1JR8A

Crystal structure of erv2p
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
b'DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erv2 PROTEIN, mitochondrial
publication title A new FAD-binding fold and intersubunit disulfide shuttle in the thiol oxidase Erv2p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 41
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1jr8A00
3TD7A 3U5SA 3W4YA 4E0IA 1JRAA 3LLIA 3U2LA 3U2MA 1JR8A 1OQCA 2HJ3A 3O55A 3MBGA 3GWLA 3R7CA 3LLKA 3GWNA 4LDKA 3TK0A 4E0HA
chains in the Genus database with same CATH superfamily
4JTCB 1OXBA 2CYDA 3EQLF 2EIJC 3ZWIA 3CSKA 2NSGA 1JRAA 1NFOA 3B0PA 2YLIA 4IB4A 1Z7Qc 1KTMA 2CW0F 2J9UA 4F4BA 3RKOF 1Z6AA 1EI7A 1YJGA 2L81A 2XLVA 3BEHA 3JYHA 3ZIBA 3R2PA 1Z3IX 1D1AA 1CGME 2OQMA 4CX9A 2XLDA 2PNOA 1NFNA 1KU2A 5DS6A 1JPJA 2R7OA 2YL7A 3T6BA 3GWNA 2BE5F 4QI0A 1TFOB 1SZIA 3K1HA 3IQCA 3W8IA 3E9VA 5DQZA 2J7PA 3AQCA 1XZPA 4NCQA 4H54A 2P7VA 1YZAA 3RIPA 4WGZA 4AL1A 5DQTA 2Y39A 3C8ZA 1HW1A 2R9RB 2R02A 2KYHA 1ZU4A 2PF4E 2GFHA 1OR2A 3S90A 4CSAC 1JAFA 5DS4A 3C62A 4N4WA 1FFHA 3OEOA 2IM8A 3V5ZA 4DBQA 1EKYA 1IZMA 3B9QA 1WN0A 2R25A 5B3SC 1D1CA 3H2VA 4MVZA 4OD4A 3O55A 4LLCA 4PJNA 4AE4A 2RD9A 2I15A 5D91A 1Q0FA 3LLKA 1Z5ZA 1MQVA 3W2VA 1E83A 2HV6A 2OOCA 1Q0KA 1W2WA 2HKVA 2UUIA 3QVZA 4JW1A 4C7OA 2XLWA 1ORJA 2DYSC 3U3BA 3DKAA 2Z15A 1S7ZA 3EFOB 4ULWA 3CZ6A 3ABKC 4OD5A 3DJNB 3HNKA 4PJMA 1LVKA 4BJ1A 4CJOA 3WAQA 3FAJA 4BJ5A 1OCOC 5T3WA 3AQBA 1V55C 3EZIA 3LUTB 1FTSA 2J0WA 3QMKA 1D1BA 4E0IA 4JTDB 3HNIA 2A6HF 5BQIA 4OIPF 2Q7RA 5JS5A 3F47A 2DGJA 4OIRF 3FHDA 2JD3A 5CI8A 5KYXA 1E2XA 2GDCA 1TQGA 3U2LA 3ZTZA 2VCAA 2P6VA 2NUPB 1Q0GA 2YL3A 5CI9A 2R7VA 1FFTC 3ZTMA 1TFKB 2W45A 3PDMP 1TWGA 1I4YA 1DOVA 1D0ZA 2KJGA 4CS8C 4OIQF 1JOGA 2WVOA 2XL4A 3N2ZB 3DI5A 2R7XA 1T6IA 4U5HA 1HMOA 3IEEA 1GM5A 3SYNA 2WL8A 1M2OA 2ZPAA 2YLGA 4KNWA 2NPUA 1ST6A 3Q6MA 4W8PA 3GM3A 2VC9A 5E33A 3C7JA 1LS4A 5A69A 1HW2A 1U6HA 4U5GA 4JRZA 1NU9C 3Q7GA 4P9FA 3V7OA 3LLIA 3HJCA 4MTOA 1ZVZA 2Q9AA 2RSEB 2R7SA 4JZAA 1WWPA 1H9GA 3PCVA 2YEVA 2KK1A 4FX5A 5JRAA 3S0XA 3ITFA 4JIOA 2YHSA 2P0NA 3EFOA 1U0BB 3L1MA 4DRIB 3I5QA 3GWLA 4JVSA 4W8KA 3EJNA 2HV7A 3LEOA 1E86A 2XM4A 1J8YF 2YVKA 3H2UA 1PCXA 1OCRC 2EPKX 2E87A 3UMIA 1YA9A 4MVUA 1H7IA 1HMDA 2OJED 2CCYA 2YKZA 3EGDA 1RCPA 2ZXPA 3SZRA 4CJGA 4E18A 2A68F 2W4BA 3NMIA 4XPXA 4DBRA 2R03A 4U5FE 2NUPA 1OXKA 2X0CA 4JCHA 3UGOA 3L34A 1TKNA 5JVEA 4WABA 3TJ6A 2MYSA 3IHUA 3EG9A 1E85A 2DI3A 2A1DD 2DYRC 4WGYA 3RQEA 5L0GA 3U2MA 5L3VA 3NYLA 2HUJA 3TQOA 3S28A 3B71A 4BPMA 1TWAA 3K7DA 2VASA 2XLMA 2HFIA 3JSEO 4MVOA 4X0RA 5E2QA 1FMWA 4L6RA 4JJGA 2LFDA 3QW1A 2W4MA 4IWBA 4LDQA 3BRJA 3AG2C 2PFDA 4DVYP 4MTFA 2WZLA 4N6CA 4BJ6C 4NC3A 1UG7A 4AE4B 1VB5A 4BEJA 2EPNA 4JURI 1PD0A 5AGFA 3U8PA 4YL3A 4DXWA 3U5SA 3FOPA 3K66A 2R05A 2AU5A 1H9TA 4C7OB 3NKEA 3GEIA 4YT8A 5DLJA 4N6HA 2ZXOA 4CSAA 5BQHA 1OCZC 4CBEA 1MMNA 1M57C 1BZ4A 1LI7A 2AWCA 1WASA 2EIKC 2VB6A 3A9CA 1JPNA 3T6GB 2HZ8A 3U9JA 3U9MA 3ZVRA 2R7UA 2J0XA 3AG1C 5KYYA 1PD1A 2M4EA 4C3EA 1VTMP 3UMKA 1T01A 1VK5A 2CNWA 4XWJA 4A4AA 4Q7CA 1G5ZA 1U89A 5A6AA 4XEVA 3U8VA 2X51A 5KYXB 2ZXWC 2XRHA 5KYWA 1MMGA 4I1OB 4M63A 2H8AA 4K1OA 256BA 5TJ5E 3GEEA 3V5XA 2XS1A 4B6IA 4J7YA 1FAPB 4IAQA 1BDJB 4HFKB 3GM1A 3KYJA 3KPHA 1NU7D 3T9OA 1HE1A 5L0FA 3LJBA 2QLAA 3DE8A 2HJMA 3NMKA 3QTHA 4CS7A 4PJJA 2BL2A 4U5EE 2Q00A 3V5YA 4Z9HA 1MMAA 5L0IA 4EBKA 3M4CA 4IAOA 1XWJA 1A0BA 1N1CA 1V4AA 2L9JA 2PX3A 2DB4A 3OA1A 4J7TA 1JR8A 1OQCA 3OWTA 3MBGA 2HMZA 4AK9A 5FZTA 3X1OA 4JJFA 2Y69C 3DD7A 3R7CA 1L3PA 3C8GD 3AGUA 4CS8A 1MNDA 3DZAA 2A0BA 1WATA 4D4NA 3ABMC 4ZLCA 1FMVA 4U5CE 2J8WA 3AGTA 4CDYA 5CIVA 1TR2A 1OKKA 5FCLA 4HFFB 1ORSC 2EILC 1C02A 2G62A 2HMQA 3JCUQ 1NG1A 4PFPA 4XPWA 3IQTA 3AOUA 4EWCA 4PFOA 2EPLX 3FDQA 1YVIA 4E17A 2IXPA 4EKWA 1ZW3A 4EBBA 3AG3C 5L3QA 3JRTA 3N0TA 3EGDB 5JLIA 3F46A 4J30B 3M79A 1Q0DA 3ZDLA 2NSFA 4J32B 4U5DE 2CGEA 2F22A 2J9WA 3NMJA 3SXZA 3TJ5A 3WG7C 3M15A 3NYMA 5COMA 4LERA 3RH3A 4JCZA 2J9BA 4JEAA 4DJ9A 2YL0A 2ZD9A 3ATPA 3K1IC 3FVYA 4P6IC 5EK0A 1F1MA 4WJ0A 3AG4C 1NZEA 3EG9B 3ZQYA 4NQFA 4AL0A 5A6BD 3TULA 1FR0A 3B0VC 3KKBA 1A41A 1G4WR 4NTFA 1ZHWA 3DMDA 2KGOA 1R4TA 3U3FA 2LCHA 5A6KA 2WB7A 2V26A 1SMYF 3FMSA 4MVSA 4YT5A 3NKDA 1QKRA 1ZHZA 3O39A 4YJWA 2XL8A 2CDQA 3W4YA 5B1BC 2R7WA 3NG1A 4DOZA 1OW7A 4PJLA 3Q6NA 2L6HA 3MLGA 2R7QA 4XTKA 1HE9A 1AVOB 3LNMB 1APCA 3DM5A 2QE9A 1YA7O 3HNJA 4PK4A 1VLSA 4XEFA 4ZLDA 4IARA 2GAQA 2Y3DA 1LE4A 1YARO 3UGPA 1GGQA 3M1CB 4LLEA 1J8MF 1E84A 1WOLA 2EINC 2WZFA 4G78A 4JE9A 4ER9A 1SF8A 3C18A 1YDIA 3DAGA 2HS5A 3GODA 3RVYA 2EPOA 4RBNA 1YYJA 2OG2A 4KC9A 5JT4A 5BUOA 1VYIA 2IXOA 1CGNA 4Q5SF 1Z23A 4CDVA 2Y3BA 1L7CA 2LSEA 4G0HA 4I3MA 1NBBA 3ECSA 4N06A 4BJ6A 4E0HA 4XLNF 3WODF 3S29A 1LIHA 5KYYB 1QZXA 2VCCA 3ASNC 4BEMJ 5EHHA 1OW8A 4Q4ZF 1BBHA 2QNLA 3A11A 4MTGA 4IJJA 2R7RA 1ZW2A 4UDVA 5KYWB 2MWQA 1BR4A 2JPUA 1WTYA 2KQ9A 3GEHA 3DWWA 5K0IA 2XSEA 5KYNA 1LE2A 2WVNA 3VM6A 2OCCC 3JSZA 3WHNA 2NUTB 1M6TA 4MQ9F 4OINF 3KYIA 2D4UA 3C63A 3JTLO 3LNRA 2XS8A 4DVZA 4O7GA 1V74B 1K04A 4NTBA 1I4ZA 1VOMA 3E70C 1M56C 3VAYA 2WVQA 3UR3C 4C3DA 1DOWA 1A7VA 1RKCA 3RYLA 2LFFA 1JMWA 3TK0A 1BR2A 3GORA 3DM9B 1QVXA 3DJUB 2XLHA 2IOQA 5JP7A 1O3UA 2UUHA 1VMAA 2GA0A 2W9YA 1VLTA 3VRCA 2P1AA 4MW3A 1HY5A 4CS9C 4O79A 2L6GA 3K6BA 4FESA 2QY9A 4FAPB 4OIOF 4DRHB 2M64A 1AUEA 4A2NB 1QSPA 2J46A 3LS1A 4LDRA 2H7VC 2IBFA 1UFBA 3G50A 3HTKC 3W8HA 4BG0A 2A69F 5JSLA 2ZXRA 2L7AA 2AWYA 2ICWG 2Y3HA 4Z9IA 4YK5A 4GYTA 4NTAA 4MVQA 4C3BA 5B3IA 1TWHA 2L6FA 2YWAA 3AJMA 3T6JA 3H65A 3CEXA 1C03A 1QLEC 2YRFA 4E7SA 2V3CC 2YQYA 3C8GA 4U9EA 3HNLA 2NUTA 1M2VA 3CAXA 3JRMO 4K7BA 5E3CA 4LACB 1PV3A 4YN0B 1RJ9A 1ORYA 3ZQVA 4YWQA 5KYUB 3J06A 2H7OA 5GPGB 2D5RB 1K05A 2I8BA 2IXMA 3US6A 1S05A 4JEBA 4KI2A 1RMVA 2XM0A 4YL0A 5T3TA 4G7ZF 4EIYA 3UNGC 3PHF2 1KNYA 4KNVA 1WGWA 1YAUO 5L0JA 2PP4A 2KNHA 3B0UX 4Z9JA 3QW0A 3K1IA 2EPMX 3LS0A 1QQ3A 4I1MA 4RDAA 4DRJB 4RD9A 1LPEA 1SR2A 1ZYRF 4JKVA 4EUKB 1RKEA 1AEPA 4LDKA 1CPQA 4CIHA 2AP3A 3FXHA 4HEAJ 2KSFA 4G7OF 1C17M 4NY3A 4O6YA 3MYFA 4XEKA 4PR9A 1OW6A 3KH2A 4MVMA 4YT2A 3GM2A 1GS9A 2CNWD 1ZZPA 3FOOA 1Z63A 2B0HA 2OKUA 1LM3B 2YLDA 2QUPA 4JTAB 5F5HA 2XXAA 1H6GA 5A6BA 2OEVA 2QTVA 3MYIA 3JZ0A 3VF0A 3EGXA 1YLMA 2J7PD 4G7HF 5F5FA 4AX2A 5T1DB 1NSGB 3K33A 2IYLD 1I5NA 2JX0A 1G4US 1SYQA 3I5PA 4H4KC 2HJ3A 2G3VA 2WZGA 2GWWA 3RQFA 2FFHA 1O87A 3DE9A 5E3AA 3IQ6A 1RXQA 4MNDA 2MHRA 3EHNA 4I44A 1Y4CA 3ZG1A 3L8JA 3SXKA 3IQ5A 3ABLC 2OU6A 2HSBA 5L0DA 1T5OA 5KYUA 3PMRA 4CDAA 1OCCC 2NG1A 4IGGA 3MFNA 4QDLA 5L0CA 1ZHXA 3EH2A 3POVA 1VYKA 3T4RA 4MS2A 1IW7F 3EH1A 1D0XA 2KW3C 3UMHA 3LAYA 4D4XA 2PBEA 3RVZA 4XLPF 3KMIA 1QPUA 4IRUA 1V54C 1MNEA 4YL1A 2O9XA 1LI5A 2LD6A 4KBLA 5EGYA 3EHMA 2KC3A 2PX0A 4HE8D 4O6MA 1O5HA 3SNHA 4ANJA 3GANA 4K0DA 1OKKD 2OEXA 4GEHA 2OJQA 4EHPA 3O6XA 2B0JA 5BQGA 1ZHYA 3SEOA 2VCBA 2XLEA 4YT4A 1FNTc 3VYWA 5L0HA 2LIGA 2LQGA 5F28E 3S27A 3NDBB 5AC4A 5IY5C 3RFYA 3TOMA 2P61A 4O6NA 2YL1A 2Q4FA 1K40A 3ZSUA 3G4ZA 3SXMA 1EA8A 1A7EA 3Q7LA 3L8IA 4U5BE 1D0YA 2C04A 4BJ5C 1B68A 3EZHA 1Q0MA 4GQHA 4ONSA 1R5ID 1XZQA 3DXJF 3NYJA 1A7DA 3IPMO 3ZC4A 2HSQA 3HKKA 1T9KA 4U9DA 2TMVP 3MX3A 2VH3A 3L0IA 2YZSA 4PACA 2FAPB 4R32A 4XPYA 3W2WA 1Y6DA 2H7BA 3NRHA 4XQ1A 4CS9A 2BC5A 1TWCA 2IXNA 5JUAA 5HSWA 2R7TA 3RF3A 3I4UA 3SXYA 3C8GB 3KL4A 1M2VB 3X2QC 2Q3TA 1LKXA 1LS1A 1RJ9B 2J45A 3O10A 1MMDA 3S84A 3ASOC 1NLXA 1T6QA 5B1AC 4BJTA 3EPVA 3LEVA 1EQ1A 3RW0A 2C03A 2FGYA 5AC5A 2A6EF 3HLZA 5A6JA 5DS5A 5COGA 3QZCA 3TD7A 1BR1A 2Y3GA 3SP1A 3JT1A 1CPRA 1RKEB 1YZCA 4P9TA 5DVWA 3JYYA 5HV9A 3LESA 3U0CA 1YYXA 2EIMC 4CIPA 2ASRA 4FWVA 2XLOA 4MVRA 4E7ZA 4JC7A 1ZU5A 2AVKA 2A0UA 3DAFA 3S9OA 4MW8A 2LK4A 3FAPB 5D92A 3QVYA 4QI2A 3CQZA 4EBJA 5COFA 1G8XA 2XXAB 3N24A 2J9VA 2G3KA 3RQGA 2ETSA 2LP4A 3EGXB 4ULVA 3TOLA 1GQAA 1CGOA 3G4XA 2Q9CA 3B29A 3M4BA 1OR3A 2XL6A 1T6UA 2Q9BA 1ZHTA
chains in the Genus database with same CATH topology
3TD7A 3U5SA 3W4YA 4E0IA 1JRAA 3LLIA 3U2LA 3U2MA 1JR8A 1OQCA 2HJ3A 3O55A 3MBGA 3GWLA 3R7CA 3LLKA 3GWNA 4LDKA 3TK0A 4E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TD7 A;  3U5S A;  3W4Y A;  4E0I A;  1JRA A;  3LLI A;  3U2L A;  3U2M A;  1JR8 A;  1OQC A;  2HJ3 A;  3O55 A;  3MBG A;  3GWL A;  3R7C A;  3LLK A;  3GWN A;  4LDK A;  3TK0 A;  4E0H A; 
#chains in the Genus database with same CATH topology
 4JTC B;  1OXB A;  2CYD A;  3EQL F;  2EIJ C;  3ZWI A;  3CSK A;  2NSG A;  1JRA A;  1NFO A;  3B0P A;  2YLI A;  4IB4 A;  1Z7Q c;  1KTM A;  2CW0 F;  2J9U A;  4F4B A;  3RKO F;  1Z6A A;  1EI7 A;  1YJG A;  2L81 A;  2XLV A;  3BEH A;  3JYH A;  3ZIB A;  3R2P A;  1Z3I X;  1D1A A;  1CGM E;  2OQM A;  4CX9 A;  2XLD A;  2PNO A;  1NFN A;  1KU2 A;  5DS6 A;  1JPJ A;  2R7O A;  2YL7 A;  3T6B A;  3GWN A;  2BE5 F;  4QI0 A;  1TFO B;  1SZI A;  3K1H A;  3IQC A;  3W8I A;  3E9V A;  5DQZ A;  2J7P A;  3AQC A;  1XZP A;  4NCQ A;  4H54 A;  2P7V A;  1YZA A;  3RIP A;  4WGZ A;  4AL1 A;  5DQT A;  2Y39 A;  3C8Z A;  1HW1 A;  2R9R B;  2R02 A;  2KYH A;  1ZU4 A;  2PF4 E;  2GFH A;  1OR2 A;  3S90 A;  4CSA C;  1JAF A;  5DS4 A;  3C62 A;  4N4W A;  1FFH A;  3OEO A;  2IM8 A;  3V5Z A;  4DBQ A;  1EKY A;  1IZM A;  3B9Q A;  1WN0 A;  2R25 A;  5B3S C;  1D1C A;  3H2V A;  4MVZ A;  4OD4 A;  3O55 A;  4LLC A;  4PJN A;  4AE4 A;  2RD9 A;  2I15 A;  5D91 A;  1Q0F A;  3LLK A;  1Z5Z A;  1MQV A;  3W2V A;  1E83 A;  2HV6 A;  2OOC A;  1Q0K A;  1W2W A;  2HKV A;  2UUI A;  3QVZ A;  4JW1 A;  4C7O A;  2XLW A;  1ORJ A;  2DYS C;  3U3B A;  3DKA A;  2Z15 A;  1S7Z A;  3EFO B;  4ULW A;  3CZ6 A;  3ABK C;  4OD5 A;  3DJN B;  3HNK A;  4PJM A;  1LVK A;  4BJ1 A;  4CJO A;  3WAQ A;  3FAJ A;  4BJ5 A;  1OCO C;  5T3W A;  3AQB A;  1V55 C;  3EZI A;  3LUT B;  1FTS A;  2J0W A;  3QMK A;  1D1B A;  4E0I A;  4JTD B;  3HNI A;  2A6H F;  5BQI A;  4OIP F;  2Q7R A;  5JS5 A;  3F47 A;  2DGJ A;  4OIR F;  3FHD A;  2JD3 A;  5CI8 A;  5KYX A;  1E2X A;  2GDC A;  1TQG A;  3U2L A;  3ZTZ A;  2VCA A;  2P6V A;  2NUP B;  1Q0G A;  2YL3 A;  5CI9 A;  2R7V A;  1FFT C;  3ZTM A;  1TFK B;  2W45 A;  3PDM P;  1TWG A;  1I4Y A;  1DOV A;  1D0Z A;  2KJG A;  4CS8 C;  4OIQ F;  1JOG A;  2WVO A;  2XL4 A;  3N2Z B;  3DI5 A;  2R7X A;  1T6I A;  4U5H A;  1HMO A;  3IEE A;  1GM5 A;  3SYN A;  2WL8 A;  1M2O A;  2ZPA A;  2YLG A;  4KNW A;  2NPU A;  1ST6 A;  3Q6M A;  4W8P A;  3GM3 A;  2VC9 A;  5E33 A;  3C7J A;  1LS4 A;  5A69 A;  1HW2 A;  1U6H A;  4U5G A;  4JRZ A;  1NU9 C;  3Q7G A;  4P9F A;  3V7O A;  3LLI A;  3HJC A;  4MTO A;  1ZVZ A;  2Q9A A;  2RSE B;  2R7S A;  4JZA A;  1WWP A;  1H9G A;  3PCV A;  2YEV A;  2KK1 A;  4FX5 A;  5JRA A;  3S0X A;  3ITF A;  4JIO A;  2YHS A;  2P0N A;  3EFO A;  1U0B B;  3L1M A;  4DRI B;  3I5Q A;  3GWL A;  4JVS A;  4W8K A;  3EJN A;  2HV7 A;  3LEO A;  1E86 A;  2XM4 A;  1J8Y F;  2YVK A;  3H2U A;  1PCX A;  1OCR C;  2EPK X;  2E87 A;  3UMI A;  1YA9 A;  4MVU A;  1H7I A;  1HMD A;  2OJE D;  2CCY A;  2YKZ A;  3EGD A;  1RCP A;  2ZXP A;  3SZR A;  4CJG A;  4E18 A;  2A68 F;  2W4B A;  3NMI A;  4XPX A;  4DBR A;  2R03 A;  4U5F E;  2NUP A;  1OXK A;  2X0C A;  4JCH A;  3UGO A;  3L34 A;  1TKN A;  5JVE A;  4WAB A;  3TJ6 A;  2MYS A;  3IHU A;  3EG9 A;  1E85 A;  2DI3 A;  2A1D D;  2DYR C;  4WGY A;  3RQE A;  5L0G A;  3U2M A;  5L3V A;  3NYL A;  2HUJ A;  3TQO A;  3S28 A;  3B71 A;  4BPM A;  1TWA A;  3K7D A;  2VAS A;  2XLM A;  2HFI A;  3JSE O;  4MVO A;  4X0R A;  5E2Q A;  1FMW A;  4L6R A;  4JJG A;  2LFD A;  3QW1 A;  2W4M A;  4IWB A;  4LDQ A;  3BRJ A;  3AG2 C;  2PFD A;  4DVY P;  4MTF A;  2WZL A;  4N6C A;  4BJ6 C;  4NC3 A;  1UG7 A;  4AE4 B;  1VB5 A;  4BEJ A;  2EPN A;  4JUR I;  1PD0 A;  5AGF A;  3U8P A;  4YL3 A;  4DXW A;  3U5S A;  3FOP A;  3K66 A;  2R05 A;  2AU5 A;  1H9T A;  4C7O B;  3NKE A;  3GEI A;  4YT8 A;  5DLJ A;  4N6H A;  2ZXO A;  4CSA A;  5BQH A;  1OCZ C;  4CBE A;  1MMN A;  1M57 C;  1BZ4 A;  1LI7 A;  2AWC A;  1WAS A;  2EIK C;  2VB6 A;  3A9C A;  1JPN A;  3T6G B;  2HZ8 A;  3U9J A;  3U9M A;  3ZVR A;  2R7U A;  2J0X A;  3AG1 C;  5KYY A;  1PD1 A;  2M4E A;  4C3E A;  1VTM P;  3UMK A;  1T01 A;  1VK5 A;  2CNW A;  4XWJ A;  4A4A A;  4Q7C A;  1G5Z A;  1U89 A;  5A6A A;  4XEV A;  3U8V A;  2X51 A;  5KYX B;  2ZXW C;  2XRH A;  5KYW A;  1MMG A;  4I1O B;  4M63 A;  2H8A A;  4K1O A;  256B A;  5TJ5 E;  3GEE A;  3V5X A;  2XS1 A;  4B6I A;  4J7Y A;  1FAP B;  4IAQ A;  1BDJ B;  4HFK B;  3GM1 A;  3KYJ A;  3KPH A;  1NU7 D;  3T9O A;  1HE1 A;  5L0F A;  3LJB A;  2QLA A;  3DE8 A;  2HJM A;  3NMK A;  3QTH A;  4CS7 A;  4PJJ A;  2BL2 A;  4U5E E;  2Q00 A;  3V5Y A;  4Z9H A;  1MMA A;  5L0I A;  4EBK A;  3M4C A;  4IAO A;  1XWJ A;  1A0B A;  1N1C A;  1V4A A;  2L9J A;  2PX3 A;  2DB4 A;  3OA1 A;  4J7T A;  1JR8 A;  1OQC A;  3OWT A;  3MBG A;  2HMZ A;  4AK9 A;  5FZT A;  3X1O A;  4JJF A;  2Y69 C;  3DD7 A;  3R7C A;  1L3P A;  3C8G D;  3AGU A;  4CS8 A;  1MND A;  3DZA A;  2A0B A;  1WAT A;  4D4N A;  3ABM C;  4ZLC A;  1FMV A;  4U5C E;  2J8W A;  3AGT A;  4CDY A;  5CIV A;  1TR2 A;  1OKK A;  5FCL A;  4HFF B;  1ORS C;  2EIL C;  1C02 A;  2G62 A;  2HMQ A;  3JCU Q;  1NG1 A;  4PFP A;  4XPW A;  3IQT A;  3AOU A;  4EWC A;  4PFO A;  2EPL X;  3FDQ A;  1YVI A;  4E17 A;  2IXP A;  4EKW A;  1ZW3 A;  4EBB A;  3AG3 C;  5L3Q A;  3JRT A;  3N0T A;  3EGD B;  5JLI A;  3F46 A;  4J30 B;  3M79 A;  1Q0D A;  3ZDL A;  2NSF A;  4J32 B;  4U5D E;  2CGE A;  2F22 A;  2J9W A;  3NMJ A;  3SXZ A;  3TJ5 A;  3WG7 C;  3M15 A;  3NYM A;  5COM A;  4LER A;  3RH3 A;  4JCZ A;  2J9B A;  4JEA A;  4DJ9 A;  2YL0 A;  2ZD9 A;  3ATP A;  3K1I C;  3FVY A;  4P6I C;  5EK0 A;  1F1M A;  4WJ0 A;  3AG4 C;  1NZE A;  3EG9 B;  3ZQY A;  4NQF A;  4AL0 A;  5A6B D;  3TUL A;  1FR0 A;  3B0V C;  3KKB A;  1A41 A;  1G4W R;  4NTF A;  1ZHW A;  3DMD A;  2KGO A;  1R4T A;  3U3F A;  2LCH A;  5A6K A;  2WB7 A;  2V26 A;  1SMY F;  3FMS A;  4MVS A;  4YT5 A;  3NKD A;  1QKR A;  1ZHZ A;  3O39 A;  4YJW A;  2XL8 A;  2CDQ A;  3W4Y A;  5B1B C;  2R7W A;  3NG1 A;  4DOZ A;  1OW7 A;  4PJL A;  3Q6N A;  2L6H A;  3MLG A;  2R7Q A;  4XTK A;  1HE9 A;  1AVO B;  3LNM B;  1APC A;  3DM5 A;  2QE9 A;  1YA7 O;  3HNJ A;  4PK4 A;  1VLS A;  4XEF A;  4ZLD A;  4IAR A;  2GAQ A;  2Y3D A;  1LE4 A;  1YAR O;  3UGP A;  1GGQ A;  3M1C B;  4LLE A;  1J8M F;  1E84 A;  1WOL A;  2EIN C;  2WZF A;  4G78 A;  4JE9 A;  4ER9 A;  1SF8 A;  3C18 A;  1YDI A;  3DAG A;  2HS5 A;  3GOD A;  3RVY A;  2EPO A;  4RBN A;  1YYJ A;  2OG2 A;  4KC9 A;  5JT4 A;  5BUO A;  1VYI A;  2IXO A;  1CGN A;  4Q5S F;  1Z23 A;  4CDV A;  2Y3B A;  1L7C A;  2LSE A;  4G0H A;  4I3M A;  1NBB A;  3ECS A;  4N06 A;  4BJ6 A;  4E0H A;  4XLN F;  3WOD F;  3S29 A;  1LIH A;  5KYY B;  1QZX A;  2VCC A;  3ASN C;  4BEM J;  5EHH A;  1OW8 A;  4Q4Z F;  1BBH A;  2QNL A;  3A11 A;  4MTG A;  4IJJ A;  2R7R A;  1ZW2 A;  4UDV A;  5KYW B;  2MWQ A;  1BR4 A;  2JPU A;  1WTY A;  2KQ9 A;  3GEH A;  3DWW A;  5K0I A;  2XSE A;  5KYN A;  1LE2 A;  2WVN A;  3VM6 A;  2OCC C;  3JSZ A;  3WHN A;  2NUT B;  1M6T A;  4MQ9 F;  4OIN F;  3KYI A;  2D4U A;  3C63 A;  3JTL O;  3LNR A;  2XS8 A;  4DVZ A;  4O7G A;  1V74 B;  1K04 A;  4NTB A;  1I4Z A;  1VOM A;  3E70 C;  1M56 C;  3VAY A;  2WVQ A;  3UR3 C;  4C3D A;  1DOW A;  1A7V A;  1RKC A;  3RYL A;  2LFF A;  1JMW A;  3TK0 A;  1BR2 A;  3GOR A;  3DM9 B;  1QVX A;  3DJU B;  2XLH A;  2IOQ A;  5JP7 A;  1O3U A;  2UUH A;  1VMA A;  2GA0 A;  2W9Y A;  1VLT A;  3VRC A;  2P1A A;  4MW3 A;  1HY5 A;  4CS9 C;  4O79 A;  2L6G A;  3K6B A;  4FES A;  2QY9 A;  4FAP B;  4OIO F;  4DRH B;  2M64 A;  1AUE A;  4A2N B;  1QSP A;  2J46 A;  3LS1 A;  4LDR A;  2H7V C;  2IBF A;  1UFB A;  3G50 A;  3HTK C;  3W8H A;  4BG0 A;  2A69 F;  5JSL A;  2ZXR A;  2L7A A;  2AWY A;  2ICW G;  2Y3H A;  4Z9I A;  4YK5 A;  4GYT A;  4NTA A;  4MVQ A;  4C3B A;  5B3I A;  1TWH A;  2L6F A;  2YWA A;  3AJM A;  3T6J A;  3H65 A;  3CEX A;  1C03 A;  1QLE C;  2YRF A;  4E7S A;  2V3C C;  2YQY A;  3C8G A;  4U9E A;  3HNL A;  2NUT A;  1M2V A;  3CAX A;  3JRM O;  4K7B A;  5E3C A;  4LAC B;  1PV3 A;  4YN0 B;  1RJ9 A;  1ORY A;  3ZQV A;  4YWQ A;  5KYU B;  3J06 A;  2H7O A;  5GPG B;  2D5R B;  1K05 A;  2I8B A;  2IXM A;  3US6 A;  1S05 A;  4JEB A;  4KI2 A;  1RMV A;  2XM0 A;  4YL0 A;  5T3T A;  4G7Z F;  4EIY A;  3UNG C;  3PHF 2;  1KNY A;  4KNV A;  1WGW A;  1YAU O;  5L0J A;  2PP4 A;  2KNH A;  3B0U X;  4Z9J A;  3QW0 A;  3K1I A;  2EPM X;  3LS0 A;  1QQ3 A;  4I1M A;  4RDA A;  4DRJ B;  4RD9 A;  1LPE A;  1SR2 A;  1ZYR F;  4JKV A;  4EUK B;  1RKE A;  1AEP A;  4LDK A;  1CPQ A;  4CIH A;  2AP3 A;  3FXH A;  4HEA J;  2KSF A;  4G7O F;  1C17 M;  4NY3 A;  4O6Y A;  3MYF A;  4XEK A;  4PR9 A;  1OW6 A;  3KH2 A;  4MVM A;  4YT2 A;  3GM2 A;  1GS9 A;  2CNW D;  1ZZP A;  3FOO A;  1Z63 A;  2B0H A;  2OKU A;  1LM3 B;  2YLD A;  2QUP A;  4JTA B;  5F5H A;  2XXA A;  1H6G A;  5A6B A;  2OEV A;  2QTV A;  3MYI A;  3JZ0 A;  3VF0 A;  3EGX A;  1YLM A;  2J7P D;  4G7H F;  5F5F A;  4AX2 A;  5T1D B;  1NSG B;  3K33 A;  2IYL D;  1I5N A;  2JX0 A;  1G4U S;  1SYQ A;  3I5P A;  4H4K C;  2HJ3 A;  2G3V A;  2WZG A;  2GWW A;  3RQF A;  2FFH A;  1O87 A;  3DE9 A;  5E3A A;  3IQ6 A;  1RXQ A;  4MND A;  2MHR A;  3EHN A;  4I44 A;  1Y4C A;  3ZG1 A;  3L8J A;  3SXK A;  3IQ5 A;  3ABL C;  2OU6 A;  2HSB A;  5L0D A;  1T5O A;  5KYU A;  3PMR A;  4CDA A;  1OCC C;  2NG1 A;  4IGG A;  3MFN A;  4QDL A;  5L0C A;  1ZHX A;  3EH2 A;  3POV A;  1VYK A;  3T4R A;  4MS2 A;  1IW7 F;  3EH1 A;  1D0X A;  2KW3 C;  3UMH A;  3LAY A;  4D4X A;  2PBE A;  3RVZ A;  4XLP F;  3KMI A;  1QPU A;  4IRU A;  1V54 C;  1MNE A;  4YL1 A;  2O9X A;  1LI5 A;  2LD6 A;  4KBL A;  5EGY A;  3EHM A;  2KC3 A;  2PX0 A;  4HE8 D;  4O6M A;  1O5H A;  3SNH A;  4ANJ A;  3GAN A;  4K0D A;  1OKK D;  2OEX A;  4GEH A;  2OJQ A;  4EHP A;  3O6X A;  2B0J A;  5BQG A;  1ZHY A;  3SEO A;  2VCB A;  2XLE A;  4YT4 A;  1FNT c;  3VYW A;  5L0H A;  2LIG A;  2LQG A;  5F28 E;  3S27 A;  3NDB B;  5AC4 A;  5IY5 C;  3RFY A;  3TOM A;  2P61 A;  4O6N A;  2YL1 A;  2Q4F A;  1K40 A;  3ZSU A;  3G4Z A;  3SXM A;  1EA8 A;  1A7E A;  3Q7L A;  3L8I A;  4U5B E;  1D0Y A;  2C04 A;  4BJ5 C;  1B68 A;  3EZH A;  1Q0M A;  4GQH A;  4ONS A;  1R5I D;  1XZQ A;  3DXJ F;  3NYJ A;  1A7D A;  3IPM O;  3ZC4 A;  2HSQ A;  3HKK A;  1T9K A;  4U9D A;  2TMV P;  3MX3 A;  2VH3 A;  3L0I A;  2YZS A;  4PAC A;  2FAP B;  4R32 A;  4XPY A;  3W2W A;  1Y6D A;  2H7B A;  3NRH A;  4XQ1 A;  4CS9 A;  2BC5 A;  1TWC A;  2IXN A;  5JUA A;  5HSW A;  2R7T A;  3RF3 A;  3I4U A;  3SXY A;  3C8G B;  3KL4 A;  1M2V B;  3X2Q C;  2Q3T A;  1LKX A;  1LS1 A;  1RJ9 B;  2J45 A;  3O10 A;  1MMD A;  3S84 A;  3ASO C;  1NLX A;  1T6Q A;  5B1A C;  4BJT A;  3EPV A;  3LEV A;  1EQ1 A;  3RW0 A;  2C03 A;  2FGY A;  5AC5 A;  2A6E F;  3HLZ A;  5A6J A;  5DS5 A;  5COG A;  3QZC A;  3TD7 A;  1BR1 A;  2Y3G A;  3SP1 A;  3JT1 A;  1CPR A;  1RKE B;  1YZC A;  4P9T A;  5DVW A;  3JYY A;  5HV9 A;  3LES A;  3U0C A;  1YYX A;  2EIM C;  4CIP A;  2ASR A;  4FWV A;  2XLO A;  4MVR A;  4E7Z A;  4JC7 A;  1ZU5 A;  2AVK A;  2A0U A;  3DAF A;  3S9O A;  4MW8 A;  2LK4 A;  3FAP B;  5D92 A;  3QVY A;  4QI2 A;  3CQZ A;  4EBJ A;  5COF A;  1G8X A;  2XXA B;  3N24 A;  2J9V A;  2G3K A;  3RQG A;  2ETS A;  2LP4 A;  3EGX B;  4ULV A;  3TOL A;  1GQA A;  1CGO A;  3G4X A;  2Q9C A;  3B29 A;  3M4B A;  1OR3 A;  2XL6 A;  1T6U A;  2Q9B A;  1ZHT A; 
#chains in the Genus database with same CATH homology
 3TD7 A;  3U5S A;  3W4Y A;  4E0I A;  1JRA A;  3LLI A;  3U2L A;  3U2M A;  1JR8 A;  1OQC A;  2HJ3 A;  3O55 A;  3MBG A;  3GWL A;  3R7C A;  3LLK A;  3GWN A;  4LDK A;  3TK0 A;  4E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...