1JR8A

Crystal structure of erv2p
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erv2 PROTEIN, mitochondrial
publication title A new FAD-binding fold and intersubunit disulfide shuttle in the thiol oxidase Erv2p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 41
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1jr8A00
4E0HA 3U5SA 2HJ3A 3MBGA 3U2MA 3U2LA 3TD7A 3W4YA 1JRAA 4E0IA 3GWLA 3TK0A 1JR8A 3LLKA 3R7CA 4LDKA 3LLIA 3O55A 3GWNA 1OQCA
chains in the Genus database with same CATH superfamily
2JD3A 2ZXWC 2B0JA 4LACB 3HNKA 5DS4A 1S7ZA 5F5FA 2P6VA 2R7QA 3DXJF 2AWYA 1Q0FA 2XL6A 2J9VA 3OWTA 4Z9JA 1Q0MA 2IOQA 3WG7C 1YVIA 5HSWA 2BE5F 3C18A 3U8VA 5KYXB 3CSKA 1EQ1A 2VH3A 4BJ5A 2QUPA 1LIHA 1QQ3A 3U9JA 3GM1A 3NRHA 5L0FA 1TWHA 2WZLA 4AL0A 3DJUB 5AGFA 3US6A 2CGEA 2XL4A 3BRJA 3EFOB 3K1HA 4IRUA 2R9RB 2J46A 4H4KC 4MTGA 3JRTA 1MMGA 1LI5A 3FOOA 4DRIB 2Q9CA 3K66A 3POVA 1U0BB 4C7OB 1ORSC 2XL8A 4NTAA 3O55A 3TJ6A 5E33A 2EPLX 3NMKA 5DQTA 3AG3C 1JMWA 3HNLA 4BJ1A 4JEBA 3MYFA 1QVXA 1RXQA 2E87A 3HJCA 4GEHA 4FESA 3VRCA 3L8JA 4JTDB 4EUKB 5D92A 2HJMA 3ZG1A 3ZVRA 3DE8A 2H7OA 1ZHTA 2GFHA 4ZLCA 2H8AA 3JRMO 4U9DA 4QI0A 1Z7Qc 3UNGC 1UG7A 4XEFA 3CEXA 4XEVA 2Q4FA 2J9WA 1XZPA 1LPEA 2XXAA 2L6FA 2W4BA 3IQTA 2XS1A 2JX0A 3DM9B 1JPNA 1ZZPA 1ZHYA 2R02A 3TOLA 4B6IA 1YAUO 2IYLD 2XLOA 1IW7F 3KYIA 3TJ5A 5IY5C 2NUPB 3X2QC 5JUAA 1MNEA 3FAPB 3NG1A 2QE9A 1BR2A 4Q7CA 4PFPA 1T6QA 1QLEC 2AP3A 3OA1A 4BJ6A 1M2VB 3RW0A 4JRZA 4BJ5C 3EH2A 3RKOF 1BR1A 5CI8A 2J0WA 3ASNC 2EPNA 3MBGA 3L8IA 2IBFA 3SYNA 4CS9C 2DYSC 3AG2C 3IHUA 3K1IA 4QDLA 3JZ0A 2YKZA 1WOLA 1NU7D 1T6UA 3SXYA 1EA8A 3ABMC 4YL3A 4OIRF 1MMNA 3TK0A 1OR2A 1CPQA 3LLKA 2YWAA 4AK9A 3DM5A 4MVOA 5K0IA 3T4RA 4LDKA 3LLIA 1D0YA 3F47A 1BDJB 2V26A 2HKVA 3F46A 2GDCA 4A2NB 2ZD9A 4IAQA 5TJ5E 2IXMA 4GYTA 4JIOA 4JCHA 1JOGA 4CDVA 3ABKC 3IEEA 3M15A 4O6YA 1D0ZA 1V55C 2WZFA 1D1AA 3FAJA 1OCRC 3QW0A 3TD7A 2KW3C 5KYUB 1LE4A 1A7VA 4JKVA 5B1BC 3M79A 3W8IA 4JTAB 4XWJA 2JPUA 2HV7A 2HUJA 2DGJA 1SYQA 3ECSA 5T3TA 3MX3A 2OEVA 4JTCB 1JR8A 3VM6A 2EPOA 3OEOA 2QLAA 1U89A 1WN0A 2W4MA 4PR9A 3SXMA 5KYXA 3FXHA 4NY3A 1PD0A 4IARA 1E86A 3RQFA 4BJ6C 4XPWA 2YVKA 5A6KA 1E84A 2CCYA 3SZRA 5FCLA 5JSLA 1RCPA 3SP1A 2EIJC 1I4ZA 5DLJA 3M4CA 1TKNA 2OU6A 1ZU4A 2OOCA 3K1IC 4C7OA 3EJNA 4CIPA 3V5XA 1VB5A 3NYMA 4D4NA 3ZIBA 1C17M 1QPUA 3H2VA 4NTBA 1OW6A 4KBLA 3N24A 2VB6A 1HMDA 1IZMA 3O10A 4NTFA 3AG4C 1CPRA 1B68A 1LKXA 3EGDB 3VYWA 1WGWA 1H9TA 3FVYA 3DJNB 4AE4B 2R7SA 4P9TA 3E9VA 1TWGA 2IXNA 1TR2A 3T6JA 1M2OA 3K6BA 3U0CA 4DOZA 4PJLA 4MTFA 3AQCA 2A6EF 3M1CB 4MVZA 3RVZA 3UR3C 4BEJA 2LK4A 1C02A 1OXKA 2HS5A 3KL4A 1KNYA 2NG1A 4MQ9F 2HSBA 1ZHZA 3KYJA 4KNWA 3LEOA 1ST6A 3NKEA 1YYJA 4FX5A 1V4AA 2F22A 2NUPA 3EZHA 3JTLO 4HFFB 4P9FA 3U2LA 2A1DD 4JJFA 3G50A 3K33A 4Q4ZF 1NU9C 1Y4CA 1RKCA 1M2VA 2AWCA 2MYSA 2YL3A 2OJED 4W8KA 4J7YA 4WABA 3FDQA 3AQBA 3ITFA 2VCBA 1YZCA 4XLPF 4PFOA 1QSPA 2Y69C 3ZDLA 4CS7A 5L0IA 2W45A 5BQIA 1R5ID 2RSEB 3GEIA 3O6XA 1E85A 2KK1A 1U6HA 1G4US 1O3UA 1M57C 1WATA 1N1CA 4L6RA 3T9OA 4MVQA 3TULA 1RJ9B 4YL0A 1NSGB 2WL8A 3SXZA 4IB4A 3W8HA 4J32B 3C63A 2OJQA 2A0BA 4NQFA 1K04A 3ABLC 1TWCA 3ASOC 3B71A 3NMJA 1PV3A 1T01A 2IXOA 3RF3A 3ZQYA 4F4BA 1NFOA 3E70C 2V3CC 5L0CA 4M63A 2WVNA 4OIOF 2KGOA 1MMDA 1NZEA 2FFHA 1AEPA 2YLGA 2CW0F 2H7VC 3Q7LA 3S90A 2XLEA 2L9JA 4MS2A 3U3BA 5EGYA 2L7AA 3QW1A 1APCA 5JLIA 3GWLA 4EKWA 3A11A 2R7RA 4P6IC 5KYUA 5A6BA 5KYNA 2NSGA 1LS4A 2ETSA 3HTKC 3DMDA 2Q7RA 4HE8D 2NUTB 4EWCA 4U5GA 1T9KA 5L0HA 2KQ9A 1K40A 3JT1A 2Y39A 3MLGA 4N06A 3CQZA 4C3BA 3H65A 3EGXB 2OCCC 3PCVA 1SF8A 2KC3A 2OG2A 1OQCA 3QMKA 2L6GA 4BPMA 1ORYA 1Y6DA 4K7BA 4EBBA 3G4XA 2XLWA 4DJ9A 2QY9A 3RIPA 2GAQA 3PMRA 4HFKB 4I1MA 4CS8A 5HV9A 2G3KA 4LDQA 1VMAA 1XZQA 4E0HA 2OEXA 2OKUA 4YT4A 2CDQA 2Q9BA 1V54C 2EIKC 3FOPA 4OINF 1FTSA 2YEVA 4H54A 3AJMA 1WTYA 1OCOC 4N6CA 3NKDA 3RYLA 1HW1A 5FZTA 4X0RA 4E0IA 4ER9A 1YARO 3GM3A 1GS9A 1SMYF 1ZW2A 3HNIA 1OCZC 2B0HA 3U3FA 3UMIA 3LNMB 4U5EE 1C03A 4Q5SF 3EGDA 4JZAA 4JW1A 4MW8A 4O79A 2PBEA 2HV6A 1SR2A 4LDRA 4PJJA 3TOMA 2LFFA 4AE4A 1YA7O 2BC5A 2WVQA 5CI9A 5BUOA 2YL1A 3CZ6A 3EG9B 3RQGA 2CNWA 2YQYA 2J7PA 3FHDA 3GORA 4LLCA 3LEVA 1ZVZA 3U5SA 2DYRC 3HNJA 2LQGA 2XLMA 4YT5A 3KPHA 3U2MA 2PP4A 3IQ6A 5E2QA 3EH1A 3QVZA 4J30B 2J45A 4ULVA 4DXWA 5KYYB 3ZQVA 1Q0DA 2A68F 3C7JA 4Z9IA 3S29A 3Q6MA 1DOWA 4LLEA 4EIYA 4PK4A 2MHRA 1S05A 2LCHA 4WGYA 3ZC4A 1WASA 2R7WA 3TQOA 2J0XA 2AVKA 1JPJA 2R7OA 4E7SA 5JRAA 1I4YA 5BQGA 4DRJB 1TFOB 1Q0GA 4JJGA 4CX9A 2Y3BA 1GQAA 3GWNA 1Z5ZA 2FAPB 1H7IA 3JSEO 1RKEB 3A9CA 5KYWA 1CGOA 3S28A 2R7XA 4G0HA 4XPYA 4YK5A 1I5NA 4PJMA 2Q00A 4CJGA 5L3VA 1OR3A 3S84A 3RVYA 3SNHA 2Y3HA 2ZXPA 3BEHA 5COMA 4CDAA 3S27A 1RJ9A 1YDIA 1Z3IX 2C03A 2VCCA 3UMHA 5A6BD 2W9YA 3JSZA 4YJWA 3AG1C 1PD1A 3B9QA 3FMSA 2A6HF 3L0IA 1D1BA 2O9XA 1VYKA 2ICWG 3M4BA 4W8PA 2XLHA 5DQZA 4G7HF 4KNVA 3B0UX 4IWBA 1CGME 1GGQA 2I15A 3N2ZB 2NSFA 1QZXA 4JE9A 3QTHA 1F1MA 1E83A 2R7VA 3DI5A 3NDBB 1ZW3A 1ZYRF 3VAYA 1T6IA 3C8GB 1NLXA 3O39A 4XPXA 2EIMC 1LE2A 2HMQA 1L7CA 3HLZA 4AL1A 1CGNA 2LFDA 4NCQA 1EKYA 3V5YA 2LSEA 4DBQA 2NUTA 4WJ0A 2A69F 1HW2A 2A0UA 4E7ZA 3LNRA 3UMKA 2L81A 3EGXA 4ULWA 3NYLA 2L6HA 4DVZA 1GM5A 2YLIA 2YL7A 2UUIA 5T3WA 1FR0A 5L0DA 4MNDA 1OKKA 2D4UA 2GA0A 2XM4A 1JRAA 3AOUA 3V5ZA 1TFKB 1BBHA 3W2VA 3C8ZA 1UFBA 2FGYA 5KYWB 1VOMA 2LIGA 1LM3B 3GEHA 1FFHA 2HZ8A 2IXPA 2QTVA 3EPVA 5F28E 4I44A 3RFYA 2CNWD 2WZGA 2J7PD 3U9MA 4MVSA 4U5BE 4YN0B 5AC5A 1OW7A 3I4UA 4K1OA 4Z9HA 1FAPB 1ZHWA 2DB4A 1O5HA 2VCAA 4NC3A 5BQHA 1FMVA 1VYIA 2EILC 2IM8A 1HY5A 2P0NA 3WAQA 2PX3A 5EK0A 256BA 1A7DA 4LERA 4ZLDA 1J8MF 4JEAA 3I5PA 4YWQA 1TWAA 1H6GA 2RD9A 2YLDA 3ATPA 1ZU5A 3V7OA 1VLTA 2P61A 5JP7A 2EPMX 2KSFA 3L1MA 3EG9A 2XSEA 2XLVA 1VK5A 1DOVA 4O6MA 4U5CE 4ANJA 4CS9A 3UGPA 2EINC 3DE9A 3IQ5A 2YL0A 2P7VA 2M64A 3LAYA 1L3PA 3ZTMA 4CIHA 5KYYA 2R7TA 1MMAA 5DVWA 3T6GB 3IPMO 3EHNA 2Y3GA 2R05A 5A6AA 1RMVA 1YYXA 2GWWA 2PX0A 4I1OB 3R2PA 5T1DB 1D1CA 2XLDA 3GEEA 1R4TA 1TQGA 1ZHXA 2C04A 2Q9AA 2UUHA 3JYHA 4C3EA 4JURI 4CBEA 4EHPA 5B3SC 4DBRA 3IQCA 3SXKA 4G78A 1J8YF 5JS5A 2ZXOA 1RKEA 4UDVA 4KI2A 2HJ3A 1KU2A 4HEAJ 1AUEA 5A69A 2P1AA 3QZCA 4OIPF 2LP4A 1M6TA 4XLNF 1NBBA 1KTMA 1WWPA 3DD7A 4RBNA 5B3IA 4JC7A 4XTKA 5L0JA 5B1AC 4OD4A 3B29A 3Q6NA 4QI2A 1Q0KA 2Q3TA 4JCZA 1BZ4A 2HSQA 4N6HA 4YL1A 5EHHA 3ZWIA 3L34A 4ONSA 1D0XA 3EZIA 3GODA 4OD5A 3LUTB 4G7OF 2LD6A 3SEOA 1NG1A 2YHSA 1HE9A 3C62A 3LS0A 3NYJA 3WODF 1YJGA 1G8XA 2CYDA 3DZAA 1OKKD 1YLMA 2R25A 3T6BA 4AX2A 3C8GA 3J06A 4BG0A 5JVEA 1XWJA 2J8WA 4CDYA 5AC4A 2PF4E 4CSAA 3W4YA 3GANA 1JAFA 1G5ZA 1A0BA 1H9GA 5E3AA 5DS6A 1A41A 2ZXRA 1VTMP 2KNHA 2ZPAA 5DS5A 3VF0A 1FFTC 2G3VA 4K0DA 1VLSA 3DAGA 2M4EA 3K7DA 3ZTZA 4U5HA 4U5FE 3RH3A 4MTOA 2KJGA 4CS8C 4O7GA 5F5HA 1HMOA 4WGZA 4MW3A 4DVYP 2KYHA 2WB7A 1YZAA 3B0PA 3KH2A 4J7TA 4GQHA 2PFDA 4KC9A 1NFNA 4N4WA 2NPUA 3S0XA 3NMIA 4MVRA 4EBJA 2G62A 3PHF2 2R03A 4JVSA 3LESA 3PDMP 3AGTA 4XQ1A 3N0TA 4I3MA 5D91A 2BL2A 4FWVA 2XXAB 3EHMA 4BEMJ 1QKRA 1Z6AA 4IAOA 4MVUA 1O87A 1LI7A 1EI7A 5L0GA 2XS8A 1A7EA 1Z23A 4RD9A 5CIVA 2HMZA 4IJJA 1YA9A 4U9EA 5COGA 4EBKA 4YT8A 3B0VC 3H2UA 1HE1A 2X51A 2EPKX 3R7CA 4C3DA 3MYIA 1K05A 1ORJA 1W2WA 2YRFA 3KMIA 2X0CA 2YZSA 2WVOA 2ASRA 3EFOA 4O6NA 2Z15A 4XEKA 4YT2A 5A6JA 3UGOA 2PNOA 3DAFA 4CSAC 2VC9A 4DRHB 4RDAA 2XM0A 3I5QA 2QNLA 3LS1A 2VASA 2MWQA 1OW8A 3DKAA 5E3CA 2AU5A 3CAXA 5GPGB 3AGUA 1T5OA 2HFIA 3G4ZA 3S9OA 3U8PA 5COFA 3HKKA 4D4XA 4U5DE 3DWWA 1Z63A 1AVOB 2DI3A 2J9UA 1LS1A 2Y3DA 3MFNA 4PJNA 1M56C 3JYYA 3KKBA 3GM2A 4BJTA 4OIQF 1G4WR 1V74B 2J9BA 3QVYA 2H7BA 4IGGA 3RQEA 4R32A 3WHNA 4E17A 1BR4A 2OQMA 2TMVP 2D5RB 2I8BA 1LVKA 3JCUQ 5L3QA 1FMWA 4E18A 4CJOA 1FNTc 3C8GD 4G7ZF 4A4AA 1E2XA 3Q7GA 4MVMA 3W2WA 4PACA 1SZIA 3ZSUA 1OXBA 1MNDA 1OCCC 1PCXA 2XRHA 3EQLF 4FAPB 5JT4A 2R7UA 3LJBA 3X1OA 1MQVA
chains in the Genus database with same CATH topology
4E0HA 3U5SA 2HJ3A 3MBGA 3U2MA 3U2LA 3TD7A 3W4YA 1JRAA 4E0IA 3GWLA 3TK0A 1JR8A 3LLKA 3R7CA 4LDKA 3LLIA 3O55A 3GWNA 1OQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0H A;  3U5S A;  2HJ3 A;  3MBG A;  3U2M A;  3U2L A;  3TD7 A;  3W4Y A;  1JRA A;  4E0I A;  3GWL A;  3TK0 A;  1JR8 A;  3LLK A;  3R7C A;  4LDK A;  3LLI A;  3O55 A;  3GWN A;  1OQC A; 
#chains in the Genus database with same CATH topology
 2JD3 A;  2ZXW C;  2B0J A;  4LAC B;  3HNK A;  5DS4 A;  1S7Z A;  5F5F A;  2P6V A;  2R7Q A;  3DXJ F;  2AWY A;  1Q0F A;  2XL6 A;  2J9V A;  3OWT A;  4Z9J A;  1Q0M A;  2IOQ A;  3WG7 C;  1YVI A;  5HSW A;  2BE5 F;  3C18 A;  3U8V A;  5KYX B;  3CSK A;  1EQ1 A;  2VH3 A;  4BJ5 A;  2QUP A;  1LIH A;  1QQ3 A;  3U9J A;  3GM1 A;  3NRH A;  5L0F A;  1TWH A;  2WZL A;  4AL0 A;  3DJU B;  5AGF A;  3US6 A;  2CGE A;  2XL4 A;  3BRJ A;  3EFO B;  3K1H A;  4IRU A;  2R9R B;  2J46 A;  4H4K C;  4MTG A;  3JRT A;  1MMG A;  1LI5 A;  3FOO A;  4DRI B;  2Q9C A;  3K66 A;  3POV A;  1U0B B;  4C7O B;  1ORS C;  2XL8 A;  4NTA A;  3O55 A;  3TJ6 A;  5E33 A;  2EPL X;  3NMK A;  5DQT A;  3AG3 C;  1JMW A;  3HNL A;  4BJ1 A;  4JEB A;  3MYF A;  1QVX A;  1RXQ A;  2E87 A;  3HJC A;  4GEH A;  4FES A;  3VRC A;  3L8J A;  4JTD B;  4EUK B;  5D92 A;  2HJM A;  3ZG1 A;  3ZVR A;  3DE8 A;  2H7O A;  1ZHT A;  2GFH A;  4ZLC A;  2H8A A;  3JRM O;  4U9D A;  4QI0 A;  1Z7Q c;  3UNG C;  1UG7 A;  4XEF A;  3CEX A;  4XEV A;  2Q4F A;  2J9W A;  1XZP A;  1LPE A;  2XXA A;  2L6F A;  2W4B A;  3IQT A;  2XS1 A;  2JX0 A;  3DM9 B;  1JPN A;  1ZZP A;  1ZHY A;  2R02 A;  3TOL A;  4B6I A;  1YAU O;  2IYL D;  2XLO A;  1IW7 F;  3KYI A;  3TJ5 A;  5IY5 C;  2NUP B;  3X2Q C;  5JUA A;  1MNE A;  3FAP B;  3NG1 A;  2QE9 A;  1BR2 A;  4Q7C A;  4PFP A;  1T6Q A;  1QLE C;  2AP3 A;  3OA1 A;  4BJ6 A;  1M2V B;  3RW0 A;  4JRZ A;  4BJ5 C;  3EH2 A;  3RKO F;  1BR1 A;  5CI8 A;  2J0W A;  3ASN C;  2EPN A;  3MBG A;  3L8I A;  2IBF A;  3SYN A;  4CS9 C;  2DYS C;  3AG2 C;  3IHU A;  3K1I A;  4QDL A;  3JZ0 A;  2YKZ A;  1WOL A;  1NU7 D;  1T6U A;  3SXY A;  1EA8 A;  3ABM C;  4YL3 A;  4OIR F;  1MMN A;  3TK0 A;  1OR2 A;  1CPQ A;  3LLK A;  2YWA A;  4AK9 A;  3DM5 A;  4MVO A;  5K0I A;  3T4R A;  4LDK A;  3LLI A;  1D0Y A;  3F47 A;  1BDJ B;  2V26 A;  2HKV A;  3F46 A;  2GDC A;  4A2N B;  2ZD9 A;  4IAQ A;  5TJ5 E;  2IXM A;  4GYT A;  4JIO A;  4JCH A;  1JOG A;  4CDV A;  3ABK C;  3IEE A;  3M15 A;  4O6Y A;  1D0Z A;  1V55 C;  2WZF A;  1D1A A;  3FAJ A;  1OCR C;  3QW0 A;  3TD7 A;  2KW3 C;  5KYU B;  1LE4 A;  1A7V A;  4JKV A;  5B1B C;  3M79 A;  3W8I A;  4JTA B;  4XWJ A;  2JPU A;  2HV7 A;  2HUJ A;  2DGJ A;  1SYQ A;  3ECS A;  5T3T A;  3MX3 A;  2OEV A;  4JTC B;  1JR8 A;  3VM6 A;  2EPO A;  3OEO A;  2QLA A;  1U89 A;  1WN0 A;  2W4M A;  4PR9 A;  3SXM A;  5KYX A;  3FXH A;  4NY3 A;  1PD0 A;  4IAR A;  1E86 A;  3RQF A;  4BJ6 C;  4XPW A;  2YVK A;  5A6K A;  1E84 A;  2CCY A;  3SZR A;  5FCL A;  5JSL A;  1RCP A;  3SP1 A;  2EIJ C;  1I4Z A;  5DLJ A;  3M4C A;  1TKN A;  2OU6 A;  1ZU4 A;  2OOC A;  3K1I C;  4C7O A;  3EJN A;  4CIP A;  3V5X A;  1VB5 A;  3NYM A;  4D4N A;  3ZIB A;  1C17 M;  1QPU A;  3H2V A;  4NTB A;  1OW6 A;  4KBL A;  3N24 A;  2VB6 A;  1HMD A;  1IZM A;  3O10 A;  4NTF A;  3AG4 C;  1CPR A;  1B68 A;  1LKX A;  3EGD B;  3VYW A;  1WGW A;  1H9T A;  3FVY A;  3DJN B;  4AE4 B;  2R7S A;  4P9T A;  3E9V A;  1TWG A;  2IXN A;  1TR2 A;  3T6J A;  1M2O A;  3K6B A;  3U0C A;  4DOZ A;  4PJL A;  4MTF A;  3AQC A;  2A6E F;  3M1C B;  4MVZ A;  3RVZ A;  3UR3 C;  4BEJ A;  2LK4 A;  1C02 A;  1OXK A;  2HS5 A;  3KL4 A;  1KNY A;  2NG1 A;  4MQ9 F;  2HSB A;  1ZHZ A;  3KYJ A;  4KNW A;  3LEO A;  1ST6 A;  3NKE A;  1YYJ A;  4FX5 A;  1V4A A;  2F22 A;  2NUP A;  3EZH A;  3JTL O;  4HFF B;  4P9F A;  3U2L A;  2A1D D;  4JJF A;  3G50 A;  3K33 A;  4Q4Z F;  1NU9 C;  1Y4C A;  1RKC A;  1M2V A;  2AWC A;  2MYS A;  2YL3 A;  2OJE D;  4W8K A;  4J7Y A;  4WAB A;  3FDQ A;  3AQB A;  3ITF A;  2VCB A;  1YZC A;  4XLP F;  4PFO A;  1QSP A;  2Y69 C;  3ZDL A;  4CS7 A;  5L0I A;  2W45 A;  5BQI A;  1R5I D;  2RSE B;  3GEI A;  3O6X A;  1E85 A;  2KK1 A;  1U6H A;  1G4U S;  1O3U A;  1M57 C;  1WAT A;  1N1C A;  4L6R A;  3T9O A;  4MVQ A;  3TUL A;  1RJ9 B;  4YL0 A;  1NSG B;  2WL8 A;  3SXZ A;  4IB4 A;  3W8H A;  4J32 B;  3C63 A;  2OJQ A;  2A0B A;  4NQF A;  1K04 A;  3ABL C;  1TWC A;  3ASO C;  3B71 A;  3NMJ A;  1PV3 A;  1T01 A;  2IXO A;  3RF3 A;  3ZQY A;  4F4B A;  1NFO A;  3E70 C;  2V3C C;  5L0C A;  4M63 A;  2WVN A;  4OIO F;  2KGO A;  1MMD A;  1NZE A;  2FFH A;  1AEP A;  2YLG A;  2CW0 F;  2H7V C;  3Q7L A;  3S90 A;  2XLE A;  2L9J A;  4MS2 A;  3U3B A;  5EGY A;  2L7A A;  3QW1 A;  1APC A;  5JLI A;  3GWL A;  4EKW A;  3A11 A;  2R7R A;  4P6I C;  5KYU A;  5A6B A;  5KYN A;  2NSG A;  1LS4 A;  2ETS A;  3HTK C;  3DMD A;  2Q7R A;  4HE8 D;  2NUT B;  4EWC A;  4U5G A;  1T9K A;  5L0H A;  2KQ9 A;  1K40 A;  3JT1 A;  2Y39 A;  3MLG A;  4N06 A;  3CQZ A;  4C3B A;  3H65 A;  3EGX B;  2OCC C;  3PCV A;  1SF8 A;  2KC3 A;  2OG2 A;  1OQC A;  3QMK A;  2L6G A;  4BPM A;  1ORY A;  1Y6D A;  4K7B A;  4EBB A;  3G4X A;  2XLW A;  4DJ9 A;  2QY9 A;  3RIP A;  2GAQ A;  3PMR A;  4HFK B;  4I1M A;  4CS8 A;  5HV9 A;  2G3K A;  4LDQ A;  1VMA A;  1XZQ A;  4E0H A;  2OEX A;  2OKU A;  4YT4 A;  2CDQ A;  2Q9B A;  1V54 C;  2EIK C;  3FOP A;  4OIN F;  1FTS A;  2YEV A;  4H54 A;  3AJM A;  1WTY A;  1OCO C;  4N6C A;  3NKD A;  3RYL A;  1HW1 A;  5FZT A;  4X0R A;  4E0I A;  4ER9 A;  1YAR O;  3GM3 A;  1GS9 A;  1SMY F;  1ZW2 A;  3HNI A;  1OCZ C;  2B0H A;  3U3F A;  3UMI A;  3LNM B;  4U5E E;  1C03 A;  4Q5S F;  3EGD A;  4JZA A;  4JW1 A;  4MW8 A;  4O79 A;  2PBE A;  2HV6 A;  1SR2 A;  4LDR A;  4PJJ A;  3TOM A;  2LFF A;  4AE4 A;  1YA7 O;  2BC5 A;  2WVQ A;  5CI9 A;  5BUO A;  2YL1 A;  3CZ6 A;  3EG9 B;  3RQG A;  2CNW A;  2YQY A;  2J7P A;  3FHD A;  3GOR A;  4LLC A;  3LEV A;  1ZVZ A;  3U5S A;  2DYR C;  3HNJ A;  2LQG A;  2XLM A;  4YT5 A;  3KPH A;  3U2M A;  2PP4 A;  3IQ6 A;  5E2Q A;  3EH1 A;  3QVZ A;  4J30 B;  2J45 A;  4ULV A;  4DXW A;  5KYY B;  3ZQV A;  1Q0D A;  2A68 F;  3C7J A;  4Z9I A;  3S29 A;  3Q6M A;  1DOW A;  4LLE A;  4EIY A;  4PK4 A;  2MHR A;  1S05 A;  2LCH A;  4WGY A;  3ZC4 A;  1WAS A;  2R7W A;  3TQO A;  2J0X A;  2AVK A;  1JPJ A;  2R7O A;  4E7S A;  5JRA A;  1I4Y A;  5BQG A;  4DRJ B;  1TFO B;  1Q0G A;  4JJG A;  4CX9 A;  2Y3B A;  1GQA A;  3GWN A;  1Z5Z A;  2FAP B;  1H7I A;  3JSE O;  1RKE B;  3A9C A;  5KYW A;  1CGO A;  3S28 A;  2R7X A;  4G0H A;  4XPY A;  4YK5 A;  1I5N A;  4PJM A;  2Q00 A;  4CJG A;  5L3V A;  1OR3 A;  3S84 A;  3RVY A;  3SNH A;  2Y3H A;  2ZXP A;  3BEH A;  5COM A;  4CDA A;  3S27 A;  1RJ9 A;  1YDI A;  1Z3I X;  2C03 A;  2VCC A;  3UMH A;  5A6B D;  2W9Y A;  3JSZ A;  4YJW A;  3AG1 C;  1PD1 A;  3B9Q A;  3FMS A;  2A6H F;  3L0I A;  1D1B A;  2O9X A;  1VYK A;  2ICW G;  3M4B A;  4W8P A;  2XLH A;  5DQZ A;  4G7H F;  4KNV A;  3B0U X;  4IWB A;  1CGM E;  1GGQ A;  2I15 A;  3N2Z B;  2NSF A;  1QZX A;  4JE9 A;  3QTH A;  1F1M A;  1E83 A;  2R7V A;  3DI5 A;  3NDB B;  1ZW3 A;  1ZYR F;  3VAY A;  1T6I A;  3C8G B;  1NLX A;  3O39 A;  4XPX A;  2EIM C;  1LE2 A;  2HMQ A;  1L7C A;  3HLZ A;  4AL1 A;  1CGN A;  2LFD A;  4NCQ A;  1EKY A;  3V5Y A;  2LSE A;  4DBQ A;  2NUT A;  4WJ0 A;  2A69 F;  1HW2 A;  2A0U A;  4E7Z A;  3LNR A;  3UMK A;  2L81 A;  3EGX A;  4ULW A;  3NYL A;  2L6H A;  4DVZ A;  1GM5 A;  2YLI A;  2YL7 A;  2UUI A;  5T3W A;  1FR0 A;  5L0D A;  4MND A;  1OKK A;  2D4U A;  2GA0 A;  2XM4 A;  1JRA A;  3AOU A;  3V5Z A;  1TFK B;  1BBH A;  3W2V A;  3C8Z A;  1UFB A;  2FGY A;  5KYW B;  1VOM A;  2LIG A;  1LM3 B;  3GEH A;  1FFH A;  2HZ8 A;  2IXP A;  2QTV A;  3EPV A;  5F28 E;  4I44 A;  3RFY A;  2CNW D;  2WZG A;  2J7P D;  3U9M A;  4MVS A;  4U5B E;  4YN0 B;  5AC5 A;  1OW7 A;  3I4U A;  4K1O A;  4Z9H A;  1FAP B;  1ZHW A;  2DB4 A;  1O5H A;  2VCA A;  4NC3 A;  5BQH A;  1FMV A;  1VYI A;  2EIL C;  2IM8 A;  1HY5 A;  2P0N A;  3WAQ A;  2PX3 A;  5EK0 A;  256B A;  1A7D A;  4LER A;  4ZLD A;  1J8M F;  4JEA A;  3I5P A;  4YWQ A;  1TWA A;  1H6G A;  2RD9 A;  2YLD A;  3ATP A;  1ZU5 A;  3V7O A;  1VLT A;  2P61 A;  5JP7 A;  2EPM X;  2KSF A;  3L1M A;  3EG9 A;  2XSE A;  2XLV A;  1VK5 A;  1DOV A;  4O6M A;  4U5C E;  4ANJ A;  4CS9 A;  3UGP A;  2EIN C;  3DE9 A;  3IQ5 A;  2YL0 A;  2P7V A;  2M64 A;  3LAY A;  1L3P A;  3ZTM A;  4CIH A;  5KYY A;  2R7T A;  1MMA A;  5DVW A;  3T6G B;  3IPM O;  3EHN A;  2Y3G A;  2R05 A;  5A6A A;  1RMV A;  1YYX A;  2GWW A;  2PX0 A;  4I1O B;  3R2P A;  5T1D B;  1D1C A;  2XLD A;  3GEE A;  1R4T A;  1TQG A;  1ZHX A;  2C04 A;  2Q9A A;  2UUH A;  3JYH A;  4C3E A;  4JUR I;  4CBE A;  4EHP A;  5B3S C;  4DBR A;  3IQC A;  3SXK A;  4G78 A;  1J8Y F;  5JS5 A;  2ZXO A;  1RKE A;  4UDV A;  4KI2 A;  2HJ3 A;  1KU2 A;  4HEA J;  1AUE A;  5A69 A;  2P1A A;  3QZC A;  4OIP F;  2LP4 A;  1M6T A;  4XLN F;  1NBB A;  1KTM A;  1WWP A;  3DD7 A;  4RBN A;  5B3I A;  4JC7 A;  4XTK A;  5L0J A;  5B1A C;  4OD4 A;  3B29 A;  3Q6N A;  4QI2 A;  1Q0K A;  2Q3T A;  4JCZ A;  1BZ4 A;  2HSQ A;  4N6H A;  4YL1 A;  5EHH A;  3ZWI A;  3L34 A;  4ONS A;  1D0X A;  3EZI A;  3GOD A;  4OD5 A;  3LUT B;  4G7O F;  2LD6 A;  3SEO A;  1NG1 A;  2YHS A;  1HE9 A;  3C62 A;  3LS0 A;  3NYJ A;  3WOD F;  1YJG A;  1G8X A;  2CYD A;  3DZA A;  1OKK D;  1YLM A;  2R25 A;  3T6B A;  4AX2 A;  3C8G A;  3J06 A;  4BG0 A;  5JVE A;  1XWJ A;  2J8W A;  4CDY A;  5AC4 A;  2PF4 E;  4CSA A;  3W4Y A;  3GAN A;  1JAF A;  1G5Z A;  1A0B A;  1H9G A;  5E3A A;  5DS6 A;  1A41 A;  2ZXR A;  1VTM P;  2KNH A;  2ZPA A;  5DS5 A;  3VF0 A;  1FFT C;  2G3V A;  4K0D A;  1VLS A;  3DAG A;  2M4E A;  3K7D A;  3ZTZ A;  4U5H A;  4U5F E;  3RH3 A;  4MTO A;  2KJG A;  4CS8 C;  4O7G A;  5F5H A;  1HMO A;  4WGZ A;  4MW3 A;  4DVY P;  2KYH A;  2WB7 A;  1YZA A;  3B0P A;  3KH2 A;  4J7T A;  4GQH A;  2PFD A;  4KC9 A;  1NFN A;  4N4W A;  2NPU A;  3S0X A;  3NMI A;  4MVR A;  4EBJ A;  2G62 A;  3PHF 2;  2R03 A;  4JVS A;  3LES A;  3PDM P;  3AGT A;  4XQ1 A;  3N0T A;  4I3M A;  5D91 A;  2BL2 A;  4FWV A;  2XXA B;  3EHM A;  4BEM J;  1QKR A;  1Z6A A;  4IAO A;  4MVU A;  1O87 A;  1LI7 A;  1EI7 A;  5L0G A;  2XS8 A;  1A7E A;  1Z23 A;  4RD9 A;  5CIV A;  2HMZ A;  4IJJ A;  1YA9 A;  4U9E A;  5COG A;  4EBK A;  4YT8 A;  3B0V C;  3H2U A;  1HE1 A;  2X51 A;  2EPK X;  3R7C A;  4C3D A;  3MYI A;  1K05 A;  1ORJ A;  1W2W A;  2YRF A;  3KMI A;  2X0C A;  2YZS A;  2WVO A;  2ASR A;  3EFO A;  4O6N A;  2Z15 A;  4XEK A;  4YT2 A;  5A6J A;  3UGO A;  2PNO A;  3DAF A;  4CSA C;  2VC9 A;  4DRH B;  4RDA A;  2XM0 A;  3I5Q A;  2QNL A;  3LS1 A;  2VAS A;  2MWQ A;  1OW8 A;  3DKA A;  5E3C A;  2AU5 A;  3CAX A;  5GPG B;  3AGU A;  1T5O A;  2HFI A;  3G4Z A;  3S9O A;  3U8P A;  5COF A;  3HKK A;  4D4X A;  4U5D E;  3DWW A;  1Z63 A;  1AVO B;  2DI3 A;  2J9U A;  1LS1 A;  2Y3D A;  3MFN A;  4PJN A;  1M56 C;  3JYY A;  3KKB A;  3GM2 A;  4BJT A;  4OIQ F;  1G4W R;  1V74 B;  2J9B A;  3QVY A;  2H7B A;  4IGG A;  3RQE A;  4R32 A;  3WHN A;  4E17 A;  1BR4 A;  2OQM A;  2TMV P;  2D5R B;  2I8B A;  1LVK A;  3JCU Q;  5L3Q A;  1FMW A;  4E18 A;  4CJO A;  1FNT c;  3C8G D;  4G7Z F;  4A4A A;  1E2X A;  3Q7G A;  4MVM A;  3W2W A;  4PAC A;  1SZI A;  3ZSU A;  1OXB A;  1MND A;  1OCC C;  1PCX A;  2XRH A;  3EQL F;  4FAP B;  5JT4 A;  2R7U A;  3LJB A;  3X1O A;  1MQV A; 
#chains in the Genus database with same CATH homology
 4E0H A;  3U5S A;  2HJ3 A;  3MBG A;  3U2M A;  3U2L A;  3TD7 A;  3W4Y A;  1JRA A;  4E0I A;  3GWL A;  3TK0 A;  1JR8 A;  3LLK A;  3R7C A;  4LDK A;  3LLI A;  3O55 A;  3GWN A;  1OQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...