3BEHA

Structure of a bacterial cyclic nucleotide regulated ion channel
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
222
structure length
222
Chain Sequence
LRIYAPLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
molecule keywords Mll3241 protein
total genus 80
structure length 222
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3behA02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 3behA01
4JTCB 4PA7A 5BZBA 1M57C 4PDMA 1JVMA 2KB1A 3AG4C 3ASOC 3E8GA 4HZ3A 3GB7C 5B3SC 2ITCC 5B1BC 1J95A 2X6CA 1XL6A 2ITDC 2WLIA 4X88A 4MVSA 2WLLA 4G27B 5J9PC 3OUFA 4GX2A 5KUKA 2ZD9A 5EBLC 4GX1A 4MSWC 4MTOA 4MVQA 4PDVA 4TWKA 2W0FC 4LBEC 5E1AC 1KKDA 3OR7C 4X8AA 5CBFA 4PDRA 5EBMC 3WG7C 3F5WC 3SPCA 1OCZC 1R3JC 3E8BA 3K0GA 4QE9A 3ASNC 3T4DA 4WFGA 3ZJZA 3ABLC 3BEHA 3JYCA 3KG2A 3T1CA 2BOBC 3T2MA 2HVJC 3K08A 2X6BA 3AG2C 4PA3A 4J9ZB 3VOUA 2OCCC 5EK0A 3SYQA 4XDJA 3SYAA 4H37A 4OXSA 4WFEA 4KFMA 3R65A 4MW8A 3LNMB 4XDLA 3RBZA 5EBWC 4MVOA 2HJFC 3SYCA 2EILC 2IH3C 2YEVA 2EIJC 5B1AC 4MVRA 1ZWIC 3LDEA 1OCCC 3EFFK 2DYSC 4X89A 1V54C 3E8FA 4PA4A 2WLMA 2K1EA 3STLC 2Y69C 3RVYA 1QLEC 3TCUA 4LP8A 2JK5C 3LDCA 2HFEC 2HG5C 4UUJC 4J9YB 4GX5A 2AHZA 4PDLA 2HVKC 3T4ZA 3ABKC 4MVZA 3LUTB 2WLJA 5KUMA 1M56C 2NLJC 1R3IC 4JTAB 3F7VC 4LCUC 2BOCC 1R3LC 3IFXA 4CBCA 3AG1C 3UM7A 3ABMC 4QNHB 2Q69A 1XL4A 3FB8C 4WFFA 1P7BA 1R3KC 4H33A 2X6AA 4XDKA 3SJQC 3OGCC 3SPHA 4DXWA 5CBHA 3E89A 2WLIB 2H8PC 2EIKC 4WFHA 3X2QC 1S5HC 1G4YB 3FB5C 3K03A 4MS2A 4PA9A 4RUFA 5IY5C 3RW0A 3SYPA 1OCOC 2A0LA 2A9HA 3HPLC 4MVUA 4P9OA 3TETA 4G28B 2EINC 2QTOA 3E83A 4R6ZA 1OCRC 2WLKA 3FB6C 3SYOA 3RVZA 2DWDC 5EC1C 4EKWA 1K4DC 2R9RB 4R7CA 3SPGA 4MVMA 3OUSA 3K04A 4RO2A 4R8CA 5CBGA 3E86A 4F4LA 4R50A 2DWEC 1LNQA 2QKSA 3OR6C 3STZC 3AG3C 4JTDB 4P30A 4PA6A 4RAIA 4BW5A 1BL8A 2A79B 2Q6AA 2P7TC 3SPJA 3K06A 2DYRC 2WLLB 3LDDA 4HYOA 4P9PA 4RUEA 2ZXWC 4MW3A 4P2ZA 3FB7C 2WLHA 3K0DA 4ZBMA 3UKMA 4MTFA 1K4CC 4GX0A 2Q68A 2WLNA 1ORQC 3PJSK 3ZRSA 5EC2C 2AHYA 3IGAC 1V55C 3E8HA 4I9WA 3F7YC 3SPIA 2ATKC 4MTGA 2EIMC 4QE7A 2IH1C 2Q67A
chains in the Genus database with same CATH superfamily
3OGIB 2B9ZA 1KQSU 1GTOA 3CRAA 4B3RO 3ZWIA 1GMGA 1XQ8A 3B4SA 5KMGB 1VQ7V 1G4US 3AQCA 5EYPA 3BPZA 2F95B 1N0NA 1KC8W 1WASA 4CS2A 2PX0A 1SF9A 4NTXA 4HEAJ 3MAQA 4EBKA 3O65A 2VCCA 3MFNA 1YITV 5H9CA 3CCUV 3ABLC 1KBHA 4MNDA 1OCOB 1YZBA 2YLGA 3S9OA 2WWWA 4JI8B 2NSFA 2QLAA 3ZHQA 4I55A 2G3VA 2QM8A 2KNHA 3B77A 1I4ZA 1KKCA 4DR1O 3POVA 2M64A 1AB3A 4JYBA 2EIJC 4YXWG 3CD6V 4EFBA 1OCCC 2OJQA 5AC4A 1QHTA 1PNLA 5KHIA 2CNWD 3QW1A 4BEJA 4HBNA 1F4MA 3O9OA 2CTPA 1SQQH 1CGNA 2H94A 3K1IA 1M90W 4Z2WA 1EI7A 2F22A 4Z9IA 1WJZA 5D92A 3X2QC 4TQFA 3VQXA 2P61A 5T3WA 3QG5A 1ZAUA 4UVCA 4U5FE 4OD5A 1OCOC 3JAKB 1C17M 3H9VA 1Q43A 2R7OA 3E83A 2H3OA 3P3PA 2ODMA 3K57A 3RKOF 2C03A 5CA0A 1GM7A 1ZU4A 3SNHA 1SRYA 3K04A 3E22A 4TT3G 2ZIOA 4GT1A 3JSEO 3WU2Z 2E76B 4TOIA 2JJ1G 4Z1VA 4O7GA 3DM5A 2N74A 1M2VB 1GQAA 4JYAO 3FOPA 4KC9A 3U11A 4DV3B 3AGUA 4DUZO 2XASA 2IJKA 4CH5A 3EGXA 4IARA 4CZZA 3TXQA 2UXBB 1K33A 1KU2A 1SZXA 1ORQC 3FXHA 1H9GA 1TWAA 3IGAC 3R2PA 1XOUA 2ZM6B 1HW7A 2Q4PA 3R7CA 1CPYA 4LH6A 1Q81W 1MMNA 2R9AA 4X62O 4GEHA 5L0HA 3SP1A 4J11A 4K1OA 1QU7A 5L0FA 4JI0B 2WLIA 2DN9A 2Y0PA 2L35A 4EBBA 3JT1A 1NVPB 2ZNIA 4Q20A 4AILC 3DAGA 5E1AC 1SESA 2QWPB 4JI2B 2CW0F 4ICGA 2LIGA 3O39A 2NUTA 3SR2C 1B6QA 2IBFA 3K0GA 4FM0A 2Q0OC 4DR7B 4O4IB 2J46A 4QPKA 4DV5B 2QWRB 2BOBC 1LE2A 2YXLA 2OIEA 3VOUA 1B06A 3APOA 2KQ9A 4O2BB 3A2FA 3OD4A 3U2MA 4PJMA 4OX9O 3N2KA 1N8RW 3GEEA 2FTKA 2YEVA 5IWAO 3GWKC 3JCZA 5B1AB 1NI8A 5B1AC 4MVRA 1DF4A 3QZCA 1E83A 2DYSC 4M63A 2VQEO 2OOCA 4ULVA 2CGNA 3RVYA 2XHBA 2IJIA 3K58A 2HG5C 4GX5A 1XNRO 1VQ6V 1HW2A 3M79A 3DXRB 4DV6O 1K5SA 1FTSA 2EJ7A 4UVAA 1VB5A 2Q69A 3HNIA 4WFFA 1Z63A 1OW6A 1JAFA 4E7SA 1Q0GA 1G4WR 3IHUA 1CP9A 1F1MA 2UUBB 2QR4A 2Y4TA 1M1KW 2QTVA 1YZAA 3BY6A 3ZN1A 3SYPA 2HSQA 3P32A 1BR4A 2WZGA 5KAFZ 1W2WA 4DK1A 3EHNA 2YI9A 5A6JA 3RYIA 1WA8A 2NG1A 3CX5F 1VMAA 4I0XB 4PHZA 1ZVZA 2VCBA 4JI2O 1JR8A 2YXHA 1T6QA 1PD3A 2UUIA 1LUVA 4U7NA 2WVOA 2IU0A 1ZW3A 1LNQA 1Z7Qc 5B3SB 2NN4A 1Z5WA 2E87A 4EUKB 3C8GB 2CYDA 4U9EA 4DR4B 3W2WA 4LFBB 3DM9B 2P6VA 3H65A 1S05A 2HSBA 3SXYA 1RPOA 5IYBO 1T5EA 2DOSA 3BFRA 2OQMA 4GX0A 4K7BA 3CSKA 5KHKA 1G8XA 4KP4A 3B29A 1DGSA 1GK9A 1EFRG 4F6RA 2CGOA 2P6JA 4LLCA 2IH1C 2OWOA 4JI6O 2PX3A 3NKDA 3KL4A 4FWVA 1AI4A 2Q9BA 1XHZA 1JVMA 1YXBA 4NXNB 2KK1A 2XLVA 3E8GA 2Y3DA 1HNZB 2A1DD 3EG9A 2L7AA 4XLPF 1OCZB 4YJ3B 3ASOB 3CS5A 1EN5A 1TA8A 5DQTA 1VIBA 1JQ0A 1IURA 2YWAA 2CDQA 2QEXV 4TV9A 2JIZG 4JZ2A 4KBLA 5EZYB 4N21A 1ST6A 4N4WA 3B2EE 3JASA 3WODF 3JYCA 1RKCA 2XXAB 3DMDA 2Q9LA 2HVJC 3K33A 2Z15A 1Z5ZA 3M4BA 3VQYA 4BW9A 1RXQA 2AWCA 5LHGA 1R6TA 3N2GB 2GTSA 2A68F 2BTQB 2EIJB 4CBEA 1WN7A 1YVWA 3PHF2 3ETQA 2W6IG 1N32O 4B3SB 3KCXA 4X1YB 4FJCC 4LWSB 5GW7A 1TVKB 2BSKA 3T4ZA 3FAPB 3LLKA 2TMVP 1Q0KA 2Y48A 1ENVA 5KUMA 3FOOA 4YT2A 3IFXA 5IY5B 1FFHA 2Q7GA 4JZAA 3RQEA 4JAAA 3SYNA 1XL4A 3B8MA 2F4VO 3OMNB 3DTUB 4FLVA 3G6EV 4J7YA 3LSUA 5JP7A 1XMQO 2Q7HA 1FMVA 4XEKA 2Y4UA 4U5CE 2GUZB 4JEAA 1XI1A 4YJ2A 2EINC 3ABTA 5B66Z 1YCIA 4EKWA 5LMNO 3ZTZA 2R9RB 4X20B 1Q8IA 2XL6A 3GVMA 2QTSA 1RJ9A 2P67A 1IBLB 4Q7CA 3TULA 5HV9A 4LF6B 4OD4A 3C8ZA 5DECA 1K7DA 2LGWA 3HKEB 5IJ0B 5LHHA 2YVKA 2GDSA 1BE3H 4Z1MG 4JI5B 4X62B 4GKJB 3MBGA 4DV2O 1IX9A 1E1RG 2A6EF 4B7KA 1J5EB 3OMAB 4PV1B 4O4HA 4J7ZA 2LFDA 4JTCB 3ETDA 1NR7A 3NXSA 2W4MA 3ZSUA 4E0HA 3CEIA 2VASA 3W7XA 5TJ5E 1APCA 2RQ6A 5H6RA 4EHPA 4JI7B 4JV5O 5FL7G 3UGOA 3GEHA 5C8YA 5KUKA 2J8WA 3ZBHA 5BMVB 4CS8C 3G71V 2HJDA 3FD9A 5HFLA 3FAVA 2IBZH 4X0RA 4O79A 4NXNO 2NR5A 2E5LO 2X51A 4JGSA 4OIQF 4LWSA 3ZRWB 5H6QA 1XDCA 3S27A 4JJFA 4YL1A 2Q4FA 3T9OA 2JGUA 3CRQA 3P30A 2YIBA 4GKJO 4UCSA 1WB8A 3LNMB 1E2XA 3K6BA 2CTQA 1TAEA 2XS1A 1XHXA 4LF7O 4I50B 1I08A 2QGNA 3RYCB 1QLEC 3OTOB 1Q6UA 1YSCA 2N04A 2HHHB 1S7ZA 5B3IA 4J7JA 2WA3A 3G80A 3PMRA 2QE9A 2Q8VA 4I1OB 4WJ0A 1T9KA 3QVNA 1U96A 4FLXA 3SJQC 2LQGA 1P49A 2PUSA 1DTOA 1GRJA 1LI5A 2CAZC 5FNVB 3RYLA 3RYHB 4G7HF 4MVUA 2EX3A 1VQNV 1L7CA 2EPLX 3WB0A 2HV7A 1K92A 2WLKA 3VQWA 3L0IA 3EXAA 5JH7A 4DR3O 4RBNA 2VWJA 3N0TA 4KHPB 2DQ3A 2GDCA 2WVNA 4C3EA 2H7VC 5IDJA 3FX7A 1TWHA 3HKEA 3A9CA 2M4EA 5KHGA 1CPQA 4CIPA 1H2SB 4AK9A 4CX9A 5FCLA 2L6HA 3CCQV 5GPGB 4DR2O 2FL4A 5BR8B 3FAJA 4P9TA 5CA1A 3U5SA 1FAFA 2HJ3A 2L6GA 4L8JA 5JLIA 4JZGA 4H4KC 2BTOA 2P7TC 1YAUO 2ARHA 4DRJB 2DE0X 5BQIA 3FB7C 1OKKD 1NBMG 2R72A 1IXBA 1K4CC 4OX9B 2VQFO 4MQ9F 1VARA 3C18A 1TGOA 3GM1A 4DVZA 1Y4MA 3F7YC 1UFIA 2Q67A 2IU3A 4PDMA 3SDLA 1I5XA 4JI3B 2YLIA 4EB6B 3T6GB 2WLLA 1RPRA 3ATPA 5EBLC 1JPNA 1NR1A 1NZEA 3ZHRA 2X7RB 3ZEDA 1HNZO 1WPXA 1VQMV 4J7TA 1XNQO 4IAOA 1TWGA 4JI7O 3FYIB 4ASUG 2QNLA 1WPBA 3QNEA 2AGAA 4XPXA 4CSAA 4UDVA 4XBFA 1JX9A 1Q5OA 3LLIA 3R65A 4XDLA 1QVFU 5JVDB 5L3DA 3TD7A 3HB3B 1Q6HA 2HJFC 3A0BZ 5AGFA 3JARB 1IVSA 3L73H 2F1MA 4JCZA 3BHPA 5LGTA 3E8FA 5LA6B 3U10A 1XEQA 4JURI 2HFEC 1JFFB 1S5LZ 2XLOA 1HW1A 2OTJV 2XAQA 1D0YA 3SJBC 2CGEA 2FYUH 2HVKC 4PDLA 3J80N 4I1MA 2W4BA 2A3QA 1WN0A 1GM8A 4XWJA 3F7VC 1NTKH 3IEEA 2YZSA 5DM6V 1F51A 1VQKV 4OGQB 1NSGB 1EN6A 1FXHA 2HLDG 4X1KA 4RDAA 1R5ID 2WLIB 1R73A 2V4DA 3JSLA 4CDVA 1G5ZA 3ZDLA 2XAJA 2Y69B 4B3TB 2PBEA 5KYWB 4JIOA 4CS4A 4IHJB 1AEPA 4FM2A 4EFEA 3CRMA 4NR1A 4J32B 2PF4E 5A2QN 1XNQB 4X66O 3KYJA 4B3MB 3JD3A 1ZU5A 1QQ3A 1U0BB 2QM4A 2G38A 4HE8D 1PM9A 3G4ZA 4GUNA 3SGIA 2P06A 4JEBA 1H7IA 3F46A 2HZ8A 1V54B 2WLLB 2GWWA 4NTBA 5LP6C 1IXMA 1S0VA 1V9PA 2ZDIC 2JJ2G 4DJ9A 3RFYA 1RM1C 2WPDG 1ORSC 4YN0B 3L72H 3AOUA 1NS1A 2CCYA 4EBJA 3QVZA 5LHIA 2ATKC 3GWLA 2XAGA 2HJMA 3ZVRA 1GS9A 2PY5A 1PL4A 2I8BA 2LP7A 2LGQA 5KYNA 3UO3A 4DW1A 1Z5VA 3KKBA 4O6MA 3D36A 1SZIA 3NMKA 1FFTB 3ETGA 4DV1B 2DB4A 2P1AA 3QTHA 2EPOA 3ZMTA 1KKDA 1VP7A 1ZSPA 2CUGA 1KUQA 1RCPA 1L0NH 4CS9C 3BRCA 3MYIA 4HFKB 2HP8A 2O57A 3Q4HB 5LP6A 2LSEA 3JRMO 2A7WA 3BEHA 5D5QA 2X6BA 4E7ZA 3C8GD 1E1QG 1CEZA 4K0DA 1XWJA 2Z3YA 3RYFA 2E5LB 1PCXA 3L8JA 3MYFA 1KTMA 5L3VA 1IBKO 4UCUA 3RBZA 3DC6A 5ITZA 3MD0A 2L9JA 1FXVA 3S0XA 3JATB 4B3MO 1JMKC 2XM4A 4FLYA 3GANA 3RQFA 1F7YA 3HNLA 5LGUA 3RT3C 1COWG 3ZRVA 2LK4A 1M93A 4LF5B 2PZSA 3RYHA 2JRIA 1K5QA 1O5HA 5HSWA 5AG2A 3JYYA 3P3NA 4J30B 2JS5A 3CB2A 1R3IC 3K5OA 5B1OA 1M57B 4LCUC 4UXNA 5J2TB 1IBMB 2XL8A 3M8AA 1FAPB 1FPOA 4QNHB 1KP3A 1MSDA 3SPHA 1VEWA 3LEVA 4YL3A 4JCHA 3KPHA 2MYSA 3B0PA 5LOVB 2P4VA 3IQ6A 1FKAO 1Y6DA 1YDIA 1NH2B 5KYYB 4E17A 3FAVB 3L9DA 1SMYF 1UJWB 3TETA 1WB7A 1NU7D 3JRTA 4G28B 1ZX3A 1LE4A 2LFFA 4WFBV 5CI8A 4YJWA 3JAWB 1BMFG 3M4CA 1VF7A 1K9MW 4K0KB 2PP4A 4P9FA 5DQZA 1EA8A 4F6RB 2O9XA 1YTFB 3G6BA 4DUZB 2UUHA 4BIUA 2DJVA 4K8ZA 3HKBA 2AZ2A 1BL8A 2A79B 4X65O 4O6NA 2XS8A 1HNWB 3EH1A 2ZXWC 2PI4A 5T1DB 4X66B 2OCHA 2LFRA 4FPPA 1OW8A 3ZHVA 2JEXA 2AU5A 1K34A 2AHYA 1UPGA 1MNDA 4LFBO 4W4KA 3SPIA 2K9PA 3KCYA 1D1CA 4LFAB 4I4TB 4CS8A 3OA1A 1ZLZA 2QKAA 4Z9HA 4ZOLB 2BE3A 2IXMA 3C90A 4MT8A 2X6CA 2BL2A 2UU9B 4B08A 1YIJV 1DOWA 3I55V 1QVXA 3OUFA 1TWCA 2OJED 2YUAA 4UV8A 5IYDO 4MTOA 4YY3O 4TWKA 3DE8A 3WB2A 5AC5A 1ZHWA 1SQXH 4B7EA 4YIOA 1Z2GA 1JCHA 5EBMC 1S5JA 3ZJZA 4WFGA 3CCLV 1FFTC 5CB4B 2RD9A 4JW1A 4U5GA 2VRZA 3S90A 1L8DA 1B68A 2PNOA 2HEPA 3IC9A 4XDJA 5LMUO 1YLMA 2EIKB 2JGDB 4P6IC 5L0GA 5EBWC 1W59A 2CNWA 3DC5A 2D4UA 3Q7GA 4QI2A 1XNRB 1EM1A 2ZT9B 5L3CA 4DR6B 3AJMA 1K97A 1CXZB 3G4SV 1NQTA 1ORYA 1MA1A 2R03A 3TCUA 1NT2B 4DR2B 2MWQA 1HMOA 4BAYA 1M5IA 1JMWA 3ABKC 1LUWA 3LUTB 4AX2A 2NLJC 3OWTA 3W7WA 4JJGA 1R3LC 3CMAV 3QF7A 1HE1A 3OEEG 3ZHTA 2WVQA 1K73W 4YIPA 2FKXA 2VQFB 3PCVA 1OKKA 2J9BA 2XT9A 1NZ6A 4WF9V 1YVIA 1AP5A 1NBBA 1GM5A 5IY5C 5KA6A 2OCCB 4B3RB 3LSQA 4O4JB 3CCSV 4Q5SF 2RDCA 3MHSC 5DS6A 2CTRA 4FLTA 4UB8Z 4GCZA 1YDXA 5L0CA 4WGZA 4R7CA 2Q7EA 4YY3B 4O4JA 3N2KB 3AGTA 1P84F 2XAHA 1WTYA 3TQOA 1QBZA 1Q6IA 3DZAA 3NG1A 1US6A 3E35A 1RSOA 4U5EE 1OR3A 2F23A 2HMQA 1D2DA 3W8HA 4ER9A 4KUMA 4FLUA 1BHAA 2Q6AA 3ZHSA 2WZLA 3CPWU 4BG0A 3K06A 4NXMO 1D1BA 1RSOB 1QPUA 2XUMA 4P2ZA 4U7OA 4YJ3A 2W9YA 1VF5B 1AR4A 1FR0A 4GQHA 3LJBA 2EPMX 3C3SA 4CSAC 2UUCO 3ZMVA 4X64O 1I94B 4XLNF 1M2OA 3ZRWA 2L6FA 2YC0A 5CI9A 3DE9A 1G1XB 5L3EA 4LACB 4NKGB 256BA 4O2AB 1S72V 1FS0G 1PNKA 1KU9A 4DV0O 1KECA 2J9VA 3NYJA 3J81N 3B71A 1G6UA 1BQZA 3VF0A 3DJNB 4IL6Z 4NCQA 1DK1A 1IW7F 2YIDA 1NFOA 4MSWC 2Q9CA 2WL8A 2DYSB 3W7TA 4W8PA 3DGEA 3HNKA 4Q6GA 2ZNJA 3K59A 1L3PA 1YYJA 1IBKB 5L3GA 3ABUA 2L6LA 2RMKB 2H7BA 2J9WA 2VS0A 5EHHA 3AEIA 4JYYA 4FX5A 4QDLA 4I7ZB 2YDEA 1XZQA 2VC9A 3T1CA 3M99B 4NVPA 1SS3A 2R70A 3RH3A 3EZHA 1XREA 2MHRA 3TJ6A 4ZHQA 5EK0A 1SC5B 1Z6AA 1SZTA 1HNXB 4JI4O 4G0HA 1QLEB 1SQVH 3HKDA 4I9QA 4MW8A 2UUCB 1YF2A 1TFOB 3N2ZB 2RNBA 4D4XA 2QY9A 3ZX6A 4BWAA 1ORJA 1CGOA 3IQ5A 3EFOB 1NTMH 2OYQA 1V54C 3SJCC 1XBLA 4L87A 4HNAA 4E18A 4J9YB 4DV3O 5DN6G 1E86A 1AUEA 4BIZA 5GONB 2W0XA 5KHJA 3CAXA 4QPJA 1D5AA 3RYIB 2HMZA 1HWYA 4DVYP 3ZC4A 2DW4A 3OGCC 5CA1B 1H2GA 4WFHA 4R32A 2H8PC 1Q0MA 5EZYA 3H1LH 2P0NA 4PI0A 5JS5A 2YHSA 5A6BD 1KMIZ 4JI4B 4X1KB 2A0LA 4TV8B 2NUTB 3D3IA 4AI8A 1J8YF 2YQYA 3K7DA 1VMGA 4IGGA 1SETA 5LBQA 1AR5A 4X20A 1V55B 4MVMA 1WP8A 2KGOA 3DXRA 3T1YO 1AI6A 1VK5A 2RSEB 1P4RA 2DWEC 2QKSA 2IW5A 1BR2A 3JSZA 2KQXA 2ZE8A 5LMNB 4RQEA 4C7OB 3ABMB 4JTDB 1Y66A 4G2KA 2EJRA 5JQGA 1T6IA 3JSNA 4UVBA 2DI3A 1QKRA 3JD1A 1VYKA 2LFSA 1JJ2U 1I4YA 1YEWA 3B09A 5F2VO 1BZ4A 1Y76B 3TOMA 4JAUA 4X65B 5A6BA 1SA0B 2IJJA 2YL1A 1VQLV 5JRAA 1MG1A 4JYAB 4DBRA 1GGQA 1VQ4V 4CDAA 3FMSA 1Y74A 1EQ1A 1GN6A 1TUBB 3OEOA 1XL6A 1KP2A 5C8YB 4DRXA 4CH3A 4W8KA 4BJ6C 3EJNA 3I4UA 4JAVA 3N2GA 3G50A 4ZLCA 2V1DA 3OEHG 2QKCA 2Q9AA 1W0KG 4OPAA 1K40A 1HP8A 1Q7YW 3L70H 3ZMSA 3S3WA 3BA8A 3D36C 3ABKB 4KI2A 4DR1B 3AG2C 2KG7A 4PA3A 3RYCA 3E2EA 4JPRA 5A6AA 3ZMZA 2Z0AA 5E3AA 4IB4A 5FZTA 1BBHA 3IQCA 3LSSA 1HR0O 3WB1A 2YL3A 3JCUQ 1ZWIC 3EZIA 2WB7A 5F5HA 3JAKA 4JF3A 1IBLO 4J10A 4BR6A 2JDIG 3RGBA 5CA0B 5IWAB 1PL0A 3RN4A 1OCCB 2A0UA 3ICXA 1YZCA 4NQFA 3I5DA 2R7UA 4ZOLA 4FZ0A 1R3KC 2IJHA 2HUJA 4EEQA 4DUYO 2F66C 4FVMA 4EIYA 1J5EO 1BSMA 3EHMA 1A32A 4RUFA 1JJOA 4RQFA 4A4AA 3GWNA 3HNJA 2ZE7A 2NSGA 2P4KA 1FFXB 2I15A 3RVZA 1XMOO 2XLHA 1X4TA 3C62A 1N36B 2V26A 5IE9A 1NTZH 5JCOA 1Q82W 5CBGA 4ONSA 4F4LA 5L0IA 1FNTc 2PTMA 2Q5ZA 4AHCA 3VM6A 2QWQB 4ULWA 3B8NA 2M7WA 1PPJH 1AJQA 3IJ4A 3LS1A 1BCCH 5FNVA 1NG1A 2DYRC 3ZQYA 1KB9F 1SYQA 3JZ0A 1C03A 4DK0A 1B3QA 1Y76A 5EYPB 4MTFA 1FXKC 2R7WA 2XNDG 1K05A 3U9JA 1I7FA 2R25A 3H1JH 1YA9A 2J9UA 3KMIA 4DBQA 5EC2C 2BCCH 4JE9A 3E22B 3CRCA 2A0BA 3S3XA 3CRRA 3EGDB 4PJ0Z 1W0JG 4CJOA 4DRIB 3AG4C 3OTOO 1I94O 1NH2D 3GB7C 1PD0A 4N6HA 5JCOC 4QGPA 2ICWG 4W4LA 3PN1A 1HY5A 2XSEA 1JA8A 1HDJA 1TFKB 1T01A 1PKXA 2QDOA 3C3TA 3W7SA 1EBOA 4GX1A 2EPKX 4I5SA 2P90A 3JALB 4OIPF 2L81A 4JI1O 4PI2A 1VQOV 4YT5A 5DS4A 4PDRA 4DYLA 3WG7C 3E8BA 1AI7A 4NYKA 3T4DA 4IYIA 4KXRA 3GORA 4AL1A 4ZKIA 1R1BA 4O4IA 4MTXA 2N05A 5DS5A 1THZA 1ZHXA 5JT4A 3VAYA 3V5XA 3VYWA 1JOGA 2Y0IA 4PJLA 4JI5O 2XAFA 2W45A 5CA3A 3TXSA 2ETSA 1GO3F 2CH7A 2EIMB 3O55A 1RKEA 5GTIZ 1EZVH 4B6IA 1H38A 2KJGA 4NB5A 3ZQVA 4X89A 2K1EA 1N33B 2OKUA 2J0WA 4J41A 2AHZA 3DXJF 1A0BA 1Y6XA 2WLJA 5EIBD 1M56C 2ZPAA 5EGYA 2VQEB 2R05A 2C04A 3SEOA 1JPXA 2PYLA 1S3JA 1P7BA 2F93B 3OTFA 4H33A 4XDKA 1E79G 4DXWA 5CBHA 5IYZA 2ZKOA 5BXZA 3M1CB 4MS2A 4AQYO 4FLWA 4U3JB 3AG1B 1E84A 3HPLC 3JD2A 3L71H 3ASNB 1WA8B 2UUBO 1NVPD 4ZI7A 5EC1C 1IZMA 2KSDA 3K5MA 4ABMA 3I5QA 3OUSA 2FFHA 4LDRA 3K79A 5GONA 2GHYA 4UCVA 4X1YA 1S76D 3CXCU 1N32B 4I3MA 1LS4A 4YJ2B 1WOLA 1BQ0A 4N6CA 2QA4V 2PFDA 4K35A 2JVDA 3AK2A 3CZ6A 3V7OA 3SPJA 1RKEB 2UXDB 3BAAA 2E3CA 1GN4A 2Q73A 1PV3A 1YA7O 5K1PA 3K9AA 1LPEA 3UKMA 1TR2A 2ILMA 4DRXB 3GEIA 3Q6NA 3EH2A 2V3CC 4JI0O 3CCRV 3ZHUA 1Z23A 3KH2A 3E8HA 2J0XA 3SXZA 2FAPB 1OZ0A 3UNGC 4JYCA 4NC3A 2CE4A 3B0UX 4D4NA 3IC7A 2YEVB 1ZHYA 1FXKA 3W4YA 1BS3A 2JD3A 3G4XA 2KB1A 4LF9O 1NKDA 4CJGA 1WLEA 4DR7O 1QLNA 3BA9A 3ZTMA 5B1BC 1XUQA 5IYZB 4G27B 4GX2A 1OXKA 2VCAA 4BJ1A 3ZN0A 4X8AA 3H2UA 3T6JA 5FPRA 3SPCA 3ETEA 2R7QA 1OV9A 5BR8O 3QMKA 3K1IC 2XXAA 4GYTA 4FIPC 4E4EA 1D5NA 3CXHF 4J9ZB 2Q3TA 4YK5A 1MOFA 2OCCC 3BABA 3ZS8C 3ZMUA 2XM0A 4LFCB 2YSUB 3ECSA 5BMVA 4UCOA 4DV4O 4DV6B 5T3TA 3SYCA 1OXBA 1SKVA 4GLXA 1M2VA 3LDEA 2LCHA 2YL7A 4OINF 5KMGA 4U3FH 3I56V 3WAQA 4PA4A 4H0LB 5LOVA 3RWRD 4ZLDA 1O9GA 2A06H 5L0JA 3LDCA 3JCUZ 2YI8A 3OT7A 4U5HA 4DUYB 3A8TA 2X0CA 3ABLB 1ROPA 3WHNA 2QWOB 1BT8A 2YL0A 1UFBA 2BOCC 1FJGO 1LS1A 4HFFB 4D6TH 1N33O 1P7GA 2HHHO 2PI5A 1TUEB 2GA0A 4PR9A 3UMKA 3GWOA 1QSPA 3V5YA 5L3BA 2XTAA 4LF8B 4WABA 4BJ6A 4UCRA 2QTOA 4H44B 2B1GA 2YKZA 3FB6C 4UCTA 2ETNA 3IPMO 5JSLA 4AE4A 3RYFB 3H1KH 1K4DC 3HR0A 2KG7B 2J7PD 3BRJA 4FK5C 2NUPA 4IAQA 4QJFB 3STZC 3MX3A 3AG3C 3OMIB 4LLEA 4DV5O 1ZYRF 3IAYA 3FVYA 3KYIA 5IJ0A 3RF3A 1NU9C 2XLWA 1HNXO 3VBBA 1E85A 3US6A 5L3QA 1SERA 1AVOB 1BGYH 3D8CA 4DV4B 2Y3HA 3AK1A 4J80A 4ZBMA 4LFAO 2GFHA 2Q68A 2YXYA 1SQGA 2E74B 3LAYA 1R6NA 4O2AA 1H9TA 1LR1A 4XEVA 2D5RB 4C3BA 3N27A 1MQVA 5FLXN 4JI1B 1I5NA 1M57C 4JKVA 4IHJA 2AW9A 3OW2U 4B3SO 3ASOC 4WBNB 2UUAO 5CIVA 1XZPA 4YWQA 2ITCC 3WG7B 4ZIBA 2JS3A 2Q7RA 2VWKA 2W6JG 1TVKA 3QO7A 5JQGB 2ZCEA 5KYWA 4JI8O 4ZHQB 3BVOA 3F5WC 1VQ9V 1Q0DA 5L3FA 4QE9A 1MMAA 2F4VB 3L34A 4TUYA 2OU6A 1F23A 3LNNA 2CTWA 3AQBA 1ZL8B 4BJ5A 3HKBB 3K08A 3MLGA 2ZXWB 3J7AU 4FMTA 1LM3B 1SA0A 5H5NA 3U3FA 3AG3B 3SYQA 3EQLF 4RWUA 3Q6MA 4WFEA 4KFMA 1SF8A 1PV0A 1LI7A 2R7TA 2ZM6O 4FZ1A 2ZE6A 4GYCB 4K0KO 3NDBB 1Q0FA 1M56B 2WLMA 4CS3A 3ITFA 4NTAA 4TSFG 2OEXA 1CPRA 3EGDA 4QIWF 3GODA 2ASRA 4LF4O 1K3EA 2D3OW 3APQA 1H2NA 2YLDA 2ZXPA 1N0JA 3OE7G 4CBCA 1WP7A 3AG1C 1M6TA 4Q4ZF 2X6AA 3KKYA 3NR7A 3U0CA 4JC7A 3E89A 3DWWA 3LESA 3A0RA 4PELA 2OG2A 2ZDIA 4CH6A 4NTWA 1EKYA 1VQPV 3K1HA 5ITZB 2WZFA 1VF6A 2RCVA 3M7MX 1A7DA 3X2QB 2D2CB 1U6HA 3JATA 2DWDC 2LD6A 3DJUB 2IXOA 2DQ0A 3E86A 4GKKO 2QUPA 3TGUH 4K8XA 4G78A 1LKXA 3E70C 4DV2B 4B3TO 5DVWA 3JYHA 4DRHB 4P30A 5F5FA 4KHPO 2IM9A 4NTFA 4DV7B 3SXKA 1EN4A 1MMGA 4RUEA 2FGYA 2ZINA 1H2KA 4YT4A 1XILA 3O6XA 1AJPA 1O87A 2EULA 2V7QG 3W2VA 2NNUA 1RM1B 4JV5B 1WGWA 2UXDO 4MTGA 4BIOA 4QE7A 4PA7A 3QO8A 5BZBA 1ZHTA 1GH6A 1CGME 1Q90D 2A6HF 1IBMO 4MVSA 1MMDA 2YIBD 4DV0B 1RFYA 2W0FC 2HV6A 3OR7C 5A9GA 3CCVV 2C2AA 4WFAV 4C3DA 5A6KA 1Y4CA 3WFVA 4E2LA 3BCCH 5L0DA 2ADQB 4XPWA 4F4BA 2B0HA 4LF7B 3NYMA 4CS7A 2VH3A 2B1IA 1AP6A 3JD0A 3SYAA 1RJ9B 4PACA 4WGYA 4OXSA 2HS5A 4IYHA 3A11A 1AR1B 4I55B 2HKOA 4LNUB 1WATA 3ML0A 1PP9H 2EZPA 3NKEA 4PK4A 3DSQA 1Q3EA 3RFRA 2IH3C 3CQZA 4U9DA 5KYYA 4CC5A 3H1HH 4UFZA 3EFFK 1FJGB 1MMMA 4DO2A 4N23A 2GAQA 1VOMA 5KHHA 4KNWA 1QR9A 4YHHB 1JR9A 2MK3A 2OTLV 2A69F 2G3KA 4PFOA 2WA4A 4LF8O 4JTAB 1BR1A 2JPUA 1A41A 1KNYA 3Q4HA 4C7UA 5KYXB 4AL0A 3U9MA 4C7OA 1MABG 1SQBH 4LF4B 1SQPH 2GTAA 5B1BB 3O10A 1VLSA 2Y3BA 2A9HA 4IJJA 1YJGA 2EINB 1YJNV 2EZOA 2OIGA 3H2VA 4LF9B 2UXCB 1T6UA 4FESA 4CDYA 2EILB 3ZIBA 1YHQV 2MW2B 2HKVA 3B40A 2KW3C 5CMUA 3T1HB 2X0LA 3K5LA 1N34B 4TUYB 1RP3B 4LF5O 3K9SA 4J42A 5TISZ 3CCJV 3EFOA 5E3CA 4PA6A 4BW5A 1YTFD 2CK3G 3ZIAG 5JJEB 3B0VC 2GV9A 2Z5UA 4P9PA 1R4TA 2ZR3A 1MSWD 1GM9A 2XLMA 2WLHA 3UCSC 4LFCO 4DR4O 3DI5A 5F28E 2OT5A 3ZRSA 4U5DE 1M9NA 3CJHB 1ZTEA 1B04A 2AZ0A 5LYJB 4TQDA 1KYOF 5J2UA 5JUAA 3K3WA 4J7KA 5B1NA 5HFMA 3EVKA 3UT5B 1NLXA 5DLJA 2JGDA 5E79Z 1URFA 4HZ3A 3V5ZA 3CHXA 2IXNA 2VB6A 4X88A 1T5OA 2GSMB 5J9PC 2ZD9A 3HKDB 1NJIW 2EPNA 1YYXA 2R7VA 2Q00A 3IQTA 2E75B 2ZXOA 4I4TA 4CC6A 3NMJA 2R7RA 2NUPB 5IYCO 1O9HA 3DAFA 1OW7A 1WNSA 4FFKA 2CH7B 4L6RA 2XL4A 4H37A 1OQCA 1FMWA 1A7VA 4UV9A 1AVMA 4MVOA 2ZE5A 5BUOA 2B0JA 2WAMA 2EILC 1FD9A 2GUZA 3S28A 3JASB 2ZXRA 4YL0A 4K3AA 3S29A 3QTCA 3UGPA 3TJ5A 2Y69C 1YJWV 4LP8A 2JK5C 3FDQA 5D91A 4NXMB 1MNGA 4JRZA 2G62A 4G7OF 3ZG1A 1AROP 2BTQA 3ZCCA 5COMA 1Q86W 3UM7A 2FB5A 1QNMA 3L8IA 5B3SC 1JOYA 3U2LA 2KC3A 4DOZA 3H1IH 4DW0A 1PNMA 5COGA 1C02A 4U5BE 1BZKA 5GTHZ 4H54A 4QI0A 3K03A 3TOLA 4PA9A 1ZUQA 3FHDA 5FPOA 3JTLO 1QVGU 5BQGA 3CMEV 1YJ9V 2R02A 2R7XA 4P9OA 1L1FA 4IRUA 3MHHC 3I5PA 2YS8A 1IDSA 4JI3O 3JAWA 2QJ1A 3AK3A 4FFBB 3SPGA 1HE9A 3TK1A 3B9QA 3M15A 1MZFA 4UB6Z 4I44A 3UMHA 3VRCA 1L0LH 1TUBA 4D7SA 4X9QA 4IT5A 4R8CA 2KYHA 2IXPA 4R50A 5EIBC 4DV1O 2P22C 3OR6C 1YI2V 4F6EA 4ANJA 1FXKB 3W7UA 1FYJA 5LL6Y 2P7VA 3AG2B 3FKSG 2KKWA 2RJZA 3LDDA 4HYOA 2QE7G 4LNUA 1I0HA 4G7ZF 3JALA 4NTYA 4HNAB 4BJ5C 1JPJA 1HNWO 1WWPA 4XQ1A 3CSXA 1HR0B 2DMXA 3L74H 1D0XA 3PDMP 5LYJA 2LW1A 2EIMC 2KSFA 2IYLD 3SZRA 5JWPA 2J7PA 3D3QA 5JH7B 4O4LA 5IJ9A 5KX5B 2AP3A 5E33A 3DKAA 4IIJB 1DOVA 3CC4V 4PD4F 4LDKA 4JVSA 5LGNA 3JARA 3JAMN 1DLBA 1FFXA 4PFPA 2Y3GA 1H8EG 3F47A 1SR2A 1UG7A 3HKKA 1WAZA 4IIJA 4CIHA 4LBEC 3U0ZA 2EBOA 5J2TA 1MNEA 4BJTA 3HKCB 3U3BA 3LNRA 1OCZC 2GBOA 5KLVH 5LMUB 4OIOF 1J8MF 5CB4A 5JJNB 2LJ2A 3HKCA 1D0ZA 4E0IA 2UXBO 1GAXA 2AWYA 3LEOA 1KD1W 3OAAG 3OM3B 2NPUA 5BY1A 2PGGA 1QQCA 1GN2A 4NY3A 4RD9A 3ZRXA 1K04A 1OCRB 4FM1A 5J2UB 4FAPB 5D5PA 4UUJC 4CS9A 3HTKC 5KYUB 2DYRB 1NU1H 1VQ5V 1NFNA 2JX0A 4FFBA 4LERA 5K0IA 3U8VA 3TK0A 1VF6C 2AVKA 4O4LB 5KX5A 3UR3C 4FLZA 5LA6A 3AG7A 2EIKC 3EHBB 4I50A 5K1XA 1A7EA 1S5HC 3FB5C 4GZRB 2JEUA 4XPYA 3NRHA 3F5TA 3MDSA 3RW0A 2HFIA 4LR3A 3CYOA 3FFQA 1QR8A 1Y67A 3CC7V 4TV9B 2ZIMA 1LVKA 4R6ZA 1MZEA 2XRHA 1O3UA 4DR5B 1SQFA 5LXTB 5KA5A 4RO2A 3THOA 5KAIZ 3R66A 1JFFA 3E9VA 1Y74B 2FMLA 1H2LA 2Y39A 4IWBA 2R7SA 4DR3B 1HMDA 4XEFA 2M6YA 4LH7A 1H2MA 5E2QA 3W8IA 1F4NA 4PJJA 2UXXA 4X64B 4OIRF 4Z9JA 5JVDA 3K0DA 2CDYA 2QWNB 2WLNA 5JJJB 3L75H 1ZHZA 5KYUA 1V55C 2F43G 4PJNA 4WBNA 1BHBA 1VQ8V 2BE5F 1OR2A 3EG9B 5A69A 4A5UB 1XMQB 4DR6O 1M4UA 3SXMA 2XLDA 2ZQMA 1LIHA 1N4CA 2B5UA 2YIAA 4O4HB 1OJHA 3EGXB 4N06A 3LS0A 1J95A 4YT8A 1H8HG 2ITDC 3UMIA 1AILA 3L1MA 3X1OA 4YHHO 1XMOB 4ZI7B 3C63A 4MVQA 4LDQA 1TQGA 4PDVA 4X1IA 3A0HZ 1ZW2A 3K66A 1RMVA 1EZJA 2BC5A 3U8PA 4D7TA 5CBFA 4BPMA 2PYJA 4LC1A 1R3JC 3ASNC 3OFNG 4LF6O 3AG4B 3UO2A 1ZL8A 4X1IB 3KG2A 3T2MA 1VYIA 2LO1A 2QSAA 3UQ8A 4I0XA 4AQYB 2YICA 3HLZA 4H13B 2J45A 3JD4A 3GM2A 5CN0A 4JASA 1K8AW 2IOQA 4DR5O 2YRFA 3GM3A 1N36O 1AJNA 3UT5A 2H7OA 4EB6A 2UXCO 2H8AA 2QM7A 3EPVA 1Z3IX 4GKKB 3HJCA 4JI6B 4A2NB 1V74B 1U97A 2Q0AA 3TJTA 5LP6B 1W2BU 1VLTA 3CJHA 5COFA 3C8GA 4KNVA 5BQHA 4TV8A 3T1HO 1N34O 3STLC 4CH4A 3T6BA 4EWCA 5JVEA 3NMIA 3DD7A 3CP1A 4U3JA 1QZXA 3CCMV 5B5EZ 5C93A 4MVZA 2LP4A 1BDJB 3S84A 2HR3A 1ZZPA 2UU9O 2UXNA 4AE4B 3CC2V 3ABMC 2R9IA 3QO5A 3FB8C 3H01A 5DEDA 3CCEV 3RIPA 2RN9A 1G4YB 4BEMJ 2LQTA 3QW0A 2P5OA 2AXTZ 3N24A 1I5YA 5IJ9B 1R6KA 1N1CA 5LXTA 5IT9N 1TKNA 2OEVA 3Q7LA 3SJAC 1OHHG 1OCRC 3SYOA 4O2BA 3VQVA 2LW7A 4O6YA 4WCEV 3NYLA 3G67A 1X59A 3J06A 1S77D 3T4RA 1U89A 1H6GA 3KZIZ 1IZ3A 2ADPA 3K5NA 5H2FZ 1VTMP 3FYEB 1V4AA 4OPHA 4RAIA 3T1YB 2XOKG 1G8MA 1QCEA 1GN3A 2XLEA 3CWBH 3CE2A 5KYXA 4MW3A 1DF5A 1D1AA 4HAMA 3C7JA 3QVYA 2WSSG 3PJSK 1YARO 3RQGA 2ZR2A 1JRAA 1PD1A 1GKFA 4DV7O 2UUAB 2BSKB 1AI5A 4I9WA 2IM8A 4KL1A 2DGJA 3CEXA 4XTKA
chains in the Genus database with same CATH topology
4PA7A 3QO8A 5BZBA 1KQSU 1GTOA 2IU3A 4PDMA 1GMGA 1VQ7V 1I5XA 1KC8W 1XL6A 1KP2A 4MVSA 2WLLA 1RPRA 5EBLC 4JAVA 1NR1A 2X7RB 2V1DA 2W0FC 3OEHG 1W0KG 1WPXA 1VQMV 3OR7C 3CCVV 1Q7YW 2C2AA 4WFAV 1YITV 3ZMSA 5H9CA 3CCUV 3WFVA 4E2LA 3FYIB 4ASUG 3ABLC 3ABKB 1OCOB 3AG2C 4PA3A 3QNEA 2WWWA 4JPRA 3E2EA 3ZMZA 2B1IA 3JD0A 1JX9A 3SYAA 4XBFA 4OXSA 2QM8A 1AR1B 3B77A 2HKOA 3R65A 3LSSA 3ML0A 4XDLA 5L3DA 1QVFU 2EZPA 3HB3B 2HJFC 2IH3C 4JYBA 2EIJC 4YXWG 1ZWIC 3CD6V 1OCCC 3EFFK 4DO2A 4N23A 5LGTA 3E8FA 4JF3A 2HFEC 2JDIG 1QR9A 2XAQA 2OTJV 4PDLA 1PNLA 2HVKC 2MK3A 2OTLV 1GM8A 1PL0A 4JTAB 1OCCB 3F7VC 1F4MA 5DM6V 1F51A 1VQKV 2H94A 1M90W 1R3KC 2IJHA 1FXHA 2HLDG 2WLIB 1MABG 1R73A 3X2QC 5B1BB 4RUFA 4UVCA 4RQFA 1OCOC 2A9HA 2XAJA 2Y69B 2EINB 3E83A 1YJNV 2EZOA 3RVZA 2EILB 1GM7A 1SRYA 1YHQV 3K04A 1Q82W 4TT3G 5CBGA 4F4LA 5CMUA 2X0LA 3JD3A 4GT1A 3B8NA 3CCJV 2JJ1G 2M7WA 4PA6A 4BW5A 1YTFD 2CK3G 1AJQA 3ZIAG 2DYRC 1V54B 2WLLB 2Z5UA 4P9PA 2XASA 2ZR3A 2IJKA 1IXMA 1S0VA 2ZDIC 1MSWD 1GM9A 2JJ2G 2WLHA 4CZZA 1K33A 4MTFA 1FXKC 1RM1C 2WPDG 2XNDG 2OT5A 1ORQC 3ZRSA 1M9NA 5EC2C 3IGAC 5LHIA 2ATKC 2XAGA 1CPYA 3K3WA 5B1NA 5HFMA 1W0JG 1Q81W 2LP7A 3AG4C 4HZ3A 1NH2D 3GB7C 4X88A 2WLIA 3D36A 2GSMB 5J9PC 1PKXA 1FFTB 2ZD9A 3ETGA 3W7SA 1EBOA 4GX1A 1NVPB 4I5SA 2P90A 4Q20A 5E1AC 1SESA 3ZMTA 1KKDA 1NJIW 1VQOV 4PDRA 1B6QA 3WG7C 3E8BA 1AI7A 3K0GA 3T4DA 4ZKIA 4QPKA 3BEHA 2BOBC 4MTXA 5IYCO 2X6BA 3VOUA 1THZA 1E1QG 1CEZA 2Z3YA 4H37A 2XAFA 5CA3A 4UV9A 3RBZA 1N8RW 1GO3F 2FTKA 3MD0A 4MVOA 2EIMB 2WAMA 2EILC 2YEVA 1FXVA 3JCZA 5B1AB 5B1AC 4MVRA 1DF4A 1H38A 5LGUA 2DYSC 1COWG 4X89A 2K1EA 3ZRVA 2Y69C 3RVYA 1YJWV 4LP8A 2IJIA 2JK5C 2HG5C 4GX5A 1K5QA 2AHZA 1VQ6V 1K5SA 2WLJA 1M56C 1AROP 1R3IC 5B1OA 1M57B 4LCUC 4UXNA 3ZCCA 4UVAA 1Q86W 3UM7A 4QNHB 1JPXA 1KP3A 2Q69A 5B3SC 1S3JA 4WFFA 1P7BA 4H33A 4XDKA 3SPHA 1JOYA 1E79G 4DXWA 1PNMA 5CBHA 1CP9A 3K03A 4MS2A 4PA9A 1M1KW 3BY6A 3AG1B 3ZN1A 3SYPA 1NH2B 1QVGU 3P32A 3CMEV 1YJ9V 3HPLC 3JD2A 4P9OA 1L1FA 1UJWB 3TETA 3MHHC 4G28B 3ASNB 4WFBV 1NVPD 1BMFG 5EC1C 3SPGA 3TK1A 1K9MW 3OUSA 3K79A 2GHYA 4R8CA 1PD3A 1YTFB 4R50A 4U7NA 3CXCU 1S76D 2IU0A 1LNQA 3OR6C 1YI2V 5B3SB 1FXKB 4BIUA 3W7UA 2QA4V 1BL8A 2A79B 3AG2B 3FKSG 3SPJA 3LDDA 4HYOA 2ZXWC 2QE7G 1RPOA 2PI4A 2LFRA 4FPPA 3K9AA 5IYBO 3UKMA 4GX0A 2JEXA 3CCRV 1K34A 4KP4A 2AHYA 3E8HA 3SPIA 1GK9A 1EFRG 1OZ0A 2EIMC 2P6JA 4JYCA 2IH1C 3IC7A 2YEVB 1FXKA 1AI4A 1JVMA 2KB1A 3E8GA 1NKDA 1WLEA 1OCZB 3CC4V 1QLNA 5B1BC 5LGNA 3ASOB 2X6CA 4MT8A 1YIJV 3I55V 1DLBA 4G27B 3OUFA 4GX2A 4UV8A 1H8EG 1JQ0A 4MTOA 5IYDO 4TWKA 2QEXV 4LBEC 2JIZG 4N21A 2EBOA 1JCHA 4X8AA 3ZN0A 5EBMC 3SPCA 1OCZC 3ETEA 3ZJZA 4WFGA 3CCLV 3JYCA 4FIPC 2HVJC 4J9ZB 1MOFA 2OCCC 3ZMUA 5LHGA 2YSUB 4XDJA 2EIKB 1KD1W 3OAAG 3OM3B 5EBWC 2EIJB 3SYCA 5L3CA 3LDEA 1K97A 3G4SV 3I56V 1NQTA 3ZRXA 4PA4A 1OCRB 2W6IG 3TCUA 3LDCA 4BAYA 4UUJC 4FJCC 5GW7A 3T4ZA 2DYRB 3ABKC 1VQ5V 3ABLB 2Y48A 3LUTB 1ENVA 1ROPA 5KUMA 2NLJC 3W7WA 2BOCC 1R3LC 3IFXA 5IY5B 3CMAV 1XL4A 3OEEG 1K73W 3B8MA 3OMNB 2PI5A 3DTUB 1TUEB 2EIKC 3EHBB 3G6EV 1S5HC 3FB5C 4WF9V 2JEUA 3GWOA 5IY5C 3RW0A 2OCCB 5KA6A 3LSQA 5L3BA 3CYOA 3CCSV 1QR8A 3MHSC 3CC7V 2EINC 2QTOA 4R6ZA 2B1GA 3FB6C 4GCZA 3ABTA 4EKWA 1K4DC 2R9RB 4R7CA 4FK5C 5KA5A 4RO2A 2XAHA 1QBZA 2P67A 3E35A 4QJFB 3STZC 3AG3C 3OMIB 4KUMA 1BHAA 1K7DA 5LHHA 2Q6AA 1F4NA 3CPWU 3K06A 2UXXA 3VBBA 4Z1MG 1SERA 4P2ZA 4U7OA 3K0DA 4ZBMA 2Q68A 2WLNA 1E1RG 1R6NA 3ZMVA 3OMAB 1V55C 2F43G 3ZRWA 1BHBA 1VQ8V 5L3EA 4JTCB 3ETDA 1NR7A 1M57C 3NXSA 2ZQMA 1S72V 1FS0G 3W7XA 1PNKA 3OW2U 2B5UA 1KECA 3ASOC 5H6RA 2ITCC 3WG7B 1J95A 1H8HG 2ITDC 5FL7G 2W6JG 5KUKA 4MSWC 4MVQA 4PDVA 2DYSB 3W7TA 3QO7A 3DGEA 3G71V 5HFLA 1EZJA 5CBFA 5L3GA 3ABUA 3F5WC 1VQ9V 5L3FA 3AEIA 1R3JC 4LC1A 4QE9A 3ASNC 3OFNG 3AG4B 1F23A 4JGSA 3ZRWB 3T2MA 3KG2A 5H6QA 3T1CA 3M99B 3K08A 5EK0A 2ZXWB 4FMTA 1SZTA 3JD4A 5CN0A 3AG3B 4JASA 3P30A 3SYQA 1K8AW 4WFEA 1QLEB 4KFMA 1AJNA 4MW8A 3LNMB 2QM7A 1W2BU 1M56B 1V54C 2WLMA 3STLC 1QLEC 4TSFG 1YSCA 4L87A 4QIWF 3CP1A 4J9YB 1K3EA 3CCMV 2D3OW 5DN6G 5C93A 4BIZA 4MVZA 2HR3A 3OE7G 2UXNA 4QPJA 4CBCA 3CC2V 3AG1C 3ABMC 1HWYA 2R9IA 3QO5A 2DW4A 3FB8C 2X6AA 3SJQC 3OGCC 3H01A 3CCEV 1H2GA 3E89A 1DTOA 2H8PC 4WFHA 3A0RA 4PELA 1G4YB 2ZDIA 1I5YA 1R6KA 1VQPV 2A0LA 4MVUA 3D3IA 1VQNV 1K92A 1OCRC 1OHHG 2WLKA 3X2QB 3SYOA 1SETA 2DWDC 5LBQA 1V55B 4MVMA 4WCEV 2DQ3A 1AI6A 1S77D 5IDJA 2DQ0A 1P4RA 3E86A 2DWEC 2QKSA 2IW5A 3CCQV 3FYEB 4RQEA 3ABMB 4JTDB 1Y66A 4P30A 4G2KA 2EJRA 4RAIA 2XOKG 1G8MA 1QCEA 2P7TC 4UVBA 3JD1A 4RUEA 2LFSA 1JJ2U 4MW3A 3FB7C 1DF5A 1NBMG 1AJPA 4HAMA 4JAUA 1K4CC 2V7QG 2WSSG 3PJSK 2IJJA 2NNUA 1RM1B 1VQLV 2ZR2A 1GKFA 1MG1A 1Y4MA 1AI5A 3F7YC 4I9WA 4MTGA 4QE7A 2Q67A 1VQ4V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JTC B;  4PA7 A;  5BZB A;  1M57 C;  4PDM A;  1JVM A;  2KB1 A;  3AG4 C;  3ASO C;  3E8G A;  4HZ3 A;  3GB7 C;  5B3S C;  2ITC C;  5B1B C;  1J95 A;  2X6C A;  1XL6 A;  2ITD C;  2WLI A;  4X88 A;  4MVS A;  2WLL A;  4G27 B;  5J9P C;  3OUF A;  4GX2 A;  5KUK A;  2ZD9 A;  5EBL C;  4GX1 A;  4MSW C;  4MTO A;  4MVQ A;  4PDV A;  4TWK A;  2W0F C;  4LBE C;  5E1A C;  1KKD A;  3OR7 C;  4X8A A;  5CBF A;  4PDR A;  5EBM C;  3WG7 C;  3F5W C;  3SPC A;  1OCZ C;  1R3J C;  3E8B A;  3K0G A;  4QE9 A;  3ASN C;  3T4D A;  4WFG A;  3ZJZ A;  3ABL C;  3BEH A;  3JYC A;  3KG2 A;  3T1C A;  2BOB C;  3T2M A;  2HVJ C;  3K08 A;  2X6B A;  3AG2 C;  4PA3 A;  4J9Z B;  3VOU A;  2OCC C;  5EK0 A;  3SYQ A;  4XDJ A;  3SYA A;  4H37 A;  4OXS A;  4WFE A;  4KFM A;  3R65 A;  4MW8 A;  3LNM B;  4XDL A;  3RBZ A;  5EBW C;  4MVO A;  2HJF C;  3SYC A;  2EIL C;  2IH3 C;  2YEV A;  2EIJ C;  5B1A C;  4MVR A;  1ZWI C;  3LDE A;  1OCC C;  3EFF K;  2DYS C;  4X89 A;  1V54 C;  3E8F A;  4PA4 A;  2WLM A;  2K1E A;  3STL C;  2Y69 C;  3RVY A;  1QLE C;  3TCU A;  4LP8 A;  2JK5 C;  3LDC A;  2HFE C;  2HG5 C;  4UUJ C;  4J9Y B;  4GX5 A;  2AHZ A;  4PDL A;  2HVK C;  3T4Z A;  3ABK C;  4MVZ A;  3LUT B;  2WLJ A;  5KUM A;  1M56 C;  2NLJ C;  1R3I C;  4JTA B;  3F7V C;  4LCU C;  2BOC C;  1R3L C;  3IFX A;  4CBC A;  3AG1 C;  3UM7 A;  3ABM C;  4QNH B;  2Q69 A;  1XL4 A;  3FB8 C;  4WFF A;  1P7B A;  1R3K C;  4H33 A;  2X6A A;  4XDK A;  3SJQ C;  3OGC C;  3SPH A;  4DXW A;  5CBH A;  3E89 A;  2WLI B;  2H8P C;  2EIK C;  4WFH A;  3X2Q C;  1S5H C;  1G4Y B;  3FB5 C;  3K03 A;  4MS2 A;  4PA9 A;  4RUF A;  5IY5 C;  3RW0 A;  3SYP A;  1OCO C;  2A0L A;  2A9H A;  3HPL C;  4MVU A;  4P9O A;  3TET A;  4G28 B;  2EIN C;  2QTO A;  3E83 A;  4R6Z A;  1OCR C;  2WLK A;  3FB6 C;  3SYO A;  3RVZ A;  2DWD C;  5EC1 C;  4EKW A;  1K4D C;  2R9R B;  4R7C A;  3SPG A;  4MVM A;  3OUS A;  3K04 A;  4RO2 A;  4R8C A;  5CBG A;  3E86 A;  4F4L A;  4R50 A;  2DWE C;  1LNQ A;  2QKS A;  3OR6 C;  3STZ C;  3AG3 C;  4JTD B;  4P30 A;  4PA6 A;  4RAI A;  4BW5 A;  1BL8 A;  2A79 B;  2Q6A A;  2P7T C;  3SPJ A;  3K06 A;  2DYR C;  2WLL B;  3LDD A;  4HYO A;  4P9P A;  4RUE A;  2ZXW C;  4MW3 A;  4P2Z A;  3FB7 C;  2WLH A;  3K0D A;  4ZBM A;  3UKM A;  4MTF A;  1K4C C;  4GX0 A;  2Q68 A;  2WLN A;  1ORQ C;  3PJS K;  3ZRS A;  5EC2 C;  2AHY A;  3IGA C;  1V55 C;  3E8H A;  4I9W A;  3F7Y C;  3SPI A;  2ATK C;  4MTG A;  2EIM C;  4QE7 A;  2IH1 C;  2Q67 A; 
#chains in the Genus database with same CATH topology
 3OGI B;  2B9Z A;  1KQS U;  1GTO A;  3CRA A;  4B3R O;  3ZWI A;  1GMG A;  1XQ8 A;  3B4S A;  5KMG B;  1VQ7 V;  1G4U S;  3AQC A;  5EYP A;  3BPZ A;  2F95 B;  1N0N A;  1KC8 W;  1WAS A;  4CS2 A;  2PX0 A;  1SF9 A;  4NTX A;  4HEA J;  3MAQ A;  4EBK A;  3O65 A;  2VCC A;  3MFN A;  1YIT V;  5H9C A;  3CCU V;  3ABL C;  1KBH A;  4MND A;  1OCO B;  1YZB A;  2YLG A;  3S9O A;  2WWW A;  4JI8 B;  2NSF A;  2QLA A;  3ZHQ A;  4I55 A;  2G3V A;  2QM8 A;  2KNH A;  3B77 A;  1I4Z A;  1KKC A;  4DR1 O;  3POV A;  2M64 A;  1AB3 A;  4JYB A;  2EIJ C;  4YXW G;  3CD6 V;  4EFB A;  1OCC C;  2OJQ A;  5AC4 A;  1QHT A;  1PNL A;  5KHI A;  2CNW D;  3QW1 A;  4BEJ A;  4HBN A;  1F4M A;  3O9O A;  2CTP A;  1SQQ H;  1CGN A;  2H94 A;  3K1I A;  1M90 W;  4Z2W A;  1EI7 A;  2F22 A;  4Z9I A;  1WJZ A;  5D92 A;  3X2Q C;  4TQF A;  3VQX A;  2P61 A;  5T3W A;  3QG5 A;  1ZAU A;  4UVC A;  4U5F E;  4OD5 A;  1OCO C;  3JAK B;  1C17 M;  3H9V A;  1Q43 A;  2R7O A;  3E83 A;  2H3O A;  3P3P A;  2ODM A;  3K57 A;  3RKO F;  2C03 A;  5CA0 A;  1GM7 A;  1ZU4 A;  3SNH A;  1SRY A;  3K04 A;  3E22 A;  4TT3 G;  2ZIO A;  4GT1 A;  3JSE O;  3WU2 Z;  2E76 B;  4TOI A;  2JJ1 G;  4Z1V A;  4O7G A;  3DM5 A;  2N74 A;  1M2V B;  1GQA A;  4JYA O;  3FOP A;  4KC9 A;  3U11 A;  4DV3 B;  3AGU A;  4DUZ O;  2XAS A;  2IJK A;  4CH5 A;  3EGX A;  4IAR A;  4CZZ A;  3TXQ A;  2UXB B;  1K33 A;  1KU2 A;  1SZX A;  1ORQ C;  3FXH A;  1H9G A;  1TWA A;  3IGA C;  3R2P A;  1XOU A;  2ZM6 B;  1HW7 A;  2Q4P A;  3R7C A;  1CPY A;  4LH6 A;  1Q81 W;  1MMN A;  2R9A A;  4X62 O;  4GEH A;  5L0H A;  3SP1 A;  4J11 A;  4K1O A;  1QU7 A;  5L0F A;  4JI0 B;  2WLI A;  2DN9 A;  2Y0P A;  2L35 A;  4EBB A;  3JT1 A;  1NVP B;  2ZNI A;  4Q20 A;  4AIL C;  3DAG A;  5E1A C;  1SES A;  2QWP B;  4JI2 B;  2CW0 F;  4ICG A;  2LIG A;  3O39 A;  2NUT A;  3SR2 C;  1B6Q A;  2IBF A;  3K0G A;  4FM0 A;  2Q0O C;  4DR7 B;  4O4I B;  2J46 A;  4QPK A;  4DV5 B;  2QWR B;  2BOB C;  1LE2 A;  2YXL A;  2OIE A;  3VOU A;  1B06 A;  3APO A;  2KQ9 A;  4O2B B;  3A2F A;  3OD4 A;  3U2M A;  4PJM A;  4OX9 O;  3N2K A;  1N8R W;  3GEE A;  2FTK A;  2YEV A;  5IWA O;  3GWK C;  3JCZ A;  5B1A B;  1NI8 A;  5B1A C;  4MVR A;  1DF4 A;  3QZC A;  1E83 A;  2DYS C;  4M63 A;  2VQE O;  2OOC A;  4ULV A;  2CGN A;  3RVY A;  2XHB A;  2IJI A;  3K58 A;  2HG5 C;  4GX5 A;  1XNR O;  1VQ6 V;  1HW2 A;  3M79 A;  3DXR B;  4DV6 O;  1K5S A;  1FTS A;  2EJ7 A;  4UVA A;  1VB5 A;  2Q69 A;  3HNI A;  4WFF A;  1Z63 A;  1OW6 A;  1JAF A;  4E7S A;  1Q0G A;  1G4W R;  3IHU A;  1CP9 A;  1F1M A;  2UUB B;  2QR4 A;  2Y4T A;  1M1K W;  2QTV A;  1YZA A;  3BY6 A;  3ZN1 A;  3SYP A;  2HSQ A;  3P32 A;  1BR4 A;  2WZG A;  5KAF Z;  1W2W A;  4DK1 A;  3EHN A;  2YI9 A;  5A6J A;  3RYI A;  1WA8 A;  2NG1 A;  3CX5 F;  1VMA A;  4I0X B;  4PHZ A;  1ZVZ A;  2VCB A;  4JI2 O;  1JR8 A;  2YXH A;  1T6Q A;  1PD3 A;  2UUI A;  1LUV A;  4U7N A;  2WVO A;  2IU0 A;  1ZW3 A;  1LNQ A;  1Z7Q c;  5B3S B;  2NN4 A;  1Z5W A;  2E87 A;  4EUK B;  3C8G B;  2CYD A;  4U9E A;  4DR4 B;  3W2W A;  4LFB B;  3DM9 B;  2P6V A;  3H65 A;  1S05 A;  2HSB A;  3SXY A;  1RPO A;  5IYB O;  1T5E A;  2DOS A;  3BFR A;  2OQM A;  4GX0 A;  4K7B A;  3CSK A;  5KHK A;  1G8X A;  4KP4 A;  3B29 A;  1DGS A;  1GK9 A;  1EFR G;  4F6R A;  2CGO A;  2P6J A;  4LLC A;  2IH1 C;  2OWO A;  4JI6 O;  2PX3 A;  3NKD A;  3KL4 A;  4FWV A;  1AI4 A;  2Q9B A;  1XHZ A;  1JVM A;  1YXB A;  4NXN B;  2KK1 A;  2XLV A;  3E8G A;  2Y3D A;  1HNZ B;  2A1D D;  3EG9 A;  2L7A A;  4XLP F;  1OCZ B;  4YJ3 B;  3ASO B;  3CS5 A;  1EN5 A;  1TA8 A;  5DQT A;  1VIB A;  1JQ0 A;  1IUR A;  2YWA A;  2CDQ A;  2QEX V;  4TV9 A;  2JIZ G;  4JZ2 A;  4KBL A;  5EZY B;  4N21 A;  1ST6 A;  4N4W A;  3B2E E;  3JAS A;  3WOD F;  3JYC A;  1RKC A;  2XXA B;  3DMD A;  2Q9L A;  2HVJ C;  3K33 A;  2Z15 A;  1Z5Z A;  3M4B A;  3VQY A;  4BW9 A;  1RXQ A;  2AWC A;  5LHG A;  1R6T A;  3N2G B;  2GTS A;  2A68 F;  2BTQ B;  2EIJ B;  4CBE A;  1WN7 A;  1YVW A;  3PHF 2;  3ETQ A;  2W6I G;  1N32 O;  4B3S B;  3KCX A;  4X1Y B;  4FJC C;  4LWS B;  5GW7 A;  1TVK B;  2BSK A;  3T4Z A;  3FAP B;  3LLK A;  2TMV P;  1Q0K A;  2Y48 A;  1ENV A;  5KUM A;  3FOO A;  4YT2 A;  3IFX A;  5IY5 B;  1FFH A;  2Q7G A;  4JZA A;  3RQE A;  4JAA A;  3SYN A;  1XL4 A;  3B8M A;  2F4V O;  3OMN B;  3DTU B;  4FLV A;  3G6E V;  4J7Y A;  3LSU A;  5JP7 A;  1XMQ O;  2Q7H A;  1FMV A;  4XEK A;  2Y4U A;  4U5C E;  2GUZ B;  4JEA A;  1XI1 A;  4YJ2 A;  2EIN C;  3ABT A;  5B66 Z;  1YCI A;  4EKW A;  5LMN O;  3ZTZ A;  2R9R B;  4X20 B;  1Q8I A;  2XL6 A;  3GVM A;  2QTS A;  1RJ9 A;  2P67 A;  1IBL B;  4Q7C A;  3TUL A;  5HV9 A;  4LF6 B;  4OD4 A;  3C8Z A;  5DEC A;  1K7D A;  2LGW A;  3HKE B;  5IJ0 B;  5LHH A;  2YVK A;  2GDS A;  1BE3 H;  4Z1M G;  4JI5 B;  4X62 B;  4GKJ B;  3MBG A;  4DV2 O;  1IX9 A;  1E1R G;  2A6E F;  4B7K A;  1J5E B;  3OMA B;  4PV1 B;  4O4H A;  4J7Z A;  2LFD A;  4JTC B;  3ETD A;  1NR7 A;  3NXS A;  2W4M A;  3ZSU A;  4E0H A;  3CEI A;  2VAS A;  3W7X A;  5TJ5 E;  1APC A;  2RQ6 A;  5H6R A;  4EHP A;  4JI7 B;  4JV5 O;  5FL7 G;  3UGO A;  3GEH A;  5C8Y A;  5KUK A;  2J8W A;  3ZBH A;  5BMV B;  4CS8 C;  3G71 V;  2HJD A;  3FD9 A;  5HFL A;  3FAV A;  2IBZ H;  4X0R A;  4O79 A;  4NXN O;  2NR5 A;  2E5L O;  2X51 A;  4JGS A;  4OIQ F;  4LWS A;  3ZRW B;  5H6Q A;  1XDC A;  3S27 A;  4JJF A;  4YL1 A;  2Q4F A;  3T9O A;  2JGU A;  3CRQ A;  3P30 A;  2YIB A;  4GKJ O;  4UCS A;  1WB8 A;  3LNM B;  1E2X A;  3K6B A;  2CTQ A;  1TAE A;  2XS1 A;  1XHX A;  4LF7 O;  4I50 B;  1I08 A;  2QGN A;  3RYC B;  1QLE C;  3OTO B;  1Q6U A;  1YSC A;  2N04 A;  2HHH B;  1S7Z A;  5B3I A;  4J7J A;  2WA3 A;  3G80 A;  3PMR A;  2QE9 A;  2Q8V A;  4I1O B;  4WJ0 A;  1T9K A;  3QVN A;  1U96 A;  4FLX A;  3SJQ C;  2LQG A;  1P49 A;  2PUS A;  1DTO A;  1GRJ A;  1LI5 A;  2CAZ C;  5FNV B;  3RYL A;  3RYH B;  4G7H F;  4MVU A;  2EX3 A;  1VQN V;  1L7C A;  2EPL X;  3WB0 A;  2HV7 A;  1K92 A;  2WLK A;  3VQW A;  3L0I A;  3EXA A;  5JH7 A;  4DR3 O;  4RBN A;  2VWJ A;  3N0T A;  4KHP B;  2DQ3 A;  2GDC A;  2WVN A;  4C3E A;  2H7V C;  5IDJ A;  3FX7 A;  1TWH A;  3HKE A;  3A9C A;  2M4E A;  5KHG A;  1CPQ A;  4CIP A;  1H2S B;  4AK9 A;  4CX9 A;  5FCL A;  2L6H A;  3CCQ V;  5GPG B;  4DR2 O;  2FL4 A;  5BR8 B;  3FAJ A;  4P9T A;  5CA1 A;  3U5S A;  1FAF A;  2HJ3 A;  2L6G A;  4L8J A;  5JLI A;  4JZG A;  4H4K C;  2BTO A;  2P7T C;  1YAU O;  2ARH A;  4DRJ B;  2DE0 X;  5BQI A;  3FB7 C;  1OKK D;  1NBM G;  2R72 A;  1IXB A;  1K4C C;  4OX9 B;  2VQF O;  4MQ9 F;  1VAR A;  3C18 A;  1TGO A;  3GM1 A;  4DVZ A;  1Y4M A;  3F7Y C;  1UFI A;  2Q67 A;  2IU3 A;  4PDM A;  3SDL A;  1I5X A;  4JI3 B;  2YLI A;  4EB6 B;  3T6G B;  2WLL A;  1RPR A;  3ATP A;  5EBL C;  1JPN A;  1NR1 A;  1NZE A;  3ZHR A;  2X7R B;  3ZED A;  1HNZ O;  1WPX A;  1VQM V;  4J7T A;  1XNQ O;  4IAO A;  1TWG A;  4JI7 O;  3FYI B;  4ASU G;  2QNL A;  1WPB A;  3QNE A;  2AGA A;  4XPX A;  4CSA A;  4UDV A;  4XBF A;  1JX9 A;  1Q5O A;  3LLI A;  3R65 A;  4XDL A;  1QVF U;  5JVD B;  5L3D A;  3TD7 A;  3HB3 B;  1Q6H A;  2HJF C;  3A0B Z;  5AGF A;  3JAR B;  1IVS A;  3L73 H;  2F1M A;  4JCZ A;  3BHP A;  5LGT A;  3E8F A;  5LA6 B;  3U10 A;  1XEQ A;  4JUR I;  2HFE C;  1JFF B;  1S5L Z;  2XLO A;  1HW1 A;  2OTJ V;  2XAQ A;  1D0Y A;  3SJB C;  2CGE A;  2FYU H;  2HVK C;  4PDL A;  3J80 N;  4I1M A;  2W4B A;  2A3Q A;  1WN0 A;  1GM8 A;  4XWJ A;  3F7V C;  1NTK H;  3IEE A;  2YZS A;  5DM6 V;  1F51 A;  1VQK V;  4OGQ B;  1NSG B;  1EN6 A;  1FXH A;  2HLD G;  4X1K A;  4RDA A;  1R5I D;  2WLI B;  1R73 A;  2V4D A;  3JSL A;  4CDV A;  1G5Z A;  3ZDL A;  2XAJ A;  2Y69 B;  4B3T B;  2PBE A;  5KYW B;  4JIO A;  4CS4 A;  4IHJ B;  1AEP A;  4FM2 A;  4EFE A;  3CRM A;  4NR1 A;  4J32 B;  2PF4 E;  5A2Q N;  1XNQ B;  4X66 O;  3KYJ A;  4B3M B;  3JD3 A;  1ZU5 A;  1QQ3 A;  1U0B B;  2QM4 A;  2G38 A;  4HE8 D;  1PM9 A;  3G4Z A;  4GUN A;  3SGI A;  2P06 A;  4JEB A;  1H7I A;  3F46 A;  2HZ8 A;  1V54 B;  2WLL B;  2GWW A;  4NTB A;  5LP6 C;  1IXM A;  1S0V A;  1V9P A;  2ZDI C;  2JJ2 G;  4DJ9 A;  3RFY A;  1RM1 C;  2WPD G;  1ORS C;  4YN0 B;  3L72 H;  3AOU A;  1NS1 A;  2CCY A;  4EBJ A;  3QVZ A;  5LHI A;  2ATK C;  3GWL A;  2XAG A;  2HJM A;  3ZVR A;  1GS9 A;  2PY5 A;  1PL4 A;  2I8B A;  2LP7 A;  2LGQ A;  5KYN A;  3UO3 A;  4DW1 A;  1Z5V A;  3KKB A;  4O6M A;  3D36 A;  1SZI A;  3NMK A;  1FFT B;  3ETG A;  4DV1 B;  2DB4 A;  2P1A A;  3QTH A;  2EPO A;  3ZMT A;  1KKD A;  1VP7 A;  1ZSP A;  2CUG A;  1KUQ A;  1RCP A;  1L0N H;  4CS9 C;  3BRC A;  3MYI A;  4HFK B;  2HP8 A;  2O57 A;  3Q4H B;  5LP6 A;  2LSE A;  3JRM O;  2A7W A;  3BEH A;  5D5Q A;  2X6B A;  4E7Z A;  3C8G D;  1E1Q G;  1CEZ A;  4K0D A;  1XWJ A;  2Z3Y A;  3RYF A;  2E5L B;  1PCX A;  3L8J A;  3MYF A;  1KTM A;  5L3V A;  1IBK O;  4UCU A;  3RBZ A;  3DC6 A;  5ITZ A;  3MD0 A;  2L9J A;  1FXV A;  3S0X A;  3JAT B;  4B3M O;  1JMK C;  2XM4 A;  4FLY A;  3GAN A;  3RQF A;  1F7Y A;  3HNL A;  5LGU A;  3RT3 C;  1COW G;  3ZRV A;  2LK4 A;  1M93 A;  4LF5 B;  2PZS A;  3RYH A;  2JRI A;  1K5Q A;  1O5H A;  5HSW A;  5AG2 A;  3JYY A;  3P3N A;  4J30 B;  2JS5 A;  3CB2 A;  1R3I C;  3K5O A;  5B1O A;  1M57 B;  4LCU C;  4UXN A;  5J2T B;  1IBM B;  2XL8 A;  3M8A A;  1FAP B;  1FPO A;  4QNH B;  1KP3 A;  1MSD A;  3SPH A;  1VEW A;  3LEV A;  4YL3 A;  4JCH A;  3KPH A;  2MYS A;  3B0P A;  5LOV B;  2P4V A;  3IQ6 A;  1FKA O;  1Y6D A;  1YDI A;  1NH2 B;  5KYY B;  4E17 A;  3FAV B;  3L9D A;  1SMY F;  1UJW B;  3TET A;  1WB7 A;  1NU7 D;  3JRT A;  4G28 B;  1ZX3 A;  1LE4 A;  2LFF A;  4WFB V;  5CI8 A;  4YJW A;  3JAW B;  1BMF G;  3M4C A;  1VF7 A;  1K9M W;  4K0K B;  2PP4 A;  4P9F A;  5DQZ A;  1EA8 A;  4F6R B;  2O9X A;  1YTF B;  3G6B A;  4DUZ B;  2UUH A;  4BIU A;  2DJV A;  4K8Z A;  3HKB A;  2AZ2 A;  1BL8 A;  2A79 B;  4X65 O;  4O6N A;  2XS8 A;  1HNW B;  3EH1 A;  2ZXW C;  2PI4 A;  5T1D B;  4X66 B;  2OCH A;  2LFR A;  4FPP A;  1OW8 A;  3ZHV A;  2JEX A;  2AU5 A;  1K34 A;  2AHY A;  1UPG A;  1MND A;  4LFB O;  4W4K A;  3SPI A;  2K9P A;  3KCY A;  1D1C A;  4LFA B;  4I4T B;  4CS8 A;  3OA1 A;  1ZLZ A;  2QKA A;  4Z9H A;  4ZOL B;  2BE3 A;  2IXM A;  3C90 A;  4MT8 A;  2X6C A;  2BL2 A;  2UU9 B;  4B08 A;  1YIJ V;  1DOW A;  3I55 V;  1QVX A;  3OUF A;  1TWC A;  2OJE D;  2YUA A;  4UV8 A;  5IYD O;  4MTO A;  4YY3 O;  4TWK A;  3DE8 A;  3WB2 A;  5AC5 A;  1ZHW A;  1SQX H;  4B7E A;  4YIO A;  1Z2G A;  1JCH A;  5EBM C;  1S5J A;  3ZJZ A;  4WFG A;  3CCL V;  1FFT C;  5CB4 B;  2RD9 A;  4JW1 A;  4U5G A;  2VRZ A;  3S90 A;  1L8D A;  1B68 A;  2PNO A;  2HEP A;  3IC9 A;  4XDJ A;  5LMU O;  1YLM A;  2EIK B;  2JGD B;  4P6I C;  5L0G A;  5EBW C;  1W59 A;  2CNW A;  3DC5 A;  2D4U A;  3Q7G A;  4QI2 A;  1XNR B;  1EM1 A;  2ZT9 B;  5L3C A;  4DR6 B;  3AJM A;  1K97 A;  1CXZ B;  3G4S V;  1NQT A;  1ORY A;  1MA1 A;  2R03 A;  3TCU A;  1NT2 B;  4DR2 B;  2MWQ A;  1HMO A;  4BAY A;  1M5I A;  1JMW A;  3ABK C;  1LUW A;  3LUT B;  4AX2 A;  2NLJ C;  3OWT A;  3W7W A;  4JJG A;  1R3L C;  3CMA V;  3QF7 A;  1HE1 A;  3OEE G;  3ZHT A;  2WVQ A;  1K73 W;  4YIP A;  2FKX A;  2VQF B;  3PCV A;  1OKK A;  2J9B A;  2XT9 A;  1NZ6 A;  4WF9 V;  1YVI A;  1AP5 A;  1NBB A;  1GM5 A;  5IY5 C;  5KA6 A;  2OCC B;  4B3R B;  3LSQ A;  4O4J B;  3CCS V;  4Q5S F;  2RDC A;  3MHS C;  5DS6 A;  2CTR A;  4FLT A;  4UB8 Z;  4GCZ A;  1YDX A;  5L0C A;  4WGZ A;  4R7C A;  2Q7E A;  4YY3 B;  4O4J A;  3N2K B;  3AGT A;  1P84 F;  2XAH A;  1WTY A;  3TQO A;  1QBZ A;  1Q6I A;  3DZA A;  3NG1 A;  1US6 A;  3E35 A;  1RSO A;  4U5E E;  1OR3 A;  2F23 A;  2HMQ A;  1D2D A;  3W8H A;  4ER9 A;  4KUM A;  4FLU A;  1BHA A;  2Q6A A;  3ZHS A;  2WZL A;  3CPW U;  4BG0 A;  3K06 A;  4NXM O;  1D1B A;  1RSO B;  1QPU A;  2XUM A;  4P2Z A;  4U7O A;  4YJ3 A;  2W9Y A;  1VF5 B;  1AR4 A;  1FR0 A;  4GQH A;  3LJB A;  2EPM X;  3C3S A;  4CSA C;  2UUC O;  3ZMV A;  4X64 O;  1I94 B;  4XLN F;  1M2O A;  3ZRW A;  2L6F A;  2YC0 A;  5CI9 A;  3DE9 A;  1G1X B;  5L3E A;  4LAC B;  4NKG B;  256B A;  4O2A B;  1S72 V;  1FS0 G;  1PNK A;  1KU9 A;  4DV0 O;  1KEC A;  2J9V A;  3NYJ A;  3J81 N;  3B71 A;  1G6U A;  1BQZ A;  3VF0 A;  3DJN B;  4IL6 Z;  4NCQ A;  1DK1 A;  1IW7 F;  2YID A;  1NFO A;  4MSW C;  2Q9C A;  2WL8 A;  2DYS B;  3W7T A;  4W8P A;  3DGE A;  3HNK A;  4Q6G A;  2ZNJ A;  3K59 A;  1L3P A;  1YYJ A;  1IBK B;  5L3G A;  3ABU A;  2L6L A;  2RMK B;  2H7B A;  2J9W A;  2VS0 A;  5EHH A;  3AEI A;  4JYY A;  4FX5 A;  4QDL A;  4I7Z B;  2YDE A;  1XZQ A;  2VC9 A;  3T1C A;  3M99 B;  4NVP A;  1SS3 A;  2R70 A;  3RH3 A;  3EZH A;  1XRE A;  2MHR A;  3TJ6 A;  4ZHQ A;  5EK0 A;  1SC5 B;  1Z6A A;  1SZT A;  1HNX B;  4JI4 O;  4G0H A;  1QLE B;  1SQV H;  3HKD A;  4I9Q A;  4MW8 A;  2UUC B;  1YF2 A;  1TFO B;  3N2Z B;  2RNB A;  4D4X A;  2QY9 A;  3ZX6 A;  4BWA A;  1ORJ A;  1CGO A;  3IQ5 A;  3EFO B;  1NTM H;  2OYQ A;  1V54 C;  3SJC C;  1XBL A;  4L87 A;  4HNA A;  4E18 A;  4J9Y B;  4DV3 O;  5DN6 G;  1E86 A;  1AUE A;  4BIZ A;  5GON B;  2W0X A;  5KHJ A;  3CAX A;  4QPJ A;  1D5A A;  3RYI B;  2HMZ A;  1HWY A;  4DVY P;  3ZC4 A;  2DW4 A;  3OGC C;  5CA1 B;  1H2G A;  4WFH A;  4R32 A;  2H8P C;  1Q0M A;  5EZY A;  3H1L H;  2P0N A;  4PI0 A;  5JS5 A;  2YHS A;  5A6B D;  1KMI Z;  4JI4 B;  4X1K B;  2A0L A;  4TV8 B;  2NUT B;  3D3I A;  4AI8 A;  1J8Y F;  2YQY A;  3K7D A;  1VMG A;  4IGG A;  1SET A;  5LBQ A;  1AR5 A;  4X20 A;  1V55 B;  4MVM A;  1WP8 A;  2KGO A;  3DXR A;  3T1Y O;  1AI6 A;  1VK5 A;  2RSE B;  1P4R A;  2DWE C;  2QKS A;  2IW5 A;  1BR2 A;  3JSZ A;  2KQX A;  2ZE8 A;  5LMN B;  4RQE A;  4C7O B;  3ABM B;  4JTD B;  1Y66 A;  4G2K A;  2EJR A;  5JQG A;  1T6I A;  3JSN A;  4UVB A;  2DI3 A;  1QKR A;  3JD1 A;  1VYK A;  2LFS A;  1JJ2 U;  1I4Y A;  1YEW A;  3B09 A;  5F2V O;  1BZ4 A;  1Y76 B;  3TOM A;  4JAU A;  4X65 B;  5A6B A;  1SA0 B;  2IJJ A;  2YL1 A;  1VQL V;  5JRA A;  1MG1 A;  4JYA B;  4DBR A;  1GGQ A;  1VQ4 V;  4CDA A;  3FMS A;  1Y74 A;  1EQ1 A;  1GN6 A;  1TUB B;  3OEO A;  1XL6 A;  1KP2 A;  5C8Y B;  4DRX A;  4CH3 A;  4W8K A;  4BJ6 C;  3EJN A;  3I4U A;  4JAV A;  3N2G A;  3G50 A;  4ZLC A;  2V1D A;  3OEH G;  2QKC A;  2Q9A A;  1W0K G;  4OPA A;  1K40 A;  1HP8 A;  1Q7Y W;  3L70 H;  3ZMS A;  3S3W A;  3BA8 A;  3D36 C;  3ABK B;  4KI2 A;  4DR1 B;  3AG2 C;  2KG7 A;  4PA3 A;  3RYC A;  3E2E A;  4JPR A;  5A6A A;  3ZMZ A;  2Z0A A;  5E3A A;  4IB4 A;  5FZT A;  1BBH A;  3IQC A;  3LSS A;  1HR0 O;  3WB1 A;  2YL3 A;  3JCU Q;  1ZWI C;  3EZI A;  2WB7 A;  5F5H A;  3JAK A;  4JF3 A;  1IBL O;  4J10 A;  4BR6 A;  2JDI G;  3RGB A;  5CA0 B;  5IWA B;  1PL0 A;  3RN4 A;  1OCC B;  2A0U A;  3ICX A;  1YZC A;  4NQF A;  3I5D A;  2R7U A;  4ZOL A;  4FZ0 A;  1R3K C;  2IJH A;  2HUJ A;  4EEQ A;  4DUY O;  2F66 C;  4FVM A;  4EIY A;  1J5E O;  1BSM A;  3EHM A;  1A32 A;  4RUF A;  1JJO A;  4RQF A;  4A4A A;  3GWN A;  3HNJ A;  2ZE7 A;  2NSG A;  2P4K A;  1FFX B;  2I15 A;  3RVZ A;  1XMO O;  2XLH A;  1X4T A;  3C62 A;  1N36 B;  2V26 A;  5IE9 A;  1NTZ H;  5JCO A;  1Q82 W;  5CBG A;  4ONS A;  4F4L A;  5L0I A;  1FNT c;  2PTM A;  2Q5Z A;  4AHC A;  3VM6 A;  2QWQ B;  4ULW A;  3B8N A;  2M7W A;  1PPJ H;  1AJQ A;  3IJ4 A;  3LS1 A;  1BCC H;  5FNV A;  1NG1 A;  2DYR C;  3ZQY A;  1KB9 F;  1SYQ A;  3JZ0 A;  1C03 A;  4DK0 A;  1B3Q A;  1Y76 A;  5EYP B;  4MTF A;  1FXK C;  2R7W A;  2XND G;  1K05 A;  3U9J A;  1I7F A;  2R25 A;  3H1J H;  1YA9 A;  2J9U A;  3KMI A;  4DBQ A;  5EC2 C;  2BCC H;  4JE9 A;  3E22 B;  3CRC A;  2A0B A;  3S3X A;  3CRR A;  3EGD B;  4PJ0 Z;  1W0J G;  4CJO A;  4DRI B;  3AG4 C;  3OTO O;  1I94 O;  1NH2 D;  3GB7 C;  1PD0 A;  4N6H A;  5JCO C;  4QGP A;  2ICW G;  4W4L A;  3PN1 A;  1HY5 A;  2XSE A;  1JA8 A;  1HDJ A;  1TFK B;  1T01 A;  1PKX A;  2QDO A;  3C3T A;  3W7S A;  1EBO A;  4GX1 A;  2EPK X;  4I5S A;  2P90 A;  3JAL B;  4OIP F;  2L81 A;  4JI1 O;  4PI2 A;  1VQO V;  4YT5 A;  5DS4 A;  4PDR A;  4DYL A;  3WG7 C;  3E8B A;  1AI7 A;  4NYK A;  3T4D A;  4IYI A;  4KXR A;  3GOR A;  4AL1 A;  4ZKI A;  1R1B A;  4O4I A;  4MTX A;  2N05 A;  5DS5 A;  1THZ A;  1ZHX A;  5JT4 A;  3VAY A;  3V5X A;  3VYW A;  1JOG A;  2Y0I A;  4PJL A;  4JI5 O;  2XAF A;  2W45 A;  5CA3 A;  3TXS A;  2ETS A;  1GO3 F;  2CH7 A;  2EIM B;  3O55 A;  1RKE A;  5GTI Z;  1EZV H;  4B6I A;  1H38 A;  2KJG A;  4NB5 A;  3ZQV A;  4X89 A;  2K1E A;  1N33 B;  2OKU A;  2J0W A;  4J41 A;  2AHZ A;  3DXJ F;  1A0B A;  1Y6X A;  2WLJ A;  5EIB D;  1M56 C;  2ZPA A;  5EGY A;  2VQE B;  2R05 A;  2C04 A;  3SEO A;  1JPX A;  2PYL A;  1S3J A;  1P7B A;  2F93 B;  3OTF A;  4H33 A;  4XDK A;  1E79 G;  4DXW A;  5CBH A;  5IYZ A;  2ZKO A;  5BXZ A;  3M1C B;  4MS2 A;  4AQY O;  4FLW A;  4U3J B;  3AG1 B;  1E84 A;  3HPL C;  3JD2 A;  3L71 H;  3ASN B;  1WA8 B;  2UUB O;  1NVP D;  4ZI7 A;  5EC1 C;  1IZM A;  2KSD A;  3K5M A;  4ABM A;  3I5Q A;  3OUS A;  2FFH A;  4LDR A;  3K79 A;  5GON A;  2GHY A;  4UCV A;  4X1Y A;  1S76 D;  3CXC U;  1N32 B;  4I3M A;  1LS4 A;  4YJ2 B;  1WOL A;  1BQ0 A;  4N6C A;  2QA4 V;  2PFD A;  4K35 A;  2JVD A;  3AK2 A;  3CZ6 A;  3V7O A;  3SPJ A;  1RKE B;  2UXD B;  3BAA A;  2E3C A;  1GN4 A;  2Q73 A;  1PV3 A;  1YA7 O;  5K1P A;  3K9A A;  1LPE A;  3UKM A;  1TR2 A;  2ILM A;  4DRX B;  3GEI A;  3Q6N A;  3EH2 A;  2V3C C;  4JI0 O;  3CCR V;  3ZHU A;  1Z23 A;  3KH2 A;  3E8H A;  2J0X A;  3SXZ A;  2FAP B;  1OZ0 A;  3UNG C;  4JYC A;  4NC3 A;  2CE4 A;  3B0U X;  4D4N A;  3IC7 A;  2YEV B;  1ZHY A;  1FXK A;  3W4Y A;  1BS3 A;  2JD3 A;  3G4X A;  2KB1 A;  4LF9 O;  1NKD A;  4CJG A;  1WLE A;  4DR7 O;  1QLN A;  3BA9 A;  3ZTM A;  5B1B C;  1XUQ A;  5IYZ B;  4G27 B;  4GX2 A;  1OXK A;  2VCA A;  4BJ1 A;  3ZN0 A;  4X8A A;  3H2U A;  3T6J A;  5FPR A;  3SPC A;  3ETE A;  2R7Q A;  1OV9 A;  5BR8 O;  3QMK A;  3K1I C;  2XXA A;  4GYT A;  4FIP C;  4E4E A;  1D5N A;  3CXH F;  4J9Z B;  2Q3T A;  4YK5 A;  1MOF A;  2OCC C;  3BAB A;  3ZS8 C;  3ZMU A;  2XM0 A;  4LFC B;  2YSU B;  3ECS A;  5BMV A;  4UCO A;  4DV4 O;  4DV6 B;  5T3T A;  3SYC A;  1OXB A;  1SKV A;  4GLX A;  1M2V A;  3LDE A;  2LCH A;  2YL7 A;  4OIN F;  5KMG A;  4U3F H;  3I56 V;  3WAQ A;  4PA4 A;  4H0L B;  5LOV A;  3RWR D;  4ZLD A;  1O9G A;  2A06 H;  5L0J A;  3LDC A;  3JCU Z;  2YI8 A;  3OT7 A;  4U5H A;  4DUY B;  3A8T A;  2X0C A;  3ABL B;  1ROP A;  3WHN A;  2QWO B;  1BT8 A;  2YL0 A;  1UFB A;  2BOC C;  1FJG O;  1LS1 A;  4HFF B;  4D6T H;  1N33 O;  1P7G A;  2HHH O;  2PI5 A;  1TUE B;  2GA0 A;  4PR9 A;  3UMK A;  3GWO A;  1QSP A;  3V5Y A;  5L3B A;  2XTA A;  4LF8 B;  4WAB A;  4BJ6 A;  4UCR A;  2QTO A;  4H44 B;  2B1G A;  2YKZ A;  3FB6 C;  4UCT A;  2ETN A;  3IPM O;  5JSL A;  4AE4 A;  3RYF B;  3H1K H;  1K4D C;  3HR0 A;  2KG7 B;  2J7P D;  3BRJ A;  4FK5 C;  2NUP A;  4IAQ A;  4QJF B;  3STZ C;  3MX3 A;  3AG3 C;  3OMI B;  4LLE A;  4DV5 O;  1ZYR F;  3IAY A;  3FVY A;  3KYI A;  5IJ0 A;  3RF3 A;  1NU9 C;  2XLW A;  1HNX O;  3VBB A;  1E85 A;  3US6 A;  5L3Q A;  1SER A;  1AVO B;  1BGY H;  3D8C A;  4DV4 B;  2Y3H A;  3AK1 A;  4J80 A;  4ZBM A;  4LFA O;  2GFH A;  2Q68 A;  2YXY A;  1SQG A;  2E74 B;  3LAY A;  1R6N A;  4O2A A;  1H9T A;  1LR1 A;  4XEV A;  2D5R B;  4C3B A;  3N27 A;  1MQV A;  5FLX N;  4JI1 B;  1I5N A;  1M57 C;  4JKV A;  4IHJ A;  2AW9 A;  3OW2 U;  4B3S O;  3ASO C;  4WBN B;  2UUA O;  5CIV A;  1XZP A;  4YWQ A;  2ITC C;  3WG7 B;  4ZIB A;  2JS3 A;  2Q7R A;  2VWK A;  2W6J G;  1TVK A;  3QO7 A;  5JQG B;  2ZCE A;  5KYW A;  4JI8 O;  4ZHQ B;  3BVO A;  3F5W C;  1VQ9 V;  1Q0D A;  5L3F A;  4QE9 A;  1MMA A;  2F4V B;  3L34 A;  4TUY A;  2OU6 A;  1F23 A;  3LNN A;  2CTW A;  3AQB A;  1ZL8 B;  4BJ5 A;  3HKB B;  3K08 A;  3MLG A;  2ZXW B;  3J7A U;  4FMT A;  1LM3 B;  1SA0 A;  5H5N A;  3U3F A;  3AG3 B;  3SYQ A;  3EQL F;  4RWU A;  3Q6M A;  4WFE A;  4KFM A;  1SF8 A;  1PV0 A;  1LI7 A;  2R7T A;  2ZM6 O;  4FZ1 A;  2ZE6 A;  4GYC B;  4K0K O;  3NDB B;  1Q0F A;  1M56 B;  2WLM A;  4CS3 A;  3ITF A;  4NTA A;  4TSF G;  2OEX A;  1CPR A;  3EGD A;  4QIW F;  3GOD A;  2ASR A;  4LF4 O;  1K3E A;  2D3O W;  3APQ A;  1H2N A;  2YLD A;  2ZXP A;  1N0J A;  3OE7 G;  4CBC A;  1WP7 A;  3AG1 C;  1M6T A;  4Q4Z F;  2X6A A;  3KKY A;  3NR7 A;  3U0C A;  4JC7 A;  3E89 A;  3DWW A;  3LES A;  3A0R A;  4PEL A;  2OG2 A;  2ZDI A;  4CH6 A;  4NTW A;  1EKY A;  1VQP V;  3K1H A;  5ITZ B;  2WZF A;  1VF6 A;  2RCV A;  3M7M X;  1A7D A;  3X2Q B;  2D2C B;  1U6H A;  3JAT A;  2DWD C;  2LD6 A;  3DJU B;  2IXO A;  2DQ0 A;  3E86 A;  4GKK O;  2QUP A;  3TGU H;  4K8X A;  4G78 A;  1LKX A;  3E70 C;  4DV2 B;  4B3T O;  5DVW A;  3JYH A;  4DRH B;  4P30 A;  5F5F A;  4KHP O;  2IM9 A;  4NTF A;  4DV7 B;  3SXK A;  1EN4 A;  1MMG A;  4RUE A;  2FGY A;  2ZIN A;  1H2K A;  4YT4 A;  1XIL A;  3O6X A;  1AJP A;  1O87 A;  2EUL A;  2V7Q G;  3W2V A;  2NNU A;  1RM1 B;  4JV5 B;  1WGW A;  2UXD O;  4MTG A;  4BIO A;  4QE7 A;  4PA7 A;  3QO8 A;  5BZB A;  1ZHT A;  1GH6 A;  1CGM E;  1Q90 D;  2A6H F;  1IBM O;  4MVS A;  1MMD A;  2YIB D;  4DV0 B;  1RFY A;  2W0F C;  2HV6 A;  3OR7 C;  5A9G A;  3CCV V;  2C2A A;  4WFA V;  4C3D A;  5A6K A;  1Y4C A;  3WFV A;  4E2L A;  3BCC H;  5L0D A;  2ADQ B;  4XPW A;  4F4B A;  2B0H A;  4LF7 B;  3NYM A;  4CS7 A;  2VH3 A;  2B1I A;  1AP6 A;  3JD0 A;  3SYA A;  1RJ9 B;  4PAC A;  4WGY A;  4OXS A;  2HS5 A;  4IYH A;  3A11 A;  1AR1 B;  4I55 B;  2HKO A;  4LNU B;  1WAT A;  3ML0 A;  1PP9 H;  2EZP A;  3NKE A;  4PK4 A;  3DSQ A;  1Q3E A;  3RFR A;  2IH3 C;  3CQZ A;  4U9D A;  5KYY A;  4CC5 A;  3H1H H;  4UFZ A;  3EFF K;  1FJG B;  1MMM A;  4DO2 A;  4N23 A;  2GAQ A;  1VOM A;  5KHH A;  4KNW A;  1QR9 A;  4YHH B;  1JR9 A;  2MK3 A;  2OTL V;  2A69 F;  2G3K A;  4PFO A;  2WA4 A;  4LF8 O;  4JTA B;  1BR1 A;  2JPU A;  1A41 A;  1KNY A;  3Q4H A;  4C7U A;  5KYX B;  4AL0 A;  3U9M A;  4C7O A;  1MAB G;  1SQB H;  4LF4 B;  1SQP H;  2GTA A;  5B1B B;  3O10 A;  1VLS A;  2Y3B A;  2A9H A;  4IJJ A;  1YJG A;  2EIN B;  1YJN V;  2EZO A;  2OIG A;  3H2V A;  4LF9 B;  2UXC B;  1T6U A;  4FES A;  4CDY A;  2EIL B;  3ZIB A;  1YHQ V;  2MW2 B;  2HKV A;  3B40 A;  2KW3 C;  5CMU A;  3T1H B;  2X0L A;  3K5L A;  1N34 B;  4TUY B;  1RP3 B;  4LF5 O;  3K9S A;  4J42 A;  5TIS Z;  3CCJ V;  3EFO A;  5E3C A;  4PA6 A;  4BW5 A;  1YTF D;  2CK3 G;  3ZIA G;  5JJE B;  3B0V C;  2GV9 A;  2Z5U A;  4P9P A;  1R4T A;  2ZR3 A;  1MSW D;  1GM9 A;  2XLM A;  2WLH A;  3UCS C;  4LFC O;  4DR4 O;  3DI5 A;  5F28 E;  2OT5 A;  3ZRS A;  4U5D E;  1M9N A;  3CJH B;  1ZTE A;  1B04 A;  2AZ0 A;  5LYJ B;  4TQD A;  1KYO F;  5J2U A;  5JUA A;  3K3W A;  4J7K A;  5B1N A;  5HFM A;  3EVK A;  3UT5 B;  1NLX A;  5DLJ A;  2JGD A;  5E79 Z;  1URF A;  4HZ3 A;  3V5Z A;  3CHX A;  2IXN A;  2VB6 A;  4X88 A;  1T5O A;  2GSM B;  5J9P C;  2ZD9 A;  3HKD B;  1NJI W;  2EPN A;  1YYX A;  2R7V A;  2Q00 A;  3IQT A;  2E75 B;  2ZXO A;  4I4T A;  4CC6 A;  3NMJ A;  2R7R A;  2NUP B;  5IYC O;  1O9H A;  3DAF A;  1OW7 A;  1WNS A;  4FFK A;  2CH7 B;  4L6R A;  2XL4 A;  4H37 A;  1OQC A;  1FMW A;  1A7V A;  4UV9 A;  1AVM A;  4MVO A;  2ZE5 A;  5BUO A;  2B0J A;  2WAM A;  2EIL C;  1FD9 A;  2GUZ A;  3S28 A;  3JAS B;  2ZXR A;  4YL0 A;  4K3A A;  3S29 A;  3QTC A;  3UGP A;  3TJ5 A;  2Y69 C;  1YJW V;  4LP8 A;  2JK5 C;  3FDQ A;  5D91 A;  4NXM B;  1MNG A;  4JRZ A;  2G62 A;  4G7O F;  3ZG1 A;  1ARO P;  2BTQ A;  3ZCC A;  5COM A;  1Q86 W;  3UM7 A;  2FB5 A;  1QNM A;  3L8I A;  5B3S C;  1JOY A;  3U2L A;  2KC3 A;  4DOZ A;  3H1I H;  4DW0 A;  1PNM A;  5COG A;  1C02 A;  4U5B E;  1BZK A;  5GTH Z;  4H54 A;  4QI0 A;  3K03 A;  3TOL A;  4PA9 A;  1ZUQ A;  3FHD A;  5FPO A;  3JTL O;  1QVG U;  5BQG A;  3CME V;  1YJ9 V;  2R02 A;  2R7X A;  4P9O A;  1L1F A;  4IRU A;  3MHH C;  3I5P A;  2YS8 A;  1IDS A;  4JI3 O;  3JAW A;  2QJ1 A;  3AK3 A;  4FFB B;  3SPG A;  1HE9 A;  3TK1 A;  3B9Q A;  3M15 A;  1MZF A;  4UB6 Z;  4I44 A;  3UMH A;  3VRC A;  1L0L H;  1TUB A;  4D7S A;  4X9Q A;  4IT5 A;  4R8C A;  2KYH A;  2IXP A;  4R50 A;  5EIB C;  4DV1 O;  2P22 C;  3OR6 C;  1YI2 V;  4F6E A;  4ANJ A;  1FXK B;  3W7U A;  1FYJ A;  5LL6 Y;  2P7V A;  3AG2 B;  3FKS G;  2KKW A;  2RJZ A;  3LDD A;  4HYO A;  2QE7 G;  4LNU A;  1I0H A;  4G7Z F;  3JAL A;  4NTY A;  4HNA B;  4BJ5 C;  1JPJ A;  1HNW O;  1WWP A;  4XQ1 A;  3CSX A;  1HR0 B;  2DMX A;  3L74 H;  1D0X A;  3PDM P;  5LYJ A;  2LW1 A;  2EIM C;  2KSF A;  2IYL D;  3SZR A;  5JWP A;  2J7P A;  3D3Q A;  5JH7 B;  4O4L A;  5IJ9 A;  5KX5 B;  2AP3 A;  5E33 A;  3DKA A;  4IIJ B;  1DOV A;  3CC4 V;  4PD4 F;  4LDK A;  4JVS A;  5LGN A;  3JAR A;  3JAM N;  1DLB A;  1FFX A;  4PFP A;  2Y3G A;  1H8E G;  3F47 A;  1SR2 A;  1UG7 A;  3HKK A;  1WAZ A;  4IIJ A;  4CIH A;  4LBE C;  3U0Z A;  2EBO A;  5J2T A;  1MNE A;  4BJT A;  3HKC B;  3U3B A;  3LNR A;  1OCZ C;  2GBO A;  5KLV H;  5LMU B;  4OIO F;  1J8M F;  5CB4 A;  5JJN B;  2LJ2 A;  3HKC A;  1D0Z A;  4E0I A;  2UXB O;  1GAX A;  2AWY A;  3LEO A;  1KD1 W;  3OAA G;  3OM3 B;  2NPU A;  5BY1 A;  2PGG A;  1QQC A;  1GN2 A;  4NY3 A;  4RD9 A;  3ZRX A;  1K04 A;  1OCR B;  4FM1 A;  5J2U B;  4FAP B;  5D5P A;  4UUJ C;  4CS9 A;  3HTK C;  5KYU B;  2DYR B;  1NU1 H;  1VQ5 V;  1NFN A;  2JX0 A;  4FFB A;  4LER A;  5K0I A;  3U8V A;  3TK0 A;  1VF6 C;  2AVK A;  4O4L B;  5KX5 A;  3UR3 C;  4FLZ A;  5LA6 A;  3AG7 A;  2EIK C;  3EHB B;  4I50 A;  5K1X A;  1A7E A;  1S5H C;  3FB5 C;  4GZR B;  2JEU A;  4XPY A;  3NRH A;  3F5T A;  3MDS A;  3RW0 A;  2HFI A;  4LR3 A;  3CYO A;  3FFQ A;  1QR8 A;  1Y67 A;  3CC7 V;  4TV9 B;  2ZIM A;  1LVK A;  4R6Z A;  1MZE A;  2XRH A;  1O3U A;  4DR5 B;  1SQF A;  5LXT B;  5KA5 A;  4RO2 A;  3THO A;  5KAI Z;  3R66 A;  1JFF A;  3E9V A;  1Y74 B;  2FML A;  1H2L A;  2Y39 A;  4IWB A;  2R7S A;  4DR3 B;  1HMD A;  4XEF A;  2M6Y A;  4LH7 A;  1H2M A;  5E2Q A;  3W8I A;  1F4N A;  4PJJ A;  2UXX A;  4X64 B;  4OIR F;  4Z9J A;  5JVD A;  3K0D A;  2CDY A;  2QWN B;  2WLN A;  5JJJ B;  3L75 H;  1ZHZ A;  5KYU A;  1V55 C;  2F43 G;  4PJN A;  4WBN A;  1BHB A;  1VQ8 V;  2BE5 F;  1OR2 A;  3EG9 B;  5A69 A;  4A5U B;  1XMQ B;  4DR6 O;  1M4U A;  3SXM A;  2XLD A;  2ZQM A;  1LIH A;  1N4C A;  2B5U A;  2YIA A;  4O4H B;  1OJH A;  3EGX B;  4N06 A;  3LS0 A;  1J95 A;  4YT8 A;  1H8H G;  2ITD C;  3UMI A;  1AIL A;  3L1M A;  3X1O A;  4YHH O;  1XMO B;  4ZI7 B;  3C63 A;  4MVQ A;  4LDQ A;  1TQG A;  4PDV A;  4X1I A;  3A0H Z;  1ZW2 A;  3K66 A;  1RMV A;  1EZJ A;  2BC5 A;  3U8P A;  4D7T A;  5CBF A;  4BPM A;  2PYJ A;  4LC1 A;  1R3J C;  3ASN C;  3OFN G;  4LF6 O;  3AG4 B;  3UO2 A;  1ZL8 A;  4X1I B;  3KG2 A;  3T2M A;  1VYI A;  2LO1 A;  2QSA A;  3UQ8 A;  4I0X A;  4AQY B;  2YIC A;  3HLZ A;  4H13 B;  2J45 A;  3JD4 A;  3GM2 A;  5CN0 A;  4JAS A;  1K8A W;  2IOQ A;  4DR5 O;  2YRF A;  3GM3 A;  1N36 O;  1AJN A;  3UT5 A;  2H7O A;  4EB6 A;  2UXC O;  2H8A A;  2QM7 A;  3EPV A;  1Z3I X;  4GKK B;  3HJC A;  4JI6 B;  4A2N B;  1V74 B;  1U97 A;  2Q0A A;  3TJT A;  5LP6 B;  1W2B U;  1VLT A;  3CJH A;  5COF A;  3C8G A;  4KNV A;  5BQH A;  4TV8 A;  3T1H O;  1N34 O;  3STL C;  4CH4 A;  3T6B A;  4EWC A;  5JVE A;  3NMI A;  3DD7 A;  3CP1 A;  4U3J A;  1QZX A;  3CCM V;  5B5E Z;  5C93 A;  4MVZ A;  2LP4 A;  1BDJ B;  3S84 A;  2HR3 A;  1ZZP A;  2UU9 O;  2UXN A;  4AE4 B;  3CC2 V;  3ABM C;  2R9I A;  3QO5 A;  3FB8 C;  3H01 A;  5DED A;  3CCE V;  3RIP A;  2RN9 A;  1G4Y B;  4BEM J;  2LQT A;  3QW0 A;  2P5O A;  2AXT Z;  3N24 A;  1I5Y A;  5IJ9 B;  1R6K A;  1N1C A;  5LXT A;  5IT9 N;  1TKN A;  2OEV A;  3Q7L A;  3SJA C;  1OHH G;  1OCR C;  3SYO A;  4O2B A;  3VQV A;  2LW7 A;  4O6Y A;  4WCE V;  3NYL A;  3G67 A;  1X59 A;  3J06 A;  1S77 D;  3T4R A;  1U89 A;  1H6G A;  3KZI Z;  1IZ3 A;  2ADP A;  3K5N A;  5H2F Z;  1VTM P;  3FYE B;  1V4A A;  4OPH A;  4RAI A;  3T1Y B;  2XOK G;  1G8M A;  1QCE A;  1GN3 A;  2XLE A;  3CWB H;  3CE2 A;  5KYX A;  4MW3 A;  1DF5 A;  1D1A A;  4HAM A;  3C7J A;  3QVY A;  2WSS G;  3PJS K;  1YAR O;  3RQG A;  2ZR2 A;  1JRA A;  1PD1 A;  1GKF A;  4DV7 O;  2UUA B;  2BSK B;  1AI5 A;  4I9W A;  2IM8 A;  4KL1 A;  2DGJ A;  3CEX A;  4XTK A; 
#chains in the Genus database with same CATH homology
 4PA7 A;  3QO8 A;  5BZB A;  1KQS U;  1GTO A;  2IU3 A;  4PDM A;  1GMG A;  1VQ7 V;  1I5X A;  1KC8 W;  1XL6 A;  1KP2 A;  4MVS A;  2WLL A;  1RPR A;  5EBL C;  4JAV A;  1NR1 A;  2X7R B;  2V1D A;  2W0F C;  3OEH G;  1W0K G;  1WPX A;  1VQM V;  3OR7 C;  3CCV V;  1Q7Y W;  2C2A A;  4WFA V;  1YIT V;  3ZMS A;  5H9C A;  3CCU V;  3WFV A;  4E2L A;  3FYI B;  4ASU G;  3ABL C;  3ABK B;  1OCO B;  3AG2 C;  4PA3 A;  3QNE A;  2WWW A;  4JPR A;  3E2E A;  3ZMZ A;  2B1I A;  3JD0 A;  1JX9 A;  3SYA A;  4XBF A;  4OXS A;  2QM8 A;  1AR1 B;  3B77 A;  2HKO A;  3R65 A;  3LSS A;  3ML0 A;  4XDL A;  5L3D A;  1QVF U;  2EZP A;  3HB3 B;  2HJF C;  2IH3 C;  4JYB A;  2EIJ C;  4YXW G;  1ZWI C;  3CD6 V;  1OCC C;  3EFF K;  4DO2 A;  4N23 A;  5LGT A;  3E8F A;  4JF3 A;  2HFE C;  2JDI G;  1QR9 A;  2XAQ A;  2OTJ V;  4PDL A;  1PNL A;  2HVK C;  2MK3 A;  2OTL V;  1GM8 A;  1PL0 A;  4JTA B;  1OCC B;  3F7V C;  1F4M A;  5DM6 V;  1F51 A;  1VQK V;  2H94 A;  1M90 W;  1R3K C;  2IJH A;  1FXH A;  2HLD G;  2WLI B;  1MAB G;  1R73 A;  3X2Q C;  5B1B B;  4RUF A;  4UVC A;  4RQF A;  1OCO C;  2A9H A;  2XAJ A;  2Y69 B;  2EIN B;  3E83 A;  1YJN V;  2EZO A;  3RVZ A;  2EIL B;  1GM7 A;  1SRY A;  1YHQ V;  3K04 A;  1Q82 W;  4TT3 G;  5CBG A;  4F4L A;  5CMU A;  2X0L A;  3JD3 A;  4GT1 A;  3B8N A;  3CCJ V;  2JJ1 G;  2M7W A;  4PA6 A;  4BW5 A;  1YTF D;  2CK3 G;  1AJQ A;  3ZIA G;  2DYR C;  1V54 B;  2WLL B;  2Z5U A;  4P9P A;  2XAS A;  2ZR3 A;  2IJK A;  1IXM A;  1S0V A;  2ZDI C;  1MSW D;  1GM9 A;  2JJ2 G;  2WLH A;  4CZZ A;  1K33 A;  4MTF A;  1FXK C;  1RM1 C;  2WPD G;  2XND G;  2OT5 A;  1ORQ C;  3ZRS A;  1M9N A;  5EC2 C;  3IGA C;  5LHI A;  2ATK C;  2XAG A;  1CPY A;  3K3W A;  5B1N A;  5HFM A;  1W0J G;  1Q81 W;  2LP7 A;  3AG4 C;  4HZ3 A;  1NH2 D;  3GB7 C;  4X88 A;  2WLI A;  3D36 A;  2GSM B;  5J9P C;  1PKX A;  1FFT B;  2ZD9 A;  3ETG A;  3W7S A;  1EBO A;  4GX1 A;  1NVP B;  4I5S A;  2P90 A;  4Q20 A;  5E1A C;  1SES A;  3ZMT A;  1KKD A;  1NJI W;  1VQO V;  4PDR A;  1B6Q A;  3WG7 C;  3E8B A;  1AI7 A;  3K0G A;  3T4D A;  4ZKI A;  4QPK A;  3BEH A;  2BOB C;  4MTX A;  5IYC O;  2X6B A;  3VOU A;  1THZ A;  1E1Q G;  1CEZ A;  2Z3Y A;  4H37 A;  2XAF A;  5CA3 A;  4UV9 A;  3RBZ A;  1N8R W;  1GO3 F;  2FTK A;  3MD0 A;  4MVO A;  2EIM B;  2WAM A;  2EIL C;  2YEV A;  1FXV A;  3JCZ A;  5B1A B;  5B1A C;  4MVR A;  1DF4 A;  1H38 A;  5LGU A;  2DYS C;  1COW G;  4X89 A;  2K1E A;  3ZRV A;  2Y69 C;  3RVY A;  1YJW V;  4LP8 A;  2IJI A;  2JK5 C;  2HG5 C;  4GX5 A;  1K5Q A;  2AHZ A;  1VQ6 V;  1K5S A;  2WLJ A;  1M56 C;  1ARO P;  1R3I C;  5B1O A;  1M57 B;  4LCU C;  4UXN A;  3ZCC A;  4UVA A;  1Q86 W;  3UM7 A;  4QNH B;  1JPX A;  1KP3 A;  2Q69 A;  5B3S C;  1S3J A;  4WFF A;  1P7B A;  4H33 A;  4XDK A;  3SPH A;  1JOY A;  1E79 G;  4DXW A;  1PNM A;  5CBH A;  1CP9 A;  3K03 A;  4MS2 A;  4PA9 A;  1M1K W;  3BY6 A;  3AG1 B;  3ZN1 A;  3SYP A;  1NH2 B;  1QVG U;  3P32 A;  3CME V;  1YJ9 V;  3HPL C;  3JD2 A;  4P9O A;  1L1F A;  1UJW B;  3TET A;  3MHH C;  4G28 B;  3ASN B;  4WFB V;  1NVP D;  1BMF G;  5EC1 C;  3SPG A;  3TK1 A;  1K9M W;  3OUS A;  3K79 A;  2GHY A;  4R8C A;  1PD3 A;  1YTF B;  4R50 A;  4U7N A;  3CXC U;  1S76 D;  2IU0 A;  1LNQ A;  3OR6 C;  1YI2 V;  5B3S B;  1FXK B;  4BIU A;  3W7U A;  2QA4 V;  1BL8 A;  2A79 B;  3AG2 B;  3FKS G;  3SPJ A;  3LDD A;  4HYO A;  2ZXW C;  2QE7 G;  1RPO A;  2PI4 A;  2LFR A;  4FPP A;  3K9A A;  5IYB O;  3UKM A;  4GX0 A;  2JEX A;  3CCR V;  1K34 A;  4KP4 A;  2AHY A;  3E8H A;  3SPI A;  1GK9 A;  1EFR G;  1OZ0 A;  2EIM C;  2P6J A;  4JYC A;  2IH1 C;  3IC7 A;  2YEV B;  1FXK A;  1AI4 A;  1JVM A;  2KB1 A;  3E8G A;  1NKD A;  1WLE A;  1OCZ B;  3CC4 V;  1QLN A;  5B1B C;  5LGN A;  3ASO B;  2X6C A;  4MT8 A;  1YIJ V;  3I55 V;  1DLB A;  4G27 B;  3OUF A;  4GX2 A;  4UV8 A;  1H8E G;  1JQ0 A;  4MTO A;  5IYD O;  4TWK A;  2QEX V;  4LBE C;  2JIZ G;  4N21 A;  2EBO A;  1JCH A;  4X8A A;  3ZN0 A;  5EBM C;  3SPC A;  1OCZ C;  3ETE A;  3ZJZ A;  4WFG A;  3CCL V;  3JYC A;  4FIP C;  2HVJ C;  4J9Z B;  1MOF A;  2OCC C;  3ZMU A;  5LHG A;  2YSU B;  4XDJ A;  2EIK B;  1KD1 W;  3OAA G;  3OM3 B;  5EBW C;  2EIJ B;  3SYC A;  5L3C A;  3LDE A;  1K97 A;  3G4S V;  3I56 V;  1NQT A;  3ZRX A;  4PA4 A;  1OCR B;  2W6I G;  3TCU A;  3LDC A;  4BAY A;  4UUJ C;  4FJC C;  5GW7 A;  3T4Z A;  2DYR B;  3ABK C;  1VQ5 V;  3ABL B;  2Y48 A;  3LUT B;  1ENV A;  1ROP A;  5KUM A;  2NLJ C;  3W7W A;  2BOC C;  1R3L C;  3IFX A;  5IY5 B;  3CMA V;  1XL4 A;  3OEE G;  1K73 W;  3B8M A;  3OMN B;  2PI5 A;  3DTU B;  1TUE B;  2EIK C;  3EHB B;  3G6E V;  1S5H C;  3FB5 C;  4WF9 V;  2JEU A;  3GWO A;  5IY5 C;  3RW0 A;  2OCC B;  5KA6 A;  3LSQ A;  5L3B A;  3CYO A;  3CCS V;  1QR8 A;  3MHS C;  3CC7 V;  2EIN C;  2QTO A;  4R6Z A;  2B1G A;  3FB6 C;  4GCZ A;  3ABT A;  4EKW A;  1K4D C;  2R9R B;  4R7C A;  4FK5 C;  5KA5 A;  4RO2 A;  2XAH A;  1QBZ A;  2P67 A;  3E35 A;  4QJF B;  3STZ C;  3AG3 C;  3OMI B;  4KUM A;  1BHA A;  1K7D A;  5LHH A;  2Q6A A;  1F4N A;  3CPW U;  3K06 A;  2UXX A;  3VBB A;  4Z1M G;  1SER A;  4P2Z A;  4U7O A;  3K0D A;  4ZBM A;  2Q68 A;  2WLN A;  1E1R G;  1R6N A;  3ZMV A;  3OMA B;  1V55 C;  2F43 G;  3ZRW A;  1BHB A;  1VQ8 V;  5L3E A;  4JTC B;  3ETD A;  1NR7 A;  1M57 C;  3NXS A;  2ZQM A;  1S72 V;  1FS0 G;  3W7X A;  1PNK A;  3OW2 U;  2B5U A;  1KEC A;  3ASO C;  5H6R A;  2ITC C;  3WG7 B;  1J95 A;  1H8H G;  2ITD C;  5FL7 G;  2W6J G;  5KUK A;  4MSW C;  4MVQ A;  4PDV A;  2DYS B;  3W7T A;  3QO7 A;  3DGE A;  3G71 V;  5HFL A;  1EZJ A;  5CBF A;  5L3G A;  3ABU A;  3F5W C;  1VQ9 V;  5L3F A;  3AEI A;  1R3J C;  4LC1 A;  4QE9 A;  3ASN C;  3OFN G;  3AG4 B;  1F23 A;  4JGS A;  3ZRW B;  3T2M A;  3KG2 A;  5H6Q A;  3T1C A;  3M99 B;  3K08 A;  5EK0 A;  2ZXW B;  4FMT A;  1SZT A;  3JD4 A;  5CN0 A;  3AG3 B;  4JAS A;  3P30 A;  3SYQ A;  1K8A W;  4WFE A;  1QLE B;  4KFM A;  1AJN A;  4MW8 A;  3LNM B;  2QM7 A;  1W2B U;  1M56 B;  1V54 C;  2WLM A;  3STL C;  1QLE C;  4TSF G;  1YSC A;  4L87 A;  4QIW F;  3CP1 A;  4J9Y B;  1K3E A;  3CCM V;  2D3O W;  5DN6 G;  5C93 A;  4BIZ A;  4MVZ A;  2HR3 A;  3OE7 G;  2UXN A;  4QPJ A;  4CBC A;  3CC2 V;  3AG1 C;  3ABM C;  1HWY A;  2R9I A;  3QO5 A;  2DW4 A;  3FB8 C;  2X6A A;  3SJQ C;  3OGC C;  3H01 A;  3CCE V;  1H2G A;  3E89 A;  1DTO A;  2H8P C;  4WFH A;  3A0R A;  4PEL A;  1G4Y B;  2ZDI A;  1I5Y A;  1R6K A;  1VQP V;  2A0L A;  4MVU A;  3D3I A;  1VQN V;  1K92 A;  1OCR C;  1OHH G;  2WLK A;  3X2Q B;  3SYO A;  1SET A;  2DWD C;  5LBQ A;  1V55 B;  4MVM A;  4WCE V;  2DQ3 A;  1AI6 A;  1S77 D;  5IDJ A;  2DQ0 A;  1P4R A;  3E86 A;  2DWE C;  2QKS A;  2IW5 A;  3CCQ V;  3FYE B;  4RQE A;  3ABM B;  4JTD B;  1Y66 A;  4P30 A;  4G2K A;  2EJR A;  4RAI A;  2XOK G;  1G8M A;  1QCE A;  2P7T C;  4UVB A;  3JD1 A;  4RUE A;  2LFS A;  1JJ2 U;  4MW3 A;  3FB7 C;  1DF5 A;  1NBM G;  1AJP A;  4HAM A;  4JAU A;  1K4C C;  2V7Q G;  2WSS G;  3PJS K;  2IJJ A;  2NNU A;  1RM1 B;  1VQL V;  2ZR2 A;  1GKF A;  1MG1 A;  1Y4M A;  1AI5 A;  3F7Y C;  4I9W A;  4MTG A;  4QE7 A;  2Q67 A;  1VQ4 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...