1JR8A

Crystal structure of erv2p
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Erv2 PROTEIN, mitochondrial
publication title A new FAD-binding fold and intersubunit disulfide shuttle in the thiol oxidase Erv2p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 41
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1jr8A00
4E0IA 4LDKA 3GWNA 1JR8A 3LLKA 1OQCA 3R7CA 2HJ3A 3MBGA 3TD7A 3U2LA 3W4YA 3TK0A 4E0HA 3LLIA 1JRAA 3U2MA 3U5SA 3O55A 3GWLA
chains in the Genus database with same CATH superfamily
3C63A 5KYYA 2W4MA 2XLDA 1LIHA 1VLSA 5B1BC 4DRHB 3CEXA 4AX2A 3QMKA 4QI0A 1GQAA 2HJ3A 2PNOA 5FZTA 4CJOA 3C8GA 1JMWA 2O9XA 1JPJA 4JJFA 4OD5A 4CS8C 3KMIA 3R2PA 1H9GA 1TQGA 2G3KA 2HMQA 2EPMX 2L9JA 3JYYA 3T9OA 3H65A 2H7OA 4IARA 2RD9A 2WZFA 2P1AA 3EGDB 3GORA 2EIMC 5L0HA 4U5HA 4HFKB 4E17A 1OR2A 4QI2A 5A6BD 1APCA 3RFYA 1YLMA 2ZXRA 1HMDA 4YT8A 2J9WA 4EBJA 1XWJA 3NYJA 2R7RA 4D4XA 2XM0A 2OEXA 3L34A 4BEJA 4EUKB 1L7CA 2IYLD 3I4UA 3LJBA 4MQ9F 1WOLA 2NSFA 4MVZA 1O5HA 2DI3A 1L3PA 2BE5F 1A7VA 1YYXA 2LP4A 2YVKA 1E2XA 2YEVA 3JCUQ 3SNHA 5EGYA 1FR0A 3RW0A 2HV7A 1J8YF 3GM1A 1U89A 1VOMA 4J7TA 2J9UA 4PACA 3TULA 4JEBA 2PBEA 1ST6A 3SXZA 2QY9A 4HFFB 3S27A 4YL0A 2EILC 2XL6A 4XQ1A 2Y3DA 3JSZA 1Z7Qc 4CS9A 2R7WA 2YRFA 4E7ZA 2TMVP 3F46A 3G4ZA 2VCCA 4C7OB 4NTAA 3MYFA 1BR4A 4MVUA 4CIPA 4JRZA 4YT4A 2J0XA 4LACB 4PFPA 4H4KC 3K6BA 4YK5A 4G7OF 1RKEB 1J8MF 1VMAA 4G0HA 4RD9A 3GEIA 5D92A 5KYUA 1S05A 2EIKC 5L0IA 2XLWA 3L8IA 4JEAA 3POVA 1RKCA 4G78A 2QLAA 2WZGA 2CNWD 1FMVA 1BDJB 3EGDA 3V5XA 3OEOA 5KYWA 2Q7RA 2IXMA 4Q7CA 3US6A 1D0YA 1H6GA 4BJ5C 3T4RA 2PF4E 1ORJA 2QTVA 1HE1A 3E9VA 4C3BA 2EPLX 3PCVA 3JT1A 5A6BA 4KNVA 1I4YA 1WGWA 1IW7F 1O3UA 5D91A 4AL0A 2C03A 3W8HA 4DOZA 3J06A 1MMGA 1CGNA 2HV6A 1BBHA 3FMSA 3O55A 4Z9JA 4CIHA 3EZHA 5CI9A 4YL3A 2OEVA 1R4TA 1TFOB 3NG1A 2OQMA 3W8IA 2AVKA 5BQIA 4C7OA 4G7HF 1OQCA 1ZHTA 1NZEA 3I5PA 4IWBA 4KC9A 5F5FA 3A9CA 2DYSC 3DKAA 1OCOC 3FHDA 3SXYA 3ASOC 4U5EE 1ZVZA 2J8WA 2EPKX 4KBLA 1RKEA 2LQGA 3ZQYA 1RCPA 1QPUA 3JRMO 4CS9C 1IZMA 1TKNA 3O39A 2J0WA 4Z9HA 4JURI 3KL4A 4XTKA 3V5YA 2NPUA 3IQ5A 3Q6NA 1E84A 5K0IA 1NFOA 3LLIA 3C18A 3C7JA 3ZDLA 2LCHA 1YDIA 2YL0A 4H54A 1YYJA 4U5GA 1T6UA 3HTKC 4K1OA 2YL1A 4LLEA 4JZAA 3EHMA 4W8PA 4P9FA 3C8GB 1LI7A 4OIPF 5TJ5E 4JC7A 4G7ZF 3NDBB 1NLXA 4NY3A 2OOCA 1I5NA 4JCHA 4LDKA 2P7VA 3FDQA 2YLDA 4N6HA 5B1AC 1UFBA 1TWHA 3MLGA 2Y3HA 5JP7A 4U9DA 3R7CA 5E33A 3NMKA 5L0FA 3QTHA 2W4BA 1SZIA 3VAYA 4DJ9A 2R7OA 3ZSUA 4EWCA 3B71A 3ZVRA 1V54C 5CIVA 1YAUO 2A0UA 3TOMA 1M56C 4XWJA 2L6GA 4EBKA 2VASA 3S0XA 4RBNA 1ZU5A 2IXPA 3PMRA 4PJLA 4J30B 4NTFA 3SZRA 1JAFA 1EA8A 1SYQA 3T6BA 2Q3TA 2CDQA 2XM4A 3K66A 3U8VA 1WWPA 2HFIA 4LDRA 3IQCA 4DBQA 4FX5A 4J7YA 1D1CA 4AK9A 1FFHA 2IM8A 2HJMA 1YVIA 3JTLO 4ER9A 2H7BA 3LEVA 1Z6AA 2F22A 1BZ4A 1SMYF 2CGEA 2EINC 4XEKA 4Q4ZF 5JUAA 1EKYA 3JRTA 1SR2A 4IB4A 4WGYA 5KYUB 1JPNA 1LS1A 1ZU4A 2KW3C 3CZ6A 3RVZA 1OKKD 2FGYA 4IGGA 2H8AA 4EHPA 1WTYA 2OJQA 4FESA 1G5ZA 2IXNA 4E0HA 2NUTB 1VLTA 2A1DD 3EHNA 2EIJC 2YKZA 4HE8D 3DD7A 1FNTc 2OKUA 4MTFA 5KYWB 3BEHA 2V26A 2A69F 2G62A 1Z5ZA 4XLPF 1ORSC 2UUIA 3O10A 4D4NA 2B0HA 4O6YA 4IAQA 2LK4A 3EH1A 3OA1A 5JVEA 2KC3A 2GFHA 2CCYA 4ZLCA 4CSAC 1T6IA 1ZHZA 1JR8A 2QNLA 1R5ID 2R25A 2VH3A 3U3BA 5BQGA 2KSFA 1O87A 2WB7A 2P61A 3CQZA 3Q7LA 2Q9AA 2ICWG 3DAFA 4XPYA 1OCZC 3UNGC 1YA9A 4LERA 1RJ9B 5EHHA 4PJJA 4LLCA 3EJNA 3ITFA 2J7PD 2HUJA 2KGOA 2R05A 4EKWA 2ZXOA 1Q0GA 5BUOA 2R7UA 2Q00A 2KJGA 4XLNF 3UGPA 1H9TA 1ORYA 1Z63A 4JCZA 3K1HA 2YQYA 1LM3B 4U5BE 1K04A 3SYNA 3HNLA 3IQ6A 4BJTA 2D4UA 3DM5A 5DQTA 3GWLA 3RVYA 1PD0A 3EFOA 4AE4A 4XEFA 4F4BA 3U0CA 4BEMJ 3AOUA 4NCQA 3ZQVA 1VK5A 2FAPB 2Y3BA 3C8ZA 1CGME 2AP3A 4K0DA 4GQHA 2CYDA 3LLKA 2QUPA 1YZCA 2NUTA 4BJ6A 1UG7A 4O6MA 1KU2A 3M4BA 1V55C 1W2WA 1QLEC 3AG1C 3K1IA 1LI5A 2ETSA 2XLOA 1B68A 2J9VA 4CS7A 5IY5C 3VRCA 3M4CA 3TD7A 1TWGA 4MNDA 4L6RA 4Z9IA 4BJ1A 3AQBA 4JE9A 3U2LA 2Y39A 2A68F 1MQVA 4YWQA 1LPEA 1NG1A 4JTAB 1OXKA 4P6IC 3WG7C 3A11A 3MYIA 1JOGA 4I3MA 3ZTZA 3EG9A 2MWQA 2ZD9A 2J46A 4EIYA 1YARO 1Q0DA 2X51A 1RJ9A 1WATA 3EGXB 3RYLA 1MNDA 2A6EF 2LD6A 4DVYP 4MVOA 3FAJA 3DWWA 1CGOA 3DZAA 3G50A 2GAQA 3PDMP 5JS5A 3NKEA 5DVWA 3KH2A 3M15A 5BQHA 1RXQA 3M79A 1DOVA 1WN0A 2I15A 2LIGA 2WZLA 2C04A 4MVQA 4U5FE 3GEEA 5F5HA 2L81A 2H7VC 4BG0A 5E3AA 2W45A 1LVKA 3RF3A 1M2OA 1K40A 4CDYA 1HMOA 2PFDA 2Q4FA 2FFHA 2ZXWC 2YL7A 1ZHWA 2HKVA 2DYRC 1AVOB 4DRIB 4DVZA 3U2MA 3AGUA 1A41A 3LESA 4YL1A 1GM5A 1ZHXA 3G4XA 4DXWA 1D0ZA 3Q7GA 2CNWA 2CW0F 3QVYA 3UMKA 1LS4A 3AG2C 3LNMB 4BJ6C 1OW7A 1OCRC 1T6QA 1U6HA 3IPMO 2UUHA 3WODF 4MVRA 1E86A 3CAXA 1G8XA 2XS8A 3B0PA 4DRJB 4PK4A 1VYKA 4EBBA 4Q5SF 1CPRA 3MBGA 5AC5A 1OW8A 4JTDB 1FMWA 1A7DA 4C3DA 3X2QC 1T01A 3PHF2 4OD4A 1DOWA 4O7GA 3FVYA 2GWWA 2LFFA 3C8GD 3HLZA 4CS8A 3EGXA 3N24A 4N4WA 3W4YA 3DAGA 4WGZA 3SEOA 2XLMA 4WJ0A 1K05A 2L7AA 4YN0B 3U9MA 4I1MA 4YT2A 2R03A 3NYMA 4FWVA 3GM3A 3QW1A 3U5SA 3W2VA 1OR3A 3TJ5A 1NFNA 2NG1A 2XLHA 4R32A 3VF0A 5JT4A 2I8BA 3ASNC 2X0CA 3U9JA 5L0GA 1HW1A 1QSPA 2YL3A 4W8KA 3ABLC 3M1CB 3DJUB 3EQLF 1NU7D 4U5DE 4XPWA 3B9QA 4LDQA 4MW3A 2R7XA 5KYNA 3L1MA 2W9YA 4N06A 1Z3IX 2XLVA 3NMIA 3ZC4A 3N0TA 4KNWA 1TWAA 1CPQA 1YJGA 2HMZA 4U9EA 3ZTMA 2ASRA 2PX0A 3EFOB 4AE4B 5A6KA 1M2VB 1E85A 5CI8A 1E83A 1VB5A 4HEAJ 4ULVA 1S7ZA 3RH3A 4GEHA 4OIOF 4BPMA 2MYSA 4C3EA 1Q0MA 1MMDA 4M63A 5T3TA 2J9BA 2JD3A 1ZYRF 2R9RB 2WVOA 3AJMA 4IRUA 2YLGA 2LSEA 4JKVA 3X1OA 5DQZA 2Q9BA 4CX9A 5COFA 5A6AA 5L0JA 2M64A 3B29A 4MVSA 3V7OA 2V3CC 1A7EA 4ZLDA 2R7VA 5KYXA 1T5OA 1HW2A 2P6VA 4QDLA 5COGA 2JPUA 2Z15A 3JSEO 1KTMA 2NSGA 1SF8A 3O6XA 3QW0A 5E3CA 3WAQA 3EG9B 4PJMA 2NUPB 1LE4A 3NKDA 1BR1A 1QVXA 1C03A 4BJ5A 3QVZA 3UR3C 2XXAB 2R02A 1N1CA 3KKBA 3ZG1A 4CJGA 5L3VA 1PD1A 3LS1A 1OW6A 1Y6DA 3IHUA 1Y4CA 4NC3A 2AWYA 2A0BA 2MHRA 1XZQA 1GGQA 4CDVA 5L0CA 1TWCA 2HSBA 3CSKA 4ANJA 1F1MA 2DGJA 5GPGB 5T3WA 3SXMA 3LS0A 3T6JA 3HJCA 2L6FA 3FOPA 5DS6A 1M2VA 4ONSA 1XZPA 4P9TA 5L0DA 5AC4A 1NU9C 2KYHA 2ZXPA 5JRAA 1D0XA 3VYWA 3HKKA 3ATPA 3IEEA 1KNYA 2KQ9A 4MVMA 4O6NA 2DB4A 4NTBA 1D1AA 1PV3A 5B3SC 1VYIA 3TJ6A 1OKKA 4J32B 1C17M 3F47A 1ZHYA 3H2UA 2Y69C 3NRHA 3LNRA 4GYTA 2B0JA 2QE9A 1MMNA 1PCXA 3HNIA 3TK0A 4CBEA 5JLIA 2VB6A 3GEHA 4PR9A 3HNKA 2E87A 4A2NB 4OINF 2XRHA 3DE9A 4JVSA 1JRAA 3T6GB 3L0IA 2OCCC 2IOQA 3FOOA 3L8JA 4N6CA 5F28E 3S28A 3AG3C 5L3QA 1U0BB 2EPNA 3SXKA 1HY5A 3N2ZB 2NUPA 2RSEB 3GODA 3UMIA 1HE9A 3AG4C 3B0VC 1T9KA 3ABMC 3GM2A 3U8PA 2XXAA 2XS1A 3NYLA 1Q0FA 3UGOA 1GS9A 3LAYA 3KYIA 2P0NA 2OJED 3EH2A 1RMVA 2L6HA 1G4WR 4I1OB 3EPVA 3FAPB 4XEVA 3LUTB 1YZAA 4UDVA 4ULWA 2IBFA 2OG2A 2VCBA 1NSGB 3HNJA 4I44A 1Z23A 2J7PA 2OU6A 3RQGA 5DS5A 1QZXA 4OIRF 2IXOA 5B3IA 3DI5A 3WHNA 2HS5A 3JYHA 2GA0A 4U5CE 2R7SA 3LEOA 3EZIA 3VM6A 5FCLA 3MX3A 5A6JA 2KNHA 4KI2A 1AEPA 1V74B 4IAOA 4YJWA 4DBRA 3W2WA 2R7QA 1BR2A 4MTOA 2WVNA 1I4ZA 2XL4A 4JJGA 4RDAA 3B0UX 1QKRA 1EQ1A 2J45A 2XL8A 2YWAA 3JZ0A 1V4AA 3MFNA 4JW1A 2D5RB 3DM9B 4FAPB 3GWNA 1OCCC 1Q0KA 5A69A 5DLJA 3I5QA 3K1IC 2BC5A 2HSQA 3S84A 1FFTC 3U3FA 2EPOA 3S90A 4E18A 2VCAA 2WL8A 2WVQA 5COMA 2GDCA 2KK1A 5T1DB 5DS4A 1AUEA 1TR2A 1ZZPA 1LKXA 3ABKC 3IQTA 3OWTA 5EK0A 3FXHA 3AQCA 5KYYB 3RQEA 3ECSA 5KYXB 3E70C 1MNEA 3UMHA 4X0RA 1ZW2A 4JIOA 3QZCA 1MMAA 2G3VA 4XPXA 2XSEA 2R7TA 2A6HF 3GANA 4O79A 3SP1A 4OIQF 3DMDA 2BL2A 3AGTA 4JTCB 3DJNB 1QQ3A 3C62A 4MW8A 1H7IA 4E7SA 1YA7O 4WABA 1G4US 5AGFA 5HSWA 4E0IA 1NBBA 4PJNA 4CSAA 2YLIA 4PFOA 2AWCA 2XLEA 1M6TA 4AL1A 2JX0A 4CDAA 1OXBA 2VC9A 3DXJF 3H2VA 5JSLA 4YT5A 2M4EA 3KPHA 5HV9A 3S29A 3S9OA 1VTMP 1FTSA 1ZW3A 3TOLA 4B6IA 2PX3A 3ZIBA 3NMJA 3V5ZA 3K7DA 3KYJA 4IJJA 3RKOF 1M57C 2PP4A 3RIPA 4MS2A 4K7BA 4NQFA 4A4AA 3ZWIA 1TFKB 3TQOA 1LE2A 1FAPB 256BA 3RQFA 1D1BA 2LFDA 5E2QA 2Y3GA 2YZSA 1A0BA 2HZ8A 1C02A 2ZPAA 3BRJA 3DE8A 1WASA 2AU5A 4MTGA 3Q6MA 3K33A 2YHSA 2Q9CA 1EI7A
chains in the Genus database with same CATH topology
4E0IA 4LDKA 3GWNA 1JR8A 3LLKA 1OQCA 3R7CA 2HJ3A 3MBGA 3TD7A 3U2LA 3W4YA 3TK0A 4E0HA 3LLIA 1JRAA 3U2MA 3U5SA 3O55A 3GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0I A;  4LDK A;  3GWN A;  1JR8 A;  3LLK A;  1OQC A;  3R7C A;  2HJ3 A;  3MBG A;  3TD7 A;  3U2L A;  3W4Y A;  3TK0 A;  4E0H A;  3LLI A;  1JRA A;  3U2M A;  3U5S A;  3O55 A;  3GWL A; 
#chains in the Genus database with same CATH topology
 3C63 A;  5KYY A;  2W4M A;  2XLD A;  1LIH A;  1VLS A;  5B1B C;  4DRH B;  3CEX A;  4AX2 A;  3QMK A;  4QI0 A;  1GQA A;  2HJ3 A;  2PNO A;  5FZT A;  4CJO A;  3C8G A;  1JMW A;  2O9X A;  1JPJ A;  4JJF A;  4OD5 A;  4CS8 C;  3KMI A;  3R2P A;  1H9G A;  1TQG A;  2G3K A;  2HMQ A;  2EPM X;  2L9J A;  3JYY A;  3T9O A;  3H65 A;  2H7O A;  4IAR A;  2RD9 A;  2WZF A;  2P1A A;  3EGD B;  3GOR A;  2EIM C;  5L0H A;  4U5H A;  4HFK B;  4E17 A;  1OR2 A;  4QI2 A;  5A6B D;  1APC A;  3RFY A;  1YLM A;  2ZXR A;  1HMD A;  4YT8 A;  2J9W A;  4EBJ A;  1XWJ A;  3NYJ A;  2R7R A;  4D4X A;  2XM0 A;  2OEX A;  3L34 A;  4BEJ A;  4EUK B;  1L7C A;  2IYL D;  3I4U A;  3LJB A;  4MQ9 F;  1WOL A;  2NSF A;  4MVZ A;  1O5H A;  2DI3 A;  1L3P A;  2BE5 F;  1A7V A;  1YYX A;  2LP4 A;  2YVK A;  1E2X A;  2YEV A;  3JCU Q;  3SNH A;  5EGY A;  1FR0 A;  3RW0 A;  2HV7 A;  1J8Y F;  3GM1 A;  1U89 A;  1VOM A;  4J7T A;  2J9U A;  4PAC A;  3TUL A;  4JEB A;  2PBE A;  1ST6 A;  3SXZ A;  2QY9 A;  4HFF B;  3S27 A;  4YL0 A;  2EIL C;  2XL6 A;  4XQ1 A;  2Y3D A;  3JSZ A;  1Z7Q c;  4CS9 A;  2R7W A;  2YRF A;  4E7Z A;  2TMV P;  3F46 A;  3G4Z A;  2VCC A;  4C7O B;  4NTA A;  3MYF A;  1BR4 A;  4MVU A;  4CIP A;  4JRZ A;  4YT4 A;  2J0X A;  4LAC B;  4PFP A;  4H4K C;  3K6B A;  4YK5 A;  4G7O F;  1RKE B;  1J8M F;  1VMA A;  4G0H A;  4RD9 A;  3GEI A;  5D92 A;  5KYU A;  1S05 A;  2EIK C;  5L0I A;  2XLW A;  3L8I A;  4JEA A;  3POV A;  1RKC A;  4G78 A;  2QLA A;  2WZG A;  2CNW D;  1FMV A;  1BDJ B;  3EGD A;  3V5X A;  3OEO A;  5KYW A;  2Q7R A;  2IXM A;  4Q7C A;  3US6 A;  1D0Y A;  1H6G A;  4BJ5 C;  3T4R A;  2PF4 E;  1ORJ A;  2QTV A;  1HE1 A;  3E9V A;  4C3B A;  2EPL X;  3PCV A;  3JT1 A;  5A6B A;  4KNV A;  1I4Y A;  1WGW A;  1IW7 F;  1O3U A;  5D91 A;  4AL0 A;  2C03 A;  3W8H A;  4DOZ A;  3J06 A;  1MMG A;  1CGN A;  2HV6 A;  1BBH A;  3FMS A;  3O55 A;  4Z9J A;  4CIH A;  3EZH A;  5CI9 A;  4YL3 A;  2OEV A;  1R4T A;  1TFO B;  3NG1 A;  2OQM A;  3W8I A;  2AVK A;  5BQI A;  4C7O A;  4G7H F;  1OQC A;  1ZHT A;  1NZE A;  3I5P A;  4IWB A;  4KC9 A;  5F5F A;  3A9C A;  2DYS C;  3DKA A;  1OCO C;  3FHD A;  3SXY A;  3ASO C;  4U5E E;  1ZVZ A;  2J8W A;  2EPK X;  4KBL A;  1RKE A;  2LQG A;  3ZQY A;  1RCP A;  1QPU A;  3JRM O;  4CS9 C;  1IZM A;  1TKN A;  3O39 A;  2J0W A;  4Z9H A;  4JUR I;  3KL4 A;  4XTK A;  3V5Y A;  2NPU A;  3IQ5 A;  3Q6N A;  1E84 A;  5K0I A;  1NFO A;  3LLI A;  3C18 A;  3C7J A;  3ZDL A;  2LCH A;  1YDI A;  2YL0 A;  4H54 A;  1YYJ A;  4U5G A;  1T6U A;  3HTK C;  4K1O A;  2YL1 A;  4LLE A;  4JZA A;  3EHM A;  4W8P A;  4P9F A;  3C8G B;  1LI7 A;  4OIP F;  5TJ5 E;  4JC7 A;  4G7Z F;  3NDB B;  1NLX A;  4NY3 A;  2OOC A;  1I5N A;  4JCH A;  4LDK A;  2P7V A;  3FDQ A;  2YLD A;  4N6H A;  5B1A C;  1UFB A;  1TWH A;  3MLG A;  2Y3H A;  5JP7 A;  4U9D A;  3R7C A;  5E33 A;  3NMK A;  5L0F A;  3QTH A;  2W4B A;  1SZI A;  3VAY A;  4DJ9 A;  2R7O A;  3ZSU A;  4EWC A;  3B71 A;  3ZVR A;  1V54 C;  5CIV A;  1YAU O;  2A0U A;  3TOM A;  1M56 C;  4XWJ A;  2L6G A;  4EBK A;  2VAS A;  3S0X A;  4RBN A;  1ZU5 A;  2IXP A;  3PMR A;  4PJL A;  4J30 B;  4NTF A;  3SZR A;  1JAF A;  1EA8 A;  1SYQ A;  3T6B A;  2Q3T A;  2CDQ A;  2XM4 A;  3K66 A;  3U8V A;  1WWP A;  2HFI A;  4LDR A;  3IQC A;  4DBQ A;  4FX5 A;  4J7Y A;  1D1C A;  4AK9 A;  1FFH A;  2IM8 A;  2HJM A;  1YVI A;  3JTL O;  4ER9 A;  2H7B A;  3LEV A;  1Z6A A;  2F22 A;  1BZ4 A;  1SMY F;  2CGE A;  2EIN C;  4XEK A;  4Q4Z F;  5JUA A;  1EKY A;  3JRT A;  1SR2 A;  4IB4 A;  4WGY A;  5KYU B;  1JPN A;  1LS1 A;  1ZU4 A;  2KW3 C;  3CZ6 A;  3RVZ A;  1OKK D;  2FGY A;  4IGG A;  2H8A A;  4EHP A;  1WTY A;  2OJQ A;  4FES A;  1G5Z A;  2IXN A;  4E0H A;  2NUT B;  1VLT A;  2A1D D;  3EHN A;  2EIJ C;  2YKZ A;  4HE8 D;  3DD7 A;  1FNT c;  2OKU A;  4MTF A;  5KYW B;  3BEH A;  2V26 A;  2A69 F;  2G62 A;  1Z5Z A;  4XLP F;  1ORS C;  2UUI A;  3O10 A;  4D4N A;  2B0H A;  4O6Y A;  4IAQ A;  2LK4 A;  3EH1 A;  3OA1 A;  5JVE A;  2KC3 A;  2GFH A;  2CCY A;  4ZLC A;  4CSA C;  1T6I A;  1ZHZ A;  1JR8 A;  2QNL A;  1R5I D;  2R25 A;  2VH3 A;  3U3B A;  5BQG A;  2KSF A;  1O87 A;  2WB7 A;  2P61 A;  3CQZ A;  3Q7L A;  2Q9A A;  2ICW G;  3DAF A;  4XPY A;  1OCZ C;  3UNG C;  1YA9 A;  4LER A;  1RJ9 B;  5EHH A;  4PJJ A;  4LLC A;  3EJN A;  3ITF A;  2J7P D;  2HUJ A;  2KGO A;  2R05 A;  4EKW A;  2ZXO A;  1Q0G A;  5BUO A;  2R7U A;  2Q00 A;  2KJG A;  4XLN F;  3UGP A;  1H9T A;  1ORY A;  1Z63 A;  4JCZ A;  3K1H A;  2YQY A;  1LM3 B;  4U5B E;  1K04 A;  3SYN A;  3HNL A;  3IQ6 A;  4BJT A;  2D4U A;  3DM5 A;  5DQT A;  3GWL A;  3RVY A;  1PD0 A;  3EFO A;  4AE4 A;  4XEF A;  4F4B A;  3U0C A;  4BEM J;  3AOU A;  4NCQ A;  3ZQV A;  1VK5 A;  2FAP B;  2Y3B A;  3C8Z A;  1CGM E;  2AP3 A;  4K0D A;  4GQH A;  2CYD A;  3LLK A;  2QUP A;  1YZC A;  2NUT A;  4BJ6 A;  1UG7 A;  4O6M A;  1KU2 A;  3M4B A;  1V55 C;  1W2W A;  1QLE C;  3AG1 C;  3K1I A;  1LI5 A;  2ETS A;  2XLO A;  1B68 A;  2J9V A;  4CS7 A;  5IY5 C;  3VRC A;  3M4C A;  3TD7 A;  1TWG A;  4MND A;  4L6R A;  4Z9I A;  4BJ1 A;  3AQB A;  4JE9 A;  3U2L A;  2Y39 A;  2A68 F;  1MQV A;  4YWQ A;  1LPE A;  1NG1 A;  4JTA B;  1OXK A;  4P6I C;  3WG7 C;  3A11 A;  3MYI A;  1JOG A;  4I3M A;  3ZTZ A;  3EG9 A;  2MWQ A;  2ZD9 A;  2J46 A;  4EIY A;  1YAR O;  1Q0D A;  2X51 A;  1RJ9 A;  1WAT A;  3EGX B;  3RYL A;  1MND A;  2A6E F;  2LD6 A;  4DVY P;  4MVO A;  3FAJ A;  3DWW A;  1CGO A;  3DZA A;  3G50 A;  2GAQ A;  3PDM P;  5JS5 A;  3NKE A;  5DVW A;  3KH2 A;  3M15 A;  5BQH A;  1RXQ A;  3M79 A;  1DOV A;  1WN0 A;  2I15 A;  2LIG A;  2WZL A;  2C04 A;  4MVQ A;  4U5F E;  3GEE A;  5F5H A;  2L81 A;  2H7V C;  4BG0 A;  5E3A A;  2W45 A;  1LVK A;  3RF3 A;  1M2O A;  1K40 A;  4CDY A;  1HMO A;  2PFD A;  2Q4F A;  2FFH A;  2ZXW C;  2YL7 A;  1ZHW A;  2HKV A;  2DYR C;  1AVO B;  4DRI B;  4DVZ A;  3U2M A;  3AGU A;  1A41 A;  3LES A;  4YL1 A;  1GM5 A;  1ZHX A;  3G4X A;  4DXW A;  1D0Z A;  3Q7G A;  2CNW A;  2CW0 F;  3QVY A;  3UMK A;  1LS4 A;  3AG2 C;  3LNM B;  4BJ6 C;  1OW7 A;  1OCR C;  1T6Q A;  1U6H A;  3IPM O;  2UUH A;  3WOD F;  4MVR A;  1E86 A;  3CAX A;  1G8X A;  2XS8 A;  3B0P A;  4DRJ B;  4PK4 A;  1VYK A;  4EBB A;  4Q5S F;  1CPR A;  3MBG A;  5AC5 A;  1OW8 A;  4JTD B;  1FMW A;  1A7D A;  4C3D A;  3X2Q C;  1T01 A;  3PHF 2;  4OD4 A;  1DOW A;  4O7G A;  3FVY A;  2GWW A;  2LFF A;  3C8G D;  3HLZ A;  4CS8 A;  3EGX A;  3N24 A;  4N4W A;  3W4Y A;  3DAG A;  4WGZ A;  3SEO A;  2XLM A;  4WJ0 A;  1K05 A;  2L7A A;  4YN0 B;  3U9M A;  4I1M A;  4YT2 A;  2R03 A;  3NYM A;  4FWV A;  3GM3 A;  3QW1 A;  3U5S A;  3W2V A;  1OR3 A;  3TJ5 A;  1NFN A;  2NG1 A;  2XLH A;  4R32 A;  3VF0 A;  5JT4 A;  2I8B A;  3ASN C;  2X0C A;  3U9J A;  5L0G A;  1HW1 A;  1QSP A;  2YL3 A;  4W8K A;  3ABL C;  3M1C B;  3DJU B;  3EQL F;  1NU7 D;  4U5D E;  4XPW A;  3B9Q A;  4LDQ A;  4MW3 A;  2R7X A;  5KYN A;  3L1M A;  2W9Y A;  4N06 A;  1Z3I X;  2XLV A;  3NMI A;  3ZC4 A;  3N0T A;  4KNW A;  1TWA A;  1CPQ A;  1YJG A;  2HMZ A;  4U9E A;  3ZTM A;  2ASR A;  2PX0 A;  3EFO B;  4AE4 B;  5A6K A;  1M2V B;  1E85 A;  5CI8 A;  1E83 A;  1VB5 A;  4HEA J;  4ULV A;  1S7Z A;  3RH3 A;  4GEH A;  4OIO F;  4BPM A;  2MYS A;  4C3E A;  1Q0M A;  1MMD A;  4M63 A;  5T3T A;  2J9B A;  2JD3 A;  1ZYR F;  2R9R B;  2WVO A;  3AJM A;  4IRU A;  2YLG A;  2LSE A;  4JKV A;  3X1O A;  5DQZ A;  2Q9B A;  4CX9 A;  5COF A;  5A6A A;  5L0J A;  2M64 A;  3B29 A;  4MVS A;  3V7O A;  2V3C C;  1A7E A;  4ZLD A;  2R7V A;  5KYX A;  1T5O A;  1HW2 A;  2P6V A;  4QDL A;  5COG A;  2JPU A;  2Z15 A;  3JSE O;  1KTM A;  2NSG A;  1SF8 A;  3O6X A;  3QW0 A;  5E3C A;  3WAQ A;  3EG9 B;  4PJM A;  2NUP B;  1LE4 A;  3NKD A;  1BR1 A;  1QVX A;  1C03 A;  4BJ5 A;  3QVZ A;  3UR3 C;  2XXA B;  2R02 A;  1N1C A;  3KKB A;  3ZG1 A;  4CJG A;  5L3V A;  1PD1 A;  3LS1 A;  1OW6 A;  1Y6D A;  3IHU A;  1Y4C A;  4NC3 A;  2AWY A;  2A0B A;  2MHR A;  1XZQ A;  1GGQ A;  4CDV A;  5L0C A;  1TWC A;  2HSB A;  3CSK A;  4ANJ A;  1F1M A;  2DGJ A;  5GPG B;  5T3W A;  3SXM A;  3LS0 A;  3T6J A;  3HJC A;  2L6F A;  3FOP A;  5DS6 A;  1M2V A;  4ONS A;  1XZP A;  4P9T A;  5L0D A;  5AC4 A;  1NU9 C;  2KYH A;  2ZXP A;  5JRA A;  1D0X A;  3VYW A;  3HKK A;  3ATP A;  3IEE A;  1KNY A;  2KQ9 A;  4MVM A;  4O6N A;  2DB4 A;  4NTB A;  1D1A A;  1PV3 A;  5B3S C;  1VYI A;  3TJ6 A;  1OKK A;  4J32 B;  1C17 M;  3F47 A;  1ZHY A;  3H2U A;  2Y69 C;  3NRH A;  3LNR A;  4GYT A;  2B0J A;  2QE9 A;  1MMN A;  1PCX A;  3HNI A;  3TK0 A;  4CBE A;  5JLI A;  2VB6 A;  3GEH A;  4PR9 A;  3HNK A;  2E87 A;  4A2N B;  4OIN F;  2XRH A;  3DE9 A;  4JVS A;  1JRA A;  3T6G B;  3L0I A;  2OCC C;  2IOQ A;  3FOO A;  3L8J A;  4N6C A;  5F28 E;  3S28 A;  3AG3 C;  5L3Q A;  1U0B B;  2EPN A;  3SXK A;  1HY5 A;  3N2Z B;  2NUP A;  2RSE B;  3GOD A;  3UMI A;  1HE9 A;  3AG4 C;  3B0V C;  1T9K A;  3ABM C;  3GM2 A;  3U8P A;  2XXA A;  2XS1 A;  3NYL A;  1Q0F A;  3UGO A;  1GS9 A;  3LAY A;  3KYI A;  2P0N A;  2OJE D;  3EH2 A;  1RMV A;  2L6H A;  1G4W R;  4I1O B;  3EPV A;  3FAP B;  4XEV A;  3LUT B;  1YZA A;  4UDV A;  4ULW A;  2IBF A;  2OG2 A;  2VCB A;  1NSG B;  3HNJ A;  4I44 A;  1Z23 A;  2J7P A;  2OU6 A;  3RQG A;  5DS5 A;  1QZX A;  4OIR F;  2IXO A;  5B3I A;  3DI5 A;  3WHN A;  2HS5 A;  3JYH A;  2GA0 A;  4U5C E;  2R7S A;  3LEO A;  3EZI A;  3VM6 A;  5FCL A;  3MX3 A;  5A6J A;  2KNH A;  4KI2 A;  1AEP A;  1V74 B;  4IAO A;  4YJW A;  4DBR A;  3W2W A;  2R7Q A;  1BR2 A;  4MTO A;  2WVN A;  1I4Z A;  2XL4 A;  4JJG A;  4RDA A;  3B0U X;  1QKR A;  1EQ1 A;  2J45 A;  2XL8 A;  2YWA A;  3JZ0 A;  1V4A A;  3MFN A;  4JW1 A;  2D5R B;  3DM9 B;  4FAP B;  3GWN A;  1OCC C;  1Q0K A;  5A69 A;  5DLJ A;  3I5Q A;  3K1I C;  2BC5 A;  2HSQ A;  3S84 A;  1FFT C;  3U3F A;  2EPO A;  3S90 A;  4E18 A;  2VCA A;  2WL8 A;  2WVQ A;  5COM A;  2GDC A;  2KK1 A;  5T1D B;  5DS4 A;  1AUE A;  1TR2 A;  1ZZP A;  1LKX A;  3ABK C;  3IQT A;  3OWT A;  5EK0 A;  3FXH A;  3AQC A;  5KYY B;  3RQE A;  3ECS A;  5KYX B;  3E70 C;  1MNE A;  3UMH A;  4X0R A;  1ZW2 A;  4JIO A;  3QZC A;  1MMA A;  2G3V A;  4XPX A;  2XSE A;  2R7T A;  2A6H F;  3GAN A;  4O79 A;  3SP1 A;  4OIQ F;  3DMD A;  2BL2 A;  3AGT A;  4JTC B;  3DJN B;  1QQ3 A;  3C62 A;  4MW8 A;  1H7I A;  4E7S A;  1YA7 O;  4WAB A;  1G4U S;  5AGF A;  5HSW A;  4E0I A;  1NBB A;  4PJN A;  4CSA A;  2YLI A;  4PFO A;  2AWC A;  2XLE A;  1M6T A;  4AL1 A;  2JX0 A;  4CDA A;  1OXB A;  2VC9 A;  3DXJ F;  3H2V A;  5JSL A;  4YT5 A;  2M4E A;  3KPH A;  5HV9 A;  3S29 A;  3S9O A;  1VTM P;  1FTS A;  1ZW3 A;  3TOL A;  4B6I A;  2PX3 A;  3ZIB A;  3NMJ A;  3V5Z A;  3K7D A;  3KYJ A;  4IJJ A;  3RKO F;  1M57 C;  2PP4 A;  3RIP A;  4MS2 A;  4K7B A;  4NQF A;  4A4A A;  3ZWI A;  1TFK B;  3TQO A;  1LE2 A;  1FAP B;  256B A;  3RQF A;  1D1B A;  2LFD A;  5E2Q A;  2Y3G A;  2YZS A;  1A0B A;  2HZ8 A;  1C02 A;  2ZPA A;  3BRJ A;  3DE8 A;  1WAS A;  2AU5 A;  4MTG A;  3Q6M A;  3K33 A;  2YHS A;  2Q9C A;  1EI7 A; 
#chains in the Genus database with same CATH homology
 4E0I A;  4LDK A;  3GWN A;  1JR8 A;  3LLK A;  1OQC A;  3R7C A;  2HJ3 A;  3MBG A;  3TD7 A;  3U2L A;  3W4Y A;  3TK0 A;  4E0H A;  3LLI A;  1JRA A;  3U2M A;  3U5S A;  3O55 A;  3GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...