1TQGA

Chea phosphotransferase domain from thermotoga maritima
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
105
structure length
105
Chain Sequence
GSHMEYLGVFVDETKEYLQNLNDTLLELEKNPEDMELINEAFRALHTLKGMAGTMGFSSMAKLCHTLENILDKARNSEIKITSDLLDKIFAGVDMITRMVDKIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Chemotaxis protein cheA
publication title Helical Shifts Generate Two Distinct Conformers in the Atomic Resolution Structure of the CheA Phosphotransferase Domain from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 48
structure length 105
sequence length 105
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1tqgA00
1OXBA 3IQTA 1BDJB 3KYIA 1C02A 1OXKA 2LP4A 2Q4FA 3MYFA 3US6A 1Y6DA 4G78A 4EUKB 1TQGA 2OOCA 2LD6A 2A0BA 1I5NA 1QSPA 1FR0A 1YVIA 1WN0A 3KYJA 1A0BA 1C03A 4PACA 1SR2A 2LCHA 3U3BA 2R25A
chains in the Genus database with same CATH superfamily
1OKKD 1R4TA 3SEOA 5DS4A 4ZLCA 2EINC 3U9JA 3OWTA 3AQBA 2OG2A 3LJBA 3UMIA 3T9OA 5A6BD 3ZG1A 2QNLA 4FWVA 4J30B 2KW3C 4L6RA 3SZRA 5BQIA 1WATA 1ORSC 3NYMA 3B0VC 1E2XA 5E2QA 1CGOA 5BQGA 1RJ9A 1AVOB 2CYDA 1RKEA 3CZ6A 4FX5A 2QY9A 3VF0A 1Z23A 3EGXA 4WGZA 4D4NA 4BJ6C 5EGYA 2L7AA 4I3MA 3L34A 1TWAA 2H7BA 1M57C 3TOMA 1JOGA 3GWLA 1EI7A 2AWYA 2DB4A 2HJ3A 1T6QA 2WVQA 3AGTA 3SXMA 1I5NA 4JIOA 1M2VA 2YKZA 3A9CA 3LESA 3U5SA 5E3AA 2XXAA 1FMWA 2NSGA 1OKKA 2OJED 3AQCA 3NYJA 3SXZA 3VYWA 1KTMA 4DBQA 1SZIA 1VK5A 1YLMA 1ZVZA 2EPKX 4DVZA 3CAXA 3K6BA 5A6BA 1Q0MA 1VB5A 3QMKA 3Q6NA 4IJJA 2Q3TA 4O7GA 2CDQA 1FTSA 2OCCC 2ZXWC 4DXWA 3TULA 4XTKA 3T4RA 2G62A 5JP7A 3C8GB 2L6HA 4JJFA 5KYYA 2C04A 3U2MA 4OIOF 2XLHA 4OD5A 3FOPA 3ZC4A 3AJMA 2O9XA 3FXHA 3B0PA 4NCQA 3E9VA 2DYSC 2EIJC 4GEHA 1ZHYA 3UNGC 2R7WA 1MMDA 5JVEA 3IPMO 1S7ZA 3ZTZA 2L81A 2NUTB 2HMQA 3HNJA 3MBGA 3WODF 5F5HA 1VLSA 2G3KA 1OR3A 5JRAA 1TFKB 1BR4A 2M4EA 3MYIA 5HSWA 5AC5A 3L8IA 2R7UA 5JUAA 1IW7F 4EBBA 1MMNA 3DJNB 1CPQA 3RF3A 2LFFA 3B9QA 2HFIA 2IXPA 2PBEA 1QLEC 2Q4FA 2VH3A 4MW3A 1RCPA 3K1IA 4BG0A 2XL8A 4U9EA 1Q0DA 2Q9AA 1WASA 3I5QA 2H8AA 4EIYA 4LDRA 1T01A 4IGGA 1A7VA 1IZMA 3LEOA 2XLEA 1M56C 5KYUA 4D4XA 2Y3HA 2CNWD 1H7IA 2P7VA 2XL6A 2WL8A 3O55A 4W8PA 3M4BA 4HFKB 3GM3A 4U5CE 3PHF2 3EGDB 3T6JA 1WOLA 2EILC 3QVYA 2Y3DA 2Y69C 256BA 2YZSA 1OXBA 3GEEA 1ZYRF 2HSQA 4MTOA 3RQGA 5BQHA 5L3VA 1LM3B 4Q4ZF 2UUIA 1SMYF 1PD0A 2AWCA 3JSEO 1J8YF 5EHHA 4XPXA 2IXOA 1JPNA 1LIHA 2W4MA 3HTKC 1ORJA 4JEBA 2NG1A 2YLDA 1C02A 3DM9B 3KPHA 2ETSA 4E7ZA 2D4UA 1OXKA 2XM0A 4AL1A 5FCLA 1U6HA 4AK9A 1YJGA 1ZHZA 2A6EF 3H2VA 4JVSA 3MYFA 5E3CA 1OCCC 1OCRC 1YYJA 4YL3A 1OW7A 3L8JA 3QZCA 1BZ4A 3C18A 4WABA 3S9OA 1TQGA 1T6UA 1OQCA 5L0CA 4YT4A 3V5ZA 4UDVA 4G7HF 3AG3C 4FESA 3W4YA 2CNWA 3S84A 2WVOA 3H2UA 1LS4A 1LS1A 3KL4A 2HZ8A 1I4ZA 3N24A 4JCZA 4JTCB 4W8KA 4XPWA 5FZTA 1PD1A 1LKXA 3C8GD 4MVMA 3U3FA 4Z9JA 4YJWA 1LE2A 4HE8D 1NG1A 4JEAA 3TQOA 2HJMA 3NYLA 2YRFA 3DE8A 3GWNA 4O6YA 2A0UA 2R7RA 1J8MF 4BJ6A 2XLMA 1VMAA 3ABMC 1NZEA 5L0JA 2LK4A 4MVRA 2AU5A 2WVNA 2OOCA 1Q0GA 3NMKA 3EG9B 2MYSA 3A11A 3LNRA 4XLPF 4K1OA 1GM5A 3TK0A 2ZPAA 4NC3A 1K04A 3C8GA 4B6IA 1BR1A 2VCAA 4MTGA 4YK5A 3DAFA 3VM6A 4PJJA 1HW2A 4ER9A 1YA7O 5JLIA 4OIQF 1H6GA 1C17M 4O6NA 5CI8A 2OU6A 2Y3GA 3V5XA 3K7DA 1D1CA 2R9RB 2VB6A 4DOZA 4E0IA 4I1MA 1KU2A 1FAPB 1D0XA 3QVZA 1GGQA 3TOLA 2LQGA 2DYRC 4K0DA 2NUTA 3T6GB 1OW8A 2ASRA 2IOQA 2EPLX 2LIGA 2EPMX 3GM1A 3JRTA 4LDKA 4YT5A 1E85A 4J7YA 1HE1A 2PX0A 3UGOA 1ZW2A 3RW0A 2EIKC 3RVYA 3C62A 4E18A 4PFOA 2M64A 3JZ0A 3VRCA 2HMZA 3ZWIA 1O3UA 2R7SA 2I8BA 1RMVA 2QUPA 4JURI 2WZFA 4LDQA 4C3BA 4MNDA 4BJ5C 3LNMB 1D0ZA 3HNKA 3JYHA 1MQVA 3EH2A 5JSLA 4CDYA 1A7EA 4N06A 1V55C 3K1HA 2EPOA 1HMOA 4BEJA 3EGDA 4MVQA 4CDAA 2CCYA 3IEEA 5T1DB 3SXKA 4JTAB 2FAPB 2QE9A 3MX3A 4CSAC 4R32A 1UFBA 2UUHA 1NFNA 2KK1A 3SNHA 2BE5F 3SYNA 1M2OA 4H54A 2XLOA 3SXYA 3EHNA 2J9VA 3LUTB 5DVWA 2L9JA 2VCCA 3FVYA 3RIPA 2Q00A 3UMHA 3W2VA 4IARA 3QW0A 2HKVA 1A0BA 4OIRF 1Z6AA 2XLVA 3LLIA 5A69A 3CEXA 1GQAA 4I1OB 4PFPA 2NUPB 1H9GA 1JAFA 2AVKA 4HFFB 4CS8C 3POVA 2TMVP 4ULVA 4JCHA 1CPRA 3KKBA 1ZHXA 2OKUA 3EPVA 2J45A 1LE4A 2HUJA 3LS0A 1HE9A 4ONSA 2WB7A 3ASOC 4N4WA 3HKKA 4YL1A 3HLZA 3PDMP 2YLGA 4Q7CA 4CS9C 3R7CA 2Y39A 1LVKA 2YL3A 1APCA 3Q6MA 1QVXA 1VYIA 4IAQA 4YN0B 3C8ZA 4U5FE 2PP4A 3ECSA 3G4ZA 4DRHB 5JT4A 3ASNC 3NKEA 3V7OA 5L0HA 3CQZA 2KYHA 2KQ9A 3GANA 2P1AA 3O10A 3B0UX 2XS8A 2ZXPA 3JSZA 3DZAA 1T6IA 2Z15A 3DAGA 3OEOA 4KNWA 3RFYA 1QSPA 1YDIA 3AG2C 1LI5A 1KNYA 3ZTMA 4U5GA 4PACA 4X0RA 1LPEA 2PFDA 5D92A 2VCBA 4IAOA 4CJOA 1U0BB 3R2PA 1YZCA 3ATPA 2KGOA 4XWJA 2PX3A 2I15A 3EG9A 5DQTA 4RD9A 1A41A 1ZZPA 2D5RB 2R7QA 3N2ZB 5GPGB 1FFTC 5EK0A 1BR2A 1MMAA 3C63A 4E7SA 2R7XA 1D0YA 2HS5A 1SYQA 1V54C 1EA8A 3FOOA 4PJLA 3UMKA 4EKWA 5COGA 5L0FA 1YYXA 3AG1C 1U89A 3B29A 4CIHA 4QDLA 1ZHTA 2BL2A 3GM2A 4PK4A 4J7TA 4PJMA 2VC9A 1JMWA 5A6JA 4JJGA 3EZIA 1E86A 1PCXA 1L7CA 1ZW3A 2YL1A 3MLGA 4J32B 4OD4A 5JS5A 3S28A 2YL7A 1G4WR 2YLIA 3M79A 1DOVA 2EIMC 2XS1A 3IHUA 3U8PA 4MVSA 4XEKA 4YWQA 3RYLA 1FR0A 3QW1A 1WN0A 3LAYA 4MQ9F 3RVZA 3CSKA 3BRJA 3ABLC 3E70C 2R25A 4I44A 1O87A 3L0IA 2J7PD 2WZLA 3AG4C 3RQEA 2F22A 1QQ3A 3FAPB 5D91A 4AL0A 5BUOA 3W2WA 1NFOA 4CIPA 4MVZA 4ULWA 1FMVA 4KBLA 1G5ZA 5TJ5E 1PV3A 5DS6A 3G4XA 4C3EA 3DE9A 3NMIA 4JKVA 4BPMA 1TWHA 2A69F 1D1AA 3TJ5A 3U8VA 3ZQVA 3BEHA 2B0HA 3M15A 2J0XA 2XL4A 3U0CA 3K1IC 1MNEA 5F28E 2J46A 4JTDB 5T3WA 4XLNF 3NDBB 1EKYA 3T6BA 2R7OA 4O79A 2X51A 3LS1A 3NKDA 2GAQA 5E33A 2PF4E 2Y3BA 4KNVA 4NY3A 3W8HA 2BC5A 4EHPA 4C7OB 1F1MA 1C03A 3F46A 2C03A 2J9UA 4A2NB 1CGNA 4MS2A 4M63A 3WG7C 1SR2A 2A0BA 2J7PA 2LCHA 5T3TA 4BJ5A 5KYXB 3DI5A 3J06A 3RH3A 3IQ5A 2R02A 3JRMO 2L6FA 1ST6A 1R5ID 2XLDA 1JRAA 3B71A 1V4AA 3EFOB 3M4CA 4HEAJ 3NRHA 3S29A 5K0IA 3AOUA 4CSAA 4U5DE 1K40A 2P0NA 2LP4A 1WGWA 4BEMJ 2J9WA 1BBHA 2VASA 4OINF 2NUPA 2DGJA 1O5HA 4E0HA 2R03A 2MWQA 4MVUA 5AC4A 3TD7A 3S90A 4FAPB 3FDQA 1A7DA 4IWBA 5L0GA 2NPUA 4DJ9A 1JR8A 4QI2A 1T5OA 3KMIA 4LLCA 2XRHA 4H4KC 1T9KA 1MNDA 1WWPA 3KYJA 3HJCA 3GODA 1YARO 1Z3IX 2RSEB 2G3VA 2LSEA 3EZHA 3X1OA 4CS8A 5L0IA 3GEHA 4PR9A 5KYWB 4YT8A 3VAYA 5DQZA 3RKOF 3JTLO 2KC3A 4LERA 3IQTA 4Z9HA 3DWWA 2W4BA 3OA1A 2CW0F 4CX9A 3EQLF 3FAJA 2YHSA 4O6MA 4CS9A 1TKNA 4GYTA 1TWCA 1XZQA 1VLTA 3ITFA 4DBRA 1AUEA 2WZGA 4RBNA 3KH2A 1Z7Qc 3JYYA 2A1DD 3M1CB 2R7TA 1AEPA 2GDCA 4G7OF 2Q7RA 4DVYP 5A6AA 5L3QA 1YA9A 3EJNA 1K05A 2W9YA 2HV7A 2IXMA 3C7JA 2YWAA 1SF8A 4XEVA 3V5YA 2HV6A 2LD6A 4U5EE 1D1BA 1JPJA 2L6GA 3I4UA 4XPYA 4C3DA 2XM4A 4IB4A 5COFA 2MHRA 1VYKA 1RXQA 4CS7A 4NQFA 2V3CC 3WHNA 2J0WA 3NG1A 3PCVA 4N6CA 1Q0FA 1G4US 2FGYA 3ZSUA 1TWGA 3DMDA 2YL0A 3ZVRA 4G0HA 4DRIB 3QTHA 3TJ6A 3U9MA 3W8IA 5L0DA 2KSFA 2JX0A 1DOWA 3I5PA 1ORYA 3EH1A 3AGUA 4WGYA 4KI2A 2DI3A 5B1AC 3O6XA 5KYNA 4P9FA 1YAUO 4AE4B 3ABKC 4JRZA 1XWJA 5HV9A 5F5FA 3ZIBA 1OW6A 2H7VC 2Q9BA 2R05A 2P61A 4JE9A 2X0CA 3UGPA 1EQ1A 3U2LA 1VTMP 1TFOB 2JPUA 2PNOA 1OR2A 5AGFA 4EWCA 1ZHWA 4MW8A 3U3BA 1NLXA 1RJ9B 4EBKA 1RKEB 2IYLD 3L1MA 1BDJB 3EGXB 2V26A 4NTAA 4BJTA 3KYIA 2YEVA 4C7OA 1N1CA 1MMGA 3NMJA 4P9TA 2QLAA 1Q0KA 1HMDA 1FFHA 3GORA 2W45A 1QKRA 3DXJF 1I4YA 4MTFA 3GEIA 1M2VB 2CGEA 2ZXRA 5KYXA 1Y6DA 2FFHA 3MFNA 4MVOA 4G78A 2XXAB 4G7ZF 2B0JA 3ZDLA 5A6KA 1XZPA 2IBFA 3EFOA 4XEFA 2A6HF 1LI7A 1FNTc 2KJGA 3HNLA 4AX2A 3EHMA 2R7VA 4ANJA 1H9TA 3HNIA 4LACB 4U5BE 4WJ0A 3G50A 4OIPF 3LLKA 2IXNA 4KC9A 3UR3C 5KYYB 3FHDA 1Y4CA 3JT1A 2ZD9A 1NSGB 1S05A 3S27A 1M6TA 2J8WA 3ZQYA 2YVKA 1V74B 3DM5A 2QTVA 3N0TA 2GA0A 3SP1A 5KYWA 4JC7A 5DLJA 4CDVA 4JW1A 3H65A 2H7OA 1UG7A 4U5HA 1Z5ZA 3US6A 4GQHA 4P6IC 4EUKB 2RD9A 4Q5SF 2ICWG 2OEXA 4U9DA 5IY5C 3LEVA 1YZAA 1RKCA 4A4AA 1B68A 4ZLDA 5COMA 1ZU5A 2Q9CA 1YVIA 4IRUA 2J9BA 4JZAA 4EBJA 1NU9C 1QZXA 2OQMA 3FMSA 5B1BC 1E83A 1VOMA 4CBEA 4Z9IA 3S0XA 2XLWA 4PJNA 3IQ6A 1E84A 1CGME 2OJQA 1OCZC 3IQCA 3O39A 4N6HA 5B3IA 5B3SC 4NTBA 3PMRA 1TR2A 3F47A 5CIVA 2XSEA 2HSBA 4NTFA 2YQYA 3X2QC 3RQFA 5KYUB 2AP3A 1Z63A 4XQ1A 3DD7A 1WTYA 3DJUB 3K66A 4LLEA 4BJ1A 3Q7LA 4YT2A 1W2WA 4K7BA 4E17A 5CI9A 2E87A 4YL0A 2P6VA 4RDAA 1OCOC 2GWWA 5DS5A 3JCUQ 1G8XA 1QPUA 2OEVA 2JD3A 1L3PA 3Q7GA 4DRJB 2A68F 4F4BA 2EPNA 4QI0A 2IM8A 1NBBA 3DKAA 3K33A 2GFHA 2KNHA 1HW1A 1HY5A 1ZU4A 2LFDA 1NU7D 2NSFA 2ZXOA 3WAQA 4AE4A 4CJGA 1GS9A
chains in the Genus database with same CATH topology
1OXBA 3IQTA 1BDJB 3KYIA 1C02A 1OXKA 2LP4A 2Q4FA 3MYFA 3US6A 1Y6DA 4G78A 4EUKB 1TQGA 2OOCA 2LD6A 2A0BA 1I5NA 1QSPA 1FR0A 1YVIA 1WN0A 3KYJA 1A0BA 1C03A 4PACA 1SR2A 2LCHA 3U3BA 2R25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXB A;  3IQT A;  1BDJ B;  3KYI A;  1C02 A;  1OXK A;  2LP4 A;  2Q4F A;  3MYF A;  3US6 A;  1Y6D A;  4G78 A;  4EUK B;  1TQG A;  2OOC A;  2LD6 A;  2A0B A;  1I5N A;  1QSP A;  1FR0 A;  1YVI A;  1WN0 A;  3KYJ A;  1A0B A;  1C03 A;  4PAC A;  1SR2 A;  2LCH A;  3U3B A;  2R25 A; 
#chains in the Genus database with same CATH topology
 1OKK D;  1R4T A;  3SEO A;  5DS4 A;  4ZLC A;  2EIN C;  3U9J A;  3OWT A;  3AQB A;  2OG2 A;  3LJB A;  3UMI A;  3T9O A;  5A6B D;  3ZG1 A;  2QNL A;  4FWV A;  4J30 B;  2KW3 C;  4L6R A;  3SZR A;  5BQI A;  1WAT A;  1ORS C;  3NYM A;  3B0V C;  1E2X A;  5E2Q A;  1CGO A;  5BQG A;  1RJ9 A;  1AVO B;  2CYD A;  1RKE A;  3CZ6 A;  4FX5 A;  2QY9 A;  3VF0 A;  1Z23 A;  3EGX A;  4WGZ A;  4D4N A;  4BJ6 C;  5EGY A;  2L7A A;  4I3M A;  3L34 A;  1TWA A;  2H7B A;  1M57 C;  3TOM A;  1JOG A;  3GWL A;  1EI7 A;  2AWY A;  2DB4 A;  2HJ3 A;  1T6Q A;  2WVQ A;  3AGT A;  3SXM A;  1I5N A;  4JIO A;  1M2V A;  2YKZ A;  3A9C A;  3LES A;  3U5S A;  5E3A A;  2XXA A;  1FMW A;  2NSG A;  1OKK A;  2OJE D;  3AQC A;  3NYJ A;  3SXZ A;  3VYW A;  1KTM A;  4DBQ A;  1SZI A;  1VK5 A;  1YLM A;  1ZVZ A;  2EPK X;  4DVZ A;  3CAX A;  3K6B A;  5A6B A;  1Q0M A;  1VB5 A;  3QMK A;  3Q6N A;  4IJJ A;  2Q3T A;  4O7G A;  2CDQ A;  1FTS A;  2OCC C;  2ZXW C;  4DXW A;  3TUL A;  4XTK A;  3T4R A;  2G62 A;  5JP7 A;  3C8G B;  2L6H A;  4JJF A;  5KYY A;  2C04 A;  3U2M A;  4OIO F;  2XLH A;  4OD5 A;  3FOP A;  3ZC4 A;  3AJM A;  2O9X A;  3FXH A;  3B0P A;  4NCQ A;  3E9V A;  2DYS C;  2EIJ C;  4GEH A;  1ZHY A;  3UNG C;  2R7W A;  1MMD A;  5JVE A;  3IPM O;  1S7Z A;  3ZTZ A;  2L81 A;  2NUT B;  2HMQ A;  3HNJ A;  3MBG A;  3WOD F;  5F5H A;  1VLS A;  2G3K A;  1OR3 A;  5JRA A;  1TFK B;  1BR4 A;  2M4E A;  3MYI A;  5HSW A;  5AC5 A;  3L8I A;  2R7U A;  5JUA A;  1IW7 F;  4EBB A;  1MMN A;  3DJN B;  1CPQ A;  3RF3 A;  2LFF A;  3B9Q A;  2HFI A;  2IXP A;  2PBE A;  1QLE C;  2Q4F A;  2VH3 A;  4MW3 A;  1RCP A;  3K1I A;  4BG0 A;  2XL8 A;  4U9E A;  1Q0D A;  2Q9A A;  1WAS A;  3I5Q A;  2H8A A;  4EIY A;  4LDR A;  1T01 A;  4IGG A;  1A7V A;  1IZM A;  3LEO A;  2XLE A;  1M56 C;  5KYU A;  4D4X A;  2Y3H A;  2CNW D;  1H7I A;  2P7V A;  2XL6 A;  2WL8 A;  3O55 A;  4W8P A;  3M4B A;  4HFK B;  3GM3 A;  4U5C E;  3PHF 2;  3EGD B;  3T6J A;  1WOL A;  2EIL C;  3QVY A;  2Y3D A;  2Y69 C;  256B A;  2YZS A;  1OXB A;  3GEE A;  1ZYR F;  2HSQ A;  4MTO A;  3RQG A;  5BQH A;  5L3V A;  1LM3 B;  4Q4Z F;  2UUI A;  1SMY F;  1PD0 A;  2AWC A;  3JSE O;  1J8Y F;  5EHH A;  4XPX A;  2IXO A;  1JPN A;  1LIH A;  2W4M A;  3HTK C;  1ORJ A;  4JEB A;  2NG1 A;  2YLD A;  1C02 A;  3DM9 B;  3KPH A;  2ETS A;  4E7Z A;  2D4U A;  1OXK A;  2XM0 A;  4AL1 A;  5FCL A;  1U6H A;  4AK9 A;  1YJG A;  1ZHZ A;  2A6E F;  3H2V A;  4JVS A;  3MYF A;  5E3C A;  1OCC C;  1OCR C;  1YYJ A;  4YL3 A;  1OW7 A;  3L8J A;  3QZC A;  1BZ4 A;  3C18 A;  4WAB A;  3S9O A;  1TQG A;  1T6U A;  1OQC A;  5L0C A;  4YT4 A;  3V5Z A;  4UDV A;  4G7H F;  3AG3 C;  4FES A;  3W4Y A;  2CNW A;  3S84 A;  2WVO A;  3H2U A;  1LS4 A;  1LS1 A;  3KL4 A;  2HZ8 A;  1I4Z A;  3N24 A;  4JCZ A;  4JTC B;  4W8K A;  4XPW A;  5FZT A;  1PD1 A;  1LKX A;  3C8G D;  4MVM A;  3U3F A;  4Z9J A;  4YJW A;  1LE2 A;  4HE8 D;  1NG1 A;  4JEA A;  3TQO A;  2HJM A;  3NYL A;  2YRF A;  3DE8 A;  3GWN A;  4O6Y A;  2A0U A;  2R7R A;  1J8M F;  4BJ6 A;  2XLM A;  1VMA A;  3ABM C;  1NZE A;  5L0J A;  2LK4 A;  4MVR A;  2AU5 A;  2WVN A;  2OOC A;  1Q0G A;  3NMK A;  3EG9 B;  2MYS A;  3A11 A;  3LNR A;  4XLP F;  4K1O A;  1GM5 A;  3TK0 A;  2ZPA A;  4NC3 A;  1K04 A;  3C8G A;  4B6I A;  1BR1 A;  2VCA A;  4MTG A;  4YK5 A;  3DAF A;  3VM6 A;  4PJJ A;  1HW2 A;  4ER9 A;  1YA7 O;  5JLI A;  4OIQ F;  1H6G A;  1C17 M;  4O6N A;  5CI8 A;  2OU6 A;  2Y3G A;  3V5X A;  3K7D A;  1D1C A;  2R9R B;  2VB6 A;  4DOZ A;  4E0I A;  4I1M A;  1KU2 A;  1FAP B;  1D0X A;  3QVZ A;  1GGQ A;  3TOL A;  2LQG A;  2DYR C;  4K0D A;  2NUT A;  3T6G B;  1OW8 A;  2ASR A;  2IOQ A;  2EPL X;  2LIG A;  2EPM X;  3GM1 A;  3JRT A;  4LDK A;  4YT5 A;  1E85 A;  4J7Y A;  1HE1 A;  2PX0 A;  3UGO A;  1ZW2 A;  3RW0 A;  2EIK C;  3RVY A;  3C62 A;  4E18 A;  4PFO A;  2M64 A;  3JZ0 A;  3VRC A;  2HMZ A;  3ZWI A;  1O3U A;  2R7S A;  2I8B A;  1RMV A;  2QUP A;  4JUR I;  2WZF A;  4LDQ A;  4C3B A;  4MND A;  4BJ5 C;  3LNM B;  1D0Z A;  3HNK A;  3JYH A;  1MQV A;  3EH2 A;  5JSL A;  4CDY A;  1A7E A;  4N06 A;  1V55 C;  3K1H A;  2EPO A;  1HMO A;  4BEJ A;  3EGD A;  4MVQ A;  4CDA A;  2CCY A;  3IEE A;  5T1D B;  3SXK A;  4JTA B;  2FAP B;  2QE9 A;  3MX3 A;  4CSA C;  4R32 A;  1UFB A;  2UUH A;  1NFN A;  2KK1 A;  3SNH A;  2BE5 F;  3SYN A;  1M2O A;  4H54 A;  2XLO A;  3SXY A;  3EHN A;  2J9V A;  3LUT B;  5DVW A;  2L9J A;  2VCC A;  3FVY A;  3RIP A;  2Q00 A;  3UMH A;  3W2V A;  4IAR A;  3QW0 A;  2HKV A;  1A0B A;  4OIR F;  1Z6A A;  2XLV A;  3LLI A;  5A69 A;  3CEX A;  1GQA A;  4I1O B;  4PFP A;  2NUP B;  1H9G A;  1JAF A;  2AVK A;  4HFF B;  4CS8 C;  3POV A;  2TMV P;  4ULV A;  4JCH A;  1CPR A;  3KKB A;  1ZHX A;  2OKU A;  3EPV A;  2J45 A;  1LE4 A;  2HUJ A;  3LS0 A;  1HE9 A;  4ONS A;  2WB7 A;  3ASO C;  4N4W A;  3HKK A;  4YL1 A;  3HLZ A;  3PDM P;  2YLG A;  4Q7C A;  4CS9 C;  3R7C A;  2Y39 A;  1LVK A;  2YL3 A;  1APC A;  3Q6M A;  1QVX A;  1VYI A;  4IAQ A;  4YN0 B;  3C8Z A;  4U5F E;  2PP4 A;  3ECS A;  3G4Z A;  4DRH B;  5JT4 A;  3ASN C;  3NKE A;  3V7O A;  5L0H A;  3CQZ A;  2KYH A;  2KQ9 A;  3GAN A;  2P1A A;  3O10 A;  3B0U X;  2XS8 A;  2ZXP A;  3JSZ A;  3DZA A;  1T6I A;  2Z15 A;  3DAG A;  3OEO A;  4KNW A;  3RFY A;  1QSP A;  1YDI A;  3AG2 C;  1LI5 A;  1KNY A;  3ZTM A;  4U5G A;  4PAC A;  4X0R A;  1LPE A;  2PFD A;  5D92 A;  2VCB A;  4IAO A;  4CJO A;  1U0B B;  3R2P A;  1YZC A;  3ATP A;  2KGO A;  4XWJ A;  2PX3 A;  2I15 A;  3EG9 A;  5DQT A;  4RD9 A;  1A41 A;  1ZZP A;  2D5R B;  2R7Q A;  3N2Z B;  5GPG B;  1FFT C;  5EK0 A;  1BR2 A;  1MMA A;  3C63 A;  4E7S A;  2R7X A;  1D0Y A;  2HS5 A;  1SYQ A;  1V54 C;  1EA8 A;  3FOO A;  4PJL A;  3UMK A;  4EKW A;  5COG A;  5L0F A;  1YYX A;  3AG1 C;  1U89 A;  3B29 A;  4CIH A;  4QDL A;  1ZHT A;  2BL2 A;  3GM2 A;  4PK4 A;  4J7T A;  4PJM A;  2VC9 A;  1JMW A;  5A6J A;  4JJG A;  3EZI A;  1E86 A;  1PCX A;  1L7C A;  1ZW3 A;  2YL1 A;  3MLG A;  4J32 B;  4OD4 A;  5JS5 A;  3S28 A;  2YL7 A;  1G4W R;  2YLI A;  3M79 A;  1DOV A;  2EIM C;  2XS1 A;  3IHU A;  3U8P A;  4MVS A;  4XEK A;  4YWQ A;  3RYL A;  1FR0 A;  3QW1 A;  1WN0 A;  3LAY A;  4MQ9 F;  3RVZ A;  3CSK A;  3BRJ A;  3ABL C;  3E70 C;  2R25 A;  4I44 A;  1O87 A;  3L0I A;  2J7P D;  2WZL A;  3AG4 C;  3RQE A;  2F22 A;  1QQ3 A;  3FAP B;  5D91 A;  4AL0 A;  5BUO A;  3W2W A;  1NFO A;  4CIP A;  4MVZ A;  4ULW A;  1FMV A;  4KBL A;  1G5Z A;  5TJ5 E;  1PV3 A;  5DS6 A;  3G4X A;  4C3E A;  3DE9 A;  3NMI A;  4JKV A;  4BPM A;  1TWH A;  2A69 F;  1D1A A;  3TJ5 A;  3U8V A;  3ZQV A;  3BEH A;  2B0H A;  3M15 A;  2J0X A;  2XL4 A;  3U0C A;  3K1I C;  1MNE A;  5F28 E;  2J46 A;  4JTD B;  5T3W A;  4XLN F;  3NDB B;  1EKY A;  3T6B A;  2R7O A;  4O79 A;  2X51 A;  3LS1 A;  3NKD A;  2GAQ A;  5E33 A;  2PF4 E;  2Y3B A;  4KNV A;  4NY3 A;  3W8H A;  2BC5 A;  4EHP A;  4C7O B;  1F1M A;  1C03 A;  3F46 A;  2C03 A;  2J9U A;  4A2N B;  1CGN A;  4MS2 A;  4M63 A;  3WG7 C;  1SR2 A;  2A0B A;  2J7P A;  2LCH A;  5T3T A;  4BJ5 A;  5KYX B;  3DI5 A;  3J06 A;  3RH3 A;  3IQ5 A;  2R02 A;  3JRM O;  2L6F A;  1ST6 A;  1R5I D;  2XLD A;  1JRA A;  3B71 A;  1V4A A;  3EFO B;  3M4C A;  4HEA J;  3NRH A;  3S29 A;  5K0I A;  3AOU A;  4CSA A;  4U5D E;  1K40 A;  2P0N A;  2LP4 A;  1WGW A;  4BEM J;  2J9W A;  1BBH A;  2VAS A;  4OIN F;  2NUP A;  2DGJ A;  1O5H A;  4E0H A;  2R03 A;  2MWQ A;  4MVU A;  5AC4 A;  3TD7 A;  3S90 A;  4FAP B;  3FDQ A;  1A7D A;  4IWB A;  5L0G A;  2NPU A;  4DJ9 A;  1JR8 A;  4QI2 A;  1T5O A;  3KMI A;  4LLC A;  2XRH A;  4H4K C;  1T9K A;  1MND A;  1WWP A;  3KYJ A;  3HJC A;  3GOD A;  1YAR O;  1Z3I X;  2RSE B;  2G3V A;  2LSE A;  3EZH A;  3X1O A;  4CS8 A;  5L0I A;  3GEH A;  4PR9 A;  5KYW B;  4YT8 A;  3VAY A;  5DQZ A;  3RKO F;  3JTL O;  2KC3 A;  4LER A;  3IQT A;  4Z9H A;  3DWW A;  2W4B A;  3OA1 A;  2CW0 F;  4CX9 A;  3EQL F;  3FAJ A;  2YHS A;  4O6M A;  4CS9 A;  1TKN A;  4GYT A;  1TWC A;  1XZQ A;  1VLT A;  3ITF A;  4DBR A;  1AUE A;  2WZG A;  4RBN A;  3KH2 A;  1Z7Q c;  3JYY A;  2A1D D;  3M1C B;  2R7T A;  1AEP A;  2GDC A;  4G7O F;  2Q7R A;  4DVY P;  5A6A A;  5L3Q A;  1YA9 A;  3EJN A;  1K05 A;  2W9Y A;  2HV7 A;  2IXM A;  3C7J A;  2YWA A;  1SF8 A;  4XEV A;  3V5Y A;  2HV6 A;  2LD6 A;  4U5E E;  1D1B A;  1JPJ A;  2L6G A;  3I4U A;  4XPY A;  4C3D A;  2XM4 A;  4IB4 A;  5COF A;  2MHR A;  1VYK A;  1RXQ A;  4CS7 A;  4NQF A;  2V3C C;  3WHN A;  2J0W A;  3NG1 A;  3PCV A;  4N6C A;  1Q0F A;  1G4U S;  2FGY A;  3ZSU A;  1TWG A;  3DMD A;  2YL0 A;  3ZVR A;  4G0H A;  4DRI B;  3QTH A;  3TJ6 A;  3U9M A;  3W8I A;  5L0D A;  2KSF A;  2JX0 A;  1DOW A;  3I5P A;  1ORY A;  3EH1 A;  3AGU A;  4WGY A;  4KI2 A;  2DI3 A;  5B1A C;  3O6X A;  5KYN A;  4P9F A;  1YAU O;  4AE4 B;  3ABK C;  4JRZ A;  1XWJ A;  5HV9 A;  5F5F A;  3ZIB A;  1OW6 A;  2H7V C;  2Q9B A;  2R05 A;  2P61 A;  4JE9 A;  2X0C A;  3UGP A;  1EQ1 A;  3U2L A;  1VTM P;  1TFO B;  2JPU A;  2PNO A;  1OR2 A;  5AGF A;  4EWC A;  1ZHW A;  4MW8 A;  3U3B A;  1NLX A;  1RJ9 B;  4EBK A;  1RKE B;  2IYL D;  3L1M A;  1BDJ B;  3EGX B;  2V26 A;  4NTA A;  4BJT A;  3KYI A;  2YEV A;  4C7O A;  1N1C A;  1MMG A;  3NMJ A;  4P9T A;  2QLA A;  1Q0K A;  1HMD A;  1FFH A;  3GOR A;  2W45 A;  1QKR A;  3DXJ F;  1I4Y A;  4MTF A;  3GEI A;  1M2V B;  2CGE A;  2ZXR A;  5KYX A;  1Y6D A;  2FFH A;  3MFN A;  4MVO A;  4G78 A;  2XXA B;  4G7Z F;  2B0J A;  3ZDL A;  5A6K A;  1XZP A;  2IBF A;  3EFO A;  4XEF A;  2A6H F;  1LI7 A;  1FNT c;  2KJG A;  3HNL A;  4AX2 A;  3EHM A;  2R7V A;  4ANJ A;  1H9T A;  3HNI A;  4LAC B;  4U5B E;  4WJ0 A;  3G50 A;  4OIP F;  3LLK A;  2IXN A;  4KC9 A;  3UR3 C;  5KYY B;  3FHD A;  1Y4C A;  3JT1 A;  2ZD9 A;  1NSG B;  1S05 A;  3S27 A;  1M6T A;  2J8W A;  3ZQY A;  2YVK A;  1V74 B;  3DM5 A;  2QTV A;  3N0T A;  2GA0 A;  3SP1 A;  5KYW A;  4JC7 A;  5DLJ A;  4CDV A;  4JW1 A;  3H65 A;  2H7O A;  1UG7 A;  4U5H A;  1Z5Z A;  3US6 A;  4GQH A;  4P6I C;  4EUK B;  2RD9 A;  4Q5S F;  2ICW G;  2OEX A;  4U9D A;  5IY5 C;  3LEV A;  1YZA A;  1RKC A;  4A4A A;  1B68 A;  4ZLD A;  5COM A;  1ZU5 A;  2Q9C A;  1YVI A;  4IRU A;  2J9B A;  4JZA A;  4EBJ A;  1NU9 C;  1QZX A;  2OQM A;  3FMS A;  5B1B C;  1E83 A;  1VOM A;  4CBE A;  4Z9I A;  3S0X A;  2XLW A;  4PJN A;  3IQ6 A;  1E84 A;  1CGM E;  2OJQ A;  1OCZ C;  3IQC A;  3O39 A;  4N6H A;  5B3I A;  5B3S C;  4NTB A;  3PMR A;  1TR2 A;  3F47 A;  5CIV A;  2XSE A;  2HSB A;  4NTF A;  2YQY A;  3X2Q C;  3RQF A;  5KYU B;  2AP3 A;  1Z63 A;  4XQ1 A;  3DD7 A;  1WTY A;  3DJU B;  3K66 A;  4LLE A;  4BJ1 A;  3Q7L A;  4YT2 A;  1W2W A;  4K7B A;  4E17 A;  5CI9 A;  2E87 A;  4YL0 A;  2P6V A;  4RDA A;  1OCO C;  2GWW A;  5DS5 A;  3JCU Q;  1G8X A;  1QPU A;  2OEV A;  2JD3 A;  1L3P A;  3Q7G A;  4DRJ B;  2A68 F;  4F4B A;  2EPN A;  4QI0 A;  2IM8 A;  1NBB A;  3DKA A;  3K33 A;  2GFH A;  2KNH A;  1HW1 A;  1HY5 A;  1ZU4 A;  2LFD A;  1NU7 D;  2NSF A;  2ZXO A;  3WAQ A;  4AE4 A;  4CJG A;  1GS9 A; 
#chains in the Genus database with same CATH homology
 1OXB A;  3IQT A;  1BDJ B;  3KYI A;  1C02 A;  1OXK A;  2LP4 A;  2Q4F A;  3MYF A;  3US6 A;  1Y6D A;  4G78 A;  4EUK B;  1TQG A;  2OOC A;  2LD6 A;  2A0B A;  1I5N A;  1QSP A;  1FR0 A;  1YVI A;  1WN0 A;  3KYJ A;  1A0B A;  1C03 A;  4PAC A;  1SR2 A;  2LCH A;  3U3B A;  2R25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...