1TQGA

Chea phosphotransferase domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
105
structure length
105
Chain Sequence
GSHMEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helical Shifts Generate Two Distinct Conformers in the Atomic Resolution Structure of the CheA Phosphotransferase Domain from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Chemotaxis protein cheA
total genus 48
structure length 105
sequence length 105
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1tqgA00
1C02A 1SR2A 3IQTA 1TQGA 4PACA 1FR0A 2A0BA 1A0BA 2LCHA 4EUKB 3KYIA 3US6A 1YVIA 1BDJB 1OXBA 1I5NA 2LP4A 3KYJA 1QSPA 3U3BA 1C03A 2R25A 3MYFA 2Q4FA 1WN0A 1OXKA 2LD6A 4G78A 1Y6DA 2OOCA
chains in the Genus database with same CATH superfamily
4NQFA 3I4UA 5JP7A 3JTLO 3ZQVA 4LDKA 4AE4B 2KJGA 5EHHA 4I3MA 2CCYA 2CNWA 3U9JA 3NYMA 4NTBA 4H54A 4QDLA 3C8GD 4U5FE 4E17A 2R7RA 1HMDA 3FXHA 3QZCA 3CZ6A 2BE5F 2B0HA 4N6CA 2WB7A 1QLEC 2Q9BA 1YVIA 2DYRC 2J46A 1TFKB 3LUTB 2J9UA 5B1AC 2WL8A 2Y39A 2YEVA 4DVYP 4I1MA 5L0IA 3HNKA 3Q7GA 4NCQA 3RFYA 4AL0A 1G8XA 2A0UA 2J9BA 4KC9A 4EBBA 3G4XA 2ZXWC 5DS5A 2PX3A 4WABA 3L1MA 3M4CA 4BJ1A 2LFDA 4U9DA 3UMHA 1H6GA 4C3EA 1Y6DA 1OCCC 1YARO 1ZW2A 2VCAA 5DQZA 1FMWA 2L6GA 5L0JA 4G7OF 4N6HA 5L3VA 3NYLA 4OD5A 1XZPA 256BA 1ST6A 2A0BA 2RD9A 3AGTA 4BJ5A 2RSEB 2A6HF 2M4EA 1ZZPA 3CAXA 4ULVA 2XLVA 2CDQA 3GEHA 4OIOF 3C7JA 5B3SC 4KNVA 1GGQA 1RKCA 2A6EF 2M64A 4MTFA 1IZMA 3H2UA 3C8ZA 2A69F 1A7EA 1IW7F 3K7DA 2X51A 3GEIA 4L6RA 1AVOB 2AWCA 3IQ5A 4QI0A 5L0CA 1TWGA 3SP1A 3W4YA 1RXQA 1ZW3A 2J45A 2L6FA 5BQHA 1U89A 4Q4ZF 3ZDLA 2OQMA 3TOLA 5KYNA 5CI9A 4WGYA 2XSEA 4A2NB 2P61A 2XLMA 4LACB 4KI2A 1QKRA 1S7ZA 2H7VC 4NTAA 2W4BA 1ZU4A 1R5ID 4MQ9F 2R7WA 4ANJA 2VASA 3PHF2 4E7SA 1G4US 1Y4CA 2OJED 1HY5A 3ABLC 2I8BA 3DE9A 3PDMP 2PFDA 3C63A 3O10A 1TWAA 4PJMA 4EIYA 4FWVA 1S05A 3K1IA 3X2QC 4WGZA 2A1DD 1Q0DA 3CEXA 2EIKC 2VB6A 1E2XA 3DJUB 1FFTC 4C7OB 3JYYA 3L8JA 2D5RB 4C7OA 1D0XA 3KL4A 1FNTc 3EZIA 3I5PA 4ONSA 2Y3GA 4U5HA 1E84A 5A6BA 5KYXA 4CS9C 4CDAA 5T1DB 3RYLA 2H7BA 2HKVA 4PFOA 1M2OA 1NSGB 2J7PD 3ATPA 3JYHA 3S29A 5JVEA 1YZCA 1VK5A 3A9CA 3B29A 3G4ZA 3HLZA 2EPLX 4ULWA 5E3AA 4H4KC 3MX3A 2GA0A 1TKNA 4MVZA 4BG0A 4ER9A 1E83A 4MNDA 3UMIA 2YL0A 4IWBA 3RIPA 3E9VA 1WOLA 1D0ZA 2XLHA 2TMVP 1XZQA 3TQOA 1LS1A 2Q7RA 3EH2A 2V3CC 1KTMA 1E85A 2LP4A 2O9XA 5A6JA 3KYJA 1D1AA 3U3BA 4AK9A 1WGWA 4YN0B 1VYIA 2ASRA 4DJ9A 2BL2A 1APCA 3UMKA 3NKEA 4DRJB 3EGDA 3WG7C 5JT4A 1RCPA 2CW0F 2JD3A 3EGDB 1DOWA 1ORYA 2YZSA 4OD4A 3IQTA 4K1OA 2MHRA 4OIPF 5KYWB 4XPYA 2IXMA 4JTDB 3ZC4A 2XRHA 2ZPAA 3O39A 3S9OA 1WATA 5CI8A 2OEVA 4IGGA 4ZLCA 5A6AA 2LCHA 2J8WA 2C03A 4RDAA 1D1CA 2NUTA 1Q0MA 1SF8A 3IHUA 4IRUA 5F5FA 4JE9A 2CGEA 3QVZA 4JC7A 3ASNC 3LEOA 3WAQA 2P0NA 4MVMA 1WWPA 3U8PA 3AQBA 1LM3B 4NY3A 3G50A 3N24A 4HFKB 4YT8A 4K7BA 3EGXA 3R7CA 4YL0A 4Q7CA 5BUOA 1GM5A 5CIVA 3EFOA 2HJMA 1M6TA 3AG3C 2HZ8A 1ZU5A 3QTHA 4MW8A 4WJ0A 3F46A 4J30B 1JMWA 4HEAJ 2OEXA 2QUPA 1VTMP 1J8MF 5F5HA 2QE9A 4JJFA 3ABMC 3ASOC 3SZRA 2DB4A 1MMAA 1ORJA 2OOCA 3JRTA 4XLNF 3U2LA 5JUAA 1LIHA 3B0PA 1GS9A 1LE4A 3O55A 2Q00A 2ETSA 3HJCA 2IXNA 3ZQYA 2R9RB 4JIOA 4PK4A 1Z23A 5JSLA 3ZWIA 3QW0A 4IJJA 4HFFB 1KU2A 3TJ5A 4C3BA 4Z9HA 3WHNA 1I4YA 2W9YA 2AU5A 5DLJA 1JOGA 4J7YA 3VAYA 5E2QA 1PV3A 5T3WA 4B6IA 3FHDA 2NUPA 4PJLA 3SNHA 3NG1A 2J9WA 2NUPB 2R25A 1JPJA 3HTKC 4D4XA 1A41A 2QLAA 3M1CB 5FCLA 2ZD9A 3S84A 2QNLA 3LEVA 2XLDA 5B3IA 2R7TA 1TQGA 4M63A 1ZHWA 2FFHA 2AVKA 3DMDA 3DZAA 3ZVRA 5IY5C 4DXWA 1F1MA 2H8AA 4EWCA 4MVSA 3DXJF 1NLXA 1H7IA 3NYJA 2LQGA 4CDYA 1AUEA 1T5OA 2AWYA 2XL6A 4R32A 1YYXA 1TWCA 3DD7A 3GEEA 1U0BB 3L34A 2UUHA 2KNHA 3GODA 5T3TA 1CPQA 3C62A 2P6VA 1RJ9B 2KYHA 2XS8A 5COMA 1PD0A 2YLIA 3BEHA 3JCUQ 5K0IA 3JSZA 2LSEA 3HNLA 2EPNA 4N4WA 3JSEO 2DGJA 4DBQA 1VLSA 2JX0A 1Z7Qc 3DKAA 3FVYA 1YLMA 4O6MA 3VF0A 4BJ6C 4CDVA 3U0CA 1JR8A 4LLEA 2J0WA 4CS8A 5KYXB 4HE8D 3KH2A 2YRFA 1M57C 1MMGA 2XL8A 3T9OA 3O6XA 2Y3BA 3B71A 2HV6A 3ABKC 4CX9A 2PF4E 4JEBA 4XPXA 1I4ZA 3N0TA 2NSFA 1PCXA 4JRZA 3B9QA 4MTOA 2J0XA 2VH3A 3ITFA 4JURI 5FZTA 4CS7A 4ZLDA 3LNMB 2BC5A 2OKUA 2R03A 1YDIA 5KYUB 1SMYF 2GFHA 4XEFA 3NDBB 1FFHA 1TFOB 2R02A 1LI7A 2HSBA 2XL4A 2WZGA 5BQGA 3TJ6A 1M2VA 4G7HF 2EINC 1MMNA 3DM9B 1M2VB 3M15A 4CS9A 4JVSA 1Q0KA 4OINF 1VOMA 4OIQF 5JRAA 3M4BA 2WVOA 1W2WA 1WN0A 2NG1A 1C17M 1OKKD 3AQCA 3K1HA 3B0VC 5EGYA 1NU7D 2OG2A 3NKDA 1SR2A 2E87A 5A6BD 1OKKA 1T01A 2WZLA 2G62A 1T9KA 2FGYA 3HNIA 2KW3C 4E0IA 4Q5SF 3QMKA 3AGUA 1OR2A 2NUTB 3V5XA 2DI3A 4JW1A 1ORSC 3ZSUA 5DQTA 3FDQA 4G7ZF 4CSAC 4I44A 1Z5ZA 2CNWD 3IPMO 1K40A 3H65A 4EBJA 1LVKA 2L6HA 2YQYA 3DWWA 1HE9A 3U9MA 1A7VA 3OEOA 3ZTMA 4DVZA 2QTVA 3OA1A 3S28A 3KMIA 1RKEA 1Q0GA 4XTKA 3RVZA 5AC5A 3J06A 3C18A 3PCVA 1RKEB 5EK0A 3FAJA 2J9VA 4U5GA 4EKWA 2R7OA 4U5CE 2R7SA 1DOVA 2I15A 3AOUA 3CQZA 5KYWA 3DAGA 5D91A 1QZXA 2MWQA 1FAPB 3EJNA 3HKKA 3TK0A 3CSKA 5DS6A 2XM4A 1K04A 4JTCB 3S27A 3C8GA 1XWJA 4PJNA 3SXMA 5D92A 1CGNA 1YA7O 2B0JA 1A0BA 3C8GB 3SEOA 1Z3IX 2Q3TA 3U2MA 3IQCA 4Z9JA 4P9FA 1HW1A 5COFA 2ICWG 3US6A 3RQEA 2YVKA 1O87A 2WZFA 2GDCA 3PMRA 5F28E 5L0GA 4Z9IA 2JPUA 4JCZA 5A6KA 3EPVA 2YWAA 4IARA 4YK5A 4CJGA 1ZHZA 3HNJA 4XEKA 1NG1A 3LNRA 5GPGB 1BR1A 4BEMJ 3MYFA 1LPEA 1B68A 3T6JA 4GYTA 3KPHA 3H2VA 1YAUO 3IQ6A 3S0XA 3RF3A 1ZHTA 4CSAA 2YHSA 3RQFA 3DAFA 1JAFA 1NZEA 4IAOA 1MQVA 4PACA 2PP4A 1QQ3A 3LLKA 2L7AA 3MBGA 4CS8C 1NFOA 1WASA 3RQGA 1OCOC 1TWHA 3DE8A 1U6HA 1HMOA 3FOPA 1ZHXA 1V74B 3EHMA 4IAQA 3LS0A 2R05A 2UUIA 4YT5A 4AL1A 1RJ9A 4RD9A 3F47A 1I5NA 1E86A 3GM2A 3SYNA 3TD7A 5BQIA 3R2PA 3U3FA 3DI5A 2P1AA 1VLTA 3MYIA 3L8IA 2R7QA 4PFPA 1C03A 2L81A 5L0FA 1CPRA 1Z63A 3K66A 1OCZC 3Q6MA 2EILC 2KQ9A 3QW1A 2YKZA 1NBBA 1OXKA 2A68F 1CGOA 1H9TA 4JKVA 5AGFA 4O6NA 1C02A 4XPWA 3GWLA 4LDRA 2F22A 2D4UA 3TULA 1G5ZA 4PJJA 3M79A 4BEJA 3Q7LA 4AE4A 3RW0A 1VYKA 4X0RA 4A4AA 4EUKB 3U5SA 4RBNA 1T6IA 2J7PA 4FESA 4YL3A 5A69A 4IB4A 3UGPA 1RMVA 1BDJB 3AG1C 3ZIBA 2YL3A 2GWWA 2LFFA 3NMKA 3LLIA 4XLPF 1YA9A 4U5DE 4XWJA 4DRHB 1OW6A 2YLDA 2YLGA 1EKYA 1QSPA 1LS4A 1ZYRF 2V26A 3FOOA 3JRMO 2DYSC 4YT2A 3B0UX 3LJBA 2R7XA 1FMVA 2Y3HA 1HW2A 4GEHA 5TJ5E 4QI2A 3EGXB 2Q4FA 3LS1A 3V7OA 1EA8A 4KNWA 3W2WA 4BJ6A 4O7GA 5L3QA 2OU6A 4G78A 1VB5A 1NFNA 3NRHA 5HSWA 3E70C 3SXKA 2KGOA 2NPUA 3FMSA 3ZG1A 1J8YF 2XM0A 1G4WR 4J7TA 3MFNA 2IM8A 2VCCA 4BJTA 3NMIA 4XQ1A 3JT1A 1MNDA 1NU9C 4FAPB 3BRJA 1YYJA 2G3VA 2AP3A 3KYIA 3UR3C 3X1OA 1T6QA 3S90A 1JRAA 3AG2C 4LDQA 4XEVA 5B1BC 2G3KA 4CIHA 1OXBA 2GAQA 3LESA 2HMZA 1A7DA 5JLIA 1HE1A 2NSGA 5KYYB 2YL1A 1OW8A 3W8HA 2PBEA 4N06A 1H9GA 1O5HA 4MVQA 1YZAA 5KYYA 4JEAA 3OWTA 4W8KA 4LERA 4U5BE 2EPMX 2P7VA 1UG7A 4C3DA 1JPNA 3DM5A 4O6YA 3T6BA 4FX5A 4OIRF 1YJGA 2LD6A 2EPOA 3IEEA 4JTAB 2Q9AA 2EIJC 1O3UA 1CGME 1ZHYA 2WVNA 3VM6A 4DRIB 1LI5A 4E18A 4E0HA 4YJWA 4E7ZA 4F4BA 1BR4A 3UGOA 2EIMC 4YWQA 4J32B 3K6BA 1SYQA 5DVWA 1T6UA 3GWNA 2X0CA 2XS1A 3N2ZB 3V5ZA 4YT4A 2KSFA 2C04A 4MW3A 2Y3DA 4KBLA 2HMQA 1R4TA 1N1CA 3V5YA 4MVOA 2IOQA 2HUJA 2QY9A 2Y69C 5AC4A 1Q0FA 3AJMA 2R7UA 3RKOF 3K33A 2MYSA 2ZXPA 3DJNB 3ECSA 1SZIA 1EI7A 1OR3A 3GM3A 3T4RA 2IXPA 3QVYA 2FAPB 3RH3A 2OCCC 2OJQA 4I1OB 4JZAA 1UFBA 4D4NA 3EQLF 2KK1A 1MNEA 1BR2A 2Q9CA 3EH1A 3GANA 3I5QA 5DS4A 2IXOA 5JS5A 1OW7A 1OQCA 2W45A 2XLOA 3EHNA 3WODF 5L0DA 1V55C 1Z6AA 3UNGC 4UDVA 1MMDA 2ZXRA 2IBFA 3POVA 3MLGA 4G0HA 2XLEA 5E33A 1EQ1A 5L0HA 4PR9A 2YL7A 4CBEA 4DOZA 1BZ4A 1QPUA 2VC9A 1L7CA 3LAYA 4P6IC 4K0DA 1K05A 3T6GB 3VYWA 4CJOA 1FR0A 2WVQA 5KYUA 1KNYA 1V54C 4W8PA 4O79A 4MTGA 3A11A 3EG9A 1GQAA 3SXYA 4BPMA 2ZXOA 2XXAB 3EG9B 3Q6NA 2L9JA 2R7VA 1TR2A 2LK4A 2XXAA 2KC3A 2HSQA 3AG4C 1LKXA 3EZHA 2H7OA 1L3PA 2IYLD 4EBKA 1ZVZA 1WTYA 1PD1A 3KKBA 2W4MA 4P9TA 5HV9A 3FAPB 3GORA 4CIPA 1D0YA 1V4AA 2PX0A 2HV7A 2LIGA 2Z15A 4MVRA 4NC3A 3U8VA 4GQHA 2EPKX 3RVYA 4YL1A 3W2VA 3ZTZA 1LE2A 2CYDA 3K1IC 2HS5A 4DBRA 3JZ0A 4MS2A 4NTFA 2HJ3A 4LLCA 4JJGA 4BJ5C 1AEPA 2XLWA 2HFIA 3GM1A 3L0IA 1BBHA 1OCRC 1D1BA 1FTSA 3SXZA 1QVXA 3NMJA 1M56C 2VCBA 1VMAA 2PNOA 4U5EE 3TOMA 3VRCA 3W8IA 4EHPA 4MVUA 3EFOB 4U9EA 5E3CA 5COGA 4JCHA 4AX2A
chains in the Genus database with same CATH topology
1C02A 1SR2A 3IQTA 1TQGA 4PACA 1FR0A 2A0BA 1A0BA 2LCHA 4EUKB 3KYIA 3US6A 1YVIA 1BDJB 1OXBA 1I5NA 2LP4A 3KYJA 1QSPA 3U3BA 1C03A 2R25A 3MYFA 2Q4FA 1WN0A 1OXKA 2LD6A 4G78A 1Y6DA 2OOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C02 A;  1SR2 A;  3IQT A;  1TQG A;  4PAC A;  1FR0 A;  2A0B A;  1A0B A;  2LCH A;  4EUK B;  3KYI A;  3US6 A;  1YVI A;  1BDJ B;  1OXB A;  1I5N A;  2LP4 A;  3KYJ A;  1QSP A;  3U3B A;  1C03 A;  2R25 A;  3MYF A;  2Q4F A;  1WN0 A;  1OXK A;  2LD6 A;  4G78 A;  1Y6D A;  2OOC A; 
#chains in the Genus database with same CATH topology
 4NQF A;  3I4U A;  5JP7 A;  3JTL O;  3ZQV A;  4LDK A;  4AE4 B;  2KJG A;  5EHH A;  4I3M A;  2CCY A;  2CNW A;  3U9J A;  3NYM A;  4NTB A;  4H54 A;  4QDL A;  3C8G D;  4U5F E;  4E17 A;  2R7R A;  1HMD A;  3FXH A;  3QZC A;  3CZ6 A;  2BE5 F;  2B0H A;  4N6C A;  2WB7 A;  1QLE C;  2Q9B A;  1YVI A;  2DYR C;  2J46 A;  1TFK B;  3LUT B;  2J9U A;  5B1A C;  2WL8 A;  2Y39 A;  2YEV A;  4DVY P;  4I1M A;  5L0I A;  3HNK A;  3Q7G A;  4NCQ A;  3RFY A;  4AL0 A;  1G8X A;  2A0U A;  2J9B A;  4KC9 A;  4EBB A;  3G4X A;  2ZXW C;  5DS5 A;  2PX3 A;  4WAB A;  3L1M A;  3M4C A;  4BJ1 A;  2LFD A;  4U9D A;  3UMH A;  1H6G A;  4C3E A;  1Y6D A;  1OCC C;  1YAR O;  1ZW2 A;  2VCA A;  5DQZ A;  1FMW A;  2L6G A;  5L0J A;  4G7O F;  4N6H A;  5L3V A;  3NYL A;  4OD5 A;  1XZP A;  256B A;  1ST6 A;  2A0B A;  2RD9 A;  3AGT A;  4BJ5 A;  2RSE B;  2A6H F;  2M4E A;  1ZZP A;  3CAX A;  4ULV A;  2XLV A;  2CDQ A;  3GEH A;  4OIO F;  3C7J A;  5B3S C;  4KNV A;  1GGQ A;  1RKC A;  2A6E F;  2M64 A;  4MTF A;  1IZM A;  3H2U A;  3C8Z A;  2A69 F;  1A7E A;  1IW7 F;  3K7D A;  2X51 A;  3GEI A;  4L6R A;  1AVO B;  2AWC A;  3IQ5 A;  4QI0 A;  5L0C A;  1TWG A;  3SP1 A;  3W4Y A;  1RXQ A;  1ZW3 A;  2J45 A;  2L6F A;  5BQH A;  1U89 A;  4Q4Z F;  3ZDL A;  2OQM A;  3TOL A;  5KYN A;  5CI9 A;  4WGY A;  2XSE A;  4A2N B;  2P61 A;  2XLM A;  4LAC B;  4KI2 A;  1QKR A;  1S7Z A;  2H7V C;  4NTA A;  2W4B A;  1ZU4 A;  1R5I D;  4MQ9 F;  2R7W A;  4ANJ A;  2VAS A;  3PHF 2;  4E7S A;  1G4U S;  1Y4C A;  2OJE D;  1HY5 A;  3ABL C;  2I8B A;  3DE9 A;  3PDM P;  2PFD A;  3C63 A;  3O10 A;  1TWA A;  4PJM A;  4EIY A;  4FWV A;  1S05 A;  3K1I A;  3X2Q C;  4WGZ A;  2A1D D;  1Q0D A;  3CEX A;  2EIK C;  2VB6 A;  1E2X A;  3DJU B;  1FFT C;  4C7O B;  3JYY A;  3L8J A;  2D5R B;  4C7O A;  1D0X A;  3KL4 A;  1FNT c;  3EZI A;  3I5P A;  4ONS A;  2Y3G A;  4U5H A;  1E84 A;  5A6B A;  5KYX A;  4CS9 C;  4CDA A;  5T1D B;  3RYL A;  2H7B A;  2HKV A;  4PFO A;  1M2O A;  1NSG B;  2J7P D;  3ATP A;  3JYH A;  3S29 A;  5JVE A;  1YZC A;  1VK5 A;  3A9C A;  3B29 A;  3G4Z A;  3HLZ A;  2EPL X;  4ULW A;  5E3A A;  4H4K C;  3MX3 A;  2GA0 A;  1TKN A;  4MVZ A;  4BG0 A;  4ER9 A;  1E83 A;  4MND A;  3UMI A;  2YL0 A;  4IWB A;  3RIP A;  3E9V A;  1WOL A;  1D0Z A;  2XLH A;  2TMV P;  1XZQ A;  3TQO A;  1LS1 A;  2Q7R A;  3EH2 A;  2V3C C;  1KTM A;  1E85 A;  2LP4 A;  2O9X A;  5A6J A;  3KYJ A;  1D1A A;  3U3B A;  4AK9 A;  1WGW A;  4YN0 B;  1VYI A;  2ASR A;  4DJ9 A;  2BL2 A;  1APC A;  3UMK A;  3NKE A;  4DRJ B;  3EGD A;  3WG7 C;  5JT4 A;  1RCP A;  2CW0 F;  2JD3 A;  3EGD B;  1DOW A;  1ORY A;  2YZS A;  4OD4 A;  3IQT A;  4K1O A;  2MHR A;  4OIP F;  5KYW B;  4XPY A;  2IXM A;  4JTD B;  3ZC4 A;  2XRH A;  2ZPA A;  3O39 A;  3S9O A;  1WAT A;  5CI8 A;  2OEV A;  4IGG A;  4ZLC A;  5A6A A;  2LCH A;  2J8W A;  2C03 A;  4RDA A;  1D1C A;  2NUT A;  1Q0M A;  1SF8 A;  3IHU A;  4IRU A;  5F5F A;  4JE9 A;  2CGE A;  3QVZ A;  4JC7 A;  3ASN C;  3LEO A;  3WAQ A;  2P0N A;  4MVM A;  1WWP A;  3U8P A;  3AQB A;  1LM3 B;  4NY3 A;  3G50 A;  3N24 A;  4HFK B;  4YT8 A;  4K7B A;  3EGX A;  3R7C A;  4YL0 A;  4Q7C A;  5BUO A;  1GM5 A;  5CIV A;  3EFO A;  2HJM A;  1M6T A;  3AG3 C;  2HZ8 A;  1ZU5 A;  3QTH A;  4MW8 A;  4WJ0 A;  3F46 A;  4J30 B;  1JMW A;  4HEA J;  2OEX A;  2QUP A;  1VTM P;  1J8M F;  5F5H A;  2QE9 A;  4JJF A;  3ABM C;  3ASO C;  3SZR A;  2DB4 A;  1MMA A;  1ORJ A;  2OOC A;  3JRT A;  4XLN F;  3U2L A;  5JUA A;  1LIH A;  3B0P A;  1GS9 A;  1LE4 A;  3O55 A;  2Q00 A;  2ETS A;  3HJC A;  2IXN A;  3ZQY A;  2R9R B;  4JIO A;  4PK4 A;  1Z23 A;  5JSL A;  3ZWI A;  3QW0 A;  4IJJ A;  4HFF B;  1KU2 A;  3TJ5 A;  4C3B A;  4Z9H A;  3WHN A;  1I4Y A;  2W9Y A;  2AU5 A;  5DLJ A;  1JOG A;  4J7Y A;  3VAY A;  5E2Q A;  1PV3 A;  5T3W A;  4B6I A;  3FHD A;  2NUP A;  4PJL A;  3SNH A;  3NG1 A;  2J9W A;  2NUP B;  2R25 A;  1JPJ A;  3HTK C;  4D4X A;  1A41 A;  2QLA A;  3M1C B;  5FCL A;  2ZD9 A;  3S84 A;  2QNL A;  3LEV A;  2XLD A;  5B3I A;  2R7T A;  1TQG A;  4M63 A;  1ZHW A;  2FFH A;  2AVK A;  3DMD A;  3DZA A;  3ZVR A;  5IY5 C;  4DXW A;  1F1M A;  2H8A A;  4EWC A;  4MVS A;  3DXJ F;  1NLX A;  1H7I A;  3NYJ A;  2LQG A;  4CDY A;  1AUE A;  1T5O A;  2AWY A;  2XL6 A;  4R32 A;  1YYX A;  1TWC A;  3DD7 A;  3GEE A;  1U0B B;  3L34 A;  2UUH A;  2KNH A;  3GOD A;  5T3T A;  1CPQ A;  3C62 A;  2P6V A;  1RJ9 B;  2KYH A;  2XS8 A;  5COM A;  1PD0 A;  2YLI A;  3BEH A;  3JCU Q;  5K0I A;  3JSZ A;  2LSE A;  3HNL A;  2EPN A;  4N4W A;  3JSE O;  2DGJ A;  4DBQ A;  1VLS A;  2JX0 A;  1Z7Q c;  3DKA A;  3FVY A;  1YLM A;  4O6M A;  3VF0 A;  4BJ6 C;  4CDV A;  3U0C A;  1JR8 A;  4LLE A;  2J0W A;  4CS8 A;  5KYX B;  4HE8 D;  3KH2 A;  2YRF A;  1M57 C;  1MMG A;  2XL8 A;  3T9O A;  3O6X A;  2Y3B A;  3B71 A;  2HV6 A;  3ABK C;  4CX9 A;  2PF4 E;  4JEB A;  4XPX A;  1I4Z A;  3N0T A;  2NSF A;  1PCX A;  4JRZ A;  3B9Q A;  4MTO A;  2J0X A;  2VH3 A;  3ITF A;  4JUR I;  5FZT A;  4CS7 A;  4ZLD A;  3LNM B;  2BC5 A;  2OKU A;  2R03 A;  1YDI A;  5KYU B;  1SMY F;  2GFH A;  4XEF A;  3NDB B;  1FFH A;  1TFO B;  2R02 A;  1LI7 A;  2HSB A;  2XL4 A;  2WZG A;  5BQG A;  3TJ6 A;  1M2V A;  4G7H F;  2EIN C;  1MMN A;  3DM9 B;  1M2V B;  3M15 A;  4CS9 A;  4JVS A;  1Q0K A;  4OIN F;  1VOM A;  4OIQ F;  5JRA A;  3M4B A;  2WVO A;  1W2W A;  1WN0 A;  2NG1 A;  1C17 M;  1OKK D;  3AQC A;  3K1H A;  3B0V C;  5EGY A;  1NU7 D;  2OG2 A;  3NKD A;  1SR2 A;  2E87 A;  5A6B D;  1OKK A;  1T01 A;  2WZL A;  2G62 A;  1T9K A;  2FGY A;  3HNI A;  2KW3 C;  4E0I A;  4Q5S F;  3QMK A;  3AGU A;  1OR2 A;  2NUT B;  3V5X A;  2DI3 A;  4JW1 A;  1ORS C;  3ZSU A;  5DQT A;  3FDQ A;  4G7Z F;  4CSA C;  4I44 A;  1Z5Z A;  2CNW D;  3IPM O;  1K40 A;  3H65 A;  4EBJ A;  1LVK A;  2L6H A;  2YQY A;  3DWW A;  1HE9 A;  3U9M A;  1A7V A;  3OEO A;  3ZTM A;  4DVZ A;  2QTV A;  3OA1 A;  3S28 A;  3KMI A;  1RKE A;  1Q0G A;  4XTK A;  3RVZ A;  5AC5 A;  3J06 A;  3C18 A;  3PCV A;  1RKE B;  5EK0 A;  3FAJ A;  2J9V A;  4U5G A;  4EKW A;  2R7O A;  4U5C E;  2R7S A;  1DOV A;  2I15 A;  3AOU A;  3CQZ A;  5KYW A;  3DAG A;  5D91 A;  1QZX A;  2MWQ A;  1FAP B;  3EJN A;  3HKK A;  3TK0 A;  3CSK A;  5DS6 A;  2XM4 A;  1K04 A;  4JTC B;  3S27 A;  3C8G A;  1XWJ A;  4PJN A;  3SXM A;  5D92 A;  1CGN A;  1YA7 O;  2B0J A;  1A0B A;  3C8G B;  3SEO A;  1Z3I X;  2Q3T A;  3U2M A;  3IQC A;  4Z9J A;  4P9F A;  1HW1 A;  5COF A;  2ICW G;  3US6 A;  3RQE A;  2YVK A;  1O87 A;  2WZF A;  2GDC A;  3PMR A;  5F28 E;  5L0G A;  4Z9I A;  2JPU A;  4JCZ A;  5A6K A;  3EPV A;  2YWA A;  4IAR A;  4YK5 A;  4CJG A;  1ZHZ A;  3HNJ A;  4XEK A;  1NG1 A;  3LNR A;  5GPG B;  1BR1 A;  4BEM J;  3MYF A;  1LPE A;  1B68 A;  3T6J A;  4GYT A;  3KPH A;  3H2V A;  1YAU O;  3IQ6 A;  3S0X A;  3RF3 A;  1ZHT A;  4CSA A;  2YHS A;  3RQF A;  3DAF A;  1JAF A;  1NZE A;  4IAO A;  1MQV A;  4PAC A;  2PP4 A;  1QQ3 A;  3LLK A;  2L7A A;  3MBG A;  4CS8 C;  1NFO A;  1WAS A;  3RQG A;  1OCO C;  1TWH A;  3DE8 A;  1U6H A;  1HMO A;  3FOP A;  1ZHX A;  1V74 B;  3EHM A;  4IAQ A;  3LS0 A;  2R05 A;  2UUI A;  4YT5 A;  4AL1 A;  1RJ9 A;  4RD9 A;  3F47 A;  1I5N A;  1E86 A;  3GM2 A;  3SYN A;  3TD7 A;  5BQI A;  3R2P A;  3U3F A;  3DI5 A;  2P1A A;  1VLT A;  3MYI A;  3L8I A;  2R7Q A;  4PFP A;  1C03 A;  2L81 A;  5L0F A;  1CPR A;  1Z63 A;  3K66 A;  1OCZ C;  3Q6M A;  2EIL C;  2KQ9 A;  3QW1 A;  2YKZ A;  1NBB A;  1OXK A;  2A68 F;  1CGO A;  1H9T A;  4JKV A;  5AGF A;  4O6N A;  1C02 A;  4XPW A;  3GWL A;  4LDR A;  2F22 A;  2D4U A;  3TUL A;  1G5Z A;  4PJJ A;  3M79 A;  4BEJ A;  3Q7L A;  4AE4 A;  3RW0 A;  1VYK A;  4X0R A;  4A4A A;  4EUK B;  3U5S A;  4RBN A;  1T6I A;  2J7P A;  4FES A;  4YL3 A;  5A69 A;  4IB4 A;  3UGP A;  1RMV A;  1BDJ B;  3AG1 C;  3ZIB A;  2YL3 A;  2GWW A;  2LFF A;  3NMK A;  3LLI A;  4XLP F;  1YA9 A;  4U5D E;  4XWJ A;  4DRH B;  1OW6 A;  2YLD A;  2YLG A;  1EKY A;  1QSP A;  1LS4 A;  1ZYR F;  2V26 A;  3FOO A;  3JRM O;  2DYS C;  4YT2 A;  3B0U X;  3LJB A;  2R7X A;  1FMV A;  2Y3H A;  1HW2 A;  4GEH A;  5TJ5 E;  4QI2 A;  3EGX B;  2Q4F A;  3LS1 A;  3V7O A;  1EA8 A;  4KNW A;  3W2W A;  4BJ6 A;  4O7G A;  5L3Q A;  2OU6 A;  4G78 A;  1VB5 A;  1NFN A;  3NRH A;  5HSW A;  3E70 C;  3SXK A;  2KGO A;  2NPU A;  3FMS A;  3ZG1 A;  1J8Y F;  2XM0 A;  1G4W R;  4J7T A;  3MFN A;  2IM8 A;  2VCC A;  4BJT A;  3NMI A;  4XQ1 A;  3JT1 A;  1MND A;  1NU9 C;  4FAP B;  3BRJ A;  1YYJ A;  2G3V A;  2AP3 A;  3KYI A;  3UR3 C;  3X1O A;  1T6Q A;  3S90 A;  1JRA A;  3AG2 C;  4LDQ A;  4XEV A;  5B1B C;  2G3K A;  4CIH A;  1OXB A;  2GAQ A;  3LES A;  2HMZ A;  1A7D A;  5JLI A;  1HE1 A;  2NSG A;  5KYY B;  2YL1 A;  1OW8 A;  3W8H A;  2PBE A;  4N06 A;  1H9G A;  1O5H A;  4MVQ A;  1YZA A;  5KYY A;  4JEA A;  3OWT A;  4W8K A;  4LER A;  4U5B E;  2EPM X;  2P7V A;  1UG7 A;  4C3D A;  1JPN A;  3DM5 A;  4O6Y A;  3T6B A;  4FX5 A;  4OIR F;  1YJG A;  2LD6 A;  2EPO A;  3IEE A;  4JTA B;  2Q9A A;  2EIJ C;  1O3U A;  1CGM E;  1ZHY A;  2WVN A;  3VM6 A;  4DRI B;  1LI5 A;  4E18 A;  4E0H A;  4YJW A;  4E7Z A;  4F4B A;  1BR4 A;  3UGO A;  2EIM C;  4YWQ A;  4J32 B;  3K6B A;  1SYQ A;  5DVW A;  1T6U A;  3GWN A;  2X0C A;  2XS1 A;  3N2Z B;  3V5Z A;  4YT4 A;  2KSF A;  2C04 A;  4MW3 A;  2Y3D A;  4KBL A;  2HMQ A;  1R4T A;  1N1C A;  3V5Y A;  4MVO A;  2IOQ A;  2HUJ A;  2QY9 A;  2Y69 C;  5AC4 A;  1Q0F A;  3AJM A;  2R7U A;  3RKO F;  3K33 A;  2MYS A;  2ZXP A;  3DJN B;  3ECS A;  1SZI A;  1EI7 A;  1OR3 A;  3GM3 A;  3T4R A;  2IXP A;  3QVY A;  2FAP B;  3RH3 A;  2OCC C;  2OJQ A;  4I1O B;  4JZA A;  1UFB A;  4D4N A;  3EQL F;  2KK1 A;  1MNE A;  1BR2 A;  2Q9C A;  3EH1 A;  3GAN A;  3I5Q A;  5DS4 A;  2IXO A;  5JS5 A;  1OW7 A;  1OQC A;  2W45 A;  2XLO A;  3EHN A;  3WOD F;  5L0D A;  1V55 C;  1Z6A A;  3UNG C;  4UDV A;  1MMD A;  2ZXR A;  2IBF A;  3POV A;  3MLG A;  4G0H A;  2XLE A;  5E33 A;  1EQ1 A;  5L0H A;  4PR9 A;  2YL7 A;  4CBE A;  4DOZ A;  1BZ4 A;  1QPU A;  2VC9 A;  1L7C A;  3LAY A;  4P6I C;  4K0D A;  1K05 A;  3T6G B;  3VYW A;  4CJO A;  1FR0 A;  2WVQ A;  5KYU A;  1KNY A;  1V54 C;  4W8P A;  4O79 A;  4MTG A;  3A11 A;  3EG9 A;  1GQA A;  3SXY A;  4BPM A;  2ZXO A;  2XXA B;  3EG9 B;  3Q6N A;  2L9J A;  2R7V A;  1TR2 A;  2LK4 A;  2XXA A;  2KC3 A;  2HSQ A;  3AG4 C;  1LKX A;  3EZH A;  2H7O A;  1L3P A;  2IYL D;  4EBK A;  1ZVZ A;  1WTY A;  1PD1 A;  3KKB A;  2W4M A;  4P9T A;  5HV9 A;  3FAP B;  3GOR A;  4CIP A;  1D0Y A;  1V4A A;  2PX0 A;  2HV7 A;  2LIG A;  2Z15 A;  4MVR A;  4NC3 A;  3U8V A;  4GQH A;  2EPK X;  3RVY A;  4YL1 A;  3W2V A;  3ZTZ A;  1LE2 A;  2CYD A;  3K1I C;  2HS5 A;  4DBR A;  3JZ0 A;  4MS2 A;  4NTF A;  2HJ3 A;  4LLC A;  4JJG A;  4BJ5 C;  1AEP A;  2XLW A;  2HFI A;  3GM1 A;  3L0I A;  1BBH A;  1OCR C;  1D1B A;  1FTS A;  3SXZ A;  1QVX A;  3NMJ A;  1M56 C;  2VCB A;  1VMA A;  2PNO A;  4U5E E;  3TOM A;  3VRC A;  3W8I A;  4EHP A;  4MVU A;  3EFO B;  4U9E A;  5E3C A;  5COG A;  4JCH A;  4AX2 A; 
#chains in the Genus database with same CATH homology
 1C02 A;  1SR2 A;  3IQT A;  1TQG A;  4PAC A;  1FR0 A;  2A0B A;  1A0B A;  2LCH A;  4EUK B;  3KYI A;  3US6 A;  1YVI A;  1BDJ B;  1OXB A;  1I5N A;  2LP4 A;  3KYJ A;  1QSP A;  3U3B A;  1C03 A;  2R25 A;  3MYF A;  2Q4F A;  1WN0 A;  1OXK A;  2LD6 A;  4G78 A;  1Y6D A;  2OOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...