3BEHA

Structure of a bacterial cyclic nucleotide regulated ion channel
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
222
structure length
222
Chain Sequence
LRIYAPLNAVLAAPGLLAVAALTIPDMSGRSRLALAALLAVIWGAYLLQLAATLLKRRAGVVRDRTPKIAIDVLAVLVPLAAFLLDGSPDWSLYCAVWLLKPLRDSTFFPVLGRVLANEARNLIGVTTLFGVVLFAVALAAYVIERDIQPEKFGSIPQAMWWAVVTLSTTGYGDTIPQSFAGRVLAGAVMMSGIGIFGLWAGILATGFYQEVRRGDFVRNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transmembrane regions of a bacterial cyclic nucleotide-regulated channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Membrane protein
molecule keywords Mll3241 protein
total genus 80
structure length 222
sequence length 222
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3behA02
1.20.120.540 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels 3behA01
4RO2A 3WG7C 4MTFA 5KUKA 3UM7A 4MVSA 5CBFA 4EKWA 3SYPA 2Q68A 4MTOA 4KFMA 4UUJC 3R65A 2K1EA 3EFFK 3FB5C 4LP8A 4MS2A 3E8BA 4WFGA 3RBZA 4QNHB 5IY5C 2Q6AA 3K06A 3LDEA 4XDKA 5EBLC 1OCZC 3FB6C 3UKMA 2AHZA 4H33A 3T1CA 2BOCC 2AHYA 3SPJA 2WLIA 2HJFC 4HZ3A 5CBGA 3RVZA 3LUTB 3SYQA 4PA9A 4X88A 5E1AC 2IH1C 2EIJC 3HPLC 1BL8A 1R3IC 3K03A 1K4DC 4G27B 1R3LC 4I9WA 4ZBMA 2HFEC 1KKDA 4HYOA 2ITDC 3AG2C 3AG3C 4P30A 3T2MA 3SYOA 2X6CA 4LBEC 3SPCA 2DWEC 3SJQC 4PA3A 4RUEA 2A9HA 2WLHA 3LNMB 2IH3C 4CBCA 1OCOC 4MVRA 4H37A 3E86A 2X6AA 4MW8A 4MVUA 3ZRSA 2A0LA 4F4LA 2BOBC 3TETA 4X89A 2HVKC 3JYCA 3TCUA 4MSWC 2Y69C 3KG2A 4OXSA 4GX1A 1S5HC 5EC2C 2Q69A 3F7YC 3OUFA 4R6ZA 3K0GA 1ORQC 2WLMA 3ZJZA 2EIMC 2ZXWC 3SYAA 4PA4A 3K0DA 2WLNA 3E83A 4RUFA 5B1BC 3E8GA 1QLEC 4MVZA 5J9PC 3LDDA 3ASNC 3OR7C 2P7TC 4R7CA 3ABKC 2A79B 3STZC 3BEHA 4JTAB 2WLIB 3ABMC 2DYRC 3T4DA 1M57C 3F5WC 3OGCC 2WLJA 3GB7C 1V54C 2KB1A 4PDVA 2WLLA 4PDMA 3OUSA 2H8PC 2HG5C 2ITCC 2Q67A 3E89A 2WLKA 4GX2A 4J9YB 2EINC 4JTCB 4QE7A 4XDLA 3SPHA 3VOUA 3STLC 2R9RB 3E8FA 2DWDC 3IGAC 1G4YB 2JK5C 1JVMA 3ABLC 5BZBA 4BW5A 1V55C 3E8HA 4WFEA 4MVQA 1R3KC 2QKSA 2ZD9A 4GX5A 2X6BA 4G28B 4WFFA 3SYCA 2WLLB 4DXWA 4PDRA 5CBHA 2EILC 4P9PA 3LDCA 4TWKA 1XL4A 4XDJA 4P2ZA 3IFXA 4MVMA 3K04A 5B3SC 4PA7A 1OCCC 1K4CC 1M56C 4JTDB 5EBMC 5EBWC 4GX0A 3RW0A 3SPIA 2YEVA 4J9ZB 4PDLA 3ASOC 3T4ZA 2QTOA 4MTGA 3PJSK 4R8CA 4RAIA 2HVJC 2ATKC 5EC1C 2W0FC 5EK0A 1LNQA 3AG4C 3OR6C 4X8AA 3RVYA 5KUMA 1ZWIC 3FB7C 1J95A 2DYSC 4WFHA 4P9OA 4PA6A 4MW3A 5B1AC 1P7BA 2OCCC 3AG1C 4MVOA 3X2QC 4QE9A 3F7VC 3K08A 1XL6A 2NLJC 4R50A 1R3JC 4LCUC 3SPGA 3FB8C 1OCRC 2EIKC
chains in the Genus database with same CATH superfamily
1EN4A 1PV3A 4FM0A 3NYJA 3BHPA 4I9QA 5DLJA 4UCVA 5F5HA 1YA7O 1NU9C 5FZTA 2EILB 2ETNA 3G4ZA 3E22A 3GVMA 1K5QA 2J7PA 5TJ5E 3EGDB 3IAYA 1HR0O 2XAFA 1YLMA 2R7QA 1DF5A 3L74H 3RYIA 1XMOB 3ZMSA 3K57A 1HNXB 1MZFA 3Q4HB 2HFEC 2ZNJA 1FR0A 1I7FA 3ZIAG 2IM8A 5IJ0A 1N32O 2DWEC 2CDQA 4JZGA 5ITZA 2DJVA 3QTCA 4DR1B 3U0CA 3U8VA 1PL4A 2YSUB 5FCLA 3F5TA 4DV0O 2D4UA 2PZSA 5CI8A 1I0HA 2HHHO 5KLVH 2Q00A 2PI4A 2WLMA 1NR7A 2EZPA 5IE9A 2XM0A 3APOA 1IURA 1BQ0A 3O55A 4K35A 4R7CA 1VQ6V 3UMHA 4U5FE 1SF9A 4X1KA 4RWUA 2DYRC 1PP9H 3CC2V 2PNOA 3D8CA 1EN6A 2CYDA 4OPHA 1YEWA 4JURI 4DV4O 3Q6MA 3L8IA 4L87A 1T9KA 4LF4B 3VOUA 1N33B 1FFTC 4NTWA 2EINC 3M4CA 1QLNA 4J7ZA 1H2NA 1G4YB 4O6YA 1HP8A 4J10A 2KGOA 1Y74B 2DYSB 5L3BA 1H2SB 2Y0IA 4X1IB 2HJMA 3S3WA 2QE9A 3A0RA 3EH1A 5EBMC 3SPIA 2ODMA 1OXKA 2ZQMA 1PCXA 1TFOB 4JYYA 3RN4A 4U5GA 3T4ZA 1VF6C 5KYYB 4OX9B 1N8RW 4OIPF 3VAYA 2B9ZA 2Q9BA 3KZIZ 2OTJV 4EFBA 3DMDA 4TUYA 3U10A 3DAGA 3CRMA 3FB7C 1JX9A 2VQEO 3ZCCA 2OCCC 1K34A 3T6GB 3W7TA 2HUJA 5BQIA 1YDXA 3SPGA 2CCYA 1JJ2U 1FXHA 1YTFD 1Z63A 3EGDA 1S05A 2LFRA 3ATPA 4KNWA 4IYHA 1WATA 5HV9A 5AC5A 4JZAA 3B09A 2Q6AA 2E5LB 3KPHA 1P84F 2CGNA 2QWNB 3BCCH 4X66O 3DGEA 4LF5O 1RJ9B 2AXTZ 4JZ2A 1HE1A 2B5UA 3RH3A 2AHYA 3QG5A 4B3SB 2F93B 3G4XA 3CPWU 4U5DE 1F1MA 1W0JG 1AVOB 3Q7GA 5COGA 2HMQA 4CS9A 4ZBMA 3BRCA 2ZM6B 2VWJA 1K05A 2UUAO 4K3AA 4I3MA 3OMIB 5KX5B 1QVXA 4X65O 1G8MA 3I5DA 4W8KA 2IJHA 1QKRA 4FVMA 4A2NB 2OQMA 1M57B 3U11A 1L1FA 2EINB 4RUFA 2H3OA 3CHXA 4CS2A 4Z9IA 4K7BA 1RKCA 1AP5A 2EIMB 4NXNB 1BR1A 1IBLO 1C03A 2HJ3A 5IYBO 5A2QN 3PN1A 2BSKB 3ETEA 1V54C 4GUNA 1VQNV 3I56V 3HNIA 2W6JG 3NKDA 1CPQA 4C3DA 5DS4A 1I5YA 2QJ1A 4DRXA 4WCEV 1NVPB 5E79Z 4LACB 3TJ5A 3JATB 1AI6A 3JD1A 5EZYB 1WOLA 5L3FA 4FFBA 3BRJA 5JQGB 2IXOA 2D5RB 1RM1B 3FOPA 1Q7YW 2X0LA 2HZ8A 2IU0A 2LW1A 4J42A 2A0BA 2KYHA 4B08A 4JI3B 1XI1A 5LGNA 5LA6B 2Q8VA 2HFIA 4N4WA 4JYCA 3RFRA 4BIOA 3OTOO 1NZEA 3DWWA 1A41A 2Y3GA 5EK0A 1LNQA 2XLOA 1LE2A 2Z3YA 1P7BA 4YT2A 3AG4B 4K8XA 1NH2B 3NG1A 2WAMA 3NR7A 3C62A 4PJLA 2IJKA 2Y4UA 5JH7B 2YLDA 4PJJA 1VQLV 1PM9A 3OGIB 1VQPV 4MTOA 3ZHUA 3R65A 3EFFK 4MS2A 3HR0A 1KP3A 4LFCO 5T3WA 2EPMX 1ZUQA 3ZMZA 1AR5A 3JD4A 1P7GA 3A8TA 4FAPB 1HW1A 4IIJB 4OX9O 5COFA 5A69A 4BEJA 2XLDA 1GM7A 3CD6V 1AI5A 2QM8A 3LUTB 4EHPA 1IW7F 1Q0DA 3ZC4A 3KKYA 1VARA 2IH1C 4XPYA 2VQFB 1H9GA 4ICGA 3OAAG 2G3VA 4O6MA 2QWQB 5JVDB 4Q4ZF 1KMIZ 3GM2A 3QW0A 1YDIA 3MDSA 4PA3A 2YL3A 1N4CA 4YT8A 1FD9A 2YXLA 2HS5A 3BY6A 1NTMH 3F47A 4JV5B 4J7TA 3UT5A 4BJ6A 4LH6A 1M1KW 3ABUA 2UXDB 1FFXB 1ZSPA 1FNTc 1V54B 1YVWA 3TXQA 1WN7A 4TT3G 4JC7A 3VYWA 4DVZA 3W7WA 1YJGA 4R32A 3IQ5A 4RBNA 3K9AA 5JJNB 2AGAA 1K8AW 3UGPA 4PR9A 2NUTB 3JATA 3T4DA 4YHHO 2R72A 2IW5A 2KB1A 3MLGA 3FOOA 1Q6HA 3U3FA 3E89A 2WZGA 4LF6O 1APCA 2XAGA 3HKDB 3ZRWA 5KYXA 3CRRA 1WGWA 4DR1O 1XHZA 1JAFA 3HJCA 1OCZB 4YJ3A 3B8NA 4IAOA 4LF9O 1R3KC 1R73A 2RCVA 4P9PA 4JI7O 3ETQA 1OCRB 3HB3B 2FTKA 1ZHWA 2EIJB 4CS4A 1OKKD 2YC0A 4DUZB 3G67A 4JEBA 4OD5A 2Y3DA 4J9ZB 3K58A 2QM7A 4I0XA 4J41A 3IC9A 4M63A 5H2FZ 3E70C 3CP1A 4L6RA 3HKEB 4LH7A 3TGUH 4IRUA 3B0VC 4DUZO 4X8AA 2MYSA 1NLXA 1VQMV 1CPRA 3V7OA 3W7SA 1K33A 3ITFA 4I1MA 4P9OA 2GV9A 2E76B 5KHGA 5J2UA 5LYJB 4EWCA 5L0GA 2N05A 1VQ8V 3DM5A 3RFYA 3KKBA 5CIVA 4B3MB 2DQ0A 1OCRC 3I4UA 4IIJA 4BJ1A 3WG7C 5LHHA 3UM7A 2ZT9B 3UQ8A 1B68A 2CW0F 5B1NA 2R9AA 1Q0FA 2Y39A 2AZ2A 5LL6Y 2P61A 3K5MA 3UKMA 1TR2A 1YYJA 3T6JA 1RPRA 3SNHA 2X51A 3CJHB 2IJJA 1VQ5V 4DW0A 2CTPA 4AILC 4K0KO 4GYTA 2W4MA 2P4VA 1G6UA 5GONA 3ZG1A 1SQFA 2B1GA 1T6QA 3EG9A 4BIUA 4DR2B 4LBEC 1NR1A 5DEDA 4G0HA 3ZSUA 3ZEDA 3HNLA 1FXVA 1JR8A 1URFA 1TUBA 2IBZH 5T3TA 4NR1A 1FMVA 5JLIA 4OGQB 3LLIA 5FNVA 5LP6A 3TOLA 1N0JA 3TCUA 3ZQVA 2Y69C 5LMNB 2Z0AA 3LSUA 4GX1A 1TWGA 5AC4A 4IT5A 1YZAA 4LFCB 2BCCH 2KG7A 2MK3A 3BAAA 1LI5A 3ZDLA 3K5OA 2AVKA 4JI1O 1GMGA 2G38A 5HFLA 3W4YA 1FXKA 2OYQA 1WP8A 4BR6A 2VQFO 1Q6IA 4FLUA 5JP7A 4PDVA 1YTFB 4I50B 1FJGB 2UUAB 4NC3A 2ITCC 4LWSB 3CCLV 3EZHA 1X59A 1XILA 1JPJA 2TMVP 4C7UA 1ZLZA 3JAKA 2FFHA 2P0NA 3IC7A 2P6VA 4EBBA 1A7VA 2QKSA 4FLZA 4UB8Z 3X2QB 1A32A 2N74A 4BIZA 4D6TH 5B3SC 1RP3B 2GTSA 1AJQA 1ZZPA 2LFDA 3EVKA 2YEVA 2IXPA 5K0IA 4B3TO 1R5ID 1G4WR 2KC3A 4Q5SF 2IBFA 5KHHA 3AGTA 1GO3F 2CE4A 5KYWA 4NCQA 1VTMP 4RAIA 3BABA 4OPAA 3JCUQ 3K1HA 3FKSG 1FXKC 2KQ9A 4PJMA 2EBOA 3JSNA 1VQOV 4JIOA 1BCCH 1IXBA 4DR3B 3QZCA 4WFHA 1KYOF 3X2QC 2ZIOA 5FNVB 2IOQA 1R3JC 2F22A 4O4HA 3GWOA 4CDYA 5ITZB 2ZXWB 1RKEB 4JI6O 2DOSA 2AW9A 1AI4A 2NSGA 5D91A 3JASA 1JPXA 1MSDA 4QIWF 2BE3A 3ZRXA 3N24A 1SQBH 5BR8O 1EZVH 3DXRB 4AL0A 2OJED 2MWQA 1FXKB 2J9WA 1QCEA 2CK3G 1L0NH 3CCQV 4W4KA 1E86A 4B6IA 2YHSA 1T5OA 1GM5A 5L3EA 2AP3A 2XL6A 3Q6NA 1IDSA 2Y69B 2ITDC 3K7DA 5IJ9B 4AHCA 4CJGA 1XZQA 1NH2D 4IL6Z 2UU9O 2CNWA 4NVPA 2KSDA 3CRQA 3MD0A 1Z23A 3DC5A 1JOGA 2Q4PA 4LFBO 1M4UA 3ZRSA 5DM6V 2NUPB 3FYIB 4FFKA 3O10A 1R6TA 1RXQA 4DV0B 1S5HC 2Q69A 2LW7A 1WP7A 3T1HB 5JT4A 1U96A 4NXMO 3T6BA 256BA 3E83A 3ABMB 1LR1A 2L81A 2D2CB 1LS1A 2GSMB 3H1HH 3NYLA 2P7TC 5H6QA 1WTYA 4X64B 4WGYA 4BG0A 4TOIA 1Q90D 4X1KB 2Q7HA 1DF4A 3GB7C 2WVOA 1K04A 2RQ6A 3KMIA 4DR2O 3LNRA 1CGOA 2CH7A 4UCTA 3OEOA 4ZLCA 3IGAC 4CS3A 3CX5F 4BW5A 2LIGA 3SJBC 4AE4A 1DLBA 2YDEA 1DK1A 3N2GB 2EILC 3LDCA 4EFEA 2PYLA 4B3RB 4I55B 1ORYA 3CCRV 3I55V 3H2VA 4NTBA 1W0KG 2XT9A 4IYIA 2ZPAA 3JSEO 2OIEA 1FS0G 2ARHA 2QTOA 2BC5A 4DR7O 5KYYA 3BPZA 3L72H 2GBOA 3SGIA 5J2TB 4NY3A 1H6GA 4FLYA 4PI2A 1NBBA 2DB4A 2IYLD 2CUGA 3LSQA 3DTUB 3JYYA 1ZWIC 3V5XA 1RKEA 4ZLDA 2Z15A 3T1YB 1IBKO 3FAVB 2HLDG 1FTSA 2G62A 5A6JA 1SQGA 1O9HA 3D3IA 3RF3A 1HWYA 2R7VA 2J9VA 4GCZA 4JI8B 1IBKB 3RYFB 5D5PA 2K1EA 4N21A 3TQOA 4DV2B 4AQYO 1G5ZA 3EFOB 1XREA 2J45A 3U9JA 1QZXA 1UJWB 2UXCO 4JKVA 1GN2A 2VWKA 3P3NA 4JGSA 3CCSV 3M99B 5IJ9A 3G71V 3SYQA 1SR2A 3C8GA 2DMXA 1XMQB 4KBLA 5BY1A 1AJPA 3BA9A 1VLTA 2C2AA 1XZPA 2PP4A 2QY9A 5KYUB 1HDJA 4U7OA 3L0IA 3ZN0A 4P30A 3T2MA 5L0FA 1VYIA 2F1MA 2LFFA 3JZ0A 3N27A 1YAUO 1R1BA 2WLHA 2P1AA 1Y6XA 3HNKA 4JCZA 3MHSC 3E86A 2JEXA 3CZ6A 4RQEA 4G78A 1VMGA 4PI0A 3FYEB 4JAAA 2F23A 1PD0A 4XLNF 1LUVA 3TK0A 2J46A 1LI7A 3MFNA 5EZYA 2CGOA 4MSWC 4ZHQB 3UGOA 3K0GA 3Q4HA 1GS9A 2FAPB 1S5LZ 2DE0X 3CSKA 2HKOA 3ZRVA 1W2WA 1HNZO 4JRZA 3LJBA 1WB8A 3RYHA 2A79B 3U2LA 4JTAB 4JI4B 1TKNA 2GHYA 1AP6A 2W9YA 2UUBO 1XQ8A 3EGXB 1GH6A 4LC1A 2HG5C 2HP8A 1F4MA 2OT5A 1D5NA 2B0HA 3DJUB 4A4AA 4IARA 4DRXB 2Y0PA 4DR6B 3ABLC 1U6HA 4XBFA 5K1XA 2YIBD 3L71H 3SJAC 1FAPB 4P9FA 3IFXA 3DKAA 4MVMA 3FXHA 1K7DA 1OXBA 2QSAA 1NT2B 1QVGU 4J30B 4AK9A 4N6CA 4CDVA 4I4TA 2CTQA 4O4IB 3WFVA 3W8HA 4WABA 3ASNB 2ATKC 2VCCA 2F43G 1Y74A 3CS5A 2VH3A 2ZE6A 4YK5A 2LO1A 2RJZA 1IVSA 1T6IA 1XHXA 3R7CA 4UDVA 1TVKB 3JALA 3AG3B 3B9QA 4EKWA 4X65B 3RYIB 3NKEA 2H94A 3U3BA 1N36O 1E84A 4E18A 2ETSA 2GA0A 3LLKA 4DR7B 4YIOA 5KAFZ 2H7OA 4FZ0A 1H8HG 2Q7RA 5DS5A 4NTFA 1E79G 4BJTA 3C7JA 1JFFA 2HV7A 4LF9B 5KYNA 1YSCA 3H1KH 1QSPA 2IXNA 1R3IC 2HR3A 2Q7GA 4G27B 1Y4CA 4JI2B 3EHNA 4HYOA 4LF8B 1SC5B 4JI0O 3SYOA 2OOCA 2Z5UA 2A0UA 4ZHQA 2UXXA 4EIYA 4UB6Z 1PD1A 4JI6B 1L7CA 4LF8O 3RKOF 4O2BA 3J81N 5EIBD 4BPMA 4X9QA 3EZIA 1RMVA 1DOVA 4YJ3B 5JJEB 2VC9A 1S3JA 1KU2A 5EC2C 3U0ZA 4XWJA 2C04A 4NXNO 2XS8A 3ETDA 2XOKG 1R4TA 2PX3A 3LNNA 1H7IA 1NU7D 1Z5ZA 3LESA 5F5FA 3CRCA 3QNEA 3IPMO 1L3PA 1YJWV 3OGCC 3P30A 1WA8B 2UUIA 2H8PC 2Q67A 3H1IH 2ICWG 1I5NA 4JI4O 1I4YA 1Z5WA 1TA8A 2YXYA 1VF6A 3JCZA 3UCSC 4MVQA 3W7XA 2R7OA 2PGGA 2LFSA 2ZE5A 4PDRA 5IYZB 1VF5B 5H5NA 3OTOB 4QI2A 3VQXA 1SQXH 1JFFB 1O87A 4DRIB 4FWVA 3V5YA 2BTQA 2XASA 1HE9A 4CJOA 1XNRB 3C8ZA 4LNUA 5K1PA 4D7TA 1CGNA 4D4NA 1AI7A 3OD4A 1GKFA 4D7SA 1E2XA 1IZMA 5CI9A 2ZIMA 3NDBB 3J7AU 4DR6O 1OJHA 3OMAB 2XSEA 1VF7A 1MMMA 4DV1B 4Z9JA 3FB8C 1MOFA 1K5SA 1F4NA 3VQVA 5IT9N 2EIKC 4HNAA 1I94B 3JD3A 1D0YA 4UVCA 2A6EF 1D1AA 2IU3A 3Q7LA 1W59A 4B3SO 3FAJA 2N04A 3E9VA 4UUJC 4WFGA 1N34B 4LF5B 4JAUA 2YL1A 4FLTA 4TV9B 4CH3A 1AVMA 3K06A 5DQZA 3FB6C 5A6BA 3B0UX 3T1CA 1M56B 3NXSA 1QPUA 3DM9B 3IEEA 2Y4TA 2VCBA 3MAQA 1TUEB 4DV5B 1UG7A 2GWWA 4D4XA 1E85A 4KUMA 4ULVA 4LF7B 4G7HF 4FFBB 4G2KA 4TV8B 2OEXA 3GM1A 4EEQA 4KHPB 2ZKOA 2BE5F 2A68F 3GWNA 1R3LC 1HMOA 3AG2C 1EM1A 1MABG 1E1RG 4F4BA 1WJZA 2FMLA 3D36A 5CB4A 1Q3EA 2A06H 4MT8A 3CC7V 3SJQC 2A9HA 4JV5O 1KNYA 1RSOA 3PHF2 1OCOC 2Q4FA 4UCSA 5IYZA 4UXNA 3MYFA 5EIBC 5IYDO 1VOMA 1VEWA 2RSEB 5DS6A 2P06A 1V9PA 3CRAA 5E3CA 1Q6UA 4YJ2B 3KG2A 1S0VA 1K97A 3H1JH 1FYJA 5JSLA 2LQGA 1H38A 2HV6A 5HFMA 3HKCB 2EIMC 3SYAA 1BZ4A 1MQVA 3AK2A 3DI5A 1QLEC 2A6HF 3K3WA 4XPWA 1Q0KA 3JARB 3LDDA 4HBNA 1QQ3A 5L0CA 2YEVB 1XUQA 3UO3A 2E74B 3K66A 2AZ0A 5KMGB 3QF7A 5L3DA 1SETA 5L3CA 1K9MW 3ETGA 1BDJB 1V74B 4PDMA 4X1YA 4JYAO 3SR2C 4LWSA 1E83A 4XDLA 1OCCB 2HJDA 3W2VA 1FFXA 1QVFU 4UV8A 4HFKB 3E8FA 2QA4V 1RFYA 3CC4V 1Q0GA 3ZHTA 4G28B 5CBHA 2R7UA 5C8YB 4EBKA 4YIPA 3RIPA 4N6HA 3B29A 3BVOA 5L0HA 5GTIZ 3GEIA 1XNQB 4C3EA 2XLMA 5B1AB 3WHNA 3CB2A 3JASB 2A1DD 5KAIZ 1KTMA 1A7EA 3F46A 1C02A 5LXTB 2QR4A 1AJNA 5CB4B 2Q9AA 1O3UA 3OR6C 4JEAA 3RYCB 2W0XA 4H0LB 5KHJA 2NN4A 1QBZA 2DYSC 3CSXA 3DE9A 1ZVZA 2IJIA 4J32B 4MVOA 3K79A 2ZE7A 2ZE8A 1N33O 4LCUC 4U5BE 4BEMJ 1O5HA 4O2AB 3AJMA 5KUKA 2EIKB 3G6BA 1D1BA 1LE4A 4CIHA 2JRIA 2FGYA 3HKCA 3U5SA 4ABMA 3JT1A 3E8BA 3RBZA 2HHHB 3HTKC 1EA8A 5CA1A 2A69F 4OIOF 3B4SA 3ZHVA 2DI3A 2QM4A 2XXAA 1RCPA 3PDMP 2YI8A 3HKDA 1Z6AA 5KYXB 4GKKB 1NG1A 1FFHA 4UCUA 2R02A 2GTAA 1LS4A 1MNDA 3M1CB 1Q81W 4U9EA 3JRTA 3KL4A 2R25A 2X6CA 4YY3O 2ZXOA 5CN0A 1U89A 4PV1B 2NSFA 2GAQA 1NTZH 5A6AA 4CBCA 4O4JB 3HKKA 1ZYRF 2WA4A 3QVYA 3HKBA 2X7RB 1JR9A 2EX3A 3E2EA 2BOBC 4PHZA 2J8WA 3ZMTA 4JI1B 4F6RA 1BGYH 1LUWA 5B66Z 2ZNIA 1XEQA 4JJGA 4Z1MG 3F7YC 1YVIA 1MMAA 2MW2B 1UPGA 2UXNA 3ZBHA 2QWRB 3ZJZA 1AR4A 2E87A 5BMVA 3T1YO 4PA4A 3DE8A 5JRAA 5B1BC 3US6A 2JPUA 2KNHA 3TJTA 3OR7C 3FVYA 3H9VA 2YZSA 2V4DA 3H2UA 1Y4MA 2J7PD 3SYNA 2XLEA 2K9PA 2WLJA 4DVYP 2HSBA 1BE3H 1SZIA 5IDJA 2LCHA 4Q6GA 2UXCB 3LAYA 1LPEA 2YLGA 1YXBA 1EBOA 2B0JA 3QO5A 4DYLA 4JVSA 2HEPA 4DXWA 4CX9A 4PK4A 3LS1A 2M4EA 4XDJA 1NKDA 2P90A 1SQVH 2E75B 1OW6A 4I55A 5H6RA 5LXTA 2CAZC 4B3RO 1Y6DA 5EBWC 4DO2A 1GN4A 4I1OB 3ZX6A 1NTKH 2R7XA 1BR4A 2QWPB 4B3MO 2W0FC 1ORSC 2LK4A 3C8GB 3H1LH 4LLEA 2FYUH 3NRHA 1AUEA 4FJCC 1YARO 4NQFA 1N32B 1TQGA 4CS8C 1R6NA 3QVNA 4DRHB 1T01A 4GZRB 4PA6A 4N06A 4QE9A 3WG7B 4DR5B 4U5EE 1XL6A 2NLJC 2QGNA 1WWPA 5E2QA 4DBRA 1Y67A 1GTOA 1UFBA 4WGZA 2KKWA 3M7MX 5DQTA 4DV3B 1OR3A 2AU5A 4H54A 3SYPA 3TK1A 1TWHA 3IQTA 1BBHA 5JQGA 2ZDIA 1XNRO 5GONB 1OCZC 2AHZA 1YJ9V 3FD9A 4E0IA 1YZCA 3SPJA 4DK1A 3NMJA 2YL7A 4X62B 1THZA 1KBHA 1G8XA 2HJFC 1LIHA 2JJ2G 4FX5A 1EI7A 2YI9A 4YL0A 3ZVRA 1TUBB 2A7WA 1ZU4A 1D0ZA 4FM1A 2EIJC 1SA0A 1YJNV 4U5CE 3ABTA 4WBNB 2JEUA 3BFRA 4I9WA 4FLXA 3KYJA 3QMKA 1E1QG 3VQWA 3EHMA 2HKVA 1SQQH 3WU2Z 1X4TA 2OU6A 4JYBA 1I94O 1GN3A 2R05A 4DUYB 3KCYA 4RUEA 3GEHA 3EGXA 5FL7G 4DW1A 3R2PA 5LGTA 3H01A 1TWCA 2P67A 4HFFB 1OZ0A 5GTHZ 1QHTA 2Y3HA 3FDQA 5LMNO 4DUYO 2QLAA 3K9SA 1N34O 1D0XA 4QGPA 4DV5O 2XLHA 4ULWA 1SZTA 4Z9HA 1Q86W 2YRFA 4XQ1A 3E8GA 4DR4O 5D5QA 5J9PC 3IHUA 4W4LA 4O4HB 1WPXA 5FPRA 2L7AA 4GQHA 5TISZ 1Q8IA 4K0DA 4TUYB 2V7QG 3JD0A 4J7KA 4JW1A 2EPOA 4CC6A 3S3XA 3L34A 5KA6A 4PJ0Z 4EB6A 2J9BA 3T4RA 5IYCO 2YVKA 1FJGO 5D92A 3N2KA 1J8MF 3OUSA 3RYLA 4J9YB 3MYIA 3A9CA 3OEEG 3SXZA 2M6YA 2UXBO 1AILA 5F28E 2R7TA 1BQZA 4U7NA 2ZINA 1JVMA 3KCXA 3D3QA 1NJIW 2XTAA 3NMIA 1YA9A 2ZD9A 1JRAA 2H7BA 5L0JA 5LHGA 1Q0MA 1JMKC 2WZLA 1U97A 2MHRA 1NZ6A 3RT3C 1OCCC 4WF9V 4JTDB 2L6HA 5T1DB 1HMDA 4WBNA 2AWCA 1JQ0A 4I4TB 3GANA 4R8CA 3JTLO 1DTOA 2NUPA 1MMGA 1D1CA 1YYXA 3N2GA 3MBGA 5KX5A 4FMTA 2NUTA 4BJ5A 3ZS8C 1KB9F 3UMKA 4LF6B 5L3VA 2NPUA 2CTRA 2Y48A 1B04A 2H7VC 4E7SA 1TVKA 3JALB 4YJWA 3G50A 3FB5C 4O2BB 2UUCB 4ONSA 4JJFA 1AEPA 2V1DA 1YI2V 1Z7Qc 1F51A 1NQTA 2Q0AA 3JAWB 4FIPC 4HZ3A 2DW4A 2WSSG 3DXJF 2GUZB 2I8BA 2LP4A 1QR9A 4DJ9A 2J0WA 1HNXO 2G3KA 4CC5A 4I5SA 1K73W 3ZHRA 3OTFA 2XRHA 3U2MA 4C7OB 1SS3A 2Q3TA 4H4KC 1HNWO 1DOWA 4MW8A 2JX0A 3U9MA 4E0HA 3M8AA 2WZFA 1EKYA 3TETA 2HVKC 4BW9A 4JI3O 1Y66A 1Y76A 2X0CA 4CSAA 1HNWB 4O79A 4X64O 2ZXPA 4I7ZB 2ZXWC 4RD9A 3FAVA 3K0DA 3N2KB 1ZW2A 3IQCA 4IB4A 3ASNC 1PL0A 3WODF 5IWAB 4QJFB 4AE4B 2R7RA 4YT4A 3E22B 3UR3C 1QR8A 2QE7G 3CCVV 2JS3A 4YY3B 4NTAA 1ORJA 5EYPB 4PD4F 3STLC 2V26A 1QU7A 3OA1A 5A9GA 2Y3BA 1FPOA 3ZMVA 2YIAA 4WFFA 3A0HZ 2X6BA 1ZX3A 2WLLB 2L6LA 4ZI7A 2R9IA 2PY5A 4P2ZA 1QQCA 4XLPF 3ZTZA 1ZU5A 2ADQB 2UXDO 5E33A 3L75H 4DK0A 5B3SB 4GX0A 4IAQA 3G80A 1NBMG 2L9JA 1J8YF 2QTSA 4Q20A 4LNUB 3OEHG 4UCOA 1PNMA 1QNMA 4X1IA 2J9UA 2EPNA 5JVDA 2XLWA 3GM3A 3AQBA 4LDKA 2OIGA 4JE9A 2IXMA 2J0XA 4XEKA 3GEEA 1H9TA 4C7OA 2JGDA 4MTXA 2AWYA 1VB5A 4C3BA 4EUKB 4J7JA 1O9GA 1TFKB 3CQZA 4Z1VA 2EJ7A 3K08A 2VQEB 3NYMA 4LERA 3P32A 4ER9A 4A5UB 5CA0A 5LMUB 4E17A 2OG2A 1N36B 3QVZA 4YWQA 1WAZA 3RQGA 4RO2A 4MTFA 3G6EV 1S7ZA 1JMWA 5IJ0B 1CP9A 1NI8A 1ZL8B 5EBLC 4XDKA 1YIJV 1UFIA 1SERA 1CEZA 3RVZA 2EULA 3JCUZ 3MX3A 4X88A 3K5LA 1S76D 3HPLC 4B7KA 1VMAA 4LF7O 1ZTEA 4DR5O 4J11A 5EGYA 2OTLV 1OKKA 1KP2A 2RN9A 3QO7A 3SPCA 3VM6A 1EFRG 3LNMB 1RSOB 4ZKIA 4OD4A 1FAFA 1PNKA 1H8EG 1KUQA 3I5PA 1M2VB 2LGWA 4IHJB 1QLEB 3AK1A 5JJJB 2UUCO 3JYHA 3A11A 1NFNA 4OXSA 4CS7A 2BL2A 1Q5OA 1V55B 2EPKX 4X0RA 3GODA 3SXYA 4R6ZA 1H2MA 3B40A 3S29A 3C3TA 4YN0B 3ZMUA 4FK5C 5L3QA 4G7OF 1MZEA 1COWG 1IBMO 1OW7A 1K92A 5AG2A 4DV7B 2YWAA 1XNQO 1PPJH 3G4SV 1IX9A 4P6IC 1R6KA 2WLIB 5DECA 3MHHC 3FHDA 2F4VB 2OJQA 1BR2A 1G1XB 1VIBA 2WLLA 2YUAA 4FZ1A 3SPHA 3H65A 4CIPA 3CE2A 2R9RB 4QPKA 1HW2A 2R7SA 3HLZA 3DC6A 4CH6A 3VBBA 1V55C 1M6TA 3NMKA 4JAVA 2PFDA 4LR3A 4HEAJ 4DV1O 1S72V 1WLEA 3C18A 5C8YA 3K04A 4GKJB 4PA7A 4LDQA 2O9XA 2GDSA 1Z3IX 3VF0A 1M56C 2W45A 1A7DA 5BR8B 3W8IA 3B71A 3QW1A 3AG7A 2RNBA 3S90A 4PELA 4NXMB 3M79A 5IWAO 3TJ6A 2CNWD 3RWRD 2PTMA 3LEOA 5LGUA 2NG1A 2VB6A 3EG9B 5EC1C 5CA0B 3OE7G 4PFPA 3ZQYA 1CPYA 3RVYA 2VRZA 1EN5A 1KC8W 1HW7A 1KU9A 3L9DA 1VQ4V 1ZHYA 1H2LA 4J80A 1MG1A 5H9CA 1FFTB 2FB5A 1VQ9V 1PNLA 3CXCU 3CCMV 4Q7CA 1G4US 2JD3A 3LSSA 2ZXRA 2I15A 3WB2A 3ZIBA 2W4BA 4RQFA 3S9OA 4XPXA 2B1IA 4KFMA 1M2OA 3JSLA 2KG7B 1LKXA 1ENVA 4FLWA 3M15A 1WA8A 4F6RB 2WVNA 3RQEA 1NFOA 3APQA 1XOUA 4QDLA 2XXAB 2W6IG 5GW7A 4OINF 2WLIA 4B3TB 1ST6A 3W2WA 3QTHA 2WB7A 3OT7A 1XBLA 2M64A 3E35A 4GEHA 1SRYA 5E1AC 1J5EO 1LM3B 2P6JA 2JIZG 3K03A 1K4DC 2PUSA 1YF2A 2DQ3A 1MA1A 3CXHF 4IHJA 2WVQA 5LOVB 4DR3O 1VYKA 4EBJA 3K1IA 4CZZA 5LA6A 1DGSA 3O9OA 3CMEV 4E4EA 3UO2A 1J5EB 1GGQA 5JCOC 4MVRA 1JOYA 5B5EZ 3HKBB 4MVUA 2OCHA 1BT8A 2BSKA 3VQYA 1N1CA 4X89A 1RM1C 3WB1A 3N2ZB 4TV8A 3C90A 2KK1A 5KHKA 3RYFA 2Q5ZA 2WA3A 2PYJA 5LHIA 4IJJA 3FAPB 2XUMA 4KNVA 3WAQA 3CCEV 3STZC 3BEHA 5JVEA 1TGOA 1GRJA 4DBQA 4NKGB 1Z2GA 4KL1A 3SZRA 3AG2B 2YLIA 2KW3C 3EXAA 1KECA 4WJ0A 1K40A 1YITV 3SXKA 2FL4A 2DWDC 5JCOA 2V3CC 1OCOB 1D5AA 1GM9A 3SJCC 3E8HA 4MQ9F 2E3CA 4YHHB 4GX5A 3ABKB 5EHHA 1L0LH 2P5OA 4IGGA 3ICXA 4JI2O 5FPOA 1MSWD 3V5ZA 4DV3O 4XTKA 5LBQA 5KMGA 4H44B 4DV7O 2LP7A 2UUHA 4W8PA 3J06A 4DRJB 4PDLA 3SDLA 2YXHA 3B2EE 3OFNG 4X1YB 1XMQO 1IBLB 1MMNA 3CEXA 4MTGA 5B1OA 4CH4A 4GKJO 1SKVA 4DV4B 4HNAB 2OKUA 1NVPD 4L8JA 3O6XA 3RYHB 5C93A 5KUMA 2R03A 3JSZA 4YJ2A 1NSGB 1J95A 2HSQA 4HAMA 4UVAA 5B1AC 3O65A 1Q82W 4TV9A 2LGQA 1ZHZA 5LP6C 1JPNA 1OW8A 4MVSA 4GKKO 2CDYA 4QPJA 4QNHB 4F6EA 2JS5A 5E3AA 2A3QA 4H33A 3RQFA 3S28A 2VS0A 3JAMN 4J7YA 4PJNA 3L8JA 4KI2A 4X20B 1JA8A 2YKZA 4O4IA 5CMUA 2R70A 4XEFA 3QO8A 1KKDA 3AG3C 1PV0A 1FMWA 2P22C 3EH2A 2DN9A 1NU1H 2IH3C 4I0XB 1ZHXA 3POVA 1SF8A 3ZTMA 3W7UA 4BJ6C 2A0LA 4ZOLA 2LJ2A 3HKEA 3JARA 4BWAA 1RJ9A 5B3IA 2GDCA 1ZHTA 3RYCA 1PD3A 1SESA 5BUOA 4H13B 3SEOA 2EZOA 3GWKC 1ORQC 1C17M 5KA5A 2QKCA 2YIDA 4TQDA 3AGUA 4FLVA 4HE8D 4MVZA 2JDIG 4O2AA 1FKAO 1VP7A 3L73H 4U5HA 3ABKC 3CCJV 3OWTA 4OIQF 2VASA 2LQTA 3KH2A 1M57C 4JYAB 2E5LO 1BHAA 4X66B 5CA1B 3K59A 1T5EA 3D36C 1KKCA 4JI0B 2WLKA 4QE7A 4JTCB 4JI5B 1VQKV 1WASA 2C03A 3C8GD 2XL8A 3S84A 2PX0A 1SZXA 4WFEA 1YCIA 1HY5A 5HSWA 1GAXA 3SYCA 3CAXA 5L0IA 4CS8A 3TXSA 5DVWA 4CDAA 2HMZA 4JI5O 4CS9C 4TQFA 4YL3A 1BZKA 1I08A 4X20A 2DYRB 1F23A 4O4LA 1GQAA 4OIRF 2NNUA 1N0NA 2BTOA 2ILMA 2YICA 3ASOC 4O4JA 2R7WA 2F4VO 1OR2A 2QDOA 1KD1W 1YZBA 5FLXN 3OW2U 2ZDIC 2WPDG 5LP6B 1HR0B 2OWOA 4K8ZA 3L1MA 3ZWIA 5JS5A 3WB0A 3AG4C 1I5XA 3DZAA 1A0BA 3OM3B 1XMOO 2ASRA 1S5JA 3ZHSA 2ZR2A 4G7ZF 3DAFA 4U9DA 2JJ1G 2YS8A 4FPPA 3CJHA 1CXZB 3T1HO 3DJNB 4R50A 3U8PA 1XWJA 2XNDG 2ADPA 1SMYF 4O7GA 3K33A 3JD2A 5BQHA 4XEVA 4NTYA 4LP8A 3ASOB 5IY5C 3IQ6A 4DV6O 3VRCA 3LDEA 1WNSA 4WFBV 3R66A 4YL1A 1VQ7V 4UCRA 3FX7A 5CBGA 3ZHQA 4GT1A 4DV6B 2CGEA 4DR4B 2Q73A 4AX2A 1OHHG 4ZOLB 4UFZA 4JF3A 2L6GA 3N0TA 1MNEA 5JH7A 2LSEA 4LLCA 4H37A 3B8MA 3LS0A 4O6NA 2OEVA 1L8DA 3SXMA 4GYCB 4LF4O 2XS1A 4BAYA 3PCVA 1S77D 4F4LA 1B3QA 2Q9LA 3JYCA 2WL8A 5A6KA 1Q43A 4Z2WA 3I5QA 3THOA 3K6BA 4ZI7B 2JGUA 1US6A 3OUFA 1Y76B 5KHIA 2D3OW 5L3GA 3CYOA 5IY5B 3RGBA 2L6FA 3GWLA 4CBEA 2EJRA 2UXBB 2LD6A 3ABMC 2Q0OC 4NTXA 4LFAO 4U3JA 3C3SA 3AOUA 2QNLA 1JJOA 3GORA 3B77A 1OV9A 1EQ1A 1K3EA 3ZRWB 5DN6G 4GX2A 3DXRA 1AR1B 3PMRA 3TOMA 2RD9A 5L0DA 1BHBA 1VLSA 2JK5C 1W2BU 2H8AA 3UT5B 4JASA 4JI7B 3EHBB 4O4LB 1U0BB 1LVKA 1WN0A 3P3PA 4TWKA 1XL4A 1NS1A 3B0PA 2L35A 4NYKA 3O39A 1K4CC 5GPGB 2QKAA 2YQYA 2P4KA 4NB5A 1ZL8A 1GN6A 3TULA 1TWAA 2OCCB 3CWBH 4RDAA 3PJSK 4MNDA 1GM8A 4JCHA 2HVJC 4KHPO 1BMFG 4DOZA 1PKXA 3SP1A 5BXZA 3CCUV 2PI5A 2XAHA 5J2UB 4ASUG 4E2LA 5LYJA 2JGDB 2PBEA 3AEIA 4MW3A 3M4BA 3ECSA 3AG1C 4B7EA 1F7YA 4AI8A 2DGJA 3F7VC 4KC9A 5CA3A 5J2TA 3K1IC 4IWBA 2XM4A 4CH5A 1YHQV 2ZCEA 4TSFG 4X62O 2ZR3A 5CBFA 2Q68A 1XDCA 2Q7EA 4EB6B 1M2VA 2IM9A 5BQGA 1SA0B 1Z5VA 3IJ4A 1WPBA 4PACA 4DV2O 4AQYB 1ROPA 2QTVA 2KJGA 2BOCC 4JI8O 1JCHA 1T6UA 3A0BZ 1OQCA 4K0KB 3TD7A 4PA9A 2QUPA 3DSQA 1IBMB 3EFOA 1BL8A 1B6QA 1AB3A 2FKXA 3HNJA 4AL1A 2Q9CA 3LEVA 4YT5A 3BA8A 4ANJA 4ZIBA 4GLXA 1M9NA 2RDCA 4CSAC 1I4ZA 2M7WA 3KYIA 2KQXA 2X6AA 2PF4E 1TAEA 4UV9A 2O57A 4K1OA 4FESA 2NR5A 5COMA 1EZJA 5F2VO 3S27A 3T9OA 2XAQA 1D2DA 1ZW3A 3AG1B 2UU9B 1ZAUA 2GFHA 4I44A 1BS3A 2GUZA 2EPLX 2CH7B 3FMSA 2BTQB 1M5IA 1KQSU 3DD7A 2QWOB 1P4RA 2WLNA 4FM2A 4U3JB 3UNGC 2XAJA 3L70H 5B1BB 4JPRA 2F95B 3OMNB 2WWWA 3K5NA 1MNGA 1AROP 4KXRA 3JRMO 3F5WC 2CTWA 5A6BD 1RPOA 3AK3A 1HNZB 2UUBB 3ML0A 4LFBB 4KP4A 3S0XA 4LDRA 3JAWA 4P9TA 1BSMA 2XHBA 1H2KA 2P7VA 5BZBA 1IXMA 2YIBA 1SQPH 3EPVA 1GK9A 5LMUO 1WB7A 1VK5A 3EQLF 5KYUA 3ABLB 3CEIA 3J80N 4WFAV 2XLVA 3X1OA 3ZN1A 2JVDA 4BJ5C 3RW0A 4E7ZA 4PFOA 1M90W 2F66C 3UMIA 4N23A 3C63A 1P49A 5JWPA 3AQCA 3FFQA 5BMVB 4LFAB 5KYWB 5EYPA 1IZ3A 1CGME 3A2FA 4U3FH 4YXWG 2VCAA 1SYQA 4QI0A 4I50A 4UVBA 2RMKB 1M93A 2QEXV 1H2GA 2XL4A 1V4AA 3CMAV 1B06A 2YL0A 3JAKB 2ZM6O 5JUAA 3EJNA 2KSFA 5AGFA 5LOVA 1MMDA
chains in the Genus database with same CATH topology
3GWOA 3LSSA 2ZXWB 5KUKA 2EIKB 4RQFA 2B1IA 1AI4A 4KFMA 2EILB 3E8BA 3RBZA 1ENVA 1JPXA 1K5QA 4QIWF 3ZRXA 2W6IG 1FXKB 5GW7A 2WLIA 2XAFA 1QCEA 2CK3G 1DF5A 3CCQV 3E35A 3ZMSA 1SRYA 5E1AC 2P6JA 5L3EA 2JIZG 3K03A 1K4DC 1Q81W 2HFEC 2DQ3A 2Y69B 2ITDC 3ZIAG 4CZZA 2X6CA 2DWEC 5CN0A 3CMEV 1NH2D 4CBCA 3MD0A 4MVRA 2YSUB 1JOYA 2X7RB 4MVUA 5DM6V 3ZRSA 3E2EA 2BOBC 3FYIB 4X89A 1RM1C 3ZMTA 1S5HC 2Q69A 4Z1MG 3F7YC 2PI4A 2UXNA 3ZJZA 2WLMA 1NR7A 4PA4A 2EZPA 3E83A 5B1BC 5LHIA 3ABMB 2GSMB 3OR7C 2P7TC 4R7CA 3CCEV 3STZC 1VQ6V 3BEHA 5H6QA 1Y4MA 2DYRC 3CC2V 1DF4A 2WLJA 3GB7C 3AG2B 4L87A 5IDJA 3VOUA 1KECA 2EINC 1YITV 1QLNA 2DWDC 3IGAC 1G4YB 1EBOA 1OCOB 3QO5A 4BW5A 1GM9A 3E8HA 1DLBA 3ABKB 4GX5A 4DXWA 2DYSB 2EILC 4XDJA 3LDCA 1NKDA 2P90A 5L3BA 1MSWD 5H6RA 3A0RA 5LBQA 3CCRV 5EBMC 5EBWC 3SPIA 4DO2A 3I55V 2LP7A 2ZQMA 1W0KG 4PDLA 3T4ZA 3OFNG 1FS0G 2QTOA 4MTGA 5B1OA 1N8RW 3CCVV 2W0FC 1NVPD 2OTJV 3LSQA 3DTUB 4FJCC 5C93A 5KUMA 1ZWIC 3FB7C 1J95A 1R6NA 1JX9A 4HAMA 4PA6A 4UVAA 5B1AC 3ZCCA 2OCCC 1K34A 4QE9A 3WG7B 1Q82W 2HLDG 1XL6A 2NLJC 3W7TA 3SPGA 1GTOA 1JJ2U 1FXHA 1YTFD 3D3IA 1HWYA 4GCZA 4MVSA 2LFRA 3SYPA 3TK1A 2K1EA 4QPJA 4QNHB 4N21A 2ZDIA 2Q6AA 1OCZC 3DGEA 2AHZA 4H33A 1UJWB 1YJ9V 2B5UA 3SPJA 2AHYA 1THZA 2HJFC 4JGSA 3CPWU 3CCSV 3M99B 2JJ2G 3SYQA 1W0JG 3G71V 1AJPA 2C2AA 2EIJC 1YJNV 3ABTA 5CMUA 2JEUA 4I9WA 4ZBMA 4U7OA 3QO8A 3ZN0A 1E1QG 1KKDA 3AG3C 4P30A 3T2MA 4JYBA 4RUEA 2WLHA 3OMIB 2IH3C 5FL7G 3MHSC 3E86A 5LGTA 3H01A 1G8MA 2JEXA 2P67A 4RQEA 3W7UA 2A0LA 1OZ0A 3FYEB 2IJHA 4MSWC 1PD3A 1SESA 3K0GA 2EZOA 1SZTA 1ORQC 1M57B 1Q86W 1L1FA 5KA5A 2EINB 4RUFA 3E8GA 2HKOA 3ZRVA 4MVZA 5J9PC 2JDIG 1WPXA 2EIMB 2V7QG 3JD0A 3ABKC 2A79B 3CCJV 4JTAB 5KA6A 2GHYA 5IYBO 5IYCO 1M57C 1BHAA 3ETEA 1V54C 1VQNV 3I56V 3OUSA 4LC1A 2HG5C 2OT5A 1F4MA 4J9YB 2W6JG 2WLKA 4QE7A 3OEEG 4JTCB 1VQKV 1I5YA 1NVPB 4WCEV 4U7NA 1JVMA 3ABLC 1NJIW 1AI6A 3JD1A 4WFEA 5L3FA 2ZD9A 4XBFA 3SYCA 5LHGA 1RM1B 1Q7YW 2X0LA 3IFXA 4MVMA 1K7DA 1OCCC 2IU0A 4WF9V 4JTDB 1QVGU 2DYRB 5LGNA 1F23A 2NNUA 3ASOC 4JYCA 1JQ0A 1KD1W 3WFVA 3OW2U 2ZDIC 2WPDG 4R8CA 3ASNB 1DTOA 2ATKC 5EK0A 1LNQA 3AG4C 1I5XA 3OM3B 2F43G 2ZR2A 2JJ1G 4FMTA 2Z3YA 1P7BA 4FPPA 3AG4B 4R50A 2XNDG 1NH2B 2WAMA 2Y48A 2IJKA 3JD2A 3AG3B 1VQLV 4EKWA 1VQPV 4MTOA 3R65A 3EFFK 4LP8A 3FB5C 1KP3A 3ASOB 4MS2A 5IY5C 2H94A 3ZMZA 3JD4A 3LDEA 4WFBV 2V1DA 1YI2V 1F51A 1NQTA 1H8HG 1VQ7V 1GM7A 3CD6V 1E79G 4FIPC 4HZ3A 1AI5A 2QM8A 5CBGA 2DW4A 2WSSG 3LUTB 4GT1A 2IH1C 1YSCA 1R3IC 2HR3A 3OAAG 4G27B 1QR9A 4HYOA 1OHHG 3SYOA 2Z5UA 4I5SA 1K73W 4JF3A 4PA3A 2UXXA 4H37A 3B8MA 4MW8A 4BAYA 1S77D 4F4LA 3TETA 3BY6A 2HVKC 3JYCA 1S3JA 1M1KW 3ABUA 1Y66A 5EC2C 1V54B 3OUFA 2D3OW 2ZXWC 3ETDA 3K0DA 4TT3G 2XOKG 3W7WA 5L3GA 3K9AA 3CYOA 5IY5B 3ASNC 1PL0A 3QNEA 1K8AW 2EJRA 3ABMC 4QJFB 1YJWV 3T4DA 3OGCC 3P30A 2IW5A 2KB1A 1QR8A 3B77A 3E89A 2H8PC 1K3EA 2Q67A 2QE7G 4GX2A 2XAGA 3ZRWA 3ZRWB 5DN6G 1AR1B 3STLC 1BHBA 2JK5C 1W2BU 3JCZA 1OCZB 3B8NA 3ZMVA 4MVQA 1R3KC 1R73A 3W7XA 4JASA 3EHBB 2X6BA 4WFFA 2LFSA 2WLLB 4PDRA 2R9IA 4P9PA 4TWKA 1XL4A 4P2ZA 1OCRB 3HB3B 2FTKA 1K4CC 2EIJB 5B3SB 4GX0A 4J9ZB 1NBMG 2XASA 2QM7A 2OCCB 3PJSK 4Q20A 3OEHG 1GM8A 1AI7A 1PNMA 1GKFA 2HVJC 3CP1A 1BMFG 1PKXA 4X8AA 1VQMV 3CCUV 2PI5A 2XAHA 3W7SA 1K33A 4MTXA 4ASUG 4E2LA 4P9OA 3AEIA 3OMAB 4MW3A 3AG1C 1VQ8V 3F7VC 3K08A 5CA3A 3P32A 3FB8C 2DQ0A 1OCRC 1K5SA 1MOFA 1F4NA 2EIKC 3JD3A 4UVCA 1YHQV 2IU3A 4RO2A 4MTFA 3WG7C 5LHHA 3UM7A 4TSFG 3G6EV 2ZR3A 5CBFA 2Q68A 5B1NA 4UUJC 4WFGA 1CP9A 4JAUA 3K06A 5EBLC 4XDKA 3FB6C 1YIJV 3UKMA 3T1CA 1M56B 3NXSA 1ROPA 2BOCC 1SERA 1RPRA 1JCHA 1CEZA 1TUEB 3RVZA 2IJJA 4KUMA 4PA9A 4X88A 1VQ5V 4G2KA 1S76D 3HPLC 1BL8A 1B6QA 2B1GA 1R3LC 3AG2C 2OTLV 1MABG 1E1RG 1KP2A 3D36A 4BIUA 4MT8A 1M9NA 1NR1A 3QO7A 4LBEC 3SJQC 3SPCA 3CC7V 2A9HA 1EFRG 3LNMB 1FXVA 2M7WA 4ZKIA 1OCOC 1PNKA 2X6AA 4UXNA 4UV9A 1H8EG 5IYDO 1QLEB 1EZJA 2XAQA 3AG1B 3TCUA 2Y69C 3KG2A 4OXSA 4GX1A 1S0VA 1K97A 1V55B 1H38A 4R6ZA 2MK3A 5HFMA 1KQSU 3ZMUA 4FK5C 2EIMC 1P4RA 3SYAA 2WLNA 1COWG 1QLEC 2XAJA 3K3WA 1K92A 1GMGA 5B1BB 4JPRA 3LDDA 2YEVB 3OMNB 3G4SV 5HFLA 2WWWA 1FXKA 1R6KA 2WLIB 5L3DA 3MHHC 1AROP 1SETA 5L3CA 3F5WC 1K9MW 3ETGA 1RPOA 4PDVA 1YTFB 2WLLA 4PDMA 2ITCC 3ML0A 3CCLV 4KP4A 3SPHA 4XDLA 1OCCB 1QVFU 4UV8A 2R9RB 4QPKA 3E8FA 2QA4V 5BZBA 1IXMA 3CC4V 3VBBA 1V55C 3IC7A 2QKSA 4JAVA 1GK9A 3X2QB 4G28B 5CBHA 1S72V 1WLEA 3ABLB 4BIZA 3K04A 5B3SC 4PA7A 4WFAV 3ZN1A 1M56C 1AJQA 3RW0A 5B1AB 1M90W 2YEVA 4N23A 4PELA 1GO3F 5LGUA 4RAIA 1AJNA 4YXWG 5EC1C 3OE7G 3FKSG 1FXKC 3OR6C 2EBOA 4UVBA 1CPYA 1VQOV 3RVYA 1KC8W 2QEXV 1QBZA 2DYSC 1H2GA 4WFHA 3CMAV 2IJIA 3X2QC 4MVOA 1VQ4V 3K79A 1MG1A 5H9CA 1FFTB 1R3JC 4LCUC 1VQ9V 1PNLA 3CXCU 3CCMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RO2 A;  3WG7 C;  4MTF A;  5KUK A;  3UM7 A;  4MVS A;  5CBF A;  4EKW A;  3SYP A;  2Q68 A;  4MTO A;  4KFM A;  4UUJ C;  3R65 A;  2K1E A;  3EFF K;  3FB5 C;  4LP8 A;  4MS2 A;  3E8B A;  4WFG A;  3RBZ A;  4QNH B;  5IY5 C;  2Q6A A;  3K06 A;  3LDE A;  4XDK A;  5EBL C;  1OCZ C;  3FB6 C;  3UKM A;  2AHZ A;  4H33 A;  3T1C A;  2BOC C;  2AHY A;  3SPJ A;  2WLI A;  2HJF C;  4HZ3 A;  5CBG A;  3RVZ A;  3LUT B;  3SYQ A;  4PA9 A;  4X88 A;  5E1A C;  2IH1 C;  2EIJ C;  3HPL C;  1BL8 A;  1R3I C;  3K03 A;  1K4D C;  4G27 B;  1R3L C;  4I9W A;  4ZBM A;  2HFE C;  1KKD A;  4HYO A;  2ITD C;  3AG2 C;  3AG3 C;  4P30 A;  3T2M A;  3SYO A;  2X6C A;  4LBE C;  3SPC A;  2DWE C;  3SJQ C;  4PA3 A;  4RUE A;  2A9H A;  2WLH A;  3LNM B;  2IH3 C;  4CBC A;  1OCO C;  4MVR A;  4H37 A;  3E86 A;  2X6A A;  4MW8 A;  4MVU A;  3ZRS A;  2A0L A;  4F4L A;  2BOB C;  3TET A;  4X89 A;  2HVK C;  3JYC A;  3TCU A;  4MSW C;  2Y69 C;  3KG2 A;  4OXS A;  4GX1 A;  1S5H C;  5EC2 C;  2Q69 A;  3F7Y C;  3OUF A;  4R6Z A;  3K0G A;  1ORQ C;  2WLM A;  3ZJZ A;  2EIM C;  2ZXW C;  3SYA A;  4PA4 A;  3K0D A;  2WLN A;  3E83 A;  4RUF A;  5B1B C;  3E8G A;  1QLE C;  4MVZ A;  5J9P C;  3LDD A;  3ASN C;  3OR7 C;  2P7T C;  4R7C A;  3ABK C;  2A79 B;  3STZ C;  3BEH A;  4JTA B;  2WLI B;  3ABM C;  2DYR C;  3T4D A;  1M57 C;  3F5W C;  3OGC C;  2WLJ A;  3GB7 C;  1V54 C;  2KB1 A;  4PDV A;  2WLL A;  4PDM A;  3OUS A;  2H8P C;  2HG5 C;  2ITC C;  2Q67 A;  3E89 A;  2WLK A;  4GX2 A;  4J9Y B;  2EIN C;  4JTC B;  4QE7 A;  4XDL A;  3SPH A;  3VOU A;  3STL C;  2R9R B;  3E8F A;  2DWD C;  3IGA C;  1G4Y B;  2JK5 C;  1JVM A;  3ABL C;  5BZB A;  4BW5 A;  1V55 C;  3E8H A;  4WFE A;  4MVQ A;  1R3K C;  2QKS A;  2ZD9 A;  4GX5 A;  2X6B A;  4G28 B;  4WFF A;  3SYC A;  2WLL B;  4DXW A;  4PDR A;  5CBH A;  2EIL C;  4P9P A;  3LDC A;  4TWK A;  1XL4 A;  4XDJ A;  4P2Z A;  3IFX A;  4MVM A;  3K04 A;  5B3S C;  4PA7 A;  1OCC C;  1K4C C;  1M56 C;  4JTD B;  5EBM C;  5EBW C;  4GX0 A;  3RW0 A;  3SPI A;  2YEV A;  4J9Z B;  4PDL A;  3ASO C;  3T4Z A;  2QTO A;  4MTG A;  3PJS K;  4R8C A;  4RAI A;  2HVJ C;  2ATK C;  5EC1 C;  2W0F C;  5EK0 A;  1LNQ A;  3AG4 C;  3OR6 C;  4X8A A;  3RVY A;  5KUM A;  1ZWI C;  3FB7 C;  1J95 A;  2DYS C;  4WFH A;  4P9O A;  4PA6 A;  4MW3 A;  5B1A C;  1P7B A;  2OCC C;  3AG1 C;  4MVO A;  3X2Q C;  4QE9 A;  3F7V C;  3K08 A;  1XL6 A;  2NLJ C;  4R50 A;  1R3J C;  4LCU C;  3SPG A;  3FB8 C;  1OCR C;  2EIK C; 
#chains in the Genus database with same CATH topology
 1EN4 A;  1PV3 A;  4FM0 A;  3NYJ A;  3BHP A;  4I9Q A;  5DLJ A;  4UCV A;  5F5H A;  1YA7 O;  1NU9 C;  5FZT A;  2EIL B;  2ETN A;  3G4Z A;  3E22 A;  3GVM A;  1K5Q A;  2J7P A;  5TJ5 E;  3EGD B;  3IAY A;  1HR0 O;  2XAF A;  1YLM A;  2R7Q A;  1DF5 A;  3L74 H;  3RYI A;  1XMO B;  3ZMS A;  3K57 A;  1HNX B;  1MZF A;  3Q4H B;  2HFE C;  2ZNJ A;  1FR0 A;  1I7F A;  3ZIA G;  2IM8 A;  5IJ0 A;  1N32 O;  2DWE C;  2CDQ A;  4JZG A;  5ITZ A;  2DJV A;  3QTC A;  4DR1 B;  3U0C A;  3U8V A;  1PL4 A;  2YSU B;  5FCL A;  3F5T A;  4DV0 O;  2D4U A;  2PZS A;  5CI8 A;  1I0H A;  2HHH O;  5KLV H;  2Q00 A;  2PI4 A;  2WLM A;  1NR7 A;  2EZP A;  5IE9 A;  2XM0 A;  3APO A;  1IUR A;  1BQ0 A;  3O55 A;  4K35 A;  4R7C A;  1VQ6 V;  3UMH A;  4U5F E;  1SF9 A;  4X1K A;  4RWU A;  2DYR C;  1PP9 H;  3CC2 V;  2PNO A;  3D8C A;  1EN6 A;  2CYD A;  4OPH A;  1YEW A;  4JUR I;  4DV4 O;  3Q6M A;  3L8I A;  4L87 A;  1T9K A;  4LF4 B;  3VOU A;  1N33 B;  1FFT C;  4NTW A;  2EIN C;  3M4C A;  1QLN A;  4J7Z A;  1H2N A;  1G4Y B;  4O6Y A;  1HP8 A;  4J10 A;  2KGO A;  1Y74 B;  2DYS B;  5L3B A;  1H2S B;  2Y0I A;  4X1I B;  2HJM A;  3S3W A;  2QE9 A;  3A0R A;  3EH1 A;  5EBM C;  3SPI A;  2ODM A;  1OXK A;  2ZQM A;  1PCX A;  1TFO B;  4JYY A;  3RN4 A;  4U5G A;  3T4Z A;  1VF6 C;  5KYY B;  4OX9 B;  1N8R W;  4OIP F;  3VAY A;  2B9Z A;  2Q9B A;  3KZI Z;  2OTJ V;  4EFB A;  3DMD A;  4TUY A;  3U10 A;  3DAG A;  3CRM A;  3FB7 C;  1JX9 A;  2VQE O;  3ZCC A;  2OCC C;  1K34 A;  3T6G B;  3W7T A;  2HUJ A;  5BQI A;  1YDX A;  3SPG A;  2CCY A;  1JJ2 U;  1FXH A;  1YTF D;  1Z63 A;  3EGD A;  1S05 A;  2LFR A;  3ATP A;  4KNW A;  4IYH A;  1WAT A;  5HV9 A;  5AC5 A;  4JZA A;  3B09 A;  2Q6A A;  2E5L B;  3KPH A;  1P84 F;  2CGN A;  2QWN B;  3BCC H;  4X66 O;  3DGE A;  4LF5 O;  1RJ9 B;  2AXT Z;  4JZ2 A;  1HE1 A;  2B5U A;  3RH3 A;  2AHY A;  3QG5 A;  4B3S B;  2F93 B;  3G4X A;  3CPW U;  4U5D E;  1F1M A;  1W0J G;  1AVO B;  3Q7G A;  5COG A;  2HMQ A;  4CS9 A;  4ZBM A;  3BRC A;  2ZM6 B;  2VWJ A;  1K05 A;  2UUA O;  4K3A A;  4I3M A;  3OMI B;  5KX5 B;  1QVX A;  4X65 O;  1G8M A;  3I5D A;  4W8K A;  2IJH A;  1QKR A;  4FVM A;  4A2N B;  2OQM A;  1M57 B;  3U11 A;  1L1F A;  2EIN B;  4RUF A;  2H3O A;  3CHX A;  4CS2 A;  4Z9I A;  4K7B A;  1RKC A;  1AP5 A;  2EIM B;  4NXN B;  1BR1 A;  1IBL O;  1C03 A;  2HJ3 A;  5IYB O;  5A2Q N;  3PN1 A;  2BSK B;  3ETE A;  1V54 C;  4GUN A;  1VQN V;  3I56 V;  3HNI A;  2W6J G;  3NKD A;  1CPQ A;  4C3D A;  5DS4 A;  1I5Y A;  2QJ1 A;  4DRX A;  4WCE V;  1NVP B;  5E79 Z;  4LAC B;  3TJ5 A;  3JAT B;  1AI6 A;  3JD1 A;  5EZY B;  1WOL A;  5L3F A;  4FFB A;  3BRJ A;  5JQG B;  2IXO A;  2D5R B;  1RM1 B;  3FOP A;  1Q7Y W;  2X0L A;  2HZ8 A;  2IU0 A;  2LW1 A;  4J42 A;  2A0B A;  2KYH A;  4B08 A;  4JI3 B;  1XI1 A;  5LGN A;  5LA6 B;  2Q8V A;  2HFI A;  4N4W A;  4JYC A;  3RFR A;  4BIO A;  3OTO O;  1NZE A;  3DWW A;  1A41 A;  2Y3G A;  5EK0 A;  1LNQ A;  2XLO A;  1LE2 A;  2Z3Y A;  1P7B A;  4YT2 A;  3AG4 B;  4K8X A;  1NH2 B;  3NG1 A;  2WAM A;  3NR7 A;  3C62 A;  4PJL A;  2IJK A;  2Y4U A;  5JH7 B;  2YLD A;  4PJJ A;  1VQL V;  1PM9 A;  3OGI B;  1VQP V;  4MTO A;  3ZHU A;  3R65 A;  3EFF K;  4MS2 A;  3HR0 A;  1KP3 A;  4LFC O;  5T3W A;  2EPM X;  1ZUQ A;  3ZMZ A;  1AR5 A;  3JD4 A;  1P7G A;  3A8T A;  4FAP B;  1HW1 A;  4IIJ B;  4OX9 O;  5COF A;  5A69 A;  4BEJ A;  2XLD A;  1GM7 A;  3CD6 V;  1AI5 A;  2QM8 A;  3LUT B;  4EHP A;  1IW7 F;  1Q0D A;  3ZC4 A;  3KKY A;  1VAR A;  2IH1 C;  4XPY A;  2VQF B;  1H9G A;  4ICG A;  3OAA G;  2G3V A;  4O6M A;  2QWQ B;  5JVD B;  4Q4Z F;  1KMI Z;  3GM2 A;  3QW0 A;  1YDI A;  3MDS A;  4PA3 A;  2YL3 A;  1N4C A;  4YT8 A;  1FD9 A;  2YXL A;  2HS5 A;  3BY6 A;  1NTM H;  3F47 A;  4JV5 B;  4J7T A;  3UT5 A;  4BJ6 A;  4LH6 A;  1M1K W;  3ABU A;  2UXD B;  1FFX B;  1ZSP A;  1FNT c;  1V54 B;  1YVW A;  3TXQ A;  1WN7 A;  4TT3 G;  4JC7 A;  3VYW A;  4DVZ A;  3W7W A;  1YJG A;  4R32 A;  3IQ5 A;  4RBN A;  3K9A A;  5JJN B;  2AGA A;  1K8A W;  3UGP A;  4PR9 A;  2NUT B;  3JAT A;  3T4D A;  4YHH O;  2R72 A;  2IW5 A;  2KB1 A;  3MLG A;  3FOO A;  1Q6H A;  3U3F A;  3E89 A;  2WZG A;  4LF6 O;  1APC A;  2XAG A;  3HKD B;  3ZRW A;  5KYX A;  3CRR A;  1WGW A;  4DR1 O;  1XHZ A;  1JAF A;  3HJC A;  1OCZ B;  4YJ3 A;  3B8N A;  4IAO A;  4LF9 O;  1R3K C;  1R73 A;  2RCV A;  4P9P A;  4JI7 O;  3ETQ A;  1OCR B;  3HB3 B;  2FTK A;  1ZHW A;  2EIJ B;  4CS4 A;  1OKK D;  2YC0 A;  4DUZ B;  3G67 A;  4JEB A;  4OD5 A;  2Y3D A;  4J9Z B;  3K58 A;  2QM7 A;  4I0X A;  4J41 A;  3IC9 A;  4M63 A;  5H2F Z;  3E70 C;  3CP1 A;  4L6R A;  3HKE B;  4LH7 A;  3TGU H;  4IRU A;  3B0V C;  4DUZ O;  4X8A A;  2MYS A;  1NLX A;  1VQM V;  1CPR A;  3V7O A;  3W7S A;  1K33 A;  3ITF A;  4I1M A;  4P9O A;  2GV9 A;  2E76 B;  5KHG A;  5J2U A;  5LYJ B;  4EWC A;  5L0G A;  2N05 A;  1VQ8 V;  3DM5 A;  3RFY A;  3KKB A;  5CIV A;  4B3M B;  2DQ0 A;  1OCR C;  3I4U A;  4IIJ A;  4BJ1 A;  3WG7 C;  5LHH A;  3UM7 A;  2ZT9 B;  3UQ8 A;  1B68 A;  2CW0 F;  5B1N A;  2R9A A;  1Q0F A;  2Y39 A;  2AZ2 A;  5LL6 Y;  2P61 A;  3K5M A;  3UKM A;  1TR2 A;  1YYJ A;  3T6J A;  1RPR A;  3SNH A;  2X51 A;  3CJH B;  2IJJ A;  1VQ5 V;  4DW0 A;  2CTP A;  4AIL C;  4K0K O;  4GYT A;  2W4M A;  2P4V A;  1G6U A;  5GON A;  3ZG1 A;  1SQF A;  2B1G A;  1T6Q A;  3EG9 A;  4BIU A;  4DR2 B;  4LBE C;  1NR1 A;  5DED A;  4G0H A;  3ZSU A;  3ZED A;  3HNL A;  1FXV A;  1JR8 A;  1URF A;  1TUB A;  2IBZ H;  5T3T A;  4NR1 A;  1FMV A;  5JLI A;  4OGQ B;  3LLI A;  5FNV A;  5LP6 A;  3TOL A;  1N0J A;  3TCU A;  3ZQV A;  2Y69 C;  5LMN B;  2Z0A A;  3LSU A;  4GX1 A;  1TWG A;  5AC4 A;  4IT5 A;  1YZA A;  4LFC B;  2BCC H;  2KG7 A;  2MK3 A;  3BAA A;  1LI5 A;  3ZDL A;  3K5O A;  2AVK A;  4JI1 O;  1GMG A;  2G38 A;  5HFL A;  3W4Y A;  1FXK A;  2OYQ A;  1WP8 A;  4BR6 A;  2VQF O;  1Q6I A;  4FLU A;  5JP7 A;  4PDV A;  1YTF B;  4I50 B;  1FJG B;  2UUA B;  4NC3 A;  2ITC C;  4LWS B;  3CCL V;  3EZH A;  1X59 A;  1XIL A;  1JPJ A;  2TMV P;  4C7U A;  1ZLZ A;  3JAK A;  2FFH A;  2P0N A;  3IC7 A;  2P6V A;  4EBB A;  1A7V A;  2QKS A;  4FLZ A;  4UB8 Z;  3X2Q B;  1A32 A;  2N74 A;  4BIZ A;  4D6T H;  5B3S C;  1RP3 B;  2GTS A;  1AJQ A;  1ZZP A;  2LFD A;  3EVK A;  2YEV A;  2IXP A;  5K0I A;  4B3T O;  1R5I D;  1G4W R;  2KC3 A;  4Q5S F;  2IBF A;  5KHH A;  3AGT A;  1GO3 F;  2CE4 A;  5KYW A;  4NCQ A;  1VTM P;  4RAI A;  3BAB A;  4OPA A;  3JCU Q;  3K1H A;  3FKS G;  1FXK C;  2KQ9 A;  4PJM A;  2EBO A;  3JSN A;  1VQO V;  4JIO A;  1BCC H;  1IXB A;  4DR3 B;  3QZC A;  4WFH A;  1KYO F;  3X2Q C;  2ZIO A;  5FNV B;  2IOQ A;  1R3J C;  2F22 A;  4O4H A;  3GWO A;  4CDY A;  5ITZ B;  2ZXW B;  1RKE B;  4JI6 O;  2DOS A;  2AW9 A;  1AI4 A;  2NSG A;  5D91 A;  3JAS A;  1JPX A;  1MSD A;  4QIW F;  2BE3 A;  3ZRX A;  3N24 A;  1SQB H;  5BR8 O;  1EZV H;  3DXR B;  4AL0 A;  2OJE D;  2MWQ A;  1FXK B;  2J9W A;  1QCE A;  2CK3 G;  1L0N H;  3CCQ V;  4W4K A;  1E86 A;  4B6I A;  2YHS A;  1T5O A;  1GM5 A;  5L3E A;  2AP3 A;  2XL6 A;  3Q6N A;  1IDS A;  2Y69 B;  2ITD C;  3K7D A;  5IJ9 B;  4AHC A;  4CJG A;  1XZQ A;  1NH2 D;  4IL6 Z;  2UU9 O;  2CNW A;  4NVP A;  2KSD A;  3CRQ A;  3MD0 A;  1Z23 A;  3DC5 A;  1JOG A;  2Q4P A;  4LFB O;  1M4U A;  3ZRS A;  5DM6 V;  2NUP B;  3FYI B;  4FFK A;  3O10 A;  1R6T A;  1RXQ A;  4DV0 B;  1S5H C;  2Q69 A;  2LW7 A;  1WP7 A;  3T1H B;  5JT4 A;  1U96 A;  4NXM O;  3T6B A;  256B A;  3E83 A;  3ABM B;  1LR1 A;  2L81 A;  2D2C B;  1LS1 A;  2GSM B;  3H1H H;  3NYL A;  2P7T C;  5H6Q A;  1WTY A;  4X64 B;  4WGY A;  4BG0 A;  4TOI A;  1Q90 D;  4X1K B;  2Q7H A;  1DF4 A;  3GB7 C;  2WVO A;  1K04 A;  2RQ6 A;  3KMI A;  4DR2 O;  3LNR A;  1CGO A;  2CH7 A;  4UCT A;  3OEO A;  4ZLC A;  3IGA C;  4CS3 A;  3CX5 F;  4BW5 A;  2LIG A;  3SJB C;  4AE4 A;  1DLB A;  2YDE A;  1DK1 A;  3N2G B;  2EIL C;  3LDC A;  4EFE A;  2PYL A;  4B3R B;  4I55 B;  1ORY A;  3CCR V;  3I55 V;  3H2V A;  4NTB A;  1W0K G;  2XT9 A;  4IYI A;  2ZPA A;  3JSE O;  2OIE A;  1FS0 G;  2ARH A;  2QTO A;  2BC5 A;  4DR7 O;  5KYY A;  3BPZ A;  3L72 H;  2GBO A;  3SGI A;  5J2T B;  4NY3 A;  1H6G A;  4FLY A;  4PI2 A;  1NBB A;  2DB4 A;  2IYL D;  2CUG A;  3LSQ A;  3DTU B;  3JYY A;  1ZWI C;  3V5X A;  1RKE A;  4ZLD A;  2Z15 A;  3T1Y B;  1IBK O;  3FAV B;  2HLD G;  1FTS A;  2G62 A;  5A6J A;  1SQG A;  1O9H A;  3D3I A;  3RF3 A;  1HWY A;  2R7V A;  2J9V A;  4GCZ A;  4JI8 B;  1IBK B;  3RYF B;  5D5P A;  2K1E A;  4N21 A;  3TQO A;  4DV2 B;  4AQY O;  1G5Z A;  3EFO B;  1XRE A;  2J45 A;  3U9J A;  1QZX A;  1UJW B;  2UXC O;  4JKV A;  1GN2 A;  2VWK A;  3P3N A;  4JGS A;  3CCS V;  3M99 B;  5IJ9 A;  3G71 V;  3SYQ A;  1SR2 A;  3C8G A;  2DMX A;  1XMQ B;  4KBL A;  5BY1 A;  1AJP A;  3BA9 A;  1VLT A;  2C2A A;  1XZP A;  2PP4 A;  2QY9 A;  5KYU B;  1HDJ A;  4U7O A;  3L0I A;  3ZN0 A;  4P30 A;  3T2M A;  5L0F A;  1VYI A;  2F1M A;  2LFF A;  3JZ0 A;  3N27 A;  1YAU O;  1R1B A;  2WLH A;  2P1A A;  1Y6X A;  3HNK A;  4JCZ A;  3MHS C;  3E86 A;  2JEX A;  3CZ6 A;  4RQE A;  4G78 A;  1VMG A;  4PI0 A;  3FYE B;  4JAA A;  2F23 A;  1PD0 A;  4XLN F;  1LUV A;  3TK0 A;  2J46 A;  1LI7 A;  3MFN A;  5EZY A;  2CGO A;  4MSW C;  4ZHQ B;  3UGO A;  3K0G A;  3Q4H A;  1GS9 A;  2FAP B;  1S5L Z;  2DE0 X;  3CSK A;  2HKO A;  3ZRV A;  1W2W A;  1HNZ O;  4JRZ A;  3LJB A;  1WB8 A;  3RYH A;  2A79 B;  3U2L A;  4JTA B;  4JI4 B;  1TKN A;  2GHY A;  1AP6 A;  2W9Y A;  2UUB O;  1XQ8 A;  3EGX B;  1GH6 A;  4LC1 A;  2HG5 C;  2HP8 A;  1F4M A;  2OT5 A;  1D5N A;  2B0H A;  3DJU B;  4A4A A;  4IAR A;  4DRX B;  2Y0P A;  4DR6 B;  3ABL C;  1U6H A;  4XBF A;  5K1X A;  2YIB D;  3L71 H;  3SJA C;  1FAP B;  4P9F A;  3IFX A;  3DKA A;  4MVM A;  3FXH A;  1K7D A;  1OXB A;  2QSA A;  1NT2 B;  1QVG U;  4J30 B;  4AK9 A;  4N6C A;  4CDV A;  4I4T A;  2CTQ A;  4O4I B;  3WFV A;  3W8H A;  4WAB A;  3ASN B;  2ATK C;  2VCC A;  2F43 G;  1Y74 A;  3CS5 A;  2VH3 A;  2ZE6 A;  4YK5 A;  2LO1 A;  2RJZ A;  1IVS A;  1T6I A;  1XHX A;  3R7C A;  4UDV A;  1TVK B;  3JAL A;  3AG3 B;  3B9Q A;  4EKW A;  4X65 B;  3RYI B;  3NKE A;  2H94 A;  3U3B A;  1N36 O;  1E84 A;  4E18 A;  2ETS A;  2GA0 A;  3LLK A;  4DR7 B;  4YIO A;  5KAF Z;  2H7O A;  4FZ0 A;  1H8H G;  2Q7R A;  5DS5 A;  4NTF A;  1E79 G;  4BJT A;  3C7J A;  1JFF A;  2HV7 A;  4LF9 B;  5KYN A;  1YSC A;  3H1K H;  1QSP A;  2IXN A;  1R3I C;  2HR3 A;  2Q7G A;  4G27 B;  1Y4C A;  4JI2 B;  3EHN A;  4HYO A;  4LF8 B;  1SC5 B;  4JI0 O;  3SYO A;  2OOC A;  2Z5U A;  2A0U A;  4ZHQ A;  2UXX A;  4EIY A;  4UB6 Z;  1PD1 A;  4JI6 B;  1L7C A;  4LF8 O;  3RKO F;  4O2B A;  3J81 N;  5EIB D;  4BPM A;  4X9Q A;  3EZI A;  1RMV A;  1DOV A;  4YJ3 B;  5JJE B;  2VC9 A;  1S3J A;  1KU2 A;  5EC2 C;  3U0Z A;  4XWJ A;  2C04 A;  4NXN O;  2XS8 A;  3ETD A;  2XOK G;  1R4T A;  2PX3 A;  3LNN A;  1H7I A;  1NU7 D;  1Z5Z A;  3LES A;  5F5F A;  3CRC A;  3QNE A;  3IPM O;  1L3P A;  1YJW V;  3OGC C;  3P30 A;  1WA8 B;  2UUI A;  2H8P C;  2Q67 A;  3H1I H;  2ICW G;  1I5N A;  4JI4 O;  1I4Y A;  1Z5W A;  1TA8 A;  2YXY A;  1VF6 A;  3JCZ A;  3UCS C;  4MVQ A;  3W7X A;  2R7O A;  2PGG A;  2LFS A;  2ZE5 A;  4PDR A;  5IYZ B;  1VF5 B;  5H5N A;  3OTO B;  4QI2 A;  3VQX A;  1SQX H;  1JFF B;  1O87 A;  4DRI B;  4FWV A;  3V5Y A;  2BTQ A;  2XAS A;  1HE9 A;  4CJO A;  1XNR B;  3C8Z A;  4LNU A;  5K1P A;  4D7T A;  1CGN A;  4D4N A;  1AI7 A;  3OD4 A;  1GKF A;  4D7S A;  1E2X A;  1IZM A;  5CI9 A;  2ZIM A;  3NDB B;  3J7A U;  4DR6 O;  1OJH A;  3OMA B;  2XSE A;  1VF7 A;  1MMM A;  4DV1 B;  4Z9J A;  3FB8 C;  1MOF A;  1K5S A;  1F4N A;  3VQV A;  5IT9 N;  2EIK C;  4HNA A;  1I94 B;  3JD3 A;  1D0Y A;  4UVC A;  2A6E F;  1D1A A;  2IU3 A;  3Q7L A;  1W59 A;  4B3S O;  3FAJ A;  2N04 A;  3E9V A;  4UUJ C;  4WFG A;  1N34 B;  4LF5 B;  4JAU A;  2YL1 A;  4FLT A;  4TV9 B;  4CH3 A;  1AVM A;  3K06 A;  5DQZ A;  3FB6 C;  5A6B A;  3B0U X;  3T1C A;  1M56 B;  3NXS A;  1QPU A;  3DM9 B;  3IEE A;  2Y4T A;  2VCB A;  3MAQ A;  1TUE B;  4DV5 B;  1UG7 A;  2GWW A;  4D4X A;  1E85 A;  4KUM A;  4ULV A;  4LF7 B;  4G7H F;  4FFB B;  4G2K A;  4TV8 B;  2OEX A;  3GM1 A;  4EEQ A;  4KHP B;  2ZKO A;  2BE5 F;  2A68 F;  3GWN A;  1R3L C;  1HMO A;  3AG2 C;  1EM1 A;  1MAB G;  1E1R G;  4F4B A;  1WJZ A;  2FML A;  3D36 A;  5CB4 A;  1Q3E A;  2A06 H;  4MT8 A;  3CC7 V;  3SJQ C;  2A9H A;  4JV5 O;  1KNY A;  1RSO A;  3PHF 2;  1OCO C;  2Q4F A;  4UCS A;  5IYZ A;  4UXN A;  3MYF A;  5EIB C;  5IYD O;  1VOM A;  1VEW A;  2RSE B;  5DS6 A;  2P06 A;  1V9P A;  3CRA A;  5E3C A;  1Q6U A;  4YJ2 B;  3KG2 A;  1S0V A;  1K97 A;  3H1J H;  1FYJ A;  5JSL A;  2LQG A;  1H38 A;  2HV6 A;  5HFM A;  3HKC B;  2EIM C;  3SYA A;  1BZ4 A;  1MQV A;  3AK2 A;  3DI5 A;  1QLE C;  2A6H F;  3K3W A;  4XPW A;  1Q0K A;  3JAR B;  3LDD A;  4HBN A;  1QQ3 A;  5L0C A;  2YEV B;  1XUQ A;  3UO3 A;  2E74 B;  3K66 A;  2AZ0 A;  5KMG B;  3QF7 A;  5L3D A;  1SET A;  5L3C A;  1K9M W;  3ETG A;  1BDJ B;  1V74 B;  4PDM A;  4X1Y A;  4JYA O;  3SR2 C;  4LWS A;  1E83 A;  4XDL A;  1OCC B;  2HJD A;  3W2V A;  1FFX A;  1QVF U;  4UV8 A;  4HFK B;  3E8F A;  2QA4 V;  1RFY A;  3CC4 V;  1Q0G A;  3ZHT A;  4G28 B;  5CBH A;  2R7U A;  5C8Y B;  4EBK A;  4YIP A;  3RIP A;  4N6H A;  3B29 A;  3BVO A;  5L0H A;  5GTI Z;  3GEI A;  1XNQ B;  4C3E A;  2XLM A;  5B1A B;  3WHN A;  3CB2 A;  3JAS B;  2A1D D;  5KAI Z;  1KTM A;  1A7E A;  3F46 A;  1C02 A;  5LXT B;  2QR4 A;  1AJN A;  5CB4 B;  2Q9A A;  1O3U A;  3OR6 C;  4JEA A;  3RYC B;  2W0X A;  4H0L B;  5KHJ A;  2NN4 A;  1QBZ A;  2DYS C;  3CSX A;  3DE9 A;  1ZVZ A;  2IJI A;  4J32 B;  4MVO A;  3K79 A;  2ZE7 A;  2ZE8 A;  1N33 O;  4LCU C;  4U5B E;  4BEM J;  1O5H A;  4O2A B;  3AJM A;  5KUK A;  2EIK B;  3G6B A;  1D1B A;  1LE4 A;  4CIH A;  2JRI A;  2FGY A;  3HKC A;  3U5S A;  4ABM A;  3JT1 A;  3E8B A;  3RBZ A;  2HHH B;  3HTK C;  1EA8 A;  5CA1 A;  2A69 F;  4OIO F;  3B4S A;  3ZHV A;  2DI3 A;  2QM4 A;  2XXA A;  1RCP A;  3PDM P;  2YI8 A;  3HKD A;  1Z6A A;  5KYX B;  4GKK B;  1NG1 A;  1FFH A;  4UCU A;  2R02 A;  2GTA A;  1LS4 A;  1MND A;  3M1C B;  1Q81 W;  4U9E A;  3JRT A;  3KL4 A;  2R25 A;  2X6C A;  4YY3 O;  2ZXO A;  5CN0 A;  1U89 A;  4PV1 B;  2NSF A;  2GAQ A;  1NTZ H;  5A6A A;  4CBC A;  4O4J B;  3HKK A;  1ZYR F;  2WA4 A;  3QVY A;  3HKB A;  2X7R B;  1JR9 A;  2EX3 A;  3E2E A;  2BOB C;  4PHZ A;  2J8W A;  3ZMT A;  4JI1 B;  4F6R A;  1BGY H;  1LUW A;  5B66 Z;  2ZNI A;  1XEQ A;  4JJG A;  4Z1M G;  3F7Y C;  1YVI A;  1MMA A;  2MW2 B;  1UPG A;  2UXN A;  3ZBH A;  2QWR B;  3ZJZ A;  1AR4 A;  2E87 A;  5BMV A;  3T1Y O;  4PA4 A;  3DE8 A;  5JRA A;  5B1B C;  3US6 A;  2JPU A;  2KNH A;  3TJT A;  3OR7 C;  3FVY A;  3H9V A;  2YZS A;  2V4D A;  3H2U A;  1Y4M A;  2J7P D;  3SYN A;  2XLE A;  2K9P A;  2WLJ A;  4DVY P;  2HSB A;  1BE3 H;  1SZI A;  5IDJ A;  2LCH A;  4Q6G A;  2UXC B;  3LAY A;  1LPE A;  2YLG A;  1YXB A;  1EBO A;  2B0J A;  3QO5 A;  4DYL A;  4JVS A;  2HEP A;  4DXW A;  4CX9 A;  4PK4 A;  3LS1 A;  2M4E A;  4XDJ A;  1NKD A;  2P90 A;  1SQV H;  2E75 B;  1OW6 A;  4I55 A;  5H6R A;  5LXT A;  2CAZ C;  4B3R O;  1Y6D A;  5EBW C;  4DO2 A;  1GN4 A;  4I1O B;  3ZX6 A;  1NTK H;  2R7X A;  1BR4 A;  2QWP B;  4B3M O;  2W0F C;  1ORS C;  2LK4 A;  3C8G B;  3H1L H;  4LLE A;  2FYU H;  3NRH A;  1AUE A;  4FJC C;  1YAR O;  4NQF A;  1N32 B;  1TQG A;  4CS8 C;  1R6N A;  3QVN A;  4DRH B;  1T01 A;  4GZR B;  4PA6 A;  4N06 A;  4QE9 A;  3WG7 B;  4DR5 B;  4U5E E;  1XL6 A;  2NLJ C;  2QGN A;  1WWP A;  5E2Q A;  4DBR A;  1Y67 A;  1GTO A;  1UFB A;  4WGZ A;  2KKW A;  3M7M X;  5DQT A;  4DV3 B;  1OR3 A;  2AU5 A;  4H54 A;  3SYP A;  3TK1 A;  1TWH A;  3IQT A;  1BBH A;  5JQG A;  2ZDI A;  1XNR O;  5GON B;  1OCZ C;  2AHZ A;  1YJ9 V;  3FD9 A;  4E0I A;  1YZC A;  3SPJ A;  4DK1 A;  3NMJ A;  2YL7 A;  4X62 B;  1THZ A;  1KBH A;  1G8X A;  2HJF C;  1LIH A;  2JJ2 G;  4FX5 A;  1EI7 A;  2YI9 A;  4YL0 A;  3ZVR A;  1TUB B;  2A7W A;  1ZU4 A;  1D0Z A;  4FM1 A;  2EIJ C;  1SA0 A;  1YJN V;  4U5C E;  3ABT A;  4WBN B;  2JEU A;  3BFR A;  4I9W A;  4FLX A;  3KYJ A;  3QMK A;  1E1Q G;  3VQW A;  3EHM A;  2HKV A;  1SQQ H;  3WU2 Z;  1X4T A;  2OU6 A;  4JYB A;  1I94 O;  1GN3 A;  2R05 A;  4DUY B;  3KCY A;  4RUE A;  3GEH A;  3EGX A;  5FL7 G;  4DW1 A;  3R2P A;  5LGT A;  3H01 A;  1TWC A;  2P67 A;  4HFF B;  1OZ0 A;  5GTH Z;  1QHT A;  2Y3H A;  3FDQ A;  5LMN O;  4DUY O;  2QLA A;  3K9S A;  1N34 O;  1D0X A;  4QGP A;  4DV5 O;  2XLH A;  4ULW A;  1SZT A;  4Z9H A;  1Q86 W;  2YRF A;  4XQ1 A;  3E8G A;  4DR4 O;  5D5Q A;  5J9P C;  3IHU A;  4W4L A;  4O4H B;  1WPX A;  5FPR A;  2L7A A;  4GQH A;  5TIS Z;  1Q8I A;  4K0D A;  4TUY B;  2V7Q G;  3JD0 A;  4J7K A;  4JW1 A;  2EPO A;  4CC6 A;  3S3X A;  3L34 A;  5KA6 A;  4PJ0 Z;  4EB6 A;  2J9B A;  3T4R A;  5IYC O;  2YVK A;  1FJG O;  5D92 A;  3N2K A;  1J8M F;  3OUS A;  3RYL A;  4J9Y B;  3MYI A;  3A9C A;  3OEE G;  3SXZ A;  2M6Y A;  2UXB O;  1AIL A;  5F28 E;  2R7T A;  1BQZ A;  4U7N A;  2ZIN A;  1JVM A;  3KCX A;  3D3Q A;  1NJI W;  2XTA A;  3NMI A;  1YA9 A;  2ZD9 A;  1JRA A;  2H7B A;  5L0J A;  5LHG A;  1Q0M A;  1JMK C;  2WZL A;  1U97 A;  2MHR A;  1NZ6 A;  3RT3 C;  1OCC C;  4WF9 V;  4JTD B;  2L6H A;  5T1D B;  1HMD A;  4WBN A;  2AWC A;  1JQ0 A;  4I4T B;  3GAN A;  4R8C A;  3JTL O;  1DTO A;  2NUP A;  1MMG A;  1D1C A;  1YYX A;  3N2G A;  3MBG A;  5KX5 A;  4FMT A;  2NUT A;  4BJ5 A;  3ZS8 C;  1KB9 F;  3UMK A;  4LF6 B;  5L3V A;  2NPU A;  2CTR A;  2Y48 A;  1B04 A;  2H7V C;  4E7S A;  1TVK A;  3JAL B;  4YJW A;  3G50 A;  3FB5 C;  4O2B B;  2UUC B;  4ONS A;  4JJF A;  1AEP A;  2V1D A;  1YI2 V;  1Z7Q c;  1F51 A;  1NQT A;  2Q0A A;  3JAW B;  4FIP C;  4HZ3 A;  2DW4 A;  2WSS G;  3DXJ F;  2GUZ B;  2I8B A;  2LP4 A;  1QR9 A;  4DJ9 A;  2J0W A;  1HNX O;  2G3K A;  4CC5 A;  4I5S A;  1K73 W;  3ZHR A;  3OTF A;  2XRH A;  3U2M A;  4C7O B;  1SS3 A;  2Q3T A;  4H4K C;  1HNW O;  1DOW A;  4MW8 A;  2JX0 A;  3U9M A;  4E0H A;  3M8A A;  2WZF A;  1EKY A;  3TET A;  2HVK C;  4BW9 A;  4JI3 O;  1Y66 A;  1Y76 A;  2X0C A;  4CSA A;  1HNW B;  4O79 A;  4X64 O;  2ZXP A;  4I7Z B;  2ZXW C;  4RD9 A;  3FAV A;  3K0D A;  3N2K B;  1ZW2 A;  3IQC A;  4IB4 A;  3ASN C;  1PL0 A;  3WOD F;  5IWA B;  4QJF B;  4AE4 B;  2R7R A;  4YT4 A;  3E22 B;  3UR3 C;  1QR8 A;  2QE7 G;  3CCV V;  2JS3 A;  4YY3 B;  4NTA A;  1ORJ A;  5EYP B;  4PD4 F;  3STL C;  2V26 A;  1QU7 A;  3OA1 A;  5A9G A;  2Y3B A;  1FPO A;  3ZMV A;  2YIA A;  4WFF A;  3A0H Z;  2X6B A;  1ZX3 A;  2WLL B;  2L6L A;  4ZI7 A;  2R9I A;  2PY5 A;  4P2Z A;  1QQC A;  4XLP F;  3ZTZ A;  1ZU5 A;  2ADQ B;  2UXD O;  5E33 A;  3L75 H;  4DK0 A;  5B3S B;  4GX0 A;  4IAQ A;  3G80 A;  1NBM G;  2L9J A;  1J8Y F;  2QTS A;  4Q20 A;  4LNU B;  3OEH G;  4UCO A;  1PNM A;  1QNM A;  4X1I A;  2J9U A;  2EPN A;  5JVD A;  2XLW A;  3GM3 A;  3AQB A;  4LDK A;  2OIG A;  4JE9 A;  2IXM A;  2J0X A;  4XEK A;  3GEE A;  1H9T A;  4C7O A;  2JGD A;  4MTX A;  2AWY A;  1VB5 A;  4C3B A;  4EUK B;  4J7J A;  1O9G A;  1TFK B;  3CQZ A;  4Z1V A;  2EJ7 A;  3K08 A;  2VQE B;  3NYM A;  4LER A;  3P32 A;  4ER9 A;  4A5U B;  5CA0 A;  5LMU B;  4E17 A;  2OG2 A;  1N36 B;  3QVZ A;  4YWQ A;  1WAZ A;  3RQG A;  4RO2 A;  4MTF A;  3G6E V;  1S7Z A;  1JMW A;  5IJ0 B;  1CP9 A;  1NI8 A;  1ZL8 B;  5EBL C;  4XDK A;  1YIJ V;  1UFI A;  1SER A;  1CEZ A;  3RVZ A;  2EUL A;  3JCU Z;  3MX3 A;  4X88 A;  3K5L A;  1S76 D;  3HPL C;  4B7K A;  1VMA A;  4LF7 O;  1ZTE A;  4DR5 O;  4J11 A;  5EGY A;  2OTL V;  1OKK A;  1KP2 A;  2RN9 A;  3QO7 A;  3SPC A;  3VM6 A;  1EFR G;  3LNM B;  1RSO B;  4ZKI A;  4OD4 A;  1FAF A;  1PNK A;  1H8E G;  1KUQ A;  3I5P A;  1M2V B;  2LGW A;  4IHJ B;  1QLE B;  3AK1 A;  5JJJ B;  2UUC O;  3JYH A;  3A11 A;  1NFN A;  4OXS A;  4CS7 A;  2BL2 A;  1Q5O A;  1V55 B;  2EPK X;  4X0R A;  3GOD A;  3SXY A;  4R6Z A;  1H2M A;  3B40 A;  3S29 A;  3C3T A;  4YN0 B;  3ZMU A;  4FK5 C;  5L3Q A;  4G7O F;  1MZE A;  1COW G;  1IBM O;  1OW7 A;  1K92 A;  5AG2 A;  4DV7 B;  2YWA A;  1XNQ O;  1PPJ H;  3G4S V;  1IX9 A;  4P6I C;  1R6K A;  2WLI B;  5DEC A;  3MHH C;  3FHD A;  2F4V B;  2OJQ A;  1BR2 A;  1G1X B;  1VIB A;  2WLL A;  2YUA A;  4FZ1 A;  3SPH A;  3H65 A;  4CIP A;  3CE2 A;  2R9R B;  4QPK A;  1HW2 A;  2R7S A;  3HLZ A;  3DC6 A;  4CH6 A;  3VBB A;  1V55 C;  1M6T A;  3NMK A;  4JAV A;  2PFD A;  4LR3 A;  4HEA J;  4DV1 O;  1S72 V;  1WLE A;  3C18 A;  5C8Y A;  3K04 A;  4GKJ B;  4PA7 A;  4LDQ A;  2O9X A;  2GDS A;  1Z3I X;  3VF0 A;  1M56 C;  2W45 A;  1A7D A;  5BR8 B;  3W8I A;  3B71 A;  3QW1 A;  3AG7 A;  2RNB A;  3S90 A;  4PEL A;  4NXM B;  3M79 A;  5IWA O;  3TJ6 A;  2CNW D;  3RWR D;  2PTM A;  3LEO A;  5LGU A;  2NG1 A;  2VB6 A;  3EG9 B;  5EC1 C;  5CA0 B;  3OE7 G;  4PFP A;  3ZQY A;  1CPY A;  3RVY A;  2VRZ A;  1EN5 A;  1KC8 W;  1HW7 A;  1KU9 A;  3L9D A;  1VQ4 V;  1ZHY A;  1H2L A;  4J80 A;  1MG1 A;  5H9C A;  1FFT B;  2FB5 A;  1VQ9 V;  1PNL A;  3CXC U;  3CCM V;  4Q7C A;  1G4U S;  2JD3 A;  3LSS A;  2ZXR A;  2I15 A;  3WB2 A;  3ZIB A;  2W4B A;  4RQF A;  3S9O A;  4XPX A;  2B1I A;  4KFM A;  1M2O A;  3JSL A;  2KG7 B;  1LKX A;  1ENV A;  4FLW A;  3M15 A;  1WA8 A;  4F6R B;  2WVN A;  3RQE A;  1NFO A;  3APQ A;  1XOU A;  4QDL A;  2XXA B;  2W6I G;  5GW7 A;  4OIN F;  2WLI A;  4B3T B;  1ST6 A;  3W2W A;  3QTH A;  2WB7 A;  3OT7 A;  1XBL A;  2M64 A;  3E35 A;  4GEH A;  1SRY A;  5E1A C;  1J5E O;  1LM3 B;  2P6J A;  2JIZ G;  3K03 A;  1K4D C;  2PUS A;  1YF2 A;  2DQ3 A;  1MA1 A;  3CXH F;  4IHJ A;  2WVQ A;  5LOV B;  4DR3 O;  1VYK A;  4EBJ A;  3K1I A;  4CZZ A;  5LA6 A;  1DGS A;  3O9O A;  3CME V;  4E4E A;  3UO2 A;  1J5E B;  1GGQ A;  5JCO C;  4MVR A;  1JOY A;  5B5E Z;  3HKB B;  4MVU A;  2OCH A;  1BT8 A;  2BSK A;  3VQY A;  1N1C A;  4X89 A;  1RM1 C;  3WB1 A;  3N2Z B;  4TV8 A;  3C90 A;  2KK1 A;  5KHK A;  3RYF A;  2Q5Z A;  2WA3 A;  2PYJ A;  5LHI A;  4IJJ A;  3FAP B;  2XUM A;  4KNV A;  3WAQ A;  3CCE V;  3STZ C;  3BEH A;  5JVE A;  1TGO A;  1GRJ A;  4DBQ A;  4NKG B;  1Z2G A;  4KL1 A;  3SZR A;  3AG2 B;  2YLI A;  2KW3 C;  3EXA A;  1KEC A;  4WJ0 A;  1K40 A;  1YIT V;  3SXK A;  2FL4 A;  2DWD C;  5JCO A;  2V3C C;  1OCO B;  1D5A A;  1GM9 A;  3SJC C;  3E8H A;  4MQ9 F;  2E3C A;  4YHH B;  4GX5 A;  3ABK B;  5EHH A;  1L0L H;  2P5O A;  4IGG A;  3ICX A;  4JI2 O;  5FPO A;  1MSW D;  3V5Z A;  4DV3 O;  4XTK A;  5LBQ A;  5KMG A;  4H44 B;  4DV7 O;  2LP7 A;  2UUH A;  4W8P A;  3J06 A;  4DRJ B;  4PDL A;  3SDL A;  2YXH A;  3B2E E;  3OFN G;  4X1Y B;  1XMQ O;  1IBL B;  1MMN A;  3CEX A;  4MTG A;  5B1O A;  4CH4 A;  4GKJ O;  1SKV A;  4DV4 B;  4HNA B;  2OKU A;  1NVP D;  4L8J A;  3O6X A;  3RYH B;  5C93 A;  5KUM A;  2R03 A;  3JSZ A;  4YJ2 A;  1NSG B;  1J95 A;  2HSQ A;  4HAM A;  4UVA A;  5B1A C;  3O65 A;  1Q82 W;  4TV9 A;  2LGQ A;  1ZHZ A;  5LP6 C;  1JPN A;  1OW8 A;  4MVS A;  4GKK O;  2CDY A;  4QPJ A;  4QNH B;  4F6E A;  2JS5 A;  5E3A A;  2A3Q A;  4H33 A;  3RQF A;  3S28 A;  2VS0 A;  3JAM N;  4J7Y A;  4PJN A;  3L8J A;  4KI2 A;  4X20 B;  1JA8 A;  2YKZ A;  4O4I A;  5CMU A;  2R70 A;  4XEF A;  3QO8 A;  1KKD A;  3AG3 C;  1PV0 A;  1FMW A;  2P22 C;  3EH2 A;  2DN9 A;  1NU1 H;  2IH3 C;  4I0X B;  1ZHX A;  3POV A;  1SF8 A;  3ZTM A;  3W7U A;  4BJ6 C;  2A0L A;  4ZOL A;  2LJ2 A;  3HKE A;  3JAR A;  4BWA A;  1RJ9 A;  5B3I A;  2GDC A;  1ZHT A;  3RYC A;  1PD3 A;  1SES A;  5BUO A;  4H13 B;  3SEO A;  2EZO A;  3GWK C;  1ORQ C;  1C17 M;  5KA5 A;  2QKC A;  2YID A;  4TQD A;  3AGU A;  4FLV A;  4HE8 D;  4MVZ A;  2JDI G;  4O2A A;  1FKA O;  1VP7 A;  3L73 H;  4U5H A;  3ABK C;  3CCJ V;  3OWT A;  4OIQ F;  2VAS A;  2LQT A;  3KH2 A;  1M57 C;  4JYA B;  2E5L O;  1BHA A;  4X66 B;  5CA1 B;  3K59 A;  1T5E A;  3D36 C;  1KKC A;  4JI0 B;  2WLK A;  4QE7 A;  4JTC B;  4JI5 B;  1VQK V;  1WAS A;  2C03 A;  3C8G D;  2XL8 A;  3S84 A;  2PX0 A;  1SZX A;  4WFE A;  1YCI A;  1HY5 A;  5HSW A;  1GAX A;  3SYC A;  3CAX A;  5L0I A;  4CS8 A;  3TXS A;  5DVW A;  4CDA A;  2HMZ A;  4JI5 O;  4CS9 C;  4TQF A;  4YL3 A;  1BZK A;  1I08 A;  4X20 A;  2DYR B;  1F23 A;  4O4L A;  1GQA A;  4OIR F;  2NNU A;  1N0N A;  2BTO A;  2ILM A;  2YIC A;  3ASO C;  4O4J A;  2R7W A;  2F4V O;  1OR2 A;  2QDO A;  1KD1 W;  1YZB A;  5FLX N;  3OW2 U;  2ZDI C;  2WPD G;  5LP6 B;  1HR0 B;  2OWO A;  4K8Z A;  3L1M A;  3ZWI A;  5JS5 A;  3WB0 A;  3AG4 C;  1I5X A;  3DZA A;  1A0B A;  3OM3 B;  1XMO O;  2ASR A;  1S5J A;  3ZHS A;  2ZR2 A;  4G7Z F;  3DAF A;  4U9D A;  2JJ1 G;  2YS8 A;  4FPP A;  3CJH A;  1CXZ B;  3T1H O;  3DJN B;  4R50 A;  3U8P A;  1XWJ A;  2XND G;  2ADP A;  1SMY F;  4O7G A;  3K33 A;  3JD2 A;  5BQH A;  4XEV A;  4NTY A;  4LP8 A;  3ASO B;  5IY5 C;  3IQ6 A;  4DV6 O;  3VRC A;  3LDE A;  1WNS A;  4WFB V;  3R66 A;  4YL1 A;  1VQ7 V;  4UCR A;  3FX7 A;  5CBG A;  3ZHQ A;  4GT1 A;  4DV6 B;  2CGE A;  4DR4 B;  2Q73 A;  4AX2 A;  1OHH G;  4ZOL B;  4UFZ A;  4JF3 A;  2L6G A;  3N0T A;  1MNE A;  5JH7 A;  2LSE A;  4LLC A;  4H37 A;  3B8M A;  3LS0 A;  4O6N A;  2OEV A;  1L8D A;  3SXM A;  4GYC B;  4LF4 O;  2XS1 A;  4BAY A;  3PCV A;  1S77 D;  4F4L A;  1B3Q A;  2Q9L A;  3JYC A;  2WL8 A;  5A6K A;  1Q43 A;  4Z2W A;  3I5Q A;  3THO A;  3K6B A;  4ZI7 B;  2JGU A;  1US6 A;  3OUF A;  1Y76 B;  5KHI A;  2D3O W;  5L3G A;  3CYO A;  5IY5 B;  3RGB A;  2L6F A;  3GWL A;  4CBE A;  2EJR A;  2UXB B;  2LD6 A;  3ABM C;  2Q0O C;  4NTX A;  4LFA O;  4U3J A;  3C3S A;  3AOU A;  2QNL A;  1JJO A;  3GOR A;  3B77 A;  1OV9 A;  1EQ1 A;  1K3E A;  3ZRW B;  5DN6 G;  4GX2 A;  3DXR A;  1AR1 B;  3PMR A;  3TOM A;  2RD9 A;  5L0D A;  1BHB A;  1VLS A;  2JK5 C;  1W2B U;  2H8A A;  3UT5 B;  4JAS A;  4JI7 B;  3EHB B;  4O4L B;  1U0B B;  1LVK A;  1WN0 A;  3P3P A;  4TWK A;  1XL4 A;  1NS1 A;  3B0P A;  2L35 A;  4NYK A;  3O39 A;  1K4C C;  5GPG B;  2QKA A;  2YQY A;  2P4K A;  4NB5 A;  1ZL8 A;  1GN6 A;  3TUL A;  1TWA A;  2OCC B;  3CWB H;  4RDA A;  3PJS K;  4MND A;  1GM8 A;  4JCH A;  2HVJ C;  4KHP O;  1BMF G;  4DOZ A;  1PKX A;  3SP1 A;  5BXZ A;  3CCU V;  2PI5 A;  2XAH A;  5J2U B;  4ASU G;  4E2L A;  5LYJ A;  2JGD B;  2PBE A;  3AEI A;  4MW3 A;  3M4B A;  3ECS A;  3AG1 C;  4B7E A;  1F7Y A;  4AI8 A;  2DGJ A;  3F7V C;  4KC9 A;  5CA3 A;  5J2T A;  3K1I C;  4IWB A;  2XM4 A;  4CH5 A;  1YHQ V;  2ZCE A;  4TSF G;  4X62 O;  2ZR3 A;  5CBF A;  2Q68 A;  1XDC A;  2Q7E A;  4EB6 B;  1M2V A;  2IM9 A;  5BQG A;  1SA0 B;  1Z5V A;  3IJ4 A;  1WPB A;  4PAC A;  4DV2 O;  4AQY B;  1ROP A;  2QTV A;  2KJG A;  2BOC C;  4JI8 O;  1JCH A;  1T6U A;  3A0B Z;  1OQC A;  4K0K B;  3TD7 A;  4PA9 A;  2QUP A;  3DSQ A;  1IBM B;  3EFO A;  1BL8 A;  1B6Q A;  1AB3 A;  2FKX A;  3HNJ A;  4AL1 A;  2Q9C A;  3LEV A;  4YT5 A;  3BA8 A;  4ANJ A;  4ZIB A;  4GLX A;  1M9N A;  2RDC A;  4CSA C;  1I4Z A;  2M7W A;  3KYI A;  2KQX A;  2X6A A;  2PF4 E;  1TAE A;  4UV9 A;  2O57 A;  4K1O A;  4FES A;  2NR5 A;  5COM A;  1EZJ A;  5F2V O;  3S27 A;  3T9O A;  2XAQ A;  1D2D A;  1ZW3 A;  3AG1 B;  2UU9 B;  1ZAU A;  2GFH A;  4I44 A;  1BS3 A;  2GUZ A;  2EPL X;  2CH7 B;  3FMS A;  2BTQ B;  1M5I A;  1KQS U;  3DD7 A;  2QWO B;  1P4R A;  2WLN A;  4FM2 A;  4U3J B;  3UNG C;  2XAJ A;  3L70 H;  5B1B B;  4JPR A;  2F95 B;  3OMN B;  2WWW A;  3K5N A;  1MNG A;  1ARO P;  4KXR A;  3JRM O;  3F5W C;  2CTW A;  5A6B D;  1RPO A;  3AK3 A;  1HNZ B;  2UUB B;  3ML0 A;  4LFB B;  4KP4 A;  3S0X A;  4LDR A;  3JAW A;  4P9T A;  1BSM A;  2XHB A;  1H2K A;  2P7V A;  5BZB A;  1IXM A;  2YIB A;  1SQP H;  3EPV A;  1GK9 A;  5LMU O;  1WB7 A;  1VK5 A;  3EQL F;  5KYU A;  3ABL B;  3CEI A;  3J80 N;  4WFA V;  2XLV A;  3X1O A;  3ZN1 A;  2JVD A;  4BJ5 C;  3RW0 A;  4E7Z A;  4PFO A;  1M90 W;  2F66 C;  3UMI A;  4N23 A;  3C63 A;  1P49 A;  5JWP A;  3AQC A;  3FFQ A;  5BMV B;  4LFA B;  5KYW B;  5EYP A;  1IZ3 A;  1CGM E;  3A2F A;  4U3F H;  4YXW G;  2VCA A;  1SYQ A;  4QI0 A;  4I50 A;  4UVB A;  2RMK B;  1M93 A;  2QEX V;  1H2G A;  2XL4 A;  1V4A A;  3CMA V;  1B06 A;  2YL0 A;  3JAK B;  2ZM6 O;  5JUA A;  3EJN A;  2KSF A;  5AGF A;  5LOV A;  1MMD A; 
#chains in the Genus database with same CATH homology
 3GWO A;  3LSS A;  2ZXW B;  5KUK A;  2EIK B;  4RQF A;  2B1I A;  1AI4 A;  4KFM A;  2EIL B;  3E8B A;  3RBZ A;  1ENV A;  1JPX A;  1K5Q A;  4QIW F;  3ZRX A;  2W6I G;  1FXK B;  5GW7 A;  2WLI A;  2XAF A;  1QCE A;  2CK3 G;  1DF5 A;  3CCQ V;  3E35 A;  3ZMS A;  1SRY A;  5E1A C;  2P6J A;  5L3E A;  2JIZ G;  3K03 A;  1K4D C;  1Q81 W;  2HFE C;  2DQ3 A;  2Y69 B;  2ITD C;  3ZIA G;  4CZZ A;  2X6C A;  2DWE C;  5CN0 A;  3CME V;  1NH2 D;  4CBC A;  3MD0 A;  4MVR A;  2YSU B;  1JOY A;  2X7R B;  4MVU A;  5DM6 V;  3ZRS A;  3E2E A;  2BOB C;  3FYI B;  4X89 A;  1RM1 C;  3ZMT A;  1S5H C;  2Q69 A;  4Z1M G;  3F7Y C;  2PI4 A;  2UXN A;  3ZJZ A;  2WLM A;  1NR7 A;  4PA4 A;  2EZP A;  3E83 A;  5B1B C;  5LHI A;  3ABM B;  2GSM B;  3OR7 C;  2P7T C;  4R7C A;  3CCE V;  3STZ C;  1VQ6 V;  3BEH A;  5H6Q A;  1Y4M A;  2DYR C;  3CC2 V;  1DF4 A;  2WLJ A;  3GB7 C;  3AG2 B;  4L87 A;  5IDJ A;  3VOU A;  1KEC A;  2EIN C;  1YIT V;  1QLN A;  2DWD C;  3IGA C;  1G4Y B;  1EBO A;  1OCO B;  3QO5 A;  4BW5 A;  1GM9 A;  3E8H A;  1DLB A;  3ABK B;  4GX5 A;  4DXW A;  2DYS B;  2EIL C;  4XDJ A;  3LDC A;  1NKD A;  2P90 A;  5L3B A;  1MSW D;  5H6R A;  3A0R A;  5LBQ A;  3CCR V;  5EBM C;  5EBW C;  3SPI A;  4DO2 A;  3I55 V;  2LP7 A;  2ZQM A;  1W0K G;  4PDL A;  3T4Z A;  3OFN G;  1FS0 G;  2QTO A;  4MTG A;  5B1O A;  1N8R W;  3CCV V;  2W0F C;  1NVP D;  2OTJ V;  3LSQ A;  3DTU B;  4FJC C;  5C93 A;  5KUM A;  1ZWI C;  3FB7 C;  1J95 A;  1R6N A;  1JX9 A;  4HAM A;  4PA6 A;  4UVA A;  5B1A C;  3ZCC A;  2OCC C;  1K34 A;  4QE9 A;  3WG7 B;  1Q82 W;  2HLD G;  1XL6 A;  2NLJ C;  3W7T A;  3SPG A;  1GTO A;  1JJ2 U;  1FXH A;  1YTF D;  3D3I A;  1HWY A;  4GCZ A;  4MVS A;  2LFR A;  3SYP A;  3TK1 A;  2K1E A;  4QPJ A;  4QNH B;  4N21 A;  2ZDI A;  2Q6A A;  1OCZ C;  3DGE A;  2AHZ A;  4H33 A;  1UJW B;  1YJ9 V;  2B5U A;  3SPJ A;  2AHY A;  1THZ A;  2HJF C;  4JGS A;  3CPW U;  3CCS V;  3M99 B;  2JJ2 G;  3SYQ A;  1W0J G;  3G71 V;  1AJP A;  2C2A A;  2EIJ C;  1YJN V;  3ABT A;  5CMU A;  2JEU A;  4I9W A;  4ZBM A;  4U7O A;  3QO8 A;  3ZN0 A;  1E1Q G;  1KKD A;  3AG3 C;  4P30 A;  3T2M A;  4JYB A;  4RUE A;  2WLH A;  3OMI B;  2IH3 C;  5FL7 G;  3MHS C;  3E86 A;  5LGT A;  3H01 A;  1G8M A;  2JEX A;  2P67 A;  4RQE A;  3W7U A;  2A0L A;  1OZ0 A;  3FYE B;  2IJH A;  4MSW C;  1PD3 A;  1SES A;  3K0G A;  2EZO A;  1SZT A;  1ORQ C;  1M57 B;  1Q86 W;  1L1F A;  5KA5 A;  2EIN B;  4RUF A;  3E8G A;  2HKO A;  3ZRV A;  4MVZ A;  5J9P C;  2JDI G;  1WPX A;  2EIM B;  2V7Q G;  3JD0 A;  3ABK C;  2A79 B;  3CCJ V;  4JTA B;  5KA6 A;  2GHY A;  5IYB O;  5IYC O;  1M57 C;  1BHA A;  3ETE A;  1V54 C;  1VQN V;  3I56 V;  3OUS A;  4LC1 A;  2HG5 C;  2OT5 A;  1F4M A;  4J9Y B;  2W6J G;  2WLK A;  4QE7 A;  3OEE G;  4JTC B;  1VQK V;  1I5Y A;  1NVP B;  4WCE V;  4U7N A;  1JVM A;  3ABL C;  1NJI W;  1AI6 A;  3JD1 A;  4WFE A;  5L3F A;  2ZD9 A;  4XBF A;  3SYC A;  5LHG A;  1RM1 B;  1Q7Y W;  2X0L A;  3IFX A;  4MVM A;  1K7D A;  1OCC C;  2IU0 A;  4WF9 V;  4JTD B;  1QVG U;  2DYR B;  5LGN A;  1F23 A;  2NNU A;  3ASO C;  4JYC A;  1JQ0 A;  1KD1 W;  3WFV A;  3OW2 U;  2ZDI C;  2WPD G;  4R8C A;  3ASN B;  1DTO A;  2ATK C;  5EK0 A;  1LNQ A;  3AG4 C;  1I5X A;  3OM3 B;  2F43 G;  2ZR2 A;  2JJ1 G;  4FMT A;  2Z3Y A;  1P7B A;  4FPP A;  3AG4 B;  4R50 A;  2XND G;  1NH2 B;  2WAM A;  2Y48 A;  2IJK A;  3JD2 A;  3AG3 B;  1VQL V;  4EKW A;  1VQP V;  4MTO A;  3R65 A;  3EFF K;  4LP8 A;  3FB5 C;  1KP3 A;  3ASO B;  4MS2 A;  5IY5 C;  2H94 A;  3ZMZ A;  3JD4 A;  3LDE A;  4WFB V;  2V1D A;  1YI2 V;  1F51 A;  1NQT A;  1H8H G;  1VQ7 V;  1GM7 A;  3CD6 V;  1E79 G;  4FIP C;  4HZ3 A;  1AI5 A;  2QM8 A;  5CBG A;  2DW4 A;  2WSS G;  3LUT B;  4GT1 A;  2IH1 C;  1YSC A;  1R3I C;  2HR3 A;  3OAA G;  4G27 B;  1QR9 A;  4HYO A;  1OHH G;  3SYO A;  2Z5U A;  4I5S A;  1K73 W;  4JF3 A;  4PA3 A;  2UXX A;  4H37 A;  3B8M A;  4MW8 A;  4BAY A;  1S77 D;  4F4L A;  3TET A;  3BY6 A;  2HVK C;  3JYC A;  1S3J A;  1M1K W;  3ABU A;  1Y66 A;  5EC2 C;  1V54 B;  3OUF A;  2D3O W;  2ZXW C;  3ETD A;  3K0D A;  4TT3 G;  2XOK G;  3W7W A;  5L3G A;  3K9A A;  3CYO A;  5IY5 B;  3ASN C;  1PL0 A;  3QNE A;  1K8A W;  2EJR A;  3ABM C;  4QJF B;  1YJW V;  3T4D A;  3OGC C;  3P30 A;  2IW5 A;  2KB1 A;  1QR8 A;  3B77 A;  3E89 A;  2H8P C;  1K3E A;  2Q67 A;  2QE7 G;  4GX2 A;  2XAG A;  3ZRW A;  3ZRW B;  5DN6 G;  1AR1 B;  3STL C;  1BHB A;  2JK5 C;  1W2B U;  3JCZ A;  1OCZ B;  3B8N A;  3ZMV A;  4MVQ A;  1R3K C;  1R73 A;  3W7X A;  4JAS A;  3EHB B;  2X6B A;  4WFF A;  2LFS A;  2WLL B;  4PDR A;  2R9I A;  4P9P A;  4TWK A;  1XL4 A;  4P2Z A;  1OCR B;  3HB3 B;  2FTK A;  1K4C C;  2EIJ B;  5B3S B;  4GX0 A;  4J9Z B;  1NBM G;  2XAS A;  2QM7 A;  2OCC B;  3PJS K;  4Q20 A;  3OEH G;  1GM8 A;  1AI7 A;  1PNM A;  1GKF A;  2HVJ C;  3CP1 A;  1BMF G;  1PKX A;  4X8A A;  1VQM V;  3CCU V;  2PI5 A;  2XAH A;  3W7S A;  1K33 A;  4MTX A;  4ASU G;  4E2L A;  4P9O A;  3AEI A;  3OMA B;  4MW3 A;  3AG1 C;  1VQ8 V;  3F7V C;  3K08 A;  5CA3 A;  3P32 A;  3FB8 C;  2DQ0 A;  1OCR C;  1K5S A;  1MOF A;  1F4N A;  2EIK C;  3JD3 A;  4UVC A;  1YHQ V;  2IU3 A;  4RO2 A;  4MTF A;  3WG7 C;  5LHH A;  3UM7 A;  4TSF G;  3G6E V;  2ZR3 A;  5CBF A;  2Q68 A;  5B1N A;  4UUJ C;  4WFG A;  1CP9 A;  4JAU A;  3K06 A;  5EBL C;  4XDK A;  3FB6 C;  1YIJ V;  3UKM A;  3T1C A;  1M56 B;  3NXS A;  1ROP A;  2BOC C;  1SER A;  1RPR A;  1JCH A;  1CEZ A;  1TUE B;  3RVZ A;  2IJJ A;  4KUM A;  4PA9 A;  4X88 A;  1VQ5 V;  4G2K A;  1S76 D;  3HPL C;  1BL8 A;  1B6Q A;  2B1G A;  1R3L C;  3AG2 C;  2OTL V;  1MAB G;  1E1R G;  1KP2 A;  3D36 A;  4BIU A;  4MT8 A;  1M9N A;  1NR1 A;  3QO7 A;  4LBE C;  3SJQ C;  3SPC A;  3CC7 V;  2A9H A;  1EFR G;  3LNM B;  1FXV A;  2M7W A;  4ZKI A;  1OCO C;  1PNK A;  2X6A A;  4UXN A;  4UV9 A;  1H8E G;  5IYD O;  1QLE B;  1EZJ A;  2XAQ A;  3AG1 B;  3TCU A;  2Y69 C;  3KG2 A;  4OXS A;  4GX1 A;  1S0V A;  1K97 A;  1V55 B;  1H38 A;  4R6Z A;  2MK3 A;  5HFM A;  1KQS U;  3ZMU A;  4FK5 C;  2EIM C;  1P4R A;  3SYA A;  2WLN A;  1COW G;  1QLE C;  2XAJ A;  3K3W A;  1K92 A;  1GMG A;  5B1B B;  4JPR A;  3LDD A;  2YEV B;  3OMN B;  3G4S V;  5HFL A;  2WWW A;  1FXK A;  1R6K A;  2WLI B;  5L3D A;  3MHH C;  1ARO P;  1SET A;  5L3C A;  3F5W C;  1K9M W;  3ETG A;  1RPO A;  4PDV A;  1YTF B;  2WLL A;  4PDM A;  2ITC C;  3ML0 A;  3CCL V;  4KP4 A;  3SPH A;  4XDL A;  1OCC B;  1QVF U;  4UV8 A;  2R9R B;  4QPK A;  3E8F A;  2QA4 V;  5BZB A;  1IXM A;  3CC4 V;  3VBB A;  1V55 C;  3IC7 A;  2QKS A;  4JAV A;  1GK9 A;  3X2Q B;  4G28 B;  5CBH A;  1S72 V;  1WLE A;  3ABL B;  4BIZ A;  3K04 A;  5B3S C;  4PA7 A;  4WFA V;  3ZN1 A;  1M56 C;  1AJQ A;  3RW0 A;  5B1A B;  1M90 W;  2YEV A;  4N23 A;  4PEL A;  1GO3 F;  5LGU A;  4RAI A;  1AJN A;  4YXW G;  5EC1 C;  3OE7 G;  3FKS G;  1FXK C;  3OR6 C;  2EBO A;  4UVB A;  1CPY A;  1VQO V;  3RVY A;  1KC8 W;  2QEX V;  1QBZ A;  2DYS C;  1H2G A;  4WFH A;  3CMA V;  2IJI A;  3X2Q C;  4MVO A;  1VQ4 V;  3K79 A;  1MG1 A;  5H9C A;  1FFT B;  1R3J C;  4LCU C;  1VQ9 V;  1PNL A;  3CXC U;  3CCM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...