C
chains in the Genus database with same CATH superfamily
2YDEA 4MS2A 3P3PA 3SPHA 2R7SA 2ARHA 1VMAA 2OIEA 4O6MA 3N24A 3AG4B 2RJZA 4WFGA 4NB5A 3SPJA 1FD9A 5A6JA 1I5XA 4LF9O 2FGYA 2LP7A 2EX3A 2YICA 4Q4ZF 2M6YA 3LSQA 1A0BA 2YL0A 4XEFA 3MAQA 4P9TA 5LMNO 1F7YA 4DR7B 4FX5A 2ITDC 4LF8B 4GX0A 4LFCO 4U5FE 1LS4A 1ORQC 4O4IA 2LQGA 4KUMA 1N4CA 2J45A 1HW7A 2M4EA 2Y48A 2GHYA 1SZIA 2A1DD 2YC0A 5JVDA 2BSKA 3CCJV 1DF5A 3SEOA 4CC5A 2WVOA 3DTUB 4Z1MG 4DR4B 1Q6UA 3CC7V 2OYQA 1CPQA 2OKUA 3EFOB 1SF9A 2R9AA 2PUSA 1FFTB 3GVMA 5IYCO 4JAVA 1SQVH 2BC5A 4FJCC 2OCCC 4EBJA 2DOSA 3UT5B 2Q4FA 1FYJA 1HE1A 1W0KG 1BQ0A 2IXNA 2VWJA 1JR8A 4WBNB 5L0HA 5J2TA 1JPXA 4I55B 1MMMA 3U3FA 3C8GB 1D5NA 3W7WA 5KYWA 1MMAA 5KYUA 1I0HA 1DOVA 4G7HF 4GUNA 1N34B 3CEIA 2AZ0A 1Q0KA 2P06A 3E2EA 2QWNB 4TV9B 4YJ3A 2KK1A 5EK0A 1S5JA 4MVOA 2AP3A 4JVSA 3CXHF 3JYCA 1OHHG 3JARA 3S27A 3AK2A 3FB8C 4XPYA 4BW5A 1DTOA 2NUPA 3VRCA 1M2VB 3TETA 1LPEA 4FZ0A 3HNJA 2QWQB 3ETDA 3NR7A 2QA4V 3CJHB 1SA0A 1S7ZA 2Q68A 3UGOA 1TVKB 3MBGA 2N05A 1Q43A 2W9YA 3CXCU 4JJFA 1VP7A 1JFFB 3NKDA 4K3AA 1AI4A 3V7OA 5LA6B 4PK4A 5K1XA 2ZM6B 2OWOA 4J30B 2G62A 2R72A 4RQEA 4NVPA 2H7OA 1ZLZA 2RCVA 4OPHA 4DR3O 4JCZA 4GCZA 2E5LO 3SJQC 2MYSA 1Y76B 3QO7A 4LCUC 4F4LA 4CSAC 3FAJA 2Q7HA 2VC9A 3K03A 2WLKA 4DRIB 5JH7B 2BCCH 2D5RB 3ZSUA 5IYZB 2FKXA 3ATPA 5CBFA 5BQIA 1H6GA 3AG7A 1VQNV 3SPCA 4P30A 3E22A 3E83A 1AJNA 2PX0A 3Q7LA 3CC4V 4C7OB 2Q9CA 3AG3C 3ZHUA 2ICWG 3K5MA 4CJGA 1TWHA 3B9QA 4CZZA 1T6IA 3CEXA 4CH5A 2Y3BA 3T9OA 1NBMG 2KNHA 4DV2O 2DE0X 3JAMN 1MABG 2AXTZ 2XAJA 4YY3O 2FAPB 3W8IA 4DK0A 4PJMA 2ADQB 4GKJB 1Y6XA 1SYQA 1JOYA 3B40A 4UCRA 1ZHTA 1CPRA 2UUBB 2ZXOA 4X64O 4TQDA 3ABLC 3G50A 1R6NA 2QE7G 4TWKA 3N2ZB 4KXRA 3EZHA 2JGDA 4PV1B 1BR1A 2F66C 4CS4A 4X62O 1NQTA 2Q9BA 3ZTMA 4FVMA 3O65A 1LI7A 2YVKA 5CIVA 1H2MA 2ZQMA 4XDKA 3JZ0A 3VYWA 3HPLC 1DGSA 3D36A 3H1IH 3OWTA 1FFXB 2WVQA 4KP4A 1OR3A 4NY3A 4XDJA 2EPLX 3ZRSA 4RO2A 4PA4A 1AUEA 2LIGA 4LF5B 3ZQYA 3CRAA 1RM1C 3HJCA 1G4YB 2M7WA 4UCTA 3CCSV 5L0FA 1M9NA 3CQZA 3LLIA 3E9VA 2Y4UA 1XZQA 3FMSA 2CTRA 4H0LB 1EBOA 1XZPA 4JC7A 3WB2A 5DECA 1Q0FA 1YVIA 4EBKA 1RSOB 1LI5A 3F7VC 3SJAC 4Z9HA 1J95A 1P7BA 5KYXB 2LFRA 2IXPA 5L0JA 3A0HZ 3U8PA 1GO3F 3IQ6A 1NSGB 5KA5A 2F93B 3UT5A 5KHGA 2RD9A 2F4VO 3HKCA 4B6IA 1YARO 1OCZC 4I55A 4K1OA 3C8GA 1NH2B 1YTFB 1Q82W 4G7ZF 2AHZA 2Q0OC 1WASA 3FFQA 4LR3A 3MHSC 1G4US 4CJOA 1ZAUA 4PDLA 1OW7A 3C8ZA 3K6BA 2WLHA 1YJGA 3OE7G 5B5EZ 3SXYA 3EVKA 2LW1A 3GODA 3BA8A 3H1KH 1IBMO 4LBEC 4IHJB 4DUZB 1FJGB 4GYTA 2Y3DA 1S5HC 4HZ3A 4U5DE 1XI1A 2WSSG 1GRJA 2XTAA 3U10A 2P7VA 1HWYA 4KL1A 2KQXA 2LGWA 1M2VA 4P6IC 3RYHA 2C04A 3DZAA 1E79G 3CCEV 2JD3A 1WGWA 2Y3GA 3CJHA 1HNWO 3WB0A 3N2GB 4Z1VA 4JI6O 3K08A 3KKBA 5A9GA 1IBLB 4LF7B 1A41A 1TVKA 5A6BD 2CAZC 4DUYO 3JD1A 4QI2A 5JJEB 3K5NA 5LL6Y 3STLC 3QTHA 3ETGA 4JI4B 5IWAO 5LA6A 2LP4A 5LP6A 1QLNA 2XL6A 1WATA 2GUZB 4UB6Z 4JTDB 3M4CA 1E1QG 4QGPA 1R5ID 3I55V 1HMDA 2IW5A 3KG2A 3LESA 3US6A 4DV7B 2EPNA 4CS9A 1UFBA 4JV5B 2HKVA 4OD5A 4BG0A 4W8KA 3WG7B 4YL1A 3ZHRA 2UXBO 4Q20A 4UFZA 5JCOA 4N06A 5JH7A 2HJMA 2X7RB 3GB7C 3UM7A 5IYZA 3OR7C 3SYNA 1M57C 3T4ZA 5L0GA 1OKKD 3O6XA 5AGFA 3HB3B 3WAQA 4C7OA 3ZRWA 4DOZA 1YCIA 3E8HA 4U7OA 3OD4A 5B66Z 4DV0O 1KD1W 5B1OA 4D7TA 1YZBA 1JJ2U 2DQ3A 1G6UA 4H13B 1ORSC 3LJBA 4FFBB 1MOFA 3NRHA 4I0XA 2VCBA 5E3CA 4ULVA 4ICGA 3KL4A 256BA 5FNVB 4LNUA 3E8BA 1PM9A 1N32O 3QVNA 2NG1A 2UUAO 3JRTA 1KNYA 2IJIA 3S28A 3OTOO 1FS0G 3M7MX 1K5QA 1U96A 2CUGA 3APOA 1Q6HA 2A3QA 4DR2B 1KB9F 4P2ZA 3OGCC 3S84A 3TULA 2J0WA 1KUQA 4BJTA 2DJVA 3OUSA 2YL7A 5COMA 2EPKX 3H9VA 4JI0O 3TCUA 5KHKA 3T1YB 2CTWA 4WFAV 1FFXA 1SQGA 2HJFC 4KHPB 3E70C 2J46A 2DYSB 3OT7A 3SPGA 3GM2A 4JGSA 4DR6O 4X1YB 3ZMUA 4WFHA 2EINB 3W2VA 1GS9A 2LFFA 1I4YA 4CDAA 1IXMA 3B09A 4K0KB 1LVKA 4G28B 1AJQA 3GEIA 2YLIA 4DV1O 3JRMO 1OCRC 2DI3A 3TXQA 4U9EA 3BFRA 4MQ9F 4RAIA 5B1NA 3IAYA 2CCYA 2MWQA 1UFIA 3OR6C 2F43G 3UMHA 2QJ1A 2RQ6A 1KU9A 3VOUA 2JS3A 3O39A 3H2VA 1ZU5A 4WF9V 1M4UA 1H38A 3QZCA 3QW1A 2WL8A 4XEKA 1D2DA 1L7CA 1OCOC 2XUMA 1B68A 3K1IC 2P5OA 3DSQA 4PELA 1HW2A 1XUQA 3G6EV 1Z63A 3HNIA 1VLTA 1OXBA 1HDJA 1YXBA 4IHJA 4Q6GA 4F6EA 3U0ZA 2CH7B 4WFBV 3CCUV 4JASA 3JYYA 5H9CA 1WTYA 4R32A 4DR7O 2KSDA 3BA9A 1HW1A 2XAHA 1ZSPA 4LF8O 3ZVRA 4LH6A 4JI8B 4GX1A 1QLEC 1W0JG 2Q6AA 3U11A 4KI2A 4DBQA 2PF4E 4RD9A 3L74H 4MW3A 4J80A 2WZFA 4YWQA 2QEXV 5GONB 4JTAB 2YIBA 4MVZA 5JQGB 3K79A 1NFNA 4UVCA 4OINF 1TUBB 2GDCA 3U5SA 4DR4O 4PR9A 1JCHA 3M15A 3E35A 1FXKC 5L0CA 3RVZA 2GBOA 1YJWV 3SXZA 2JJ1G 2PI5A 4J41A 4J9YB 3I56V 2IM8A 2GUZA 1VQOV 1JOGA 3M79A 4E2LA 5KA6A 4AQYB 2EJRA 4ZBMA 1Z23A 1VF5B 3G4ZA 3FOPA 2WLIA 2BTQB 3K9SA 1L0NH 3QO5A 2A0UA 1I4ZA 3UMIA 5KX5B 1N34O 1Q8IA 5CN0A 5DS4A 3LAYA 3AQBA 5AC4A 3AGUA 2Q67A 4O2AB 2P90A 2XNDG 2ZR2A 5D92A 2LGQA 3B8MA 4ZLDA 2IYLD 2ZE8A 4W4LA 5JJNB 4WJ0A 4EFBA 5E79Z 3EGXA 4KNWA 4AL1A 4GT1A 2KJGA 1SQBH 2HP8A 2AWCA 1GGQA 5FNVA 1AILA 2W45A 1FR0A 4JEAA 3ZCCA 3OFNG 2P4KA 4U7NA 4UCSA 3VAYA 3OMNB 3E89A 3HR0A 4E4EA 3ABKC 5JVDB 3L9DA 1ZHZA 2VQEB 1LIHA 4OIQF 2ZM6O 4GX5A 4LF4B 3LS1A 1NTMH 1XHXA 4K8XA 1Z5WA 2PFDA 1YF2A 1AROP 5EHHA 2X51A 1A7DA 5D5QA 1AI6A 4JI5B 1JJOA 1JPJA 3P32A 2P6JA 3GWLA 4MVQA 1D0XA 1O3UA 4NTAA 4U5CE 3M99B 4X1YA 5TJ5E 1A32A 5KYWB 4C7UA 4H37A 2YHSA 1M93A 3AG2C 3RKOF 3DM5A 4U5HA 1WNSA 2IJKA 3G4XA 4M63A 3JD4A 3L34A 4NYKA 4LH7A 1JRAA 5IYBO 1T5EA 1YLMA 2QGNA 4X89A 1K3EA 4XLNF 5KAIZ 1U97A 3FAVB 4X8AA 4GKJO 2A0LA 2L7AA 3K5OA 5CB4A 2BL2A 3PHF2 1R3IC 4HNAB 2BOBC 1G1XB 4OGQB 2HMQA 1VF6C 4UVAA 2UUBO 3BHPA 5A6AA 1WB8A 3TK0A 3OMAB 3CSKA 1AP5A 3ZQVA 4QE7A 1SA0B 5IY5C 2VCCA 1BZ4A 4JCHA 1Z7Qc 1GN6A 2EBOA 4PDRA 1PNLA 4HFKB 3QTCA 3HKEA 3F5WC 2QDOA 1WPXA 2ZXWB 1XNRB 3T4DA 2YQYA 5KHHA 2VS0A 2QKAA 4HBNA 3EG9B 3CYOA 1QSPA 3KCYA 3S3WA 3E8GA 4IB4A 3LDEA 4LF5O 2QNLA 3GWKC 2D3OW 1JPNA 3ASNC 5GONA 5H5NA 4UXNA 1M2OA 3FHDA 3FDQA 5JQGA 1D1BA 5KHJA 1QR9A 3SGIA 4W8PA 4LF6B 1TUBA 3ZJZA 3J80N 4YIOA 4J7TA 3LDCA 1PCXA 3QMKA 4A2NB 3K5LA 3JCUZ 4EHPA 2IU0A 1TWAA 4YHHB 1SKVA 1SZXA 3T2MA 5AC5A 3CHXA 1J8MF 1PNMA 2OCCB 2YEVB 4LFBB 3F7YC 1K04A 4JZAA 4GKKB 1VQ5V 1RPOA 4J7JA 1TUEB 4BJ6A 1FMWA 3T6BA 2IJHA 3LSSA 4AHCA 1N0NA 1YITV 1YZCA 2MK3A 1AR1B 2OCHA 1H2GA 4JURI 5KX5A 5K1PA 1YVWA 3LNMB 5IJ9B 1X4TA 2ZR3A 3H1LH 5A6BA 2AGAA 2ZD9A 1MNEA 4O2AA 1UG7A 3DKAA 2C2AA 2ZCEA 2AW9A 2JGDB 4DUZO 1NT2B 1FJGO 1YZAA 5L3FA 1V4AA 1PNKA 4Q7CA 4IAOA 3W7XA 4D4XA 3LSUA 2ZDIC 1UPGA 5LXTB 2W6JG 3ZC4A 3LEVA 4B7EA 3KKYA 4WGYA 2V4DA 3SYPA 2EPMX 3H65A 1YJ9V 4ONSA 1QQCA 2WPDG 4O4JB 1IBLO 5JS5A 4LF7O 2EILC 4FAPB 1YYXA 2JIZG 1COWG 4PA7A 5J2UB 1GN4A 1CGNA 2CTPA 2ZE6A 3S29A 1AVOB 1LNQA 4U3JA 1A7VA 4L6RA 4JI4O 1M56C 3CCMV 3ZIBA 1NVPB 1GN3A 2B9ZA 1ZTEA 3MD0A 3JSEO 4J42A 2XAFA 2XS8A 4DV7O 2NPUA 2WA3A 4JV5O 4R8CA 2LJ2A 4U5BE 3OEOA 3PDMP 4OX9B 3VQYA 2YL1A 3HKCB 4J9ZB 4JI3B 5JUAA 2PTMA 4LFAB 1R3LC 3ABUA 1ZL8B 4YT2A 5E33A 4X1KB 2ZXPA 2YI8A 1P4RA 5B1BC 3ZHSA 4EKWA 3WHNA 2YRFA 2R70A 3JASA 1NU9C 3AG3B 2NSGA 3V5XA 4G2KA 1QPUA 4O79A 2UU9B 1IZMA 5DVWA 3T6JA 4C3BA 2A9HA 4YT8A 3FAVA 4U5GA 2R7UA 2UXNA 1B06A 3IPMO 4MW8A 3MYIA 1R6TA 4HNAA 2JEUA 4IL6Z 2PZSA 2JEXA 3OW2U 4GLXA 4X0RA 4XQ1A 1XMQB 2XOKG 3ICXA 3FVYA 3JT1A 3RVYA 2LFSA 3ABLB 3RYHB 3GM3A 4JKVA 3ZTZA 4BJ5C 1I5YA 4D6TH 3NG1A 1U0BB 2OJQA 4AX2A 1BL8A 3JD2A 4DR2O 1LUVA 4MT8A 5FPOA 2IJJA 2R25A 4HEAJ 3RN4A 3NMKA 5C8YB 2RNBA 1RCPA 3DJUB 3T1YO 4U3FH 1NR1A 3DAGA 3MX3A 1Y4CA 5LP6B 4KHPO 3ZN0A 3T4RA 3EG9A 3UGPA 5LYJB 3M4BA 4KFMA 2KC3A 4ER9A 1IX9A 3G4SV 3RYLA 1Z3IX 3QG5A 3VBBA 3I5PA 1MA1A 5T3TA 3WB1A 1BBHA 4DR1B 1BHAA 1QBZA 3JSLA 3DI5A 3EHBB 3FX7A 2IU3A 4K0KO 4XEVA 2HFIA 2R03A 4UCUA 3CCRV 3AK1A 3DXRB 2H3OA 4I5SA 4ULWA 4JE9A 1IBKB 3K06A 3ZRWB 3B4SA 4FLTA 3WODF 2YEVA 5L0IA 3RFRA 4FIPC 3GANA 4BEMJ 3CCQV 3QVYA 3ZEDA 4NR1A 2VWKA 1OCZB 2Q4PA 4JYYA 1O87A 4I0XB 2VB6A 2F22A 2RMKB 1SZTA 4PACA 1LKXA 1XWJA 1S77D 4LNUB 4E7SA 5IJ9A 4IARA 1BMFG 2QE9A 4MVMA 2QWOB 1PKXA 2CNWA 4ASUG 2FTKA 4A5UB 5DS5A 2CYDA 1V55B 5L0DA 2YSUB 1TFKB 3B2EE 3RF3A 4JI8O 1JA8A 5LXTA 2E3CA 4YT5A 4PD4F 2EIMB 1JAFA 3IQ5A 3CMEV 2ETSA 2RDCA 4X20A 1O5HA 3JAWB 3RQFA 1NKDA 4DV3B 1M6TA 2A6HF 4N4WA 2DMXA 5DQTA 5CBGA 3IEEA 3AK3A 1VQLV 4B3SB 4O4JA 1OCCB 3SYAA 1FXHA 5J2UA 2ZINA 1BZKA 1D1AA 1JVMA 2L81A 1U6HA 4NXMB 2XASA 4EUKB 1K73W 4ZLCA 1KKCA 2OEXA 3B0VC 2BTOA 1L3PA 3FB7C 1BSMA 5CI9A 1Y67A 1YYJA 4I50B 4PI2A 3K3WA 3G67A 3MHHC 1Y66A 4AQYO 2IH1C 1RKEB 3TJ5A 2Y0PA 3CMAV 5L3BA 1FMVA 4LERA 3JAKA 1ENVA 3SJCC 3CPWU 4CSAA 2NR5A 1VYIA 3Q6NA 3R7CA 1ZU4A 3B0UX 1ZL8A 2UXCB 4CS3A 1OQCA 3K33A 5JP7A 2ATKC 1KP2A 2X6AA 1FKAO 4DRXB 1WA8A 4X1KA 2P6VA 1YHQV 3CWBH 4B3RB 1GMGA 1BR4A 5K0IA 5KAFZ 4OIRF 3HKDB 5COFA 1RJ9B 2WA4A 5DEDA 2DWEC 1FNTc 4NTBA 2J0XA 2ZE5A 1O9HA 5A69A 1K05A 5DLJA 2XHBA 2OQMA 3FAPB 1J8YF 1Q6IA 1XBLA 4CBCA 1VTMP 5CA1A 5BR8B 3JSZA 3PCVA 4H4KC 3SXKA 3W8HA 3VQXA 3K1HA 2R7TA 2N74A 5LGNA 1VQ6V 2XS1A 4XTKA 2J9UA 1XDCA 2KSFA 2Q7GA 1GQAA 4QJFB 3MDSA 4CDYA 3FB6C 3IGAC 4F4BA 2VQEO 3BPZA 4DV6B 1NFOA 3C7JA 5E3AA 2FB5A 2VASA 5C8YA 1DF4A 4LF4O 1WAZA 2JS5A 2UXDB 4DBRA 3DMDA 1VB5A 2LW7A 4JI5O 5LYJA 4NC3A 3ZBHA 1I7FA 1F23A 2PI4A 2E76B 1TKNA 2Q69A 4PDMA 1S72V 1Z5ZA 3TJTA 2WLIB 2QWRB 3LNRA 2PNOA 3FKSG 1ZW2A 3WU2Z 2R7WA 5JT4A 4DV5B 4ANJA 3D8CA 5CA3A 2B0HA 3ZIAG 1OCRB 3DXRA 2Q9LA 4IWBA 2NUTA 3P30A 5B3SC 1HP8A 4R50A 3TXSA 4FWVA 4EBBA 3I5DA 1P84F 2A79B 3EGXB 2JGUA 1EN4A 4DV4B 4BR6A 1MMGA 5DM6V 3C63A 1HNXB 4MVUA 1NLXA 2PX3A 3PJSK 5IYDO 2PYLA 3C3SA 4BIUA 1F51A 3MYFA 1NZ6A 1VMGA 1H2LA 2P4VA 5TISZ 2ZXRA 3K7DA 5EIBC 4FLZA 4IIJA 1XNRO 5BZBA 3DM9B 1L1FA 2XAQA 1QLEB 2ZE7A 4DYLA 3JAWA 1YAUO 2Q7RA 1YJNV 4TQFA 4FESA 1R73A 1H2NA 1LM3B 3L1MA 3GEHA 1TFOB 1VQ9V 4CS8C 3AGTA 1MNGA 4LF6O 5GPGB 3RYFA 3DWWA 1Y4MA 3V5YA 2QWPB 4DRHB 3I4UA 4MTFA 1IDSA 3O9OA 2LSEA 4JYAB 1FXKB 3JD0A 1H8EG 3U3BA 4YHHO 4I9QA 2ZT9B 3TGUH 1ZWIC 4I50A 4LFBO 3FYEB 5BQHA 1MQVA 3ASOB 4GKKO 4UV9A 1ZHYA 2YUAA 1RKEA 1XL6A 4YT4A 5H2FZ 3WFVA 4N23A 3TOLA 1W59A 4TV8B 4IGGA 4P9PA 2NSFA 1ORJA 5CB4B 2Y69C 4U9DA 3JYHA 1QZXA 4N21A 4ZHQA 3JD3A 3AEIA 3WG7C 2W4MA 2YZSA 1QU7A 4DRXA 1G8XA 1OR2A 1BR2A 4DVZA 1YSCA 4QE9A 3HKDA 2IOQA 1RJ9A 3A0RA 2DW4A 4K8ZA 3SYCA 3LEOA 3KYIA 3ETEA 4B3TB 3HKEB 2X6BA 2P0NA 3DC6A 4H44B 4O4HB 4YK5A 4FM1A 2V7QG 3J06A 1PV3A 5FPRA 3ZRVA 3DE9A 3DJNB 2G3KA 4QPJA 1KP3A 1JQ0A 1WP7A 4AE4A 2DYRB 1BE3H 2WLMA 3NMIA 4QDLA 4P9OA 3ZHVA 3RQGA 3ABKB 1K4DC 3ZMTA 1EFRG 4J7KA 1C03A 1CPYA 2DN9A 3CCLV 4I3MA 2C03A 2EZOA 1CP9A 3X2QC 2FMLA 3SXMA 2XLEA 4B7KA 1L8DA 3W7TA 1BQZA 2JPUA 3JTLO 2AVKA 5KHIA 2MW2B 4CIPA 1K40A 2YWAA 1BCCH 1Q0DA 2R02A 4OX9O 3L75H 4FLVA 2Q7EA 4JI3O 1W2WA 3APQA 2ZIMA 4OPAA 4LFAO 1ZW3A 4O2BB 4NKGB 1NU7D 3RWRD 3AOUA 3LNNA 3EHMA 4RQFA 1Z6AA 2X6CA 3Q6MA 4FPPA 4ZOLB 3AG2B 2J9WA 2R7RA 1QR8A 2ZPAA 4EB6B 2YIDA 1EKYA 3OAAG 5B1AB 2XRHA 4JI2B 4H33A 3KCXA 4X65B 2HV7A 2X0LA 2UU9O 1M5IA 3T1HB 4NTXA 3B0PA 4WCEV 5L3CA 1D5AA 5IE9A 4LLCA 4DK1A 4FLUA 3RYIA 3KPHA 1T01A 3IFXA 2PP4A 4PA3A 1XMQO 2YS8A 3CX5F 3L72H 1M1KW 3OGIB 1LR1A 1MZEA 3EZIA 3K1IA 4LDRA 2JK5C 1UJWB 2YL3A 2J9VA 2X0CA 3SP1A 2BOCC 3K9AA 4D7SA 1AB3A 1I94B 5JLIA 4I1MA 1FTSA 4UB8Z 4L8JA 5IY5B 2GTAA 2B5UA 1XMOB 3D3QA 5LBQA 1WJZA 4FM2A 1YI2V 4MVSA 3M1CB 3UMKA 1I5NA 3TQOA 4AI8A 4U3JB 4L87A 1SR2A 3GORA 1OXKA 2P67A 1R6KA 1TWGA 1H2KA 1TAEA 4CS2A 3GWOA 4E7ZA 1IW7F 2XLDA 1Q86W 4C3EA 4LDQA 1MMNA 1QNMA 2P1AA 1PD3A 4YIPA 1T6UA 2KW3C 2Z15A 3T1CA 3H1HH 1NTZH 2R7XA 4X1IB 2CGNA 4FZ1A 2I8BA 1SERA 4DR1O 1ZYRF 3EH2A 3G80A 3C8GD 2HG5C 3SDLA 1SQPH 2HR3A 4JAUA 2H8PC 5B3IA 1B6QA 2KG7B 3O10A 4PA9A 4XBFA 1FXKA 2EZPA 2EPOA 2HS5A 4N6HA 1IBKO 4RWUA 2VRZA 2V1DA 3HNLA 3KZIZ 3Q4HA 3CB2A 4JJGA 3DGEA 3JASB 1JMWA 5JSLA 4IJJA 3K0GA 4IYIA 1GM7A 4BIZA 3S90A 2XLVA 4AK9A 1G5ZA 3HKBB 2R05A 3VQWA 2B1IA 4TV8A 1J5EB 1GM5A 3UR3C 3K59A 3T6GB 2GFHA 4DR5B 1ST6A 4JPRA 4J7YA 1H7IA 3FOOA 1Q5OA 2QR4A 5JJJB 5IT9N 5E1AC 1ZVZA 3TD7A 2WZGA 3MFNA 4JZ2A 3CAXA 1TA8A 2P22C 5DS6A 5BUOA 5EBLC 4PI0A 2PY5A 4BAYA 1Z5VA 4DV3O 4O4HA 2F23A 1XREA 5LGUA 1KQSU 3HKKA 1S3JA 3U9MA 1E2XA 3ABMC 1FAFA 4B3SO 3U8VA 2GWWA 1YEWA 1BS3A 2EILB 1MSDA 2LQTA 1P7GA 4NXMO 3DC5A 4B3MB 3UCSC 4CBEA 2OTLV 3KH2A 3SZRA 3DAFA 1M56B 5A6KA 4I1OB 5D91A 1AJPA 2XLHA 2D4UA 3C18A 3BRJA 2YXHA 3RBZA 4MTXA 3R65A 2CK3G 1LE4A 1RPRA 2WB7A 1JR9A 4E0IA 4LWSB 4CH3A 2LK4A 4RUFA 4I44A 4O4LB 3UKMA 5EC2C 1F4NA 2R9RB 4WFFA 1V54C 5CA0A 4O2BA 2KQ9A 2UXCO 4MNDA 5GW7A 3CRRA 1VARA 1DLBA 3F46A 2L6FA 3B77A 4B3RO 2I15A 5LHGA 4ZOLA 5B1BB 1RKCA 2OJED 3ZMSA 4EB6A 1ZHXA 2H94A 3NKEA 4MTOA 5L3DA 2VQFB 5L3VA 3C3TA 4XPWA 3AG1C 4TSFG 4ZI7A 1E86A 5AG2A 4UCVA 2HVKC 5KLVH 2Y0IA 1U89A 2HHHB 5EBWC 4X66B 3U2LA 3QO8A 2A6EF 4U5EE 4PA6A 5LGTA 5BR8O 3ZDLA 4DVYP 2H7BA 4RBNA 5L3GA 2PYJA 1VF6A 3FYIB 2CE4A 1M90W 3BAAA 2Q9AA 4X20B 1IURA 2EIJC 4JI1B 1H2SB 2XT9A 4X88A 3SYQA 1NJIW 1LUWA 4DV6O 1EI7A 5GTHZ 2HSBA 3KMIA 3EXAA 3L70H 2FFHA 2H8AA 1NTKH 1OKKA 3BY6A 2UXDO 1OV9A 2EJ7A 3ABTA 4YN0B 4KC9A 2EIKC 3P3NA 1HNZB 2ASRA 2ZXWC 2KYHA 1EQ1A 4BJ1A 4IRUA 5KYYA 2AHYA 2DQ0A 1E84A 2Z0AA 4UDVA 1EZVH 4X1IA 4FLXA 2HVJC 2XL8A 4JYCA 2XLMA 5IJ0B 4QPKA 2N04A 3JAKB 1TGOA 1NH2D 1YTFD 3B29A 3H01A 4F6RB 2F1MA 2FL4A 3E86A 2KG7A 4DV5O 2IBFA 3SNHA 1CEZA 4G78A 2R7VA 3F5TA 4ZIBA 5T3WA 5JVEA 2AWYA 1WA8B 1C17M 3KYJA 5CMUA 5IDJA 1SS3A 5KUKA 5EIBD 1AEPA 1Y74B 3X1OA 1TR2A 3A11A 4QI0A 4YL0A 1QVXA 3OEEG 3BRCA 3HKBA 2IM9A 4DV4O 3ZHQA 2DGJA 2QKSA 4OIOF 1H9GA 2OU6A 1Q81W 2UXXA 3EGDA 2QKCA 1N36B 1QCEA 2NNUA 5CA1B 1NS1A 5LHHA 2OT5A 1KC8W 1QQ3A 3GEEA 4LACB 1HNXO 2Q00A 2V26A 3TOMA 1OZ0A 4E0HA 2HFEC 2YIBD 1VQ7V 1X59A 4MTGA 1T5OA 1F1MA 4NTYA 2MHRA 2W0FC 1O9GA 1MSWD 2QLAA 3AG4C 4PFPA 4DW1A 1IZ3A 1VQPV 2QUPA 1WPBA 2ZDIA 3R66A 4DJ9A 4PFOA 2HLDG 3IHUA 1DOWA 5F2VO 5KMGA 4FMTA 4EEQA 2OEVA 4HE8D 1PL0A 1XL4A 2JJ2G 1WLEA 2GSMB 3D36C 4R6ZA 5T1DB 4CH6A 1FAPB 1GM8A 2YKZA 1YA7O 1N33B 1SETA 4JW1A 3RYCA 4JF3A 1RM1B 3A9CA 5J9PC 4JYAO 2Q73A 2IXOA 4QNHB 3S9OA 2HV6A 3M8AA 5BQGA 4NCQA 4YL3A 3OTFA 4BPMA 2XM0A 1H9TA 3PN1A 3A2FA 2NUTB 1RXQA 1R4TA 4H54A 3TJ6A 3BVOA 5LHIA 1QVFU 4LWSA 4OD4A 4HAMA 3U0CA 1FFTC 2UUCB 4O4LA 2JX0A 1JX9A 1QKRA 1XILA 1AR5A 4TUYA 3ZX6A 2HJDA 3FD9A 3IC7A 5BY1A 4NXNB 1XNQB 2HMZA 5HFMA 4XPXA 1MG1A 3EFFK 2YI9A 3C62A 1VLSA 1D1CA 1VQKV 4FFKA 3FB5C 2L35A 2JRIA 4B3TO 4JI7B 4UV8A 2CGOA 5DQZA 4IIJB 4W4KA 3JALB 2XXAB 3OUFA 4QIWF 3NMJA 3L8IA 4XLPF 3GWNA 1Q3EA 3NYJA 2ETNA 2OG2A 1OW8A 1QHTA 3U9JA 4BJ5A 1EA8A 4X9QA 2AU5A 5D5PA 2WZLA 3O55A 3A0BZ 1TWCA 3CRMA 2HJ3A 3RYFB 4LDKA 3H2UA 1VOMA 4Z9IA 2XL4A 3BEHA 2O9XA 1HR0B 1Y6DA 1VIBA 1EM1A 3ZRXA 1Q0MA 3EH1A 4IT5A 1G8MA 1NU1H 2QM7A 4AL0A 2E74B 1C02A 4O6NA 5LP6C 3W4YA 4NTFA 1EN5A 4IYHA 5HFLA 4ABMA 3PMRA 3QNEA 1BDJB 3GM1A 5FZTA 1GN2A 5IJ0A 4KNVA 4CS9C 4PJNA 2LCHA 4F6RA 4G0HA 5H6RA 4C3DA 1MNDA 1E85A 4ZHQB 2K9PA 4JI2O 4X65O 5EGYA 1AVMA 5HV9A 5BXZA 2LFDA 4I9WA 5JCOC 2OOCA 2Y39A 4WGZA 4AILC 1PV0A 3T1HO 1M57B 1HE9A 4CIHA 1S76D 2O57A 3EFOA 1Y74A 5B3SB 5LMUB 2E87A 4PJJA 4E18A 4PJLA 5E2QA 4CH4A 2AZ2A 2CDQA 5FL7G 4JEBA 3ZN1A 3RGBA 1SQQH 4WBNA 1NR7A 3BCCH 1OJHA 4J32B 1FFHA 1I94O 5F5HA 2CGEA 1BGYH 2Z5UA 4LP8A 1K92A 4GX2A 2ADPA 1ZHWA 1VQ4V 3QVZA 1K34A 3K66A 1GM9A 1XMOO 2YIAA 3SYOA 4AE4B 3DD7A 2BE5F 4YJWA 2J9BA 2Y3HA 3JCZA 3OM3B 2YLGA 1WB7A 2V3CC 5LOVB 2VCAA 1V55C 2QM8A 2Q0AA 3OEHG 1S05A 2A7WA 3AJMA 4TV9A 4CX9A 4LF9B 1FPOA 1NI8A 4PDVA 1XHZA 1NBBA 2EIMC 2WVNA 1ZX3A 2GA0A 5LMNB 3THOA 2J7PD 3K04A 4RUEA 4ZKIA 4LFCB 3OA1A 4K0DA 5EC1C 1OCCC 1VEWA 2Q5ZA 4I4TB 1WWPA 3LS0A 4N6CA 2ITCC 4FK5C 1US6A 1K9MW 4RDAA 1JFFA 4BWAA 1KBHA 2YXYA 4NTWA 2WLLB 1H8HG 4LC1A 1J5EO 3CRCA 1MZFA 1K8AW 3POVA 3I5QA 2WLJA 3RYIB 5KYNA 3IJ4A 2Y69B 5F5FA 1Q7YW 1Y76A 3EPVA 1XQ8A 4DR5O 1ZUQA 1OCOB 3STZC 1WN7A 2XSEA 2HSQA 2KB1A 1NG1A 1E83A 1WP8A 4WABA 1AP6A 2ZIOA 2HEPA 1B04A 1IVSA 2DB4A 3K0DA 1V9PA 3CS5A 4DRJB 3JALA 1R3JC 2XXAA 3EHNA 4GQHA 1KU2A 4E17A 2F95B 3VM6A 3SJBC 3S0XA 1SRYA 1N1CA 4B3MO 2W4BA 1CGOA 1KTMA 4OXSA 3VF0A 4D4NA 3K58A 2G38A 4DW0A 3F47A 2LO1A 2NLJC 4YJ2B 4G7OF 3X2QB 3JATB 1LE2A 2Q3TA 5CBHA 5F28E 1CXZB 2OTJV 1EZJA 1SF8A 4WFEA 2P7TC 3Q4HB 2ZNIA 1GH6A 1THZA 3ETQA 1T9KA 3ECSA 1SQFA 3CP1A 3UO3A 3H1JH 1VYKA 4NQFA 2QTVA 1PPJH 3OMIB 2J8WA 1E1RG 4DR3B 3CSXA 4R7CA 2E5LB 1VQ8V 5A2QN 1PP9H 2PGGA 2R9IA 5ITZB 3SR2C 2VQFO 3EQLF 3HNKA 3CD6V 2P61A 1RSOA 3CC2V 2WAMA 3N2KB 3D3IA 2HHHO 2ZKOA 4X66O 4JRZA 1XOUA 5KYXA 4Q5SF 3DXJF 2M64A 1KECA 4FLYA 2L6HA 2GTSA 3S3XA 1Z2GA 2W0XA 4FLWA 2XLWA 4JI1O 2XM4A 3CZ6A 1K7DA 4YXWG 4DV2B 3C90A 3G71V 4YY3B 5EBMC 3IQTA 1WOLA 2QSAA 1AR4A 2XAGA 3NYMA 3UNGC 2DWDC 5BMVB 4K7BA 2YXLA 2QTSA 1KKDA 4X64B 3UO2A 5LOVA 1YDXA 1HNZO 2L6LA 4X62B 5EYPB 2R7QA 1KMIZ 1XEQA 1HMOA 4J7ZA 5EZYB 4HFFB 4DO2A 5FCLA 4HYOA 1S5LZ 3HLZA 5COGA 3V5ZA 5HSWA 2E75B 2Y4TA 4XDLA 1N0JA 4JZGA 5CA0B 4CS8A 3QF7A 3ITFA 3NDBB 3NXSA 2DYSC 3VQVA 1R3KC 3N2GA 4I4TA 1LS1A 1YA9A 1F4MA 1GAXA 1B3QA 3L0IA 2JVDA 3RH3A 3MLGA 1AI7A 5FLXN 1ORYA 3RW0A 2CNWD 2CW0F 2KKWA 2JDIG 2EINC 2KGOA 2ILMA 1BHBA 1GTOA 2IXMA 2WLLA 2GDSA 1AI5A 4ZI7B 1IXBA 2B1GA 4UUJC 3ASOC 1WN0A 3ML0A 3W7UA 1APCA 1TQGA 1N36O 3ZWIA 3ZMVA 3IQCA 3ZG1A 1VK5A 2NN4A 3TK1A 2FYUH 1VQMV 3ZHTA 1G4WR 3N0TA 2WLNA 2ZNJA 2F4VB 2CTQA 3RFYA 5JRAA 3CCVV 2CDYA 2OIGA 3N27A 5H6QA 5CI8A 3J81N 3RQEA 4GZRB 1MMDA 4EIYA 1NVPD 3L71H 4BW9A 3CRQA 5DN6G 2RSEB 4JYBA 3W2WA 4PJ0Z 3AQCA 1IBMB 2QY9A 1PD1A 2A0BA 1N8RW 3L73H 1K33A 2YLDA 3ABMB 3LDDA 4FFBA 1N33O 2L6GA 2A06H 4JTCB 5KYYB 5L3QA 3ASNB 4O4IB 4FM0A 2L9JA 2DYRC 1CGME 2B0JA 1EN6A 4TT3G 2W6IG 4BIOA 1RMVA 4J11A 1I08A 2QTOA 4YJ2A 3JATA 4UVBA 1HNWB 1HY5A 1OW6A 3E8FA 1SESA 4JI6B 2BSKB 4O7GA 4BEJA 3J7AU 1ZZPA 1URFA 3LLKA 4DUYB 1BT8A 2UUCO 2A69F 2GAQA 4G27B 3Q7GA 5IWAB 3HTKC 4EWCA 1V54B 3LUTB 2A68F 5GTIZ 4IAQA 4I7ZB 3G6BA 5C93A 2PBEA 4BJ6C 4NXNO 1XNQO 2H7VC 3EGDB 3RIPA 3EJNA 5J2TB 1PL4A 1P49A 3ZS8C 2IBZH 2ODMA 5ITZA 5KYUB 2Z3YA 4JAAA 2EULA 3IC9A 3SPIA 2UXBB 3ZMZA 4PHZA 3BABA 3AG1B 1SMYF 5B1AC 4JI7O 4GYCB 5KUMA 3K57A 3N2KA 1FXVA 1RP3B 2Q8VA 2QM4A 2TMVP 1YIJV 2G3VA 4CC6A 1V74B 3UQ8A 2WWWA 2XLOA 3B71A 3R2PA 4B08A 1GKFA 4YJ3B 1R1BA 4CDVA 4DV0B 3JARB 5KMGB 4Z9JA 3FXHA 3QW0A 2EIJB 1NZEA 2RN9A 1QVGU 2NUPB 1K5SA 4MVRA 1JMKC 4J10A 1S0VA 4TOIA 4P9FA 3RYCB 5BMVA 2IH3C 1KYOF 4K35A 5JWPA 3CE2A 4A4AA 1L0LH 1N32B 1K4CC 4UCOA 2UUAB 1PD0A 3A8TA 1HR0O 2D2CB 2UUIA 3DE8A 3OTOB 2CH7A 3U2MA 1RFYA 4XWJA 2EIKB 5EYPA 4EFEA 2GV9A 4KBLA 1K97A 5EZYA 1D0ZA 4O6YA 3JSNA 1A7EA 1W2BU 2HUJA 4JI0B 2UUHA 1Q90D 2HZ8A 4CS7A 3B8NA 1SQXH 4TUYB 1GK9A 3RT3C 4DXWA 1D0YA 2R7OA 2VH3A 4Z2WA 2HKOA 3NYLA 4GEHA 5LMUO 4DR6B 2LD6A 5L3EA 4JIOA 1ROPA 3E22B 1DK1A 4OIPF 1YDIA 2K1EA 1Q0GA 4DV1B 3JCUQ 2BE3A 1VF7A 3L8JA 3W7SA 4LLEA 1T6QA 1SC5B 2J7PA 2BTQA 4MSWC
chains in the Genus database with same CATH topology
4MS2A 3FB5C 3SPHA 4UV8A 3OUFA 4QIWF 5DM6V 3AG4B 4MVUA 3PJSK 4GT1A 5IYDO 4WFGA 3SPJA 4BIUA 1F51A 1I5XA 2LP7A 3LSQA 5BZBA 1L1FA 2XAQA 1QLEB 3OFNG 3ZCCA 4U7NA 3OMNB 3E89A 2ITDC 4GX0A 3ABKC 1YJNV 3BEHA 1ORQC 1R73A 4KUMA 4GX5A 3ZRXA 1VQ9V 1G8MA 2QM7A 1Y4MA 4MTFA 2Y48A 2GHYA 5HFLA 1FXKB 3CCJV 3JD0A 1H8EG 3QNEA 1AROP 1DF5A 1AI6A 3DTUB 3P32A 1ZWIC 2P6JA 4Z1MG 3CC7V 3FYEB 5H6RA 4MVQA 3ASOB 1FFTB 5IYCO 4UV9A 3M99B 4JAVA 1XL6A 4H37A 4FJCC 4I9WA 2OCCC 3AG2C 4N23A 3WFVA 2IJKA 4P9PA 1M57B 1W0KG 3JD4A 2Y69C 1S76D 5B3SB 5IYBO 4N21A 1JPXA 3JD3A 3AEIA 3WG7C 4X89A 3W7WA 1K3EA 5FL7G 4X8AA 3ZN1A 2A0LA 1NR7A 1R3IC 2BOBC 1YSCA 4QE9A 2Z5UA 3A0RA 4LP8A 1K92A 2DW4A 4GX2A 4UVAA 3E2EA 3SYCA 1VQ4V 1K34A 1GM9A 3ETEA 3OMAB 3SYOA 5EK0A 2X6BA 4MVOA 3JYCA 1OHHG 2V7QG 4QE7A 3JCZA 3OM3B 5IY5C 3FB8C 3ZRVA 1V55C 2EBOA 2QM8A 4BW5A 3OEHG 1DTOA 4PDRA 1KP3A 4QPJA 3TETA 1JQ0A 1PNLA 2DYRB 3F5WC 3ETDA 2QA4V 2WLMA 1WPXA 4PDVA 2ZXWB 3T4DA 2EIMC 4P9OA 3CYOA 2Q68A 3ABKB 1K4DC 3ZMTA 1EFRG 1CPYA 3CCLV 3E8GA 2EZOA 1CP9A 3X2QC 3CXCU 3LDEA 3K04A 1AI4A 2D3OW 4RUEA 3ASNC 4ZKIA 4UXNA 3W7TA 5EC1C 1OCCC 2ITCC 1QR9A 4FK5C 3ZJZA 4RQEA 3LDCA 1K9MW 4GCZA 3SJQC 2IU0A 3QO7A 4LCUC 4F4LA 2WLLB 1H8HG 3T2MA 4RQFA 4LC1A 2X6CA 3K03A 1PNMA 2OCCB 2WLKA 2YEVB 3AG2B 3F7YC 4FPPA 1K8AW 1QR8A 1VQ5V 1RPOA 2WLJA 1TUEB 3OAAG 5B1AB 2Y69B 5CBFA 4H33A 1Q7YW 1VQNV 3SPCA 2IJHA 2X0LA 3LSSA 4P30A 3E83A 1YITV 1AJNA 2MK3A 1OCOB 1AR1B 3CC4V 3AG3C 3STZC 1H2GA 4WCEV 5L3CA 4CZZA 3LNMB 2KB1A 2ZR3A 1NBMG 2ZD9A 3IFXA 4PA3A 1MABG 2XAJA 2C2AA 1M1KW 2JK5C 1UJWB 2BOCC 1JOYA 3K9AA 5L3FA 1PNKA 3K0DA 3W7XA 1R3JC 2ZDIC 3ABLC 1R6NA 2QE7G 2W6JG 4TWKA 2B5UA 5IY5B 5LBQA 1YI2V 4MVSA 3SYPA 1NQTA 1SRYA 4L87A 1YJ9V 4OXSA 2P67A 2WPDG 1R6KA 2ZQMA 3GWOA 4XDKA 2EILC 1Q86W 2JIZG 1COWG 3HPLC 4PA7A 1PD3A 2NLJC 3D36A 3X2QB 3T1CA 5CBHA 1LNQA 4KP4A 2OTJV 4XDJA 1EZJA 1M56C 3ZRSA 3CCMV 4RO2A 1SERA 1NVPB 4WFEA 4PA4A 3MD0A 2P7TC 2HG5C 1THZA 2XAFA 2HR3A 4JAUA 1RM1C 2H8PC 1G4YB 2M7WA 3CCSV 1B6QA 1M9NA 3CP1A 4PA9A 4R8CA 4XBFA 1FXKA 2EZPA 1EBOA 2V1DA 3OMIB 1E1RG 3F7VC 4J9ZB 1J95A 1P7BA 3DGEA 4R7CA 1R3LC 3ABUA 2LFRA 3K0GA 4BIZA 1GM7A 1VQ8V 2R9IA 1GO3F 2B1IA 5KA5A 1P4RA 5B1BC 3CD6V 3CC2V 4EKWA 2WAMA 3D3IA 3AG3B 1OCZC 4G2KA 1KECA 1NH2B 1YTFB 1Q82W 2A9HA 2AHZA 4JPRA 2UXNA 3MHSC 4PDLA 5E1AC 2WLHA 4MW8A 3OE7G 2JEUA 1K7DA 2JEXA 4YXWG 3OW2U 3G71V 2XOKG 4LBEC 5EBMC 3RVYA 2LFSA 3ABLB 2XAGA 5EBLC 1I5YA 2DWDC 4BAYA 1S5HC 4HZ3A 5LGUA 1KQSU 2WSSG 1BL8A 3JD2A 1KKDA 4MT8A 1HWYA 1S3JA 3ABMC 2IJJA 1E79G 2EILB 3CCEV 1NR1A 3K08A 3ZN0A 4DO2A 2OTLV 4HYOA 4KFMA 1M56B 4XDLA 1AJPA 3JD1A 3STLC 3NXSA 3ETGA 3G4SV 2DYSC 3RBZA 1R3KC 4MTXA 3R65A 3VBBA 1QLNA 2CK3G 1RPRA 1F4MA 1BHAA 4JTDB 1AI7A 1QBZA 1E1QG 3EHBB 4RUFA 2IU3A 2IW5A 3KG2A 3RW0A 3UKMA 3I55V 2JDIG 5EC2C 1F4NA 2EINC 2R9RB 1V54C 4WFFA 3CCRV 1BHBA 1GTOA 4I5SA 5GW7A 2WLLA 1DLBA 3WG7B 1AI5A 2B1GA 3K06A 4Q20A 3ASOC 3B77A 4UUJC 3ML0A 3ZRWB 2YEVA 5LHGA 3W7UA 2X7RB 3GB7C 4FIPC 5B1BB 3UM7A 3ZMSA 3ZMVA 3CCQV 3OR7C 2H94A 3TK1A 4MTOA 5L3DA 1M57C 3T4ZA 1OCZB 3AG1C 4TSFG 1VQMV 3HB3B 2WLNA 3ZRWA 2HVKC 1SZTA 1S77D 3E8HA 4U7OA 5EBWC 3QO8A 1KD1W 3CCVV 5B1OA 4PA6A 1BMFG 5LGTA 4MVMA 2DQ3A 1JJ2U 1PKXA 5H6QA 4ASUG 2FTKA 5L3GA 1V55B 3FYIB 2YSUB 1M90W 1MOFA 1NVPD 2EIJC 5DN6G 3E8BA 4X88A 4JYBA 3SYQA 1NJIW 2IJIA 1N8RW 1FS0G 1K5QA 1K33A 2EIMB 3ABMB 3LDDA 3CMEV 1NKDA 4JTCB 3BY6A 4P2ZA 5CBGA 3ASNB 3OGCC 1VQLV 3OUSA 1OCCB 2DYRC 3ABTA 3SYAA 1FXHA 4TT3G 2EIKC 2W6IG 3TCUA 2ZXWC 1JVMA 2QTOA 2XASA 4WFAV 4UVBA 1K73W 2AHYA 1SESA 2DQ0A 3E8FA 2HJFC 2HVJC 3FB7C 4JYCA 2DYSB 4QPKA 1NH2D 3SPGA 1YTFD 3H01A 3K3WA 3MHHC 1Y66A 3E86A 4G27B 4JGSA 2IH1C 1CEZA 3ZMUA 4WFHA 2EINB 1V54B 3LUTB 3CMAV 5L3BA 5C93A 1IXMA 5CMUA 1ENVA 5IDJA 3CPWU 5KUKA 4G28B 1AJQA 1OCRC 4RAIA 5B1NA 3OEEG 2ATKC 3OR6C 1KP2A 2F43G 2X6AA 2Z3YA 3SPIA 1YHQV 3ZMZA 2QKSA 1GMGA 3AG1B 1Q81W 2UXXA 5B1AC 3VOUA 5KUMA 4WF9V 1H38A 1FXVA 1QCEA 2NNUA 1YIJV 5LHHA 1KC8W 2OT5A 1OCOC 2DWEC 2WWWA 1GKFA 1OZ0A 2HFEC 1VQ7V 4MTGA 4PELA 2W0FC 1MSWD 3G6EV 3AG4C 4CBCA 2EIJB 1VQPV 1QVGU 1K5SA 4MVRA 5LGNA 4WFBV 3CCUV 4JASA 1VQ6V 2ZDIA 5H9CA 1S0VA 2HLDG 2IH3C 2XAHA 4FMTA 1PL0A 1K4CC 1XL4A 4GX1A 1QLEC 1W0JG 2Q6AA 4QJFB 3FB6C 2JJ2G 3IGAC 1WLEA 2GSMB 4MW3A 4R6ZA 1GM8A 1SETA 1DF4A 2QEXV 2EIKB 4JF3A 1RM1B 5J9PC 4JTAB 1K97A 4MVZA 4QNHB 3K79A 4UVCA 1W2BU 1F23A 1JCHA 3E35A 1FXKC 2PI4A 2Q69A 3RVZA 4PDMA 1S72V 1YJWV 2JJ1G 2PI5A 3B8NA 4J9YB 2WLIB 3I56V 1GK9A 3FKSG 4DXWA 5LHIA 1VQOV 1QVFU 4E2LA 4HAMA 5KA6A 2HKOA 1JX9A 2EJRA 5CA3A 4ZBMA 3ZIAG 1OCRB 5L3EA 1ROPA 2WLIA 3P30A 3QO5A 2K1EA 5B3SC 3IC7A 5HFMA 4R50A 1MG1A 3EFFK 5CN0A 3W7SA 2A79B 2Q67A 2P90A 2XNDG 1VQKV 4MSWC 2ZR2A 3B8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MS2 A;  1OCC C;  2HJF C;  3FB5 C;  4PDL A;  3SPH A;  5E1A C;  2HVJ C;  2WLH A;  3FB7 C;  4MW8 A;  2ITC C;  3SPG A;  3ZJZ A;  3OUF A;  3LDC A;  4LBE C;  4MVU A;  5EBM C;  3PJS K;  3E86 A;  4G27 B;  2IH1 C;  4WFG A;  3RVY A;  3SJQ C;  4LCU C;  4WFH A;  3SPJ A;  5EBL C;  4F4L A;  2DWD C;  2WLL B;  3LUT B;  1S5H C;  4HZ3 A;  3T2M A;  1BL8 A;  2X6C A;  1KKD A;  3K03 A;  2WLK A;  5KUK A;  3F7Y C;  4G28 B;  5BZB A;  3ABM C;  1OCR C;  2WLJ A;  5CBF A;  4RAI A;  4H33 A;  3SPC A;  3E89 A;  4P30 A;  2ATK C;  3E83 A;  2ITD C;  2X6A A;  3OR6 C;  3SPI A;  4GX0 A;  3ABK C;  2QKS A;  3AG3 C;  3BEH A;  1ORQ C;  3K08 A;  5B1A C;  3STZ C;  3VOU A;  5KUM A;  4HYO A;  3LNM B;  4GX5 A;  2KB1 A;  4KFM A;  4XDL A;  2ZD9 A;  3IFX A;  1OCO C;  2DWE C;  4PA3 A;  3STL C;  4MTF A;  2DYS C;  3RBZ A;  2HFE C;  1R3K C;  4MTG A;  2JK5 C;  3R65 A;  2W0F C;  2BOC C;  4JTD B;  3AG4 C;  3K0D A;  4CBC A;  1ZWI C;  1R3J C;  3KG2 A;  4RUF A;  3RW0 A;  3UKM A;  3ABL C;  3E8F A;  5EC2 C;  4MVQ A;  2EIN C;  2R9R B;  4MVR A;  1V54 C;  4TWK A;  4WFF A;  1XL6 A;  4H37 A;  2WLL A;  2OCC C;  4I9W A;  3AG2 C;  4MVS A;  2IH3 C;  3SYP A;  4P9P A;  3K06 A;  4UUJ C;  3ASO C;  1K4C C;  1XL4 A;  2YEV A;  1QLE C;  2Q6A A;  4GX1 A;  4OXS A;  2Y69 C;  3FB6 C;  3GB7 C;  3IGA C;  3UM7 A;  4MW3 A;  4XDK A;  2EIL C;  4R6Z A;  3OR7 C;  3WG7 C;  4X89 A;  4PA7 A;  3HPL C;  4MTO A;  1M57 C;  2NLJ C;  3T4Z A;  3AG1 C;  3T1C A;  4X8A A;  5CBH A;  1LNQ A;  2A0L A;  2WLN A;  5J9P C;  4XDJ A;  2HVK C;  4JTA B;  1M56 C;  3ZRS A;  4RO2 A;  4MVZ A;  4QNH B;  3E8H A;  5EBW C;  4WFE A;  1R3I C;  4PA4 A;  2BOB C;  2P7T C;  4QE9 A;  2HG5 C;  4PA6 A;  4LP8 A;  4MVM A;  2H8P C;  4GX2 A;  3SYC A;  1G4Y B;  2Q69 A;  3RVZ A;  4PDM A;  4PA9 A;  4R8C A;  3SYO A;  5EK0 A;  4J9Y B;  2WLI B;  2X6B A;  4MVO A;  2EIJ C;  3JYC A;  4QE7 A;  3E8B A;  4DXW A;  5IY5 C;  3FB8 C;  4X88 A;  3F7V C;  1V55 C;  3SYQ A;  4BW5 A;  4J9Z B;  1J95 A;  1P7B A;  4R7C A;  1R3L C;  4PDR A;  3TET A;  4ZBM A;  3K0G A;  3LDD A;  2WLI A;  3F5W C;  4JTC B;  2WLM A;  4PDV A;  2K1E A;  5B1B C;  5B3S C;  3T4D A;  4P2Z A;  5CBG A;  2EIM C;  4P9O A;  4EKW A;  3OGC C;  4R50 A;  2Q68 A;  1K4D C;  3EFF K;  3OUS A;  2DYR C;  3E8G A;  1OCZ C;  3SYA A;  3X2Q C;  2EIK C;  2A79 B;  3LDE A;  3TCU A;  2ZXW C;  2Q67 A;  1JVM A;  3K04 A;  2QTO A;  2A9H A;  2AHZ A;  3ASN C;  4MSW C;  4RUE A;  2AHY A;  5EC1 C; 
#chains in the Genus database with same CATH topology
 2YDE A;  4MS2 A;  3P3P A;  3SPH A;  2R7S A;  2ARH A;  1VMA A;  2OIE A;  4O6M A;  3N24 A;  3AG4 B;  2RJZ A;  4WFG A;  4NB5 A;  3SPJ A;  1FD9 A;  5A6J A;  1I5X A;  4LF9 O;  2FGY A;  2LP7 A;  2EX3 A;  2YIC A;  4Q4Z F;  2M6Y A;  3LSQ A;  1A0B A;  2YL0 A;  4XEF A;  3MAQ A;  4P9T A;  5LMN O;  1F7Y A;  4DR7 B;  4FX5 A;  2ITD C;  4LF8 B;  4GX0 A;  4LFC O;  4U5F E;  1LS4 A;  1ORQ C;  4O4I A;  2LQG A;  4KUM A;  1N4C A;  2J45 A;  1HW7 A;  2M4E A;  2Y48 A;  2GHY A;  1SZI A;  2A1D D;  2YC0 A;  5JVD A;  2BSK A;  3CCJ V;  1DF5 A;  3SEO A;  4CC5 A;  2WVO A;  3DTU B;  4Z1M G;  4DR4 B;  1Q6U A;  3CC7 V;  2OYQ A;  1CPQ A;  2OKU A;  3EFO B;  1SF9 A;  2R9A A;  2PUS A;  1FFT B;  3GVM A;  5IYC O;  4JAV A;  1SQV H;  2BC5 A;  4FJC C;  2OCC C;  4EBJ A;  2DOS A;  3UT5 B;  2Q4F A;  1FYJ A;  1HE1 A;  1W0K G;  1BQ0 A;  2IXN A;  2VWJ A;  1JR8 A;  4WBN B;  5L0H A;  5J2T A;  1JPX A;  4I55 B;  1MMM A;  3U3F A;  3C8G B;  1D5N A;  3W7W A;  5KYW A;  1MMA A;  5KYU A;  1I0H A;  1DOV A;  4G7H F;  4GUN A;  1N34 B;  3CEI A;  2AZ0 A;  1Q0K A;  2P06 A;  3E2E A;  2QWN B;  4TV9 B;  4YJ3 A;  2KK1 A;  5EK0 A;  1S5J A;  4MVO A;  2AP3 A;  4JVS A;  3CXH F;  3JYC A;  1OHH G;  3JAR A;  3S27 A;  3AK2 A;  3FB8 C;  4XPY A;  4BW5 A;  1DTO A;  2NUP A;  3VRC A;  1M2V B;  3TET A;  1LPE A;  4FZ0 A;  3HNJ A;  2QWQ B;  3ETD A;  3NR7 A;  2QA4 V;  3CJH B;  1SA0 A;  1S7Z A;  2Q68 A;  3UGO A;  1TVK B;  3MBG A;  2N05 A;  1Q43 A;  2W9Y A;  3CXC U;  4JJF A;  1VP7 A;  1JFF B;  3NKD A;  4K3A A;  1AI4 A;  3V7O A;  5LA6 B;  4PK4 A;  5K1X A;  2ZM6 B;  2OWO A;  4J30 B;  2G62 A;  2R72 A;  4RQE A;  4NVP A;  2H7O A;  1ZLZ A;  2RCV A;  4OPH A;  4DR3 O;  4JCZ A;  4GCZ A;  2E5L O;  3SJQ C;  2MYS A;  1Y76 B;  3QO7 A;  4LCU C;  4F4L A;  4CSA C;  3FAJ A;  2Q7H A;  2VC9 A;  3K03 A;  2WLK A;  4DRI B;  5JH7 B;  2BCC H;  2D5R B;  3ZSU A;  5IYZ B;  2FKX A;  3ATP A;  5CBF A;  5BQI A;  1H6G A;  3AG7 A;  1VQN V;  3SPC A;  4P30 A;  3E22 A;  3E83 A;  1AJN A;  2PX0 A;  3Q7L A;  3CC4 V;  4C7O B;  2Q9C A;  3AG3 C;  3ZHU A;  2ICW G;  3K5M A;  4CJG A;  1TWH A;  3B9Q A;  4CZZ A;  1T6I A;  3CEX A;  4CH5 A;  2Y3B A;  3T9O A;  1NBM G;  2KNH A;  4DV2 O;  2DE0 X;  3JAM N;  1MAB G;  2AXT Z;  2XAJ A;  4YY3 O;  2FAP B;  3W8I A;  4DK0 A;  4PJM A;  2ADQ B;  4GKJ B;  1Y6X A;  1SYQ A;  1JOY A;  3B40 A;  4UCR A;  1ZHT A;  1CPR A;  2UUB B;  2ZXO A;  4X64 O;  4TQD A;  3ABL C;  3G50 A;  1R6N A;  2QE7 G;  4TWK A;  3N2Z B;  4KXR A;  3EZH A;  2JGD A;  4PV1 B;  1BR1 A;  2F66 C;  4CS4 A;  4X62 O;  1NQT A;  2Q9B A;  3ZTM A;  4FVM A;  3O65 A;  1LI7 A;  2YVK A;  5CIV A;  1H2M A;  2ZQM A;  4XDK A;  3JZ0 A;  3VYW A;  3HPL C;  1DGS A;  3D36 A;  3H1I H;  3OWT A;  1FFX B;  2WVQ A;  4KP4 A;  1OR3 A;  4NY3 A;  4XDJ A;  2EPL X;  3ZRS A;  4RO2 A;  4PA4 A;  1AUE A;  2LIG A;  4LF5 B;  3ZQY A;  3CRA A;  1RM1 C;  3HJC A;  1G4Y B;  2M7W A;  4UCT A;  3CCS V;  5L0F A;  1M9N A;  3CQZ A;  3LLI A;  3E9V A;  2Y4U A;  1XZQ A;  3FMS A;  2CTR A;  4H0L B;  1EBO A;  1XZP A;  4JC7 A;  3WB2 A;  5DEC A;  1Q0F A;  1YVI A;  4EBK A;  1RSO B;  1LI5 A;  3F7V C;  3SJA C;  4Z9H A;  1J95 A;  1P7B A;  5KYX B;  2LFR A;  2IXP A;  5L0J A;  3A0H Z;  3U8P A;  1GO3 F;  3IQ6 A;  1NSG B;  5KA5 A;  2F93 B;  3UT5 A;  5KHG A;  2RD9 A;  2F4V O;  3HKC A;  4B6I A;  1YAR O;  1OCZ C;  4I55 A;  4K1O A;  3C8G A;  1NH2 B;  1YTF B;  1Q82 W;  4G7Z F;  2AHZ A;  2Q0O C;  1WAS A;  3FFQ A;  4LR3 A;  3MHS C;  1G4U S;  4CJO A;  1ZAU A;  4PDL A;  1OW7 A;  3C8Z A;  3K6B A;  2WLH A;  1YJG A;  3OE7 G;  5B5E Z;  3SXY A;  3EVK A;  2LW1 A;  3GOD A;  3BA8 A;  3H1K H;  1IBM O;  4LBE C;  4IHJ B;  4DUZ B;  1FJG B;  4GYT A;  2Y3D A;  1S5H C;  4HZ3 A;  4U5D E;  1XI1 A;  2WSS G;  1GRJ A;  2XTA A;  3U10 A;  2P7V A;  1HWY A;  4KL1 A;  2KQX A;  2LGW A;  1M2V A;  4P6I C;  3RYH A;  2C04 A;  3DZA A;  1E79 G;  3CCE V;  2JD3 A;  1WGW A;  2Y3G A;  3CJH A;  1HNW O;  3WB0 A;  3N2G B;  4Z1V A;  4JI6 O;  3K08 A;  3KKB A;  5A9G A;  1IBL B;  4LF7 B;  1A41 A;  1TVK A;  5A6B D;  2CAZ C;  4DUY O;  3JD1 A;  4QI2 A;  5JJE B;  3K5N A;  5LL6 Y;  3STL C;  3QTH A;  3ETG A;  4JI4 B;  5IWA O;  5LA6 A;  2LP4 A;  5LP6 A;  1QLN A;  2XL6 A;  1WAT A;  2GUZ B;  4UB6 Z;  4JTD B;  3M4C A;  1E1Q G;  4QGP A;  1R5I D;  3I55 V;  1HMD A;  2IW5 A;  3KG2 A;  3LES A;  3US6 A;  4DV7 B;  2EPN A;  4CS9 A;  1UFB A;  4JV5 B;  2HKV A;  4OD5 A;  4BG0 A;  4W8K A;  3WG7 B;  4YL1 A;  3ZHR A;  2UXB O;  4Q20 A;  4UFZ A;  5JCO A;  4N06 A;  5JH7 A;  2HJM A;  2X7R B;  3GB7 C;  3UM7 A;  5IYZ A;  3OR7 C;  3SYN A;  1M57 C;  3T4Z A;  5L0G A;  1OKK D;  3O6X A;  5AGF A;  3HB3 B;  3WAQ A;  4C7O A;  3ZRW A;  4DOZ A;  1YCI A;  3E8H A;  4U7O A;  3OD4 A;  5B66 Z;  4DV0 O;  1KD1 W;  5B1O A;  4D7T A;  1YZB A;  1JJ2 U;  2DQ3 A;  1G6U A;  4H13 B;  1ORS C;  3LJB A;  4FFB B;  1MOF A;  3NRH A;  4I0X A;  2VCB A;  5E3C A;  4ULV A;  4ICG A;  3KL4 A;  256B A;  5FNV B;  4LNU A;  3E8B A;  1PM9 A;  1N32 O;  3QVN A;  2NG1 A;  2UUA O;  3JRT A;  1KNY A;  2IJI A;  3S28 A;  3OTO O;  1FS0 G;  3M7M X;  1K5Q A;  1U96 A;  2CUG A;  3APO A;  1Q6H A;  2A3Q A;  4DR2 B;  1KB9 F;  4P2Z A;  3OGC C;  3S84 A;  3TUL A;  2J0W A;  1KUQ A;  4BJT A;  2DJV A;  3OUS A;  2YL7 A;  5COM A;  2EPK X;  3H9V A;  4JI0 O;  3TCU A;  5KHK A;  3T1Y B;  2CTW A;  4WFA V;  1FFX A;  1SQG A;  2HJF C;  4KHP B;  3E70 C;  2J46 A;  2DYS B;  3OT7 A;  3SPG A;  3GM2 A;  4JGS A;  4DR6 O;  4X1Y B;  3ZMU A;  4WFH A;  2EIN B;  3W2V A;  1GS9 A;  2LFF A;  1I4Y A;  4CDA A;  1IXM A;  3B09 A;  4K0K B;  1LVK A;  4G28 B;  1AJQ A;  3GEI A;  2YLI A;  4DV1 O;  3JRM O;  1OCR C;  2DI3 A;  3TXQ A;  4U9E A;  3BFR A;  4MQ9 F;  4RAI A;  5B1N A;  3IAY A;  2CCY A;  2MWQ A;  1UFI A;  3OR6 C;  2F43 G;  3UMH A;  2QJ1 A;  2RQ6 A;  1KU9 A;  3VOU A;  2JS3 A;  3O39 A;  3H2V A;  1ZU5 A;  4WF9 V;  1M4U A;  1H38 A;  3QZC A;  3QW1 A;  2WL8 A;  4XEK A;  1D2D A;  1L7C A;  1OCO C;  2XUM A;  1B68 A;  3K1I C;  2P5O A;  3DSQ A;  4PEL A;  1HW2 A;  1XUQ A;  3G6E V;  1Z63 A;  3HNI A;  1VLT A;  1OXB A;  1HDJ A;  1YXB A;  4IHJ A;  4Q6G A;  4F6E A;  3U0Z A;  2CH7 B;  4WFB V;  3CCU V;  4JAS A;  3JYY A;  5H9C A;  1WTY A;  4R32 A;  4DR7 O;  2KSD A;  3BA9 A;  1HW1 A;  2XAH A;  1ZSP A;  4LF8 O;  3ZVR A;  4LH6 A;  4JI8 B;  4GX1 A;  1QLE C;  1W0J G;  2Q6A A;  3U11 A;  4KI2 A;  4DBQ A;  2PF4 E;  4RD9 A;  3L74 H;  4MW3 A;  4J80 A;  2WZF A;  4YWQ A;  2QEX V;  5GON B;  4JTA B;  2YIB A;  4MVZ A;  5JQG B;  3K79 A;  1NFN A;  4UVC A;  4OIN F;  1TUB B;  2GDC A;  3U5S A;  4DR4 O;  4PR9 A;  1JCH A;  3M15 A;  3E35 A;  1FXK C;  5L0C A;  3RVZ A;  2GBO A;  1YJW V;  3SXZ A;  2JJ1 G;  2PI5 A;  4J41 A;  4J9Y B;  3I56 V;  2IM8 A;  2GUZ A;  1VQO V;  1JOG A;  3M79 A;  4E2L A;  5KA6 A;  4AQY B;  2EJR A;  4ZBM A;  1Z23 A;  1VF5 B;  3G4Z A;  3FOP A;  2WLI A;  2BTQ B;  3K9S A;  1L0N H;  3QO5 A;  2A0U A;  1I4Z A;  3UMI A;  5KX5 B;  1N34 O;  1Q8I A;  5CN0 A;  5DS4 A;  3LAY A;  3AQB A;  5AC4 A;  3AGU A;  2Q67 A;  4O2A B;  2P90 A;  2XND G;  2ZR2 A;  5D92 A;  2LGQ A;  3B8M A;  4ZLD A;  2IYL D;  2ZE8 A;  4W4L A;  5JJN B;  4WJ0 A;  4EFB A;  5E79 Z;  3EGX A;  4KNW A;  4AL1 A;  4GT1 A;  2KJG A;  1SQB H;  2HP8 A;  2AWC A;  1GGQ A;  5FNV A;  1AIL A;  2W45 A;  1FR0 A;  4JEA A;  3ZCC A;  3OFN G;  2P4K A;  4U7N A;  4UCS A;  3VAY A;  3OMN B;  3E89 A;  3HR0 A;  4E4E A;  3ABK C;  5JVD B;  3L9D A;  1ZHZ A;  2VQE B;  1LIH A;  4OIQ F;  2ZM6 O;  4GX5 A;  4LF4 B;  3LS1 A;  1NTM H;  1XHX A;  4K8X A;  1Z5W A;  2PFD A;  1YF2 A;  1ARO P;  5EHH A;  2X51 A;  1A7D A;  5D5Q A;  1AI6 A;  4JI5 B;  1JJO A;  1JPJ A;  3P32 A;  2P6J A;  3GWL A;  4MVQ A;  1D0X A;  1O3U A;  4NTA A;  4U5C E;  3M99 B;  4X1Y A;  5TJ5 E;  1A32 A;  5KYW B;  4C7U A;  4H37 A;  2YHS A;  1M93 A;  3AG2 C;  3RKO F;  3DM5 A;  4U5H A;  1WNS A;  2IJK A;  3G4X A;  4M63 A;  3JD4 A;  3L34 A;  4NYK A;  4LH7 A;  1JRA A;  5IYB O;  1T5E A;  1YLM A;  2QGN A;  4X89 A;  1K3E A;  4XLN F;  5KAI Z;  1U97 A;  3FAV B;  4X8A A;  4GKJ O;  2A0L A;  2L7A A;  3K5O A;  5CB4 A;  2BL2 A;  3PHF 2;  1R3I C;  4HNA B;  2BOB C;  1G1X B;  4OGQ B;  2HMQ A;  1VF6 C;  4UVA A;  2UUB O;  3BHP A;  5A6A A;  1WB8 A;  3TK0 A;  3OMA B;  3CSK A;  1AP5 A;  3ZQV A;  4QE7 A;  1SA0 B;  5IY5 C;  2VCC A;  1BZ4 A;  4JCH A;  1Z7Q c;  1GN6 A;  2EBO A;  4PDR A;  1PNL A;  4HFK B;  3QTC A;  3HKE A;  3F5W C;  2QDO A;  1WPX A;  2ZXW B;  1XNR B;  3T4D A;  2YQY A;  5KHH A;  2VS0 A;  2QKA A;  4HBN A;  3EG9 B;  3CYO A;  1QSP A;  3KCY A;  3S3W A;  3E8G A;  4IB4 A;  3LDE A;  4LF5 O;  2QNL A;  3GWK C;  2D3O W;  1JPN A;  3ASN C;  5GON A;  5H5N A;  4UXN A;  1M2O A;  3FHD A;  3FDQ A;  5JQG A;  1D1B A;  5KHJ A;  1QR9 A;  3SGI A;  4W8P A;  4LF6 B;  1TUB A;  3ZJZ A;  3J80 N;  4YIO A;  4J7T A;  3LDC A;  1PCX A;  3QMK A;  4A2N B;  3K5L A;  3JCU Z;  4EHP A;  2IU0 A;  1TWA A;  4YHH B;  1SKV A;  1SZX A;  3T2M A;  5AC5 A;  3CHX A;  1J8M F;  1PNM A;  2OCC B;  2YEV B;  4LFB B;  3F7Y C;  1K04 A;  4JZA A;  4GKK B;  1VQ5 V;  1RPO A;  4J7J A;  1TUE B;  4BJ6 A;  1FMW A;  3T6B A;  2IJH A;  3LSS A;  4AHC A;  1N0N A;  1YIT V;  1YZC A;  2MK3 A;  1AR1 B;  2OCH A;  1H2G A;  4JUR I;  5KX5 A;  5K1P A;  1YVW A;  3LNM B;  5IJ9 B;  1X4T A;  2ZR3 A;  3H1L H;  5A6B A;  2AGA A;  2ZD9 A;  1MNE A;  4O2A A;  1UG7 A;  3DKA A;  2C2A A;  2ZCE A;  2AW9 A;  2JGD B;  4DUZ O;  1NT2 B;  1FJG O;  1YZA A;  5L3F A;  1V4A A;  1PNK A;  4Q7C A;  4IAO A;  3W7X A;  4D4X A;  3LSU A;  2ZDI C;  1UPG A;  5LXT B;  2W6J G;  3ZC4 A;  3LEV A;  4B7E A;  3KKY A;  4WGY A;  2V4D A;  3SYP A;  2EPM X;  3H65 A;  1YJ9 V;  4ONS A;  1QQC A;  2WPD G;  4O4J B;  1IBL O;  5JS5 A;  4LF7 O;  2EIL C;  4FAP B;  1YYX A;  2JIZ G;  1COW G;  4PA7 A;  5J2U B;  1GN4 A;  1CGN A;  2CTP A;  2ZE6 A;  3S29 A;  1AVO B;  1LNQ A;  4U3J A;  1A7V A;  4L6R A;  4JI4 O;  1M56 C;  3CCM V;  3ZIB A;  1NVP B;  1GN3 A;  2B9Z A;  1ZTE A;  3MD0 A;  3JSE O;  4J42 A;  2XAF A;  2XS8 A;  4DV7 O;  2NPU A;  2WA3 A;  4JV5 O;  4R8C A;  2LJ2 A;  4U5B E;  3OEO A;  3PDM P;  4OX9 B;  3VQY A;  2YL1 A;  3HKC B;  4J9Z B;  4JI3 B;  5JUA A;  2PTM A;  4LFA B;  1R3L C;  3ABU A;  1ZL8 B;  4YT2 A;  5E33 A;  4X1K B;  2ZXP A;  2YI8 A;  1P4R A;  5B1B C;  3ZHS A;  4EKW A;  3WHN A;  2YRF A;  2R70 A;  3JAS A;  1NU9 C;  3AG3 B;  2NSG A;  3V5X A;  4G2K A;  1QPU A;  4O79 A;  2UU9 B;  1IZM A;  5DVW A;  3T6J A;  4C3B A;  2A9H A;  4YT8 A;  3FAV A;  4U5G A;  2R7U A;  2UXN A;  1B06 A;  3IPM O;  4MW8 A;  3MYI A;  1R6T A;  4HNA A;  2JEU A;  4IL6 Z;  2PZS A;  2JEX A;  3OW2 U;  4GLX A;  4X0R A;  4XQ1 A;  1XMQ B;  2XOK G;  3ICX A;  3FVY A;  3JT1 A;  3RVY A;  2LFS A;  3ABL B;  3RYH B;  3GM3 A;  4JKV A;  3ZTZ A;  4BJ5 C;  1I5Y A;  4D6T H;  3NG1 A;  1U0B B;  2OJQ A;  4AX2 A;  1BL8 A;  3JD2 A;  4DR2 O;  1LUV A;  4MT8 A;  5FPO A;  2IJJ A;  2R25 A;  4HEA J;  3RN4 A;  3NMK A;  5C8Y B;  2RNB A;  1RCP A;  3DJU B;  3T1Y O;  4U3F H;  1NR1 A;  3DAG A;  3MX3 A;  1Y4C A;  5LP6 B;  4KHP O;  3ZN0 A;  3T4R A;  3EG9 A;  3UGP A;  5LYJ B;  3M4B A;  4KFM A;  2KC3 A;  4ER9 A;  1IX9 A;  3G4S V;  3RYL A;  1Z3I X;  3QG5 A;  3VBB A;  3I5P A;  1MA1 A;  5T3T A;  3WB1 A;  1BBH A;  4DR1 B;  1BHA A;  1QBZ A;  3JSL A;  3DI5 A;  3EHB B;  3FX7 A;  2IU3 A;  4K0K O;  4XEV A;  2HFI A;  2R03 A;  4UCU A;  3CCR V;  3AK1 A;  3DXR B;  2H3O A;  4I5S A;  4ULW A;  4JE9 A;  1IBK B;  3K06 A;  3ZRW B;  3B4S A;  4FLT A;  3WOD F;  2YEV A;  5L0I A;  3RFR A;  4FIP C;  3GAN A;  4BEM J;  3CCQ V;  3QVY A;  3ZED A;  4NR1 A;  2VWK A;  1OCZ B;  2Q4P A;  4JYY A;  1O87 A;  4I0X B;  2VB6 A;  2F22 A;  2RMK B;  1SZT A;  4PAC A;  1LKX A;  1XWJ A;  1S77 D;  4LNU B;  4E7S A;  5IJ9 A;  4IAR A;  1BMF G;  2QE9 A;  4MVM A;  2QWO B;  1PKX A;  2CNW A;  4ASU G;  2FTK A;  4A5U B;  5DS5 A;  2CYD A;  1V55 B;  5L0D A;  2YSU B;  1TFK B;  3B2E E;  3RF3 A;  4JI8 O;  1JA8 A;  5LXT A;  2E3C A;  4YT5 A;  4PD4 F;  2EIM B;  1JAF A;  3IQ5 A;  3CME V;  2ETS A;  2RDC A;  4X20 A;  1O5H A;  3JAW B;  3RQF A;  1NKD A;  4DV3 B;  1M6T A;  2A6H F;  4N4W A;  2DMX A;  5DQT A;  5CBG A;  3IEE A;  3AK3 A;  1VQL V;  4B3S B;  4O4J A;  1OCC B;  3SYA A;  1FXH A;  5J2U A;  2ZIN A;  1BZK A;  1D1A A;  1JVM A;  2L81 A;  1U6H A;  4NXM B;  2XAS A;  4EUK B;  1K73 W;  4ZLC A;  1KKC A;  2OEX A;  3B0V C;  2BTO A;  1L3P A;  3FB7 C;  1BSM A;  5CI9 A;  1Y67 A;  1YYJ A;  4I50 B;  4PI2 A;  3K3W A;  3G67 A;  3MHH C;  1Y66 A;  4AQY O;  2IH1 C;  1RKE B;  3TJ5 A;  2Y0P A;  3CMA V;  5L3B A;  1FMV A;  4LER A;  3JAK A;  1ENV A;  3SJC C;  3CPW U;  4CSA A;  2NR5 A;  1VYI A;  3Q6N A;  3R7C A;  1ZU4 A;  3B0U X;  1ZL8 A;  2UXC B;  4CS3 A;  1OQC A;  3K33 A;  5JP7 A;  2ATK C;  1KP2 A;  2X6A A;  1FKA O;  4DRX B;  1WA8 A;  4X1K A;  2P6V A;  1YHQ V;  3CWB H;  4B3R B;  1GMG A;  1BR4 A;  5K0I A;  5KAF Z;  4OIR F;  3HKD B;  5COF A;  1RJ9 B;  2WA4 A;  5DED A;  2DWE C;  1FNT c;  4NTB A;  2J0X A;  2ZE5 A;  1O9H A;  5A69 A;  1K05 A;  5DLJ A;  2XHB A;  2OQM A;  3FAP B;  1J8Y F;  1Q6I A;  1XBL A;  4CBC A;  1VTM P;  5CA1 A;  5BR8 B;  3JSZ A;  3PCV A;  4H4K C;  3SXK A;  3W8H A;  3VQX A;  3K1H A;  2R7T A;  2N74 A;  5LGN A;  1VQ6 V;  2XS1 A;  4XTK A;  2J9U A;  1XDC A;  2KSF A;  2Q7G A;  1GQA A;  4QJF B;  3MDS A;  4CDY A;  3FB6 C;  3IGA C;  4F4B A;  2VQE O;  3BPZ A;  4DV6 B;  1NFO A;  3C7J A;  5E3A A;  2FB5 A;  2VAS A;  5C8Y A;  1DF4 A;  4LF4 O;  1WAZ A;  2JS5 A;  2UXD B;  4DBR A;  3DMD A;  1VB5 A;  2LW7 A;  4JI5 O;  5LYJ A;  4NC3 A;  3ZBH A;  1I7F A;  1F23 A;  2PI4 A;  2E76 B;  1TKN A;  2Q69 A;  4PDM A;  1S72 V;  1Z5Z A;  3TJT A;  2WLI B;  2QWR B;  3LNR A;  2PNO A;  3FKS G;  1ZW2 A;  3WU2 Z;  2R7W A;  5JT4 A;  4DV5 B;  4ANJ A;  3D8C A;  5CA3 A;  2B0H A;  3ZIA G;  1OCR B;  3DXR A;  2Q9L A;  4IWB A;  2NUT A;  3P30 A;  5B3S C;  1HP8 A;  4R50 A;  3TXS A;  4FWV A;  4EBB A;  3I5D A;  1P84 F;  2A79 B;  3EGX B;  2JGU A;  1EN4 A;  4DV4 B;  4BR6 A;  1MMG A;  5DM6 V;  3C63 A;  1HNX B;  4MVU A;  1NLX A;  2PX3 A;  3PJS K;  5IYD O;  2PYL A;  3C3S A;  4BIU A;  1F51 A;  3MYF A;  1NZ6 A;  1VMG A;  1H2L A;  2P4V A;  5TIS Z;  2ZXR A;  3K7D A;  5EIB C;  4FLZ A;  4IIJ A;  1XNR O;  5BZB A;  3DM9 B;  1L1F A;  2XAQ A;  1QLE B;  2ZE7 A;  4DYL A;  3JAW A;  1YAU O;  2Q7R A;  1YJN V;  4TQF A;  4FES A;  1R73 A;  1H2N A;  1LM3 B;  3L1M A;  3GEH A;  1TFO B;  1VQ9 V;  4CS8 C;  3AGT A;  1MNG A;  4LF6 O;  5GPG B;  3RYF A;  3DWW A;  1Y4M A;  3V5Y A;  2QWP B;  4DRH B;  3I4U A;  4MTF A;  1IDS A;  3O9O A;  2LSE A;  4JYA B;  1FXK B;  3JD0 A;  1H8E G;  3U3B A;  4YHH O;  4I9Q A;  2ZT9 B;  3TGU H;  1ZWI C;  4I50 A;  4LFB O;  3FYE B;  5BQH A;  1MQV A;  3ASO B;  4GKK O;  4UV9 A;  1ZHY A;  2YUA A;  1RKE A;  1XL6 A;  4YT4 A;  5H2F Z;  3WFV A;  4N23 A;  3TOL A;  1W59 A;  4TV8 B;  4IGG A;  4P9P A;  2NSF A;  1ORJ A;  5CB4 B;  2Y69 C;  4U9D A;  3JYH A;  1QZX A;  4N21 A;  4ZHQ A;  3JD3 A;  3AEI A;  3WG7 C;  2W4M A;  2YZS A;  1QU7 A;  4DRX A;  1G8X A;  1OR2 A;  1BR2 A;  4DVZ A;  1YSC A;  4QE9 A;  3HKD A;  2IOQ A;  1RJ9 A;  3A0R A;  2DW4 A;  4K8Z A;  3SYC A;  3LEO A;  3KYI A;  3ETE A;  4B3T B;  3HKE B;  2X6B A;  2P0N A;  3DC6 A;  4H44 B;  4O4H B;  4YK5 A;  4FM1 A;  2V7Q G;  3J06 A;  1PV3 A;  5FPR A;  3ZRV A;  3DE9 A;  3DJN B;  2G3K A;  4QPJ A;  1KP3 A;  1JQ0 A;  1WP7 A;  4AE4 A;  2DYR B;  1BE3 H;  2WLM A;  3NMI A;  4QDL A;  4P9O A;  3ZHV A;  3RQG A;  3ABK B;  1K4D C;  3ZMT A;  1EFR G;  4J7K A;  1C03 A;  1CPY A;  2DN9 A;  3CCL V;  4I3M A;  2C03 A;  2EZO A;  1CP9 A;  3X2Q C;  2FML A;  3SXM A;  2XLE A;  4B7K A;  1L8D A;  3W7T A;  1BQZ A;  2JPU A;  3JTL O;  2AVK A;  5KHI A;  2MW2 B;  4CIP A;  1K40 A;  2YWA A;  1BCC H;  1Q0D A;  2R02 A;  4OX9 O;  3L75 H;  4FLV A;  2Q7E A;  4JI3 O;  1W2W A;  3APQ A;  2ZIM A;  4OPA A;  4LFA O;  1ZW3 A;  4O2B B;  4NKG B;  1NU7 D;  3RWR D;  3AOU A;  3LNN A;  3EHM A;  4RQF A;  1Z6A A;  2X6C A;  3Q6M A;  4FPP A;  4ZOL B;  3AG2 B;  2J9W A;  2R7R A;  1QR8 A;  2ZPA A;  4EB6 B;  2YID A;  1EKY A;  3OAA G;  5B1A B;  2XRH A;  4JI2 B;  4H33 A;  3KCX A;  4X65 B;  2HV7 A;  2X0L A;  2UU9 O;  1M5I A;  3T1H B;  4NTX A;  3B0P A;  4WCE V;  5L3C A;  1D5A A;  5IE9 A;  4LLC A;  4DK1 A;  4FLU A;  3RYI A;  3KPH A;  1T01 A;  3IFX A;  2PP4 A;  4PA3 A;  1XMQ O;  2YS8 A;  3CX5 F;  3L72 H;  1M1K W;  3OGI B;  1LR1 A;  1MZE A;  3EZI A;  3K1I A;  4LDR A;  2JK5 C;  1UJW B;  2YL3 A;  2J9V A;  2X0C A;  3SP1 A;  2BOC C;  3K9A A;  4D7S A;  1AB3 A;  1I94 B;  5JLI A;  4I1M A;  1FTS A;  4UB8 Z;  4L8J A;  5IY5 B;  2GTA A;  2B5U A;  1XMO B;  3D3Q A;  5LBQ A;  1WJZ A;  4FM2 A;  1YI2 V;  4MVS A;  3M1C B;  3UMK A;  1I5N A;  3TQO A;  4AI8 A;  4U3J B;  4L87 A;  1SR2 A;  3GOR A;  1OXK A;  2P67 A;  1R6K A;  1TWG A;  1H2K A;  1TAE A;  4CS2 A;  3GWO A;  4E7Z A;  1IW7 F;  2XLD A;  1Q86 W;  4C3E A;  4LDQ A;  1MMN A;  1QNM A;  2P1A A;  1PD3 A;  4YIP A;  1T6U A;  2KW3 C;  2Z15 A;  3T1C A;  3H1H H;  1NTZ H;  2R7X A;  4X1I B;  2CGN A;  4FZ1 A;  2I8B A;  1SER A;  4DR1 O;  1ZYR F;  3EH2 A;  3G80 A;  3C8G D;  2HG5 C;  3SDL A;  1SQP H;  2HR3 A;  4JAU A;  2H8P C;  5B3I A;  1B6Q A;  2KG7 B;  3O10 A;  4PA9 A;  4XBF A;  1FXK A;  2EZP A;  2EPO A;  2HS5 A;  4N6H A;  1IBK O;  4RWU A;  2VRZ A;  2V1D A;  3HNL A;  3KZI Z;  3Q4H A;  3CB2 A;  4JJG A;  3DGE A;  3JAS B;  1JMW A;  5JSL A;  4IJJ A;  3K0G A;  4IYI A;  1GM7 A;  4BIZ A;  3S90 A;  2XLV A;  4AK9 A;  1G5Z A;  3HKB B;  2R05 A;  3VQW A;  2B1I A;  4TV8 A;  1J5E B;  1GM5 A;  3UR3 C;  3K59 A;  3T6G B;  2GFH A;  4DR5 B;  1ST6 A;  4JPR A;  4J7Y A;  1H7I A;  3FOO A;  1Q5O A;  2QR4 A;  5JJJ B;  5IT9 N;  5E1A C;  1ZVZ A;  3TD7 A;  2WZG A;  3MFN A;  4JZ2 A;  3CAX A;  1TA8 A;  2P22 C;  5DS6 A;  5BUO A;  5EBL C;  4PI0 A;  2PY5 A;  4BAY A;  1Z5V A;  4DV3 O;  4O4H A;  2F23 A;  1XRE A;  5LGU A;  1KQS U;  3HKK A;  1S3J A;  3U9M A;  1E2X A;  3ABM C;  1FAF A;  4B3S O;  3U8V A;  2GWW A;  1YEW A;  1BS3 A;  2EIL B;  1MSD A;  2LQT A;  1P7G A;  4NXM O;  3DC5 A;  4B3M B;  3UCS C;  4CBE A;  2OTL V;  3KH2 A;  3SZR A;  3DAF A;  1M56 B;  5A6K A;  4I1O B;  5D91 A;  1AJP A;  2XLH A;  2D4U A;  3C18 A;  3BRJ A;  2YXH A;  3RBZ A;  4MTX A;  3R65 A;  2CK3 G;  1LE4 A;  1RPR A;  2WB7 A;  1JR9 A;  4E0I A;  4LWS B;  4CH3 A;  2LK4 A;  4RUF A;  4I44 A;  4O4L B;  3UKM A;  5EC2 C;  1F4N A;  2R9R B;  4WFF A;  1V54 C;  5CA0 A;  4O2B A;  2KQ9 A;  2UXC O;  4MND A;  5GW7 A;  3CRR A;  1VAR A;  1DLB A;  3F46 A;  2L6F A;  3B77 A;  4B3R O;  2I15 A;  5LHG A;  4ZOL A;  5B1B B;  1RKC A;  2OJE D;  3ZMS A;  4EB6 A;  1ZHX A;  2H94 A;  3NKE A;  4MTO A;  5L3D A;  2VQF B;  5L3V A;  3C3T A;  4XPW A;  3AG1 C;  4TSF G;  4ZI7 A;  1E86 A;  5AG2 A;  4UCV A;  2HVK C;  5KLV H;  2Y0I A;  1U89 A;  2HHH B;  5EBW C;  4X66 B;  3U2L A;  3QO8 A;  2A6E F;  4U5E E;  4PA6 A;  5LGT A;  5BR8 O;  3ZDL A;  4DVY P;  2H7B A;  4RBN A;  5L3G A;  2PYJ A;  1VF6 A;  3FYI B;  2CE4 A;  1M90 W;  3BAA A;  2Q9A A;  4X20 B;  1IUR A;  2EIJ C;  4JI1 B;  1H2S B;  2XT9 A;  4X88 A;  3SYQ A;  1NJI W;  1LUW A;  4DV6 O;  1EI7 A;  5GTH Z;  2HSB A;  3KMI A;  3EXA A;  3L70 H;  2FFH A;  2H8A A;  1NTK H;  1OKK A;  3BY6 A;  2UXD O;  1OV9 A;  2EJ7 A;  3ABT A;  4YN0 B;  4KC9 A;  2EIK C;  3P3N A;  1HNZ B;  2ASR A;  2ZXW C;  2KYH A;  1EQ1 A;  4BJ1 A;  4IRU A;  5KYY A;  2AHY A;  2DQ0 A;  1E84 A;  2Z0A A;  4UDV A;  1EZV H;  4X1I A;  4FLX A;  2HVJ C;  2XL8 A;  4JYC A;  2XLM A;  5IJ0 B;  4QPK A;  2N04 A;  3JAK B;  1TGO A;  1NH2 D;  1YTF D;  3B29 A;  3H01 A;  4F6R B;  2F1M A;  2FL4 A;  3E86 A;  2KG7 A;  4DV5 O;  2IBF A;  3SNH A;  1CEZ A;  4G78 A;  2R7V A;  3F5T A;  4ZIB A;  5T3W A;  5JVE A;  2AWY A;  1WA8 B;  1C17 M;  3KYJ A;  5CMU A;  5IDJ A;  1SS3 A;  5KUK A;  5EIB D;  1AEP A;  1Y74 B;  3X1O A;  1TR2 A;  3A11 A;  4QI0 A;  4YL0 A;  1QVX A;  3OEE G;  3BRC A;  3HKB A;  2IM9 A;  4DV4 O;  3ZHQ A;  2DGJ A;  2QKS A;  4OIO F;  1H9G A;  2OU6 A;  1Q81 W;  2UXX A;  3EGD A;  2QKC A;  1N36 B;  1QCE A;  2NNU A;  5CA1 B;  1NS1 A;  5LHH A;  2OT5 A;  1KC8 W;  1QQ3 A;  3GEE A;  4LAC B;  1HNX O;  2Q00 A;  2V26 A;  3TOM A;  1OZ0 A;  4E0H A;  2HFE C;  2YIB D;  1VQ7 V;  1X59 A;  4MTG A;  1T5O A;  1F1M A;  4NTY A;  2MHR A;  2W0F C;  1O9G A;  1MSW D;  2QLA A;  3AG4 C;  4PFP A;  4DW1 A;  1IZ3 A;  1VQP V;  2QUP A;  1WPB A;  2ZDI A;  3R66 A;  4DJ9 A;  4PFO A;  2HLD G;  3IHU A;  1DOW A;  5F2V O;  5KMG A;  4FMT A;  4EEQ A;  2OEV A;  4HE8 D;  1PL0 A;  1XL4 A;  2JJ2 G;  1WLE A;  2GSM B;  3D36 C;  4R6Z A;  5T1D B;  4CH6 A;  1FAP B;  1GM8 A;  2YKZ A;  1YA7 O;  1N33 B;  1SET A;  4JW1 A;  3RYC A;  4JF3 A;  1RM1 B;  3A9C A;  5J9P C;  4JYA O;  2Q73 A;  2IXO A;  4QNH B;  3S9O A;  2HV6 A;  3M8A A;  5BQG A;  4NCQ A;  4YL3 A;  3OTF A;  4BPM A;  2XM0 A;  1H9T A;  3PN1 A;  3A2F A;  2NUT B;  1RXQ A;  1R4T A;  4H54 A;  3TJ6 A;  3BVO A;  5LHI A;  1QVF U;  4LWS A;  4OD4 A;  4HAM A;  3U0C A;  1FFT C;  2UUC B;  4O4L A;  2JX0 A;  1JX9 A;  1QKR A;  1XIL A;  1AR5 A;  4TUY A;  3ZX6 A;  2HJD A;  3FD9 A;  3IC7 A;  5BY1 A;  4NXN B;  1XNQ B;  2HMZ A;  5HFM A;  4XPX A;  1MG1 A;  3EFF K;  2YI9 A;  3C62 A;  1VLS A;  1D1C A;  1VQK V;  4FFK A;  3FB5 C;  2L35 A;  2JRI A;  4B3T O;  4JI7 B;  4UV8 A;  2CGO A;  5DQZ A;  4IIJ B;  4W4K A;  3JAL B;  2XXA B;  3OUF A;  4QIW F;  3NMJ A;  3L8I A;  4XLP F;  3GWN A;  1Q3E A;  3NYJ A;  2ETN A;  2OG2 A;  1OW8 A;  1QHT A;  3U9J A;  4BJ5 A;  1EA8 A;  4X9Q A;  2AU5 A;  5D5P A;  2WZL A;  3O55 A;  3A0B Z;  1TWC A;  3CRM A;  2HJ3 A;  3RYF B;  4LDK A;  3H2U A;  1VOM A;  4Z9I A;  2XL4 A;  3BEH A;  2O9X A;  1HR0 B;  1Y6D A;  1VIB A;  1EM1 A;  3ZRX A;  1Q0M A;  3EH1 A;  4IT5 A;  1G8M A;  1NU1 H;  2QM7 A;  4AL0 A;  2E74 B;  1C02 A;  4O6N A;  5LP6 C;  3W4Y A;  4NTF A;  1EN5 A;  4IYH A;  5HFL A;  4ABM A;  3PMR A;  3QNE A;  1BDJ B;  3GM1 A;  5FZT A;  1GN2 A;  5IJ0 A;  4KNV A;  4CS9 C;  4PJN A;  2LCH A;  4F6R A;  4G0H A;  5H6R A;  4C3D A;  1MND A;  1E85 A;  4ZHQ B;  2K9P A;  4JI2 O;  4X65 O;  5EGY A;  1AVM A;  5HV9 A;  5BXZ A;  2LFD A;  4I9W A;  5JCO C;  2OOC A;  2Y39 A;  4WGZ A;  4AIL C;  1PV0 A;  3T1H O;  1M57 B;  1HE9 A;  4CIH A;  1S76 D;  2O57 A;  3EFO A;  1Y74 A;  5B3S B;  5LMU B;  2E87 A;  4PJJ A;  4E18 A;  4PJL A;  5E2Q A;  4CH4 A;  2AZ2 A;  2CDQ A;  5FL7 G;  4JEB A;  3ZN1 A;  3RGB A;  1SQQ H;  4WBN A;  1NR7 A;  3BCC H;  1OJH A;  4J32 B;  1FFH A;  1I94 O;  5F5H A;  2CGE A;  1BGY H;  2Z5U A;  4LP8 A;  1K92 A;  4GX2 A;  2ADP A;  1ZHW A;  1VQ4 V;  3QVZ A;  1K34 A;  3K66 A;  1GM9 A;  1XMO O;  2YIA A;  3SYO A;  4AE4 B;  3DD7 A;  2BE5 F;  4YJW A;  2J9B A;  2Y3H A;  3JCZ A;  3OM3 B;  2YLG A;  1WB7 A;  2V3C C;  5LOV B;  2VCA A;  1V55 C;  2QM8 A;  2Q0A A;  3OEH G;  1S05 A;  2A7W A;  3AJM A;  4TV9 A;  4CX9 A;  4LF9 B;  1FPO A;  1NI8 A;  4PDV A;  1XHZ A;  1NBB A;  2EIM C;  2WVN A;  1ZX3 A;  2GA0 A;  5LMN B;  3THO A;  2J7P D;  3K04 A;  4RUE A;  4ZKI A;  4LFC B;  3OA1 A;  4K0D A;  5EC1 C;  1OCC C;  1VEW A;  2Q5Z A;  4I4T B;  1WWP A;  3LS0 A;  4N6C A;  2ITC C;  4FK5 C;  1US6 A;  1K9M W;  4RDA A;  1JFF A;  4BWA A;  1KBH A;  2YXY A;  4NTW A;  2WLL B;  1H8H G;  4LC1 A;  1J5E O;  3CRC A;  1MZF A;  1K8A W;  3POV A;  3I5Q A;  2WLJ A;  3RYI B;  5KYN A;  3IJ4 A;  2Y69 B;  5F5F A;  1Q7Y W;  1Y76 A;  3EPV A;  1XQ8 A;  4DR5 O;  1ZUQ A;  1OCO B;  3STZ C;  1WN7 A;  2XSE A;  2HSQ A;  2KB1 A;  1NG1 A;  1E83 A;  1WP8 A;  4WAB A;  1AP6 A;  2ZIO A;  2HEP A;  1B04 A;  1IVS A;  2DB4 A;  3K0D A;  1V9P A;  3CS5 A;  4DRJ B;  3JAL A;  1R3J C;  2XXA A;  3EHN A;  4GQH A;  1KU2 A;  4E17 A;  2F95 B;  3VM6 A;  3SJB C;  3S0X A;  1SRY A;  1N1C A;  4B3M O;  2W4B A;  1CGO A;  1KTM A;  4OXS A;  3VF0 A;  4D4N A;  3K58 A;  2G38 A;  4DW0 A;  3F47 A;  2LO1 A;  2NLJ C;  4YJ2 B;  4G7O F;  3X2Q B;  3JAT B;  1LE2 A;  2Q3T A;  5CBH A;  5F28 E;  1CXZ B;  2OTJ V;  1EZJ A;  1SF8 A;  4WFE A;  2P7T C;  3Q4H B;  2ZNI A;  1GH6 A;  1THZ A;  3ETQ A;  1T9K A;  3ECS A;  1SQF A;  3CP1 A;  3UO3 A;  3H1J H;  1VYK A;  4NQF A;  2QTV A;  1PPJ H;  3OMI B;  2J8W A;  1E1R G;  4DR3 B;  3CSX A;  4R7C A;  2E5L B;  1VQ8 V;  5A2Q N;  1PP9 H;  2PGG A;  2R9I A;  5ITZ B;  3SR2 C;  2VQF O;  3EQL F;  3HNK A;  3CD6 V;  2P61 A;  1RSO A;  3CC2 V;  2WAM A;  3N2K B;  3D3I A;  2HHH O;  2ZKO A;  4X66 O;  4JRZ A;  1XOU A;  5KYX A;  4Q5S F;  3DXJ F;  2M64 A;  1KEC A;  4FLY A;  2L6H A;  2GTS A;  3S3X A;  1Z2G A;  2W0X A;  4FLW A;  2XLW A;  4JI1 O;  2XM4 A;  3CZ6 A;  1K7D A;  4YXW G;  4DV2 B;  3C90 A;  3G71 V;  4YY3 B;  5EBM C;  3IQT A;  1WOL A;  2QSA A;  1AR4 A;  2XAG A;  3NYM A;  3UNG C;  2DWD C;  5BMV B;  4K7B A;  2YXL A;  2QTS A;  1KKD A;  4X64 B;  3UO2 A;  5LOV A;  1YDX A;  1HNZ O;  2L6L A;  4X62 B;  5EYP B;  2R7Q A;  1KMI Z;  1XEQ A;  1HMO A;  4J7Z A;  5EZY B;  4HFF B;  4DO2 A;  5FCL A;  4HYO A;  1S5L Z;  3HLZ A;  5COG A;  3V5Z A;  5HSW A;  2E75 B;  2Y4T A;  4XDL A;  1N0J A;  4JZG A;  5CA0 B;  4CS8 A;  3QF7 A;  3ITF A;  3NDB B;  3NXS A;  2DYS C;  3VQV A;  1R3K C;  3N2G A;  4I4T A;  1LS1 A;  1YA9 A;  1F4M A;  1GAX A;  1B3Q A;  3L0I A;  2JVD A;  3RH3 A;  3MLG A;  1AI7 A;  5FLX N;  1ORY A;  3RW0 A;  2CNW D;  2CW0 F;  2KKW A;  2JDI G;  2EIN C;  2KGO A;  2ILM A;  1BHB A;  1GTO A;  2IXM A;  2WLL A;  2GDS A;  1AI5 A;  4ZI7 B;  1IXB A;  2B1G A;  4UUJ C;  3ASO C;  1WN0 A;  3ML0 A;  3W7U A;  1APC A;  1TQG A;  1N36 O;  3ZWI A;  3ZMV A;  3IQC A;  3ZG1 A;  1VK5 A;  2NN4 A;  3TK1 A;  2FYU H;  1VQM V;  3ZHT A;  1G4W R;  3N0T A;  2WLN A;  2ZNJ A;  2F4V B;  2CTQ A;  3RFY A;  5JRA A;  3CCV V;  2CDY A;  2OIG A;  3N27 A;  5H6Q A;  5CI8 A;  3J81 N;  3RQE A;  4GZR B;  1MMD A;  4EIY A;  1NVP D;  3L71 H;  4BW9 A;  3CRQ A;  5DN6 G;  2RSE B;  4JYB A;  3W2W A;  4PJ0 Z;  3AQC A;  1IBM B;  2QY9 A;  1PD1 A;  2A0B A;  1N8R W;  3L73 H;  1K33 A;  2YLD A;  3ABM B;  3LDD A;  4FFB A;  1N33 O;  2L6G A;  2A06 H;  4JTC B;  5KYY B;  5L3Q A;  3ASN B;  4O4I B;  4FM0 A;  2L9J A;  2DYR C;  1CGM E;  2B0J A;  1EN6 A;  4TT3 G;  2W6I G;  4BIO A;  1RMV A;  4J11 A;  1I08 A;  2QTO A;  4YJ2 A;  3JAT A;  4UVB A;  1HNW B;  1HY5 A;  1OW6 A;  3E8F A;  1SES A;  4JI6 B;  2BSK B;  4O7G A;  4BEJ A;  3J7A U;  1ZZP A;  1URF A;  3LLK A;  4DUY B;  1BT8 A;  2UUC O;  2A69 F;  2GAQ A;  4G27 B;  3Q7G A;  5IWA B;  3HTK C;  4EWC A;  1V54 B;  3LUT B;  2A68 F;  5GTI Z;  4IAQ A;  4I7Z B;  3G6B A;  5C93 A;  2PBE A;  4BJ6 C;  4NXN O;  1XNQ O;  2H7V C;  3EGD B;  3RIP A;  3EJN A;  5J2T B;  1PL4 A;  1P49 A;  3ZS8 C;  2IBZ H;  2ODM A;  5ITZ A;  5KYU B;  2Z3Y A;  4JAA A;  2EUL A;  3IC9 A;  3SPI A;  2UXB B;  3ZMZ A;  4PHZ A;  3BAB A;  3AG1 B;  1SMY F;  5B1A C;  4JI7 O;  4GYC B;  5KUM A;  3K57 A;  3N2K A;  1FXV A;  1RP3 B;  2Q8V A;  2QM4 A;  2TMV P;  1YIJ V;  2G3V A;  4CC6 A;  1V74 B;  3UQ8 A;  2WWW A;  2XLO A;  3B71 A;  3R2P A;  4B08 A;  1GKF A;  4YJ3 B;  1R1B A;  4CDV A;  4DV0 B;  3JAR B;  5KMG B;  4Z9J A;  3FXH A;  3QW0 A;  2EIJ B;  1NZE A;  2RN9 A;  1QVG U;  2NUP B;  1K5S A;  4MVR A;  1JMK C;  4J10 A;  1S0V A;  4TOI A;  4P9F A;  3RYC B;  5BMV A;  2IH3 C;  1KYO F;  4K35 A;  5JWP A;  3CE2 A;  4A4A A;  1L0L H;  1N32 B;  1K4C C;  4UCO A;  2UUA B;  1PD0 A;  3A8T A;  1HR0 O;  2D2C B;  2UUI A;  3DE8 A;  3OTO B;  2CH7 A;  3U2M A;  1RFY A;  4XWJ A;  2EIK B;  5EYP A;  4EFE A;  2GV9 A;  4KBL A;  1K97 A;  5EZY A;  1D0Z A;  4O6Y A;  3JSN A;  1A7E A;  1W2B U;  2HUJ A;  4JI0 B;  2UUH A;  1Q90 D;  2HZ8 A;  4CS7 A;  3B8N A;  1SQX H;  4TUY B;  1GK9 A;  3RT3 C;  4DXW A;  1D0Y A;  2R7O A;  2VH3 A;  4Z2W A;  2HKO A;  3NYL A;  4GEH A;  5LMU O;  4DR6 B;  2LD6 A;  5L3E A;  4JIO A;  1ROP A;  3E22 B;  1DK1 A;  4OIP F;  1YDI A;  2K1E A;  1Q0G A;  4DV1 B;  3JCU Q;  2BE3 A;  1VF7 A;  3L8J A;  3W7S A;  4LLE A;  1T6Q A;  1SC5 B;  2J7P A;  2BTQ A;  4MSW C; 
#chains in the Genus database with same CATH homology
 4MS2 A;  3FB5 C;  3SPH A;  4UV8 A;  3OUF A;  4QIW F;  5DM6 V;  3AG4 B;  4MVU A;  3PJS K;  4GT1 A;  5IYD O;  4WFG A;  3SPJ A;  4BIU A;  1F51 A;  1I5X A;  2LP7 A;  3LSQ A;  5BZB A;  1L1F A;  2XAQ A;  1QLE B;  3OFN G;  3ZCC A;  4U7N A;  3OMN B;  3E89 A;  2ITD C;  4GX0 A;  3ABK C;  1YJN V;  3BEH A;  1ORQ C;  1R73 A;  4KUM A;  4GX5 A;  3ZRX A;  1VQ9 V;  1G8M A;  2QM7 A;  1Y4M A;  4MTF A;  2Y48 A;  2GHY A;  5HFL A;  1FXK B;  3CCJ V;  3JD0 A;  1H8E G;  3QNE A;  1ARO P;  1DF5 A;  1AI6 A;  3DTU B;  3P32 A;  1ZWI C;  2P6J A;  4Z1M G;  3CC7 V;  3FYE B;  5H6R A;  4MVQ A;  3ASO B;  1FFT B;  5IYC O;  4UV9 A;  3M99 B;  4JAV A;  1XL6 A;  4H37 A;  4FJC C;  4I9W A;  2OCC C;  3AG2 C;  4N23 A;  3WFV A;  2IJK A;  4P9P A;  1M57 B;  1W0K G;  3JD4 A;  2Y69 C;  1S76 D;  5B3S B;  5IYB O;  4N21 A;  1JPX A;  3JD3 A;  3AEI A;  3WG7 C;  4X89 A;  3W7W A;  1K3E A;  5FL7 G;  4X8A A;  3ZN1 A;  2A0L A;  1NR7 A;  1R3I C;  2BOB C;  1YSC A;  4QE9 A;  2Z5U A;  3A0R A;  4LP8 A;  1K92 A;  2DW4 A;  4GX2 A;  4UVA A;  3E2E A;  3SYC A;  1VQ4 V;  1K34 A;  1GM9 A;  3ETE A;  3OMA B;  3SYO A;  5EK0 A;  2X6B A;  4MVO A;  3JYC A;  1OHH G;  2V7Q G;  4QE7 A;  3JCZ A;  3OM3 B;  5IY5 C;  3FB8 C;  3ZRV A;  1V55 C;  2EBO A;  2QM8 A;  4BW5 A;  3OEH G;  1DTO A;  4PDR A;  1KP3 A;  4QPJ A;  3TET A;  1JQ0 A;  1PNL A;  2DYR B;  3F5W C;  3ETD A;  2QA4 V;  2WLM A;  1WPX A;  4PDV A;  2ZXW B;  3T4D A;  2EIM C;  4P9O A;  3CYO A;  2Q68 A;  3ABK B;  1K4D C;  3ZMT A;  1EFR G;  1CPY A;  3CCL V;  3E8G A;  2EZO A;  1CP9 A;  3X2Q C;  3CXC U;  3LDE A;  3K04 A;  1AI4 A;  2D3O W;  4RUE A;  3ASN C;  4ZKI A;  4UXN A;  3W7T A;  5EC1 C;  1OCC C;  2ITC C;  1QR9 A;  4FK5 C;  3ZJZ A;  4RQE A;  3LDC A;  1K9M W;  4GCZ A;  3SJQ C;  2IU0 A;  3QO7 A;  4LCU C;  4F4L A;  2WLL B;  1H8H G;  3T2M A;  4RQF A;  4LC1 A;  2X6C A;  3K03 A;  1PNM A;  2OCC B;  2WLK A;  2YEV B;  3AG2 B;  3F7Y C;  4FPP A;  1K8A W;  1QR8 A;  1VQ5 V;  1RPO A;  2WLJ A;  1TUE B;  3OAA G;  5B1A B;  2Y69 B;  5CBF A;  4H33 A;  1Q7Y W;  1VQN V;  3SPC A;  2IJH A;  2X0L A;  3LSS A;  4P30 A;  3E83 A;  1YIT V;  1AJN A;  2MK3 A;  1OCO B;  1AR1 B;  3CC4 V;  3AG3 C;  3STZ C;  1H2G A;  4WCE V;  5L3C A;  4CZZ A;  3LNM B;  2KB1 A;  2ZR3 A;  1NBM G;  2ZD9 A;  3IFX A;  4PA3 A;  1MAB G;  2XAJ A;  2C2A A;  1M1K W;  2JK5 C;  1UJW B;  2BOC C;  1JOY A;  3K9A A;  5L3F A;  1PNK A;  3K0D A;  3W7X A;  1R3J C;  2ZDI C;  3ABL C;  1R6N A;  2QE7 G;  2W6J G;  4TWK A;  2B5U A;  5IY5 B;  5LBQ A;  1YI2 V;  4MVS A;  3SYP A;  1NQT A;  1SRY A;  4L87 A;  1YJ9 V;  4OXS A;  2P67 A;  2WPD G;  1R6K A;  2ZQM A;  3GWO A;  4XDK A;  2EIL C;  1Q86 W;  2JIZ G;  1COW G;  3HPL C;  4PA7 A;  1PD3 A;  2NLJ C;  3D36 A;  3X2Q B;  3T1C A;  5CBH A;  1LNQ A;  4KP4 A;  2OTJ V;  4XDJ A;  1EZJ A;  1M56 C;  3ZRS A;  3CCM V;  4RO2 A;  1SER A;  1NVP B;  4WFE A;  4PA4 A;  3MD0 A;  2P7T C;  2HG5 C;  1THZ A;  2XAF A;  2HR3 A;  4JAU A;  1RM1 C;  2H8P C;  1G4Y B;  2M7W A;  3CCS V;  1B6Q A;  1M9N A;  3CP1 A;  4PA9 A;  4R8C A;  4XBF A;  1FXK A;  2EZP A;  1EBO A;  2V1D A;  3OMI B;  1E1R G;  3F7V C;  4J9Z B;  1J95 A;  1P7B A;  3DGE A;  4R7C A;  1R3L C;  3ABU A;  2LFR A;  3K0G A;  4BIZ A;  1GM7 A;  1VQ8 V;  2R9I A;  1GO3 F;  2B1I A;  5KA5 A;  1P4R A;  5B1B C;  3CD6 V;  3CC2 V;  4EKW A;  2WAM A;  3D3I A;  3AG3 B;  1OCZ C;  4G2K A;  1KEC A;  1NH2 B;  1YTF B;  1Q82 W;  2A9H A;  2AHZ A;  4JPR A;  2UXN A;  3MHS C;  4PDL A;  5E1A C;  2WLH A;  4MW8 A;  3OE7 G;  2JEU A;  1K7D A;  2JEX A;  4YXW G;  3OW2 U;  3G71 V;  2XOK G;  4LBE C;  5EBM C;  3RVY A;  2LFS A;  3ABL B;  2XAG A;  5EBL C;  1I5Y A;  2DWD C;  4BAY A;  1S5H C;  4HZ3 A;  5LGU A;  1KQS U;  2WSS G;  1BL8 A;  3JD2 A;  1KKD A;  4MT8 A;  1HWY A;  1S3J A;  3ABM C;  2IJJ A;  1E79 G;  2EIL B;  3CCE V;  1NR1 A;  3K08 A;  3ZN0 A;  4DO2 A;  2OTL V;  4HYO A;  4KFM A;  1M56 B;  4XDL A;  1AJP A;  3JD1 A;  3STL C;  3NXS A;  3ETG A;  3G4S V;  2DYS C;  3RBZ A;  1R3K C;  4MTX A;  3R65 A;  3VBB A;  1QLN A;  2CK3 G;  1RPR A;  1F4M A;  1BHA A;  4JTD B;  1AI7 A;  1QBZ A;  1E1Q G;  3EHB B;  4RUF A;  2IU3 A;  2IW5 A;  3KG2 A;  3RW0 A;  3UKM A;  3I55 V;  2JDI G;  5EC2 C;  1F4N A;  2EIN C;  2R9R B;  1V54 C;  4WFF A;  3CCR V;  1BHB A;  1GTO A;  4I5S A;  5GW7 A;  2WLL A;  1DLB A;  3WG7 B;  1AI5 A;  2B1G A;  3K06 A;  4Q20 A;  3ASO C;  3B77 A;  4UUJ C;  3ML0 A;  3ZRW B;  2YEV A;  5LHG A;  3W7U A;  2X7R B;  3GB7 C;  4FIP C;  5B1B B;  3UM7 A;  3ZMS A;  3ZMV A;  3CCQ V;  3OR7 C;  2H94 A;  3TK1 A;  4MTO A;  5L3D A;  1M57 C;  3T4Z A;  1OCZ B;  3AG1 C;  4TSF G;  1VQM V;  3HB3 B;  2WLN A;  3ZRW A;  2HVK C;  1SZT A;  1S77 D;  3E8H A;  4U7O A;  5EBW C;  3QO8 A;  1KD1 W;  3CCV V;  5B1O A;  4PA6 A;  1BMF G;  5LGT A;  4MVM A;  2DQ3 A;  1JJ2 U;  1PKX A;  5H6Q A;  4ASU G;  2FTK A;  5L3G A;  1V55 B;  3FYI B;  2YSU B;  1M90 W;  1MOF A;  1NVP D;  2EIJ C;  5DN6 G;  3E8B A;  4X88 A;  4JYB A;  3SYQ A;  1NJI W;  2IJI A;  1N8R W;  1FS0 G;  1K5Q A;  1K33 A;  2EIM B;  3ABM B;  3LDD A;  3CME V;  1NKD A;  4JTC B;  3BY6 A;  4P2Z A;  5CBG A;  3ASN B;  3OGC C;  1VQL V;  3OUS A;  1OCC B;  2DYR C;  3ABT A;  3SYA A;  1FXH A;  4TT3 G;  2EIK C;  2W6I G;  3TCU A;  2ZXW C;  1JVM A;  2QTO A;  2XAS A;  4WFA V;  4UVB A;  1K73 W;  2AHY A;  1SES A;  2DQ0 A;  3E8F A;  2HJF C;  2HVJ C;  3FB7 C;  4JYC A;  2DYS B;  4QPK A;  1NH2 D;  3SPG A;  1YTF D;  3H01 A;  3K3W A;  3MHH C;  1Y66 A;  3E86 A;  4G27 B;  4JGS A;  2IH1 C;  1CEZ A;  3ZMU A;  4WFH A;  2EIN B;  1V54 B;  3LUT B;  3CMA V;  5L3B A;  5C93 A;  1IXM A;  5CMU A;  1ENV A;  5IDJ A;  3CPW U;  5KUK A;  4G28 B;  1AJQ A;  1OCR C;  4RAI A;  5B1N A;  3OEE G;  2ATK C;  3OR6 C;  1KP2 A;  2F43 G;  2X6A A;  2Z3Y A;  3SPI A;  1YHQ V;  3ZMZ A;  2QKS A;  1GMG A;  3AG1 B;  1Q81 W;  2UXX A;  5B1A C;  3VOU A;  5KUM A;  4WF9 V;  1H38 A;  1FXV A;  1QCE A;  2NNU A;  1YIJ V;  5LHH A;  1KC8 W;  2OT5 A;  1OCO C;  2DWE C;  2WWW A;  1GKF A;  1OZ0 A;  2HFE C;  1VQ7 V;  4MTG A;  4PEL A;  2W0F C;  1MSW D;  3G6E V;  3AG4 C;  4CBC A;  2EIJ B;  1VQP V;  1QVG U;  1K5S A;  4MVR A;  5LGN A;  4WFB V;  3CCU V;  4JAS A;  1VQ6 V;  2ZDI A;  5H9C A;  1S0V A;  2HLD G;  2IH3 C;  2XAH A;  4FMT A;  1PL0 A;  1K4C C;  1XL4 A;  4GX1 A;  1QLE C;  1W0J G;  2Q6A A;  4QJF B;  3FB6 C;  2JJ2 G;  3IGA C;  1WLE A;  2GSM B;  4MW3 A;  4R6Z A;  1GM8 A;  1SET A;  1DF4 A;  2QEX V;  2EIK B;  4JF3 A;  1RM1 B;  5J9P C;  4JTA B;  1K97 A;  4MVZ A;  4QNH B;  3K79 A;  4UVC A;  1W2B U;  1F23 A;  1JCH A;  3E35 A;  1FXK C;  2PI4 A;  2Q69 A;  3RVZ A;  4PDM A;  1S72 V;  1YJW V;  2JJ1 G;  2PI5 A;  3B8N A;  4J9Y B;  2WLI B;  3I56 V;  1GK9 A;  3FKS G;  4DXW A;  5LHI A;  1VQO V;  1QVF U;  4E2L A;  4HAM A;  5KA6 A;  2HKO A;  1JX9 A;  2EJR A;  5CA3 A;  4ZBM A;  3ZIA G;  1OCR B;  5L3E A;  1ROP A;  2WLI A;  3P30 A;  3QO5 A;  2K1E A;  5B3S C;  3IC7 A;  5HFM A;  4R50 A;  1MG1 A;  3EFF K;  5CN0 A;  3W7S A;  2A79 B;  2Q67 A;  2P90 A;  2XND G;  1VQK V;  4MSW C;  2ZR2 A;  3B8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...