1TQGA

Chea phosphotransferase domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
105
structure length
105
Chain Sequence
b'GSHMEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheA
publication title Helical Shifts Generate Two Distinct Conformers in the Atomic Resolution Structure of the CheA Phosphotransferase Domain from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 48
structure length 105
sequence length 105
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1tqgA00
1OXKA 1QSPA 1C03A 3KYJA 2LD6A 2R25A 1FR0A 1TQGA 1WN0A 4PACA 2LCHA 1C02A 1A0BA 1SR2A 3IQTA 4G78A 3US6A 3MYFA 1Y6DA 4EUKB 2A0BA 1I5NA 1YVIA 2Q4FA 3KYIA 2OOCA 3U3BA 1OXBA 1BDJB 2LP4A
chains in the Genus database with same CATH superfamily
3J06A 2HFIA 3H2UA 3NKDA 4AE4B 2KYHA 4C3BA 1TFOB 1AVOB 1XWJA 1Q0GA 2M4EA 2QNLA 1WWPA 5E3CA 3TJ5A 2P7VA 4CDVA 4EWCA 3PHF2 5B1AC 2KNHA 1YLMA 3JRTA 1PCXA 3AG1C 3O6XA 3VYWA 2ZXOA 1J8MF 5T1DB 1EA8A 1Q0DA 4IARA 4LDQA 1ORSC 4U9EA 2ZD9A 4XLPF 2XXAB 3CAXA 5F28E 3GEIA 2YQYA 3B0PA 2TMVP 1JPJA 1LIHA 2LSEA 1V4AA 2ZXRA 4BJ5C 2WVNA 1JRAA 3DWWA 2XM0A 3PCVA 4JEAA 4CX9A 1AEPA 3HNLA 3QW1A 3I5PA 5KYYB 1D1AA 1H6GA 4IGGA 2NUPA 2Q7RA 3U3BA 1LM3B 2UUHA 3HNKA 2PBEA 3LJBA 1ZU5A 3ZDLA 1VYIA 3Q7GA 3IEEA 1RXQA 2ICWG 2ETSA 2YL1A 1TWCA 3Q7LA 2WZGA 3TD7A 5AC4A 3U2LA 4RBNA 3NYJA 4YWQA 3GM1A 4I1OB 2W4MA 4XPYA 3NMKA 2NG1A 3LLIA 5DLJA 3EG9B 5E2QA 2XL8A 3O55A 2MWQA 2V26A 4DBQA 1F1MA 3L0IA 1U0BB 3DAGA 3ZVRA 3EJNA 2XL6A 3G50A 5FZTA 4N6HA 4U5CE 1VMAA 1OW7A 3GM3A 2MYSA 5E33A 4EUKB 4C3DA 1L3PA 1B68A 3S84A 1T9KA 4AL1A 1Q0MA 2R02A 2R7QA 3IQ5A 3NYLA 4MVMA 4WJ0A 3HKKA 2VC9A 2XLHA 5L0JA 2L6HA 3EGDA 4FWVA 2HUJA 3HNIA 1W2WA 2Y3HA 3M1CB 1OXBA 1Z23A 3V5ZA 1YA9A 2GFHA 2AWCA 2P6VA 1Z5ZA 3JT1A 3RQEA 1ZHXA 1ZHZA 5KYWB 2YHSA 3GWLA 1OKKD 5B3SC 1R4TA 2VCAA 2YZSA 2GDCA 1RKEA 1WASA 2L7AA 1TFKB 3FXHA 2CGEA 1Z7Qc 5AC5A 2FGYA 3MYIA 1ZW3A 2J8WA 2XLOA 1SR2A 2HMQA 2YLDA 3DE9A 2Y3DA 3AGTA 3Q6MA 4IB4A 3W2WA 3DD7A 5JUAA 3CEXA 3H65A 4G78A 1D0XA 4J7TA 4D4NA 3MX3A 4KI2A 3FHDA 3TOLA 3C8GA 3N2ZB 2EIMC 2CNWD 4OINF 3K33A 1LS4A 3RFYA 5KYUA 5KYXA 1NFOA 2YWAA 1V74B 3K66A 3ZQVA 3GWNA 4EBJA 3EFOA 1ZU4A 3O39A 4OIPF 3A11A 1VYKA 4I3MA 2E87A 1OXKA 5AGFA 3S90A 1R5ID 5DQZA 5A6BD 2IBFA 1K40A 4NC3A 4LDKA 1C03A 1VLSA 2CCYA 2KC3A 3RYLA 2LD6A 2HJMA 2XLMA 2D4UA 5B3IA 4CS8A 3S29A 5D91A 2GAQA 4JJFA 1KU2A 2EPNA 1FMVA 2NUPB 2J9VA 4G7ZF 4FX5A 2PFDA 2A68F 4KC9A 3AQCA 3I5QA 2J9WA 1LI7A 1BBHA 3LEVA 1O3UA 2OJED 2HJ3A 1XZQA 4X0RA 4BJ1A 4JTDB 2V3CC 2CDQA 1YDIA 5JT4A 1MMGA 2XS8A 4U5FE 4CDYA 4YT8A 1QZXA 2Q9CA 3GORA 2CW0F 3WAQA 4JIOA 2LFDA 1T6UA 2IYLD 1WATA 1O87A 4GEHA 1YA7O 3RF3A 3FVYA 3LNMB 4OIRF 4N06A 2IXOA 4ZLCA 3S9OA 4G7OF 1ORJA 5FCLA 4JVSA 1T01A 2XLEA 4JKVA 5IY5C 1V54C 1WTYA 1Q0FA 3C7JA 3EQLF 3VM6A 3HJCA 3U0CA 1OW8A 3M79A 4LLCA 5D92A 1JPNA 4ER9A 2HZ8A 5CIVA 1GGQA 3UR3C 2R03A 1CGME 4U5EE 3NYMA 2LCHA 2YL7A 2MHRA 4HFKB 4LDRA 1U89A 1EKYA 4J30B 4JCHA 3QMKA 2RSEB 3IQTA 3R2PA 2R7RA 4QDLA 4ANJA 3A9CA 2VCCA 3OA1A 4ULWA 1MNDA 3AJMA 3HTKC 4XPWA 1TKNA 2W9YA 1QKRA 1E85A 3KPHA 1BR4A 1OCZC 1RKEB 2KJGA 2XRHA 2OKUA 3T9OA 2H8AA 1WOLA 4PJMA 3WHNA 3RQGA 2G3KA 2XLWA 5COMA 2OQMA 1U6HA 3C8GB 1TR2A 3H2VA 1PD1A 3KYJA 2KK1A 4N6CA 4YL0A 1D0ZA 4CS8C 4K1OA 5KYUB 4K7BA 5KYXB 5BQHA 4Z9JA 2HV6A 3EFOB 4PACA 4J32B 4JE9A 1DOWA 3JSZA 4IRUA 2YRFA 2C03A 3TULA 2B0HA 1Z6AA 3EGXA 2KW3C 4JRZA 2PNOA 4C3EA 5L0IA 1RJ9B 1E2XA 3R7CA 3M4BA 2EPMX 2HKVA 4HE8D 3SXKA 4KNVA 3U5SA 3X2QC 3SXYA 1FAPB 4W8KA 5A69A 3C62A 4U9DA 3LNRA 4MVRA 4MQ9F 3JYYA 4Q4ZF 2LP4A 4P9TA 3RQFA 3TOMA 5F5HA 2B0JA 3CZ6A 1NSGB 4PFPA 3AG2C 5COFA 3V5YA 1RMVA 4F4BA 1ZW2A 2R25A 2JD3A 3LLKA 4O6YA 1HW1A 3QVZA 2J0WA 2JX0A 2YL3A 1E86A 4LLEA 4K0DA 4JTAB 3DE8A 3M15A 3IPMO 4YK5A 5L3VA 1FTSA 3K1IA 1S7ZA 2IXMA 1DOVA 1M6TA 2EILC 2QUPA 2H7VC 2NUTB 3EH1A 1I4YA 3U9JA 1UFBA 2DYSC 2NPUA 2WZFA 3ZG1A 4CS7A 1Z63A 3PMRA 1XZPA 2J7PA 5L0CA 2O9XA 1CPRA 1JAFA 3ASOC 4JC7A 4FAPB 1T6QA 1NG1A 3KL4A 2XS1A 2WVOA 2IOQA 1UG7A 1HMDA 4DVYP 5EHHA 4KNWA 4MW3A 2LK4A 3AG3C 4A2NB 4I1MA 1QQ3A 1J8YF 3KKBA 3RH3A 3AGUA 4BJ6A 2OU6A 3IHUA 4P6IC 2DI3A 1SF8A 2Q3TA 2P0NA 4LERA 3TQOA 4HEAJ 4OIOF 5TJ5E 2FAPB 1QPUA 2H7BA 1RKCA 1PV3A 2R05A 1YZAA 3E9VA 1YYXA 1TWGA 4PJNA 4QI0A 2J9UA 2KGOA 3C8GD 3US6A 4MNDA 1FFTC 1VOMA 4NQFA 4BEJA 1LKXA 1LPEA 2QY9A 1QVXA 1A7VA 4XWJA 2WZLA 3POVA 3RVZA 1I5NA 4IJJA 5A6KA 5KYNA 5DS5A 1K05A 3DZAA 4GYTA 4NTFA 4AX2A 3W2VA 1NFNA 2DGJA 1GQAA 3FOOA 4LACB 3FDQA 2LIGA 3L8IA 3DXJF 4JW1A 3VF0A 1MMDA 2NSFA 3SZRA 3JZ0A 1I4ZA 1NU9C 4PR9A 1OR3A 2F22A 3ABKC 3QTHA 3V5XA 1D0YA 1BR1A 3IQ6A 4YL1A 1LE4A 3LS1A 3HNJA 2I8BA 4YT2A 2DYRC 3M4CA 3T4RA 3LS0A 1YJGA 2ZPAA 1A0BA 3DKAA 3DAFA 3K1IC 2R7VA 1PD0A 2PX3A 4OD5A 2C04A 2XM4A 1OQCA 4EBKA 2EIKC 3LAYA 3DMDA 5BQGA 1H7IA 2RD9A 1OCOC 3NMJA 2J0XA 3JCUQ 2ASRA 3ZTMA 4MVOA 1LVKA 5CI8A 2OJQA 3IQCA 4H4KC 4UDVA 3UGPA 5A6AA 1A41A 2XXAA 3ATPA 3F46A 2M64A 2OCCC 1BDJB 4DRHB 4BJ6C 2EIJC 2LQGA 4U5DE 4MVSA 1HMOA 1N1CA 2VASA 5A6BA 1VB5A 3X1OA 2JPUA 2Q00A 2D5RB 4CSAA 5CI9A 1VTMP 3K7DA 4OIQF 1L7CA 1C17M 1NZEA 3B9QA 2PX0A 1T5OA 3JTLO 4MVUA 3C63A 4MS2A 2R7WA 4QI2A 2YEVA 3EGDB 4U5HA 3HLZA 4EHPA 3GEEA 4XTKA 2EPKX 4YT5A 2EPOA 2WB7A 2BL2A 4DRJB 1Y6DA 2R9RB 3E70C 3ECSA 1ZVZA 4P9FA 2ZXWC 3S27A 1VLTA 1E84A 4PJLA 4JTCB 3U8PA 4EIYA 2G62A 3JSEO 2PP4A 1BZ4A 3NMIA 1IW7F 4IWBA 1JR8A 1YYJA 5L0GA 3T6GB 1NBBA 4CJOA 1QLEC 4N4WA 5L0FA 2EINC 3C18A 4E17A 5KYYA 1IZMA 4NY3A 3RKOF 3QZCA 1OCCC 4GQHA 1YARO 2A1DD 4XEVA 1H9TA 1TQGA 1OW6A 3OWTA 4AK9A 1TWAA 1JOGA 2NSGA 4DOZA 1D1BA 4ULVA 3S28A 2XLDA 1M56C 3UMKA 4CIHA 1O5HA 5A6JA 2IM8A 3ZTZA 3ITFA 3ASNC 3GODA 2L9JA 4EBBA 3L8JA 4Z9HA 4NTAA 3SEOA 2YKZA 2BE5F 3WG7C 5KYWA 3T6JA 1OR2A 1APCA 4DRIB 2R7OA 5E3AA 3LESA 1G8XA 2EPLX 3SXMA 2Q4FA 2AVKA 5K0IA 2VCBA 2HSQA 3RIPA 4E18A 4O6NA 4CDAA 5HV9A 3U3FA 2FFHA 1TWHA 2X51A 4CSAC 2XSEA 2A6HF 3LEOA 1D1CA 3LUTB 3B29A 4O7GA 5COGA 2ZXPA 3B0UX 3UMIA 5JP7A 1KNYA 4JZAA 4BEMJ 4C7OA 3SYNA 4Q7CA 3SP1A 2GWWA 2Y69C 3AQBA 1OCRC 5JS5A 1GM5A 1MNEA 1AUEA 1SYQA 4DVZA 4D4XA 4AL0A 1FNTc 2QTVA 1M2VA 4IAQA 2HV7A 2OEXA 4OD4A 4JEBA 4DBRA 3C8ZA 4CBEA 1ZHWA 2J7PD 5F5FA 4G0HA 5L0HA 4MVQA 1CGNA 2IXPA 3EHMA 3EZHA 1ST6A 3G4ZA 2HS5A 3JRMO 3TK0A 3ZIBA 4E7ZA 3PDMP 5L3QA 3W8HA 2I15A 1HW2A 1T6IA 4PJJA 1A7DA 5DS6A 1RCPA 1E83A 4YJWA 2YLIA 4NTBA 4MTOA 3ZC4A 4MW8A 4B6IA 3NRHA 4JJGA 4JCZA 3MFNA 4W8PA 5JLIA 1SMYF 4XPXA 4O6MA 4MVZA 2OG2A 2PF4E 3EPVA 1WN0A 1ZZPA 1M2OA 3Q6NA 3SXZA 4CJGA 1KTMA 4KBLA 1ZHTA 3ABMC 3DI5A 3QW0A 1FMWA 2YLGA 2W4BA 4E0IA 4WABA 3W8IA 5EK0A 4L6RA 1G4US 3MYFA 2AU5A 1ORYA 4M63A 5B1BC 4EKWA 3OEOA 5DS4A 2OEVA 1YVIA 2A0UA 2J46A 1HY5A 2L81A 3EH2A 3CQZA 4CS9A 2P61A 1K04A 3SNHA 3K1HA 4A4AA 2Z15A 2P1AA 4XEFA 2VH3A 4YT4A 2QE9A 2QLAA 2IXNA 3FAPB 5EGYA 1BR2A 3EGXB 4PFOA 1V55C 4I44A 2YL0A 4WGYA 4E7SA 5T3TA 4MTGA 4FESA 1YZCA 1OKKA 3EZIA 3NDBB 5GPGB 1YAUO 4NCQA 3VRCA 2Y39A 4G7HF 1G5ZA 1CPQA 3GEHA 2KQ9A 2G3VA 3UNGC 4AE4A 3UGOA 3MBGA 1HE9A 2CYDA 3ABLC 1FFHA 4XLNF 2CNWA 1SZIA 2YVKA 4C7OB 3RVYA 2DB4A 1WGWA 2KSFA 4Z9IA 3TJ6A 2A6EF 3FOPA 3KYIA 3I4UA 2X0CA 1EQ1A 4WGZA 1JMWA 3KMIA 3CSKA 4R32A 4XEKA 1M2VB 3V7OA 1A7EA 1RJ9A 1VK5A 4H54A 4E0HA 2R7UA 4RDAA 1FR0A 3KH2A 2AP3A 1Z3IX 4XQ1A 5HSWA 1LS1A 4MTFA 3EHNA 1LI5A 3F47A 3FMSA 4O79A 3T6BA 3U8VA 4BPMA 1G4WR 1H9GA 3NKEA 1C02A 1ZHYA 2XLVA 4JURI 3WODF 5BQIA 3L1MA 5JVEA 2H7OA 3DJNB 3DM9B 2LFFA 2BC5A 1S05A 2VB6A 3BRJA 3QVYA 4ZLDA 3K6BA 4YL3A 3ZQYA 4HFFB 2XL4A 3L34A 4CS9C 2A0BA 3W4YA 1MMAA 1CGOA 4BJ5A 4DJ9A 2J45A 4CIPA 1M57C 4ONSA 2L6FA 3EG9A 4BJTA 3MLGA 3N24A 2R7SA 1NLXA 3DJUB 1MQVA 2R7XA 3U2MA 3GANA 3BEHA 2NUTA 4Q5SF 3AOUA 2UUIA 1GS9A 1QSPA 1NU7D 2L6GA 256BA 3RW0A 3U9MA 4DXWA 1ZYRF 3JYHA 4RD9A 4U5BE 2Q9AA 1LE2A 3DM5A 3O10A 2WVQA 3GM2A 3N0TA 5JSLA 1MMNA 3ZSUA 5L0DA 3G4XA 4J7YA 2HMZA 5JRAA 2A69F 3AG4C 2Y3BA 5DVWA 3UMHA 2WL8A 1Q0KA 3B71A 2Q9BA 4U5GA 2Y3GA 5BUOA 5T3WA 4BG0A 5DQTA 2AWYA 3VAYA 3B0VC 3NG1A 2GA0A 2R7TA 2W45A 3ZWIA 4IAOA 1HE1A 2OOCA 3S0XA 1Y4CA 3FAJA 4YN0B 1EI7A 2J9BA 4PK4A 2HSBA
chains in the Genus database with same CATH topology
1OXKA 1QSPA 1C03A 3KYJA 2LD6A 2R25A 1FR0A 1TQGA 1WN0A 4PACA 2LCHA 1C02A 1A0BA 1SR2A 3IQTA 4G78A 3US6A 3MYFA 1Y6DA 4EUKB 2A0BA 1I5NA 1YVIA 2Q4FA 3KYIA 2OOCA 3U3BA 1OXBA 1BDJB 2LP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXK A;  1QSP A;  1C03 A;  3KYJ A;  2LD6 A;  2R25 A;  1FR0 A;  1TQG A;  1WN0 A;  4PAC A;  2LCH A;  1C02 A;  1A0B A;  1SR2 A;  3IQT A;  4G78 A;  3US6 A;  3MYF A;  1Y6D A;  4EUK B;  2A0B A;  1I5N A;  1YVI A;  2Q4F A;  3KYI A;  2OOC A;  3U3B A;  1OXB A;  1BDJ B;  2LP4 A; 
#chains in the Genus database with same CATH topology
 3J06 A;  2HFI A;  3H2U A;  3NKD A;  4AE4 B;  2KYH A;  4C3B A;  1TFO B;  1AVO B;  1XWJ A;  1Q0G A;  2M4E A;  2QNL A;  1WWP A;  5E3C A;  3TJ5 A;  2P7V A;  4CDV A;  4EWC A;  3PHF 2;  5B1A C;  2KNH A;  1YLM A;  3JRT A;  1PCX A;  3AG1 C;  3O6X A;  3VYW A;  2ZXO A;  1J8M F;  5T1D B;  1EA8 A;  1Q0D A;  4IAR A;  4LDQ A;  1ORS C;  4U9E A;  2ZD9 A;  4XLP F;  2XXA B;  3CAX A;  5F28 E;  3GEI A;  2YQY A;  3B0P A;  2TMV P;  1JPJ A;  1LIH A;  2LSE A;  1V4A A;  2ZXR A;  4BJ5 C;  2WVN A;  1JRA A;  3DWW A;  2XM0 A;  3PCV A;  4JEA A;  4CX9 A;  1AEP A;  3HNL A;  3QW1 A;  3I5P A;  5KYY B;  1D1A A;  1H6G A;  4IGG A;  2NUP A;  2Q7R A;  3U3B A;  1LM3 B;  2UUH A;  3HNK A;  2PBE A;  3LJB A;  1ZU5 A;  3ZDL A;  1VYI A;  3Q7G A;  3IEE A;  1RXQ A;  2ICW G;  2ETS A;  2YL1 A;  1TWC A;  3Q7L A;  2WZG A;  3TD7 A;  5AC4 A;  3U2L A;  4RBN A;  3NYJ A;  4YWQ A;  3GM1 A;  4I1O B;  2W4M A;  4XPY A;  3NMK A;  2NG1 A;  3LLI A;  5DLJ A;  3EG9 B;  5E2Q A;  2XL8 A;  3O55 A;  2MWQ A;  2V26 A;  4DBQ A;  1F1M A;  3L0I A;  1U0B B;  3DAG A;  3ZVR A;  3EJN A;  2XL6 A;  3G50 A;  5FZT A;  4N6H A;  4U5C E;  1VMA A;  1OW7 A;  3GM3 A;  2MYS A;  5E33 A;  4EUK B;  4C3D A;  1L3P A;  1B68 A;  3S84 A;  1T9K A;  4AL1 A;  1Q0M A;  2R02 A;  2R7Q A;  3IQ5 A;  3NYL A;  4MVM A;  4WJ0 A;  3HKK A;  2VC9 A;  2XLH A;  5L0J A;  2L6H A;  3EGD A;  4FWV A;  2HUJ A;  3HNI A;  1W2W A;  2Y3H A;  3M1C B;  1OXB A;  1Z23 A;  3V5Z A;  1YA9 A;  2GFH A;  2AWC A;  2P6V A;  1Z5Z A;  3JT1 A;  3RQE A;  1ZHX A;  1ZHZ A;  5KYW B;  2YHS A;  3GWL A;  1OKK D;  5B3S C;  1R4T A;  2VCA A;  2YZS A;  2GDC A;  1RKE A;  1WAS A;  2L7A A;  1TFK B;  3FXH A;  2CGE A;  1Z7Q c;  5AC5 A;  2FGY A;  3MYI A;  1ZW3 A;  2J8W A;  2XLO A;  1SR2 A;  2HMQ A;  2YLD A;  3DE9 A;  2Y3D A;  3AGT A;  3Q6M A;  4IB4 A;  3W2W A;  3DD7 A;  5JUA A;  3CEX A;  3H65 A;  4G78 A;  1D0X A;  4J7T A;  4D4N A;  3MX3 A;  4KI2 A;  3FHD A;  3TOL A;  3C8G A;  3N2Z B;  2EIM C;  2CNW D;  4OIN F;  3K33 A;  1LS4 A;  3RFY A;  5KYU A;  5KYX A;  1NFO A;  2YWA A;  1V74 B;  3K66 A;  3ZQV A;  3GWN A;  4EBJ A;  3EFO A;  1ZU4 A;  3O39 A;  4OIP F;  3A11 A;  1VYK A;  4I3M A;  2E87 A;  1OXK A;  5AGF A;  3S90 A;  1R5I D;  5DQZ A;  5A6B D;  2IBF A;  1K40 A;  4NC3 A;  4LDK A;  1C03 A;  1VLS A;  2CCY A;  2KC3 A;  3RYL A;  2LD6 A;  2HJM A;  2XLM A;  2D4U A;  5B3I A;  4CS8 A;  3S29 A;  5D91 A;  2GAQ A;  4JJF A;  1KU2 A;  2EPN A;  1FMV A;  2NUP B;  2J9V A;  4G7Z F;  4FX5 A;  2PFD A;  2A68 F;  4KC9 A;  3AQC A;  3I5Q A;  2J9W A;  1LI7 A;  1BBH A;  3LEV A;  1O3U A;  2OJE D;  2HJ3 A;  1XZQ A;  4X0R A;  4BJ1 A;  4JTD B;  2V3C C;  2CDQ A;  1YDI A;  5JT4 A;  1MMG A;  2XS8 A;  4U5F E;  4CDY A;  4YT8 A;  1QZX A;  2Q9C A;  3GOR A;  2CW0 F;  3WAQ A;  4JIO A;  2LFD A;  1T6U A;  2IYL D;  1WAT A;  1O87 A;  4GEH A;  1YA7 O;  3RF3 A;  3FVY A;  3LNM B;  4OIR F;  4N06 A;  2IXO A;  4ZLC A;  3S9O A;  4G7O F;  1ORJ A;  5FCL A;  4JVS A;  1T01 A;  2XLE A;  4JKV A;  5IY5 C;  1V54 C;  1WTY A;  1Q0F A;  3C7J A;  3EQL F;  3VM6 A;  3HJC A;  3U0C A;  1OW8 A;  3M79 A;  4LLC A;  5D92 A;  1JPN A;  4ER9 A;  2HZ8 A;  5CIV A;  1GGQ A;  3UR3 C;  2R03 A;  1CGM E;  4U5E E;  3NYM A;  2LCH A;  2YL7 A;  2MHR A;  4HFK B;  4LDR A;  1U89 A;  1EKY A;  4J30 B;  4JCH A;  3QMK A;  2RSE B;  3IQT A;  3R2P A;  2R7R A;  4QDL A;  4ANJ A;  3A9C A;  2VCC A;  3OA1 A;  4ULW A;  1MND A;  3AJM A;  3HTK C;  4XPW A;  1TKN A;  2W9Y A;  1QKR A;  1E85 A;  3KPH A;  1BR4 A;  1OCZ C;  1RKE B;  2KJG A;  2XRH A;  2OKU A;  3T9O A;  2H8A A;  1WOL A;  4PJM A;  3WHN A;  3RQG A;  2G3K A;  2XLW A;  5COM A;  2OQM A;  1U6H A;  3C8G B;  1TR2 A;  3H2V A;  1PD1 A;  3KYJ A;  2KK1 A;  4N6C A;  4YL0 A;  1D0Z A;  4CS8 C;  4K1O A;  5KYU B;  4K7B A;  5KYX B;  5BQH A;  4Z9J A;  2HV6 A;  3EFO B;  4PAC A;  4J32 B;  4JE9 A;  1DOW A;  3JSZ A;  4IRU A;  2YRF A;  2C03 A;  3TUL A;  2B0H A;  1Z6A A;  3EGX A;  2KW3 C;  4JRZ A;  2PNO A;  4C3E A;  5L0I A;  1RJ9 B;  1E2X A;  3R7C A;  3M4B A;  2EPM X;  2HKV A;  4HE8 D;  3SXK A;  4KNV A;  3U5S A;  3X2Q C;  3SXY A;  1FAP B;  4W8K A;  5A69 A;  3C62 A;  4U9D A;  3LNR A;  4MVR A;  4MQ9 F;  3JYY A;  4Q4Z F;  2LP4 A;  4P9T A;  3RQF A;  3TOM A;  5F5H A;  2B0J A;  3CZ6 A;  1NSG B;  4PFP A;  3AG2 C;  5COF A;  3V5Y A;  1RMV A;  4F4B A;  1ZW2 A;  2R25 A;  2JD3 A;  3LLK A;  4O6Y A;  1HW1 A;  3QVZ A;  2J0W A;  2JX0 A;  2YL3 A;  1E86 A;  4LLE A;  4K0D A;  4JTA B;  3DE8 A;  3M15 A;  3IPM O;  4YK5 A;  5L3V A;  1FTS A;  3K1I A;  1S7Z A;  2IXM A;  1DOV A;  1M6T A;  2EIL C;  2QUP A;  2H7V C;  2NUT B;  3EH1 A;  1I4Y A;  3U9J A;  1UFB A;  2DYS C;  2NPU A;  2WZF A;  3ZG1 A;  4CS7 A;  1Z63 A;  3PMR A;  1XZP A;  2J7P A;  5L0C A;  2O9X A;  1CPR A;  1JAF A;  3ASO C;  4JC7 A;  4FAP B;  1T6Q A;  1NG1 A;  3KL4 A;  2XS1 A;  2WVO A;  2IOQ A;  1UG7 A;  1HMD A;  4DVY P;  5EHH A;  4KNW A;  4MW3 A;  2LK4 A;  3AG3 C;  4A2N B;  4I1M A;  1QQ3 A;  1J8Y F;  3KKB A;  3RH3 A;  3AGU A;  4BJ6 A;  2OU6 A;  3IHU A;  4P6I C;  2DI3 A;  1SF8 A;  2Q3T A;  2P0N A;  4LER A;  3TQO A;  4HEA J;  4OIO F;  5TJ5 E;  2FAP B;  1QPU A;  2H7B A;  1RKC A;  1PV3 A;  2R05 A;  1YZA A;  3E9V A;  1YYX A;  1TWG A;  4PJN A;  4QI0 A;  2J9U A;  2KGO A;  3C8G D;  3US6 A;  4MND A;  1FFT C;  1VOM A;  4NQF A;  4BEJ A;  1LKX A;  1LPE A;  2QY9 A;  1QVX A;  1A7V A;  4XWJ A;  2WZL A;  3POV A;  3RVZ A;  1I5N A;  4IJJ A;  5A6K A;  5KYN A;  5DS5 A;  1K05 A;  3DZA A;  4GYT A;  4NTF A;  4AX2 A;  3W2V A;  1NFN A;  2DGJ A;  1GQA A;  3FOO A;  4LAC B;  3FDQ A;  2LIG A;  3L8I A;  3DXJ F;  4JW1 A;  3VF0 A;  1MMD A;  2NSF A;  3SZR A;  3JZ0 A;  1I4Z A;  1NU9 C;  4PR9 A;  1OR3 A;  2F22 A;  3ABK C;  3QTH A;  3V5X A;  1D0Y A;  1BR1 A;  3IQ6 A;  4YL1 A;  1LE4 A;  3LS1 A;  3HNJ A;  2I8B A;  4YT2 A;  2DYR C;  3M4C A;  3T4R A;  3LS0 A;  1YJG A;  2ZPA A;  1A0B A;  3DKA A;  3DAF A;  3K1I C;  2R7V A;  1PD0 A;  2PX3 A;  4OD5 A;  2C04 A;  2XM4 A;  1OQC A;  4EBK A;  2EIK C;  3LAY A;  3DMD A;  5BQG A;  1H7I A;  2RD9 A;  1OCO C;  3NMJ A;  2J0X A;  3JCU Q;  2ASR A;  3ZTM A;  4MVO A;  1LVK A;  5CI8 A;  2OJQ A;  3IQC A;  4H4K C;  4UDV A;  3UGP A;  5A6A A;  1A41 A;  2XXA A;  3ATP A;  3F46 A;  2M64 A;  2OCC C;  1BDJ B;  4DRH B;  4BJ6 C;  2EIJ C;  2LQG A;  4U5D E;  4MVS A;  1HMO A;  1N1C A;  2VAS A;  5A6B A;  1VB5 A;  3X1O A;  2JPU A;  2Q00 A;  2D5R B;  4CSA A;  5CI9 A;  1VTM P;  3K7D A;  4OIQ F;  1L7C A;  1C17 M;  1NZE A;  3B9Q A;  2PX0 A;  1T5O A;  3JTL O;  4MVU A;  3C63 A;  4MS2 A;  2R7W A;  4QI2 A;  2YEV A;  3EGD B;  4U5H A;  3HLZ A;  4EHP A;  3GEE A;  4XTK A;  2EPK X;  4YT5 A;  2EPO A;  2WB7 A;  2BL2 A;  4DRJ B;  1Y6D A;  2R9R B;  3E70 C;  3ECS A;  1ZVZ A;  4P9F A;  2ZXW C;  3S27 A;  1VLT A;  1E84 A;  4PJL A;  4JTC B;  3U8P A;  4EIY A;  2G62 A;  3JSE O;  2PP4 A;  1BZ4 A;  3NMI A;  1IW7 F;  4IWB A;  1JR8 A;  1YYJ A;  5L0G A;  3T6G B;  1NBB A;  4CJO A;  1QLE C;  4N4W A;  5L0F A;  2EIN C;  3C18 A;  4E17 A;  5KYY A;  1IZM A;  4NY3 A;  3RKO F;  3QZC A;  1OCC C;  4GQH A;  1YAR O;  2A1D D;  4XEV A;  1H9T A;  1TQG A;  1OW6 A;  3OWT A;  4AK9 A;  1TWA A;  1JOG A;  2NSG A;  4DOZ A;  1D1B A;  4ULV A;  3S28 A;  2XLD A;  1M56 C;  3UMK A;  4CIH A;  1O5H A;  5A6J A;  2IM8 A;  3ZTZ A;  3ITF A;  3ASN C;  3GOD A;  2L9J A;  4EBB A;  3L8J A;  4Z9H A;  4NTA A;  3SEO A;  2YKZ A;  2BE5 F;  3WG7 C;  5KYW A;  3T6J A;  1OR2 A;  1APC A;  4DRI B;  2R7O A;  5E3A A;  3LES A;  1G8X A;  2EPL X;  3SXM A;  2Q4F A;  2AVK A;  5K0I A;  2VCB A;  2HSQ A;  3RIP A;  4E18 A;  4O6N A;  4CDA A;  5HV9 A;  3U3F A;  2FFH A;  1TWH A;  2X51 A;  4CSA C;  2XSE A;  2A6H F;  3LEO A;  1D1C A;  3LUT B;  3B29 A;  4O7G A;  5COG A;  2ZXP A;  3B0U X;  3UMI A;  5JP7 A;  1KNY A;  4JZA A;  4BEM J;  4C7O A;  3SYN A;  4Q7C A;  3SP1 A;  2GWW A;  2Y69 C;  3AQB A;  1OCR C;  5JS5 A;  1GM5 A;  1MNE A;  1AUE A;  1SYQ A;  4DVZ A;  4D4X A;  4AL0 A;  1FNT c;  2QTV A;  1M2V A;  4IAQ A;  2HV7 A;  2OEX A;  4OD4 A;  4JEB A;  4DBR A;  3C8Z A;  4CBE A;  1ZHW A;  2J7P D;  5F5F A;  4G0H A;  5L0H A;  4MVQ A;  1CGN A;  2IXP A;  3EHM A;  3EZH A;  1ST6 A;  3G4Z A;  2HS5 A;  3JRM O;  3TK0 A;  3ZIB A;  4E7Z A;  3PDM P;  5L3Q A;  3W8H A;  2I15 A;  1HW2 A;  1T6I A;  4PJJ A;  1A7D A;  5DS6 A;  1RCP A;  1E83 A;  4YJW A;  2YLI A;  4NTB A;  4MTO A;  3ZC4 A;  4MW8 A;  4B6I A;  3NRH A;  4JJG A;  4JCZ A;  3MFN A;  4W8P A;  5JLI A;  1SMY F;  4XPX A;  4O6M A;  4MVZ A;  2OG2 A;  2PF4 E;  3EPV A;  1WN0 A;  1ZZP A;  1M2O A;  3Q6N A;  3SXZ A;  4CJG A;  1KTM A;  4KBL A;  1ZHT A;  3ABM C;  3DI5 A;  3QW0 A;  1FMW A;  2YLG A;  2W4B A;  4E0I A;  4WAB A;  3W8I A;  5EK0 A;  4L6R A;  1G4U S;  3MYF A;  2AU5 A;  1ORY A;  4M63 A;  5B1B C;  4EKW A;  3OEO A;  5DS4 A;  2OEV A;  1YVI A;  2A0U A;  2J46 A;  1HY5 A;  2L81 A;  3EH2 A;  3CQZ A;  4CS9 A;  2P61 A;  1K04 A;  3SNH A;  3K1H A;  4A4A A;  2Z15 A;  2P1A A;  4XEF A;  2VH3 A;  4YT4 A;  2QE9 A;  2QLA A;  2IXN A;  3FAP B;  5EGY A;  1BR2 A;  3EGX B;  4PFO A;  1V55 C;  4I44 A;  2YL0 A;  4WGY A;  4E7S A;  5T3T A;  4MTG A;  4FES A;  1YZC A;  1OKK A;  3EZI A;  3NDB B;  5GPG B;  1YAU O;  4NCQ A;  3VRC A;  2Y39 A;  4G7H F;  1G5Z A;  1CPQ A;  3GEH A;  2KQ9 A;  2G3V A;  3UNG C;  4AE4 A;  3UGO A;  3MBG A;  1HE9 A;  2CYD A;  3ABL C;  1FFH A;  4XLN F;  2CNW A;  1SZI A;  2YVK A;  4C7O B;  3RVY A;  2DB4 A;  1WGW A;  2KSF A;  4Z9I A;  3TJ6 A;  2A6E F;  3FOP A;  3KYI A;  3I4U A;  2X0C A;  1EQ1 A;  4WGZ A;  1JMW A;  3KMI A;  3CSK A;  4R32 A;  4XEK A;  1M2V B;  3V7O A;  1A7E A;  1RJ9 A;  1VK5 A;  4H54 A;  4E0H A;  2R7U A;  4RDA A;  1FR0 A;  3KH2 A;  2AP3 A;  1Z3I X;  4XQ1 A;  5HSW A;  1LS1 A;  4MTF A;  3EHN A;  1LI5 A;  3F47 A;  3FMS A;  4O79 A;  3T6B A;  3U8V A;  4BPM A;  1G4W R;  1H9G A;  3NKE A;  1C02 A;  1ZHY A;  2XLV A;  4JUR I;  3WOD F;  5BQI A;  3L1M A;  5JVE A;  2H7O A;  3DJN B;  3DM9 B;  2LFF A;  2BC5 A;  1S05 A;  2VB6 A;  3BRJ A;  3QVY A;  4ZLD A;  3K6B A;  4YL3 A;  3ZQY A;  4HFF B;  2XL4 A;  3L34 A;  4CS9 C;  2A0B A;  3W4Y A;  1MMA A;  1CGO A;  4BJ5 A;  4DJ9 A;  2J45 A;  4CIP A;  1M57 C;  4ONS A;  2L6F A;  3EG9 A;  4BJT A;  3MLG A;  3N24 A;  2R7S A;  1NLX A;  3DJU B;  1MQV A;  2R7X A;  3U2M A;  3GAN A;  3BEH A;  2NUT A;  4Q5S F;  3AOU A;  2UUI A;  1GS9 A;  1QSP A;  1NU7 D;  2L6G A;  256B A;  3RW0 A;  3U9M A;  4DXW A;  1ZYR F;  3JYH A;  4RD9 A;  4U5B E;  2Q9A A;  1LE2 A;  3DM5 A;  3O10 A;  2WVQ A;  3GM2 A;  3N0T A;  5JSL A;  1MMN A;  3ZSU A;  5L0D A;  3G4X A;  4J7Y A;  2HMZ A;  5JRA A;  2A69 F;  3AG4 C;  2Y3B A;  5DVW A;  3UMH A;  2WL8 A;  1Q0K A;  3B71 A;  2Q9B A;  4U5G A;  2Y3G A;  5BUO A;  5T3W A;  4BG0 A;  5DQT A;  2AWY A;  3VAY A;  3B0V C;  3NG1 A;  2GA0 A;  2R7T A;  2W45 A;  3ZWI A;  4IAO A;  1HE1 A;  2OOC A;  3S0X A;  1Y4C A;  3FAJ A;  4YN0 B;  1EI7 A;  2J9B A;  4PK4 A;  2HSB A; 
#chains in the Genus database with same CATH homology
 1OXK A;  1QSP A;  1C03 A;  3KYJ A;  2LD6 A;  2R25 A;  1FR0 A;  1TQG A;  1WN0 A;  4PAC A;  2LCH A;  1C02 A;  1A0B A;  1SR2 A;  3IQT A;  4G78 A;  3US6 A;  3MYF A;  1Y6D A;  4EUK B;  2A0B A;  1I5N A;  1YVI A;  2Q4F A;  3KYI A;  2OOC A;  3U3B A;  1OXB A;  1BDJ B;  2LP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...