1EQ1A

Nmr structure of an exchangeable apolipoprotein-manduca sexta apolipophorin-iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
b'DAPAGGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVASNMEETNKKLAPKIKQAYDDFVKHAEEVQKKLHEAATKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPHORIN-III
publication title Structural basis for the conformational adaptability of apolipophorin III, a helix-bundle exchangeable apolipoprotein
pubmed doi rcsb
source organism Manduca sexta
molecule tags Lipid binding protein
total genus 46
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07464 ApoLp-III Apolipophorin-III precursor (apoLp-III)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1eq1A00
1LS4A 1BZ4A 1B68A 2KC3A 1NFOA 3S84A 1OR3A 1LE4A 1LPEA 1GS9A 3R2PA 1NFNA 1H7IA 1OR2A 1EA8A 1EQ1A 1LE2A 1AEPA 1YA9A
chains in the Genus database with same CATH superfamily
3DI5A 3T9OA 2W4BA 1BZ4A 2E87A 2IXMA 4JKVA 2BL2A 3FAPB 1LM3B 5FZTA 4E0IA 4Q4ZF 2ZPAA 3K1HA 4WGYA 3H2VA 3C8GB 4YK5A 5A6BD 4DJ9A 2FGYA 2OG2A 5COGA 2NSGA 1LPEA 4ONSA 4XPYA 2M4EA 3ZG1A 4WABA 3LS1A 1XWJA 1RCPA 4PFOA 1G8XA 2GWWA 2AWYA 3AQCA 5DS6A 2VCBA 1M2VB 2LFFA 1A0BA 3JT1A 2HJ3A 4U9EA 4LERA 1ZW3A 4LDKA 1JMWA 2WZGA 3S28A 3U3BA 1ZZPA 2TMVP 2CDQA 2CNWA 1YDIA 3I4UA 2XM0A 4I1MA 5DS5A 1LIHA 1ORJA 3NKDA 5KYUA 5E33A 4G78A 3L8IA 1GGQA 1IZMA 1T5OA 1MNDA 1V54C 2ZXOA 3ASOC 4XPXA 2R7XA 5D92A 5DQTA 3UMIA 4EUKB 3JRTA 2R7VA 4ZLCA 5T3TA 3EG9B 2NPUA 4Z9IA 1HW1A 2ICWG 2J8WA 3ZTZA 2H8AA 1I5NA 1Q0KA 4BPMA 3LS0A 2HZ8A 4U5GA 5DLJA 2R03A 4YT5A 1GS9A 3DXJF 1LI5A 1NZEA 1T6IA 4NTFA 3US6A 1MMDA 5F28E 3V5YA 3EJNA 3F47A 4DRIB 3O6XA 4FESA 4BJ5A 2CYDA 4YT4A 3B0UX 3LNMB 3GORA 3SXKA 2EINC 3UR3C 3ZC4A 4YT2A 5EK0A 4GYTA 2VB6A 3CSKA 4FAPB 3TOLA 1E83A 2HV7A 4JEAA 4NC3A 1XZQA 2Y3GA 256BA 5KYWB 4MW8A 4NQFA 2A6HF 3FHDA 4D4NA 3FVYA 1G4WR 2A69F 2J7PD 4PJLA 3SXMA 4C7OB 2NUTB 2NUPA 2EPOA 4P9TA 2J9VA 4MQ9F 3EFOA 3EGXB 3FOPA 5B1BC 4JEBA 2LSEA 4CS8C 1TFOB 4P6IC 2L7AA 4OD4A 3C18A 3TOMA 3U3FA 5BQHA 1M6TA 2FFHA 4JE9A 1Z23A 5T1DB 2OQMA 4W8PA 4XWJA 4EBKA 2UUIA 3IQCA 3KL4A 1H9GA 4JCHA 2X51A 3FDQA 2D4UA 2HUJA 1VYIA 5GPGB 3PHF2 2J46A 3M4BA 3NYJA 4U5CE 1HE9A 3S9OA 4JCZA 4LDQA 4OIPF 2D5RB 4N6CA 4LLCA 2L6GA 5DVWA 5E2QA 2Y3HA 1QLEC 1U6HA 1WOLA 2XM4A 1SZIA 2LP4A 3L1MA 4NTAA 3K1IC 3VYWA 3S90A 2KYHA 4BJ6A 1OQCA 3B9QA 3C63A 3UNGC 1FFTC 2P6VA 3LJBA 3UMKA 5L0FA 4CS7A 2PFDA 1D1AA 3J06A 2HMZA 2W45A 3SXYA 3ECSA 4XEFA 3EZIA 3QMKA 1Q0MA 3R2PA 1JOGA 4FWVA 3TK0A 4CIHA 4CS9A 3C8GD 3GWLA 3TJ6A 3GANA 1NLXA 2WVOA 4JZAA 2EIKC 1UG7A 1RKEB 3C62A 3QW1A 2J9WA 3U5SA 3V5ZA 1NSGB 4BEMJ 1OW6A 4YL3A 3HNIA 2KNHA 3JRMO 4PK4A 5JVEA 3T6BA 3DD7A 2C04A 1MMNA 1YA7O 2WL8A 2R7OA 3EZHA 4GEHA 3EH2A 5JS5A 1ZHXA 4U5BE 2MWQA 2G62A 3U8PA 2AWCA 2EPLX 3EGDB 1OCZC 5K0IA 3VM6A 1A7DA 3POVA 2CGEA 4Z9JA 1AUEA 3IQTA 3DJNB 1QVXA 4BEJA 2KQ9A 2HSQA 3HTKC 2YL7A 4H54A 2ZD9A 4X0RA 2Y69C 5F5FA 1LVKA 1NG1A 4JC7A 2P1AA 3AG4C 3V5XA 4J7TA 1LKXA 3LNRA 3HNLA 1QPUA 3JTLO 4RBNA 4ANJA 2QY9A 3ABKC 1U89A 4CSAA 3I5QA 5L0DA 3O39A 2XLMA 3FOOA 2KK1A 3OEOA 1H9TA 4QI2A 2WVQA 4OINF 4IAOA 2A1DD 5T3WA 2CW0F 2AVKA 3EH1A 4CBEA 4MTFA 2R25A 2ZXPA 3HNJA 2H7VC 3NYMA 3C7JA 2KW3C 1D1CA 2LQGA 3AGUA 3SEOA 2IXNA 3RYLA 3LUTB 2H7BA 4HEAJ 1TKNA 1ZHWA 3L0IA 1RMVA 1OCRC 5EHHA 3E70C 1MQVA 1ZU5A 3JYYA 4OIOF 1A7VA 1GM5A 4I1OB 2Q4FA 4MVMA 1NFNA 2Z15A 1D0ZA 1M2VA 4L6RA 3MYIA 4MTOA 1Y6DA 2DYRC 4IGGA 3SZRA 4CX9A 3RH3A 3NMJA 3F46A 1HY5A 2EILC 4EHPA 1G5ZA 2QNLA 4FX5A 4ULVA 2V3CC 3BRJA 5COFA 1LE2A 1QQ3A 2YEVA 3V7OA 5AC5A 1E85A 3LLIA 1OW8A 3H2UA 1O87A 1YA9A 5JLIA 3CZ6A 1PV3A 3DAGA 3FMSA 2LK4A 3X2QC 2Q7RA 2OOCA 5TJ5E 2FAPB 1ZU4A 1DOWA 1BR4A 1HE1A 2EPKX 3JSZA 4YL0A 4NCQA 4XLPF 3HLZA 1V4AA 1J8YF 2MYSA 1VB5A 2F22A 3DJUB 4BJ6C 2A68F 3Q7GA 1A41A 4MNDA 4XEKA 3W8IA 3R7CA 2EPNA 3DM5A 1H6GA 2YZSA 1HMDA 1YJGA 2Q00A 4XEVA 3AQBA 4XLNF 3WAQA 4OIRF 2Y3DA 1Q0DA 1C17M 4KBLA 3ZQYA 4AE4B 1M57C 3B71A 4JJGA 1OW7A 4AL0A 2PBEA 3OWTA 4DVYP 3O10A 5KYXA 3WG7C 2XL8A 4IB4A 5L0HA 2Q3TA 2GA0A 4CS9C 1E86A 1SF8A 1TQGA 4A2NB 5A6BA 4C7OA 2VC9A 2KJGA 4IJJA 4CDAA 3DE9A 2NUTA 4EIYA 1B68A 1RKCA 2IYLD 2VASA 3BEHA 3RIPA 3ITFA 3KKBA 4DOZA 4O7GA 2OCCC 2VH3A 5L3QA 4U5EE 2EPMX 2ZXWC 4BJ1A 2JPUA 2XSEA 2J0WA 4K1OA 1CGOA 1S05A 2B0HA 4KNWA 4YJWA 2HV6A 3RW0A 4D4XA 2EIJC 3UGPA 1YZCA 2PX0A 4CDYA 4JTDB 1FMVA 4Q7CA 4ER9A 3A9CA 1A7EA 4RD9A 1T9KA 1FTSA 1LI7A 4MVSA 2GAQA 1M2OA 3IQ6A 3M79A 3N0TA 4U5DE 1BBHA 3K7DA 3CEXA 3LESA 1WWPA 1G4US 1J8MF 1VOMA 1N1CA 1YYXA 1Z3IX 3DZAA 3UMHA 1ORYA 2ASRA 2WB7A 3CAXA 4MW3A 3IQ5A 2YRFA 1PD0A 4PR9A 3SXZA 3WODF 3B0PA 3ZSUA 4N06A 5KYUB 3FAJA 1ORSC 3S0XA 1DOVA 4QI0A 2Y3BA 3IHUA 1ZHYA 5F5HA 2AU5A 5KYYA 1WN0A 5JP7A 1ST6A 4J32B 3IEEA 2QLAA 3LAYA 4KNVA 4ULWA 4CJGA 4DRJB 4E18A 5E3AA 3JZ0A 3L34A 5B3SC 4YL1A 2J7PA 2GFHA 3KYIA 1FNTc 3FXHA 2X0CA 3EHMA 3DAFA 1MMGA 4H4KC 1EI7A 1QZXA 1ZHZA 3NRHA 2YLGA 4JRZA 4ZLDA 2P0NA 3RQFA 2XXAB 2DB4A 2I8BA 4KI2A 1FMWA 4Z9HA 1YLMA 4O6MA 3ZQVA 3KYJA 4C3BA 4EWCA 2BE5F 4YT8A 5CI9A 5A6JA 1AVOB 3A11A 2QTVA 4KC9A 5BQGA 1LE4A 2ETSA 2IBFA 1T6QA 1WTYA 2A0UA 3VRCA 2GDCA 1JPNA 2NSFA 4NY3A 2YL0A 1NU9C 3C8ZA 3NMKA 3TJ5A 4LDRA 1MNEA 4JIOA 3ASNC 4OIQF 3S27A 1FAPB 5DQZA 2PF4E 4MVQA 3HKKA 4MVUA 3G50A 1JAFA 2H7OA 2VCCA 4J30B 2LIGA 1OKKD 2J9BA 2PNOA 4U5FE 3N24A 4I44A 1EA8A 1K05A 1RJ9A 2R7QA 3NG1A 4PJMA 1TWHA 1T6UA 1YARO 3ZVRA 4AL1A 5L0GA 1C02A 1EQ1A 4K0DA 1AEPA 2J45A 4MS2A 1TFKB 1TWCA 1SMYF 3GEHA 2LCHA 1R5ID 4PJNA 3ZIBA 4RDAA 1CGME 4Q5SF 3ATPA 2IXPA 2CNWD 1KNYA 3EHNA 1VLSA 1GQAA 3K66A 3QVYA 4BJ5C 2KGOA 1APCA 4O6NA 1WGWA 3RVYA 3T6JA 1U0BB 4E0HA 3B0VC 3NDBB 2P61A 5D91A 3I5PA 3C8GA 1KTMA 3U0CA 1E2XA 1K04A 1YAUO 3LEVA 4DVZA 2R7SA 1WASA 4A4AA 4GQHA 1ZYRF 1SYQA 2Q9CA 2XS8A 5B1AC 2G3VA 2M64A 2O9XA 2W4MA 1VYKA 1Z7Qc 5L0CA 1Z63A 3MFNA 3NKEA 3NYLA 3U9JA 4XQ1A 2HSBA 4PJJA 2EIMC 2KSFA 4PACA 3QVZA 5L0JA 3RF3A 2V26A 4U5HA 4EBBA 4JTCB 5KYWA 2HJMA 2J9UA 2YQYA 2NG1A 1OCCC 3EG9A 4MTGA 4U9DA 4G7HF 2MHRA 1L3PA 3M1CB 5B3IA 3W4YA 1ZVZA 3SYNA 2YVKA 2DYSC 4J7YA 4B6IA 4XPWA 3VF0A 3PDMP 1OKKA 1QSPA 2A0BA 2YL3A 4R32A 2VCAA 5AC4A 1HMOA 3Q7LA 5CIVA 4DRHB 5JSLA 2YWAA 4E17A 3GEEA 2IOQA 3RKOF 3RVZA 1VK5A 3Q6NA 3S29A 5A6AA 3L8JA 3MYFA 4UDVA 4EKWA 4AE4A 4N4WA 3G4XA 3PCVA 3RQEA 1ZHTA 3EQLF 3DKAA 2RD9A 1F1MA 2OJED 5L0IA 3ABLC 3HJCA 3RQGA 4E7SA 2L9JA 3GM1A 3MBGA 4IARA 3KMIA 3X1OA 1LS4A 2I15A 1IW7F 4JVSA 2YHSA 1T01A 2PX3A 4HFFB 1NFOA 3EGXA 2QUPA 4DXWA 3N2ZB 1CPRA 1O5HA 1YYJA 3MLGA 4O79A 2B0JA 2IXOA 2R7RA 3W8HA 2HS5A 1E84A 3AG1C 5FCLA 4M63A 2OKUA 2WVNA 4IRUA 1K40A 4C3EA 1I4ZA 2OJQA 3W2WA 4IWBA 1Q0GA 4BG0A 1VLTA 2LFDA 2PP4A 5EGYA 4G7ZF 1HW2A 1M56C 3M4CA 1NU7D 4I3MA 1SR2A 2BC5A 3E9VA 4WGZA 2W9YA 4PFPA 3SP1A 3U2LA 3M15A 2XL4A 5KYXB 1Z6AA 4OD5A 3TQOA 5E3CA 5L3VA 1D1BA 4HFKB 1V55C 1LS1A 4DBQA 2L6HA 4MVRA 2XLHA 2J0XA 2KC3A 3EPVA 4EBJA 1WATA 2R9RB 2ZXRA 4AX2A 1I4YA 2XL6A 2NUPB 1OR3A 2XLWA 3AOUA 3PMRA 5AGFA 3EFOB 4CSAC 1BDJB 3B29A 4MVOA 2Q9AA 2IM8A 3UGOA 1OXKA 1NBBA 1PD1A 3JCUQ 3QZCA 5JT4A 3VAYA 1O3UA 4WJ0A 2YL1A 1MMAA 4YWQA 1EKYA 3G4ZA 3T4RA 3DM9B 3LLKA 3JSEO 3K6BA 4MVZA 2OU6A 1Y4CA 2QE9A 1H7IA 1RKEA 1OCOC 3AGTA 3QW0A 4W8KA 1OR2A 2C03A 3ZDLA 2HMQA 1D0XA 1V74B 3AG3C 1BR1A 3IPMO 1PCXA 3JYHA 3U9MA 2R02A 1XZPA 2YLDA 4LLEA 1R4TA 3GWNA 3SNHA 2XXAA 3K33A 2A6EF 2R7WA 2XLVA 2LD6A 3GM3A 1UFBA 3Q6MA 4NTBA 1FFHA 3GEIA 1RXQA 4F4BA 3TULA 2XLDA 5COMA 2AP3A 1VMAA 3EGDA 3GM2A 4QDLA 3S84A 1L7CA 1TR2A 1C03A 2DGJA 2HKVA 2Q9BA 2R7TA 5BQIA 1OXBA 2JX0A 5JUAA 3AJMA 4LACB 4O6YA 4N6HA 2RSEB 3KPHA 1QKRA 2UUHA 2XLEA 3HNKA 3LEOA 5A6KA 5KYYB 4P9FA 1KU2A 3AG2C 1FR0A 3U8VA 2JD3A 4AK9A 1YZAA 3T6GB 3NMIA 5KYNA 3QTHA 4JTAB 4DBRA 3MX3A 4YN0B 2Y39A 5IY5C 4IAQA 3OA1A 4G0HA 1CGNA 1D0YA 1ZW2A 2XRHA 2HFIA 2G3KA 2OEVA 3ZWIA 4CDVA 3ABMC 4CS8A 5JRAA 4BJTA 1YVIA 1JPJA 2WZFA 3TD7A 1TWAA 4HE8D 4CJOA 4XTKA 3KH2A 3DE8A 4CIPA 3RFYA 5A69A 2XS1A 1BR2A 2YLIA 1JRAA 2R7UA 1Q0FA 4JJFA 3ZTMA 2L6FA 2XLOA 4K7BA 5DS4A 1CPQA 4E7ZA 2L81A 2OEXA 3W2VA 3DMDA 1S7ZA 4C3DA 3GODA 3K1IA 5CI8A 5HV9A 3WHNA 2WZLA 1JR8A 1RJ9B 2YKZA 4JW1A 5HSWA 2R05A 3CQZA 3H65A 5BUOA 2P7VA 1VTMP 3DWWA 1W2WA 4JURI 2DI3A 3U2MA 3O55A 4G7OF 1TWGA 2CCYA 1Z5ZA
chains in the Genus database with same CATH topology
1LS4A 1BZ4A 1B68A 2KC3A 1NFOA 3S84A 1OR3A 1LE4A 1LPEA 1GS9A 3R2PA 1NFNA 1H7IA 1OR2A 1EA8A 1EQ1A 1LE2A 1AEPA 1YA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS4 A;  1BZ4 A;  1B68 A;  2KC3 A;  1NFO A;  3S84 A;  1OR3 A;  1LE4 A;  1LPE A;  1GS9 A;  3R2P A;  1NFN A;  1H7I A;  1OR2 A;  1EA8 A;  1EQ1 A;  1LE2 A;  1AEP A;  1YA9 A; 
#chains in the Genus database with same CATH topology
 3DI5 A;  3T9O A;  2W4B A;  1BZ4 A;  2E87 A;  2IXM A;  4JKV A;  2BL2 A;  3FAP B;  1LM3 B;  5FZT A;  4E0I A;  4Q4Z F;  2ZPA A;  3K1H A;  4WGY A;  3H2V A;  3C8G B;  4YK5 A;  5A6B D;  4DJ9 A;  2FGY A;  2OG2 A;  5COG A;  2NSG A;  1LPE A;  4ONS A;  4XPY A;  2M4E A;  3ZG1 A;  4WAB A;  3LS1 A;  1XWJ A;  1RCP A;  4PFO A;  1G8X A;  2GWW A;  2AWY A;  3AQC A;  5DS6 A;  2VCB A;  1M2V B;  2LFF A;  1A0B A;  3JT1 A;  2HJ3 A;  4U9E A;  4LER A;  1ZW3 A;  4LDK A;  1JMW A;  2WZG A;  3S28 A;  3U3B A;  1ZZP A;  2TMV P;  2CDQ A;  2CNW A;  1YDI A;  3I4U A;  2XM0 A;  4I1M A;  5DS5 A;  1LIH A;  1ORJ A;  3NKD A;  5KYU A;  5E33 A;  4G78 A;  3L8I A;  1GGQ A;  1IZM A;  1T5O A;  1MND A;  1V54 C;  2ZXO A;  3ASO C;  4XPX A;  2R7X A;  5D92 A;  5DQT A;  3UMI A;  4EUK B;  3JRT A;  2R7V A;  4ZLC A;  5T3T A;  3EG9 B;  2NPU A;  4Z9I A;  1HW1 A;  2ICW G;  2J8W A;  3ZTZ A;  2H8A A;  1I5N A;  1Q0K A;  4BPM A;  3LS0 A;  2HZ8 A;  4U5G A;  5DLJ A;  2R03 A;  4YT5 A;  1GS9 A;  3DXJ F;  1LI5 A;  1NZE A;  1T6I A;  4NTF A;  3US6 A;  1MMD A;  5F28 E;  3V5Y A;  3EJN A;  3F47 A;  4DRI B;  3O6X A;  4FES A;  4BJ5 A;  2CYD A;  4YT4 A;  3B0U X;  3LNM B;  3GOR A;  3SXK A;  2EIN C;  3UR3 C;  3ZC4 A;  4YT2 A;  5EK0 A;  4GYT A;  2VB6 A;  3CSK A;  4FAP B;  3TOL A;  1E83 A;  2HV7 A;  4JEA A;  4NC3 A;  1XZQ A;  2Y3G A;  256B A;  5KYW B;  4MW8 A;  4NQF A;  2A6H F;  3FHD A;  4D4N A;  3FVY A;  1G4W R;  2A69 F;  2J7P D;  4PJL A;  3SXM A;  4C7O B;  2NUT B;  2NUP A;  2EPO A;  4P9T A;  2J9V A;  4MQ9 F;  3EFO A;  3EGX B;  3FOP A;  5B1B C;  4JEB A;  2LSE A;  4CS8 C;  1TFO B;  4P6I C;  2L7A A;  4OD4 A;  3C18 A;  3TOM A;  3U3F A;  5BQH A;  1M6T A;  2FFH A;  4JE9 A;  1Z23 A;  5T1D B;  2OQM A;  4W8P A;  4XWJ A;  4EBK A;  2UUI A;  3IQC A;  3KL4 A;  1H9G A;  4JCH A;  2X51 A;  3FDQ A;  2D4U A;  2HUJ A;  1VYI A;  5GPG B;  3PHF 2;  2J46 A;  3M4B A;  3NYJ A;  4U5C E;  1HE9 A;  3S9O A;  4JCZ A;  4LDQ A;  4OIP F;  2D5R B;  4N6C A;  4LLC A;  2L6G A;  5DVW A;  5E2Q A;  2Y3H A;  1QLE C;  1U6H A;  1WOL A;  2XM4 A;  1SZI A;  2LP4 A;  3L1M A;  4NTA A;  3K1I C;  3VYW A;  3S90 A;  2KYH A;  4BJ6 A;  1OQC A;  3B9Q A;  3C63 A;  3UNG C;  1FFT C;  2P6V A;  3LJB A;  3UMK A;  5L0F A;  4CS7 A;  2PFD A;  1D1A A;  3J06 A;  2HMZ A;  2W45 A;  3SXY A;  3ECS A;  4XEF A;  3EZI A;  3QMK A;  1Q0M A;  3R2P A;  1JOG A;  4FWV A;  3TK0 A;  4CIH A;  4CS9 A;  3C8G D;  3GWL A;  3TJ6 A;  3GAN A;  1NLX A;  2WVO A;  4JZA A;  2EIK C;  1UG7 A;  1RKE B;  3C62 A;  3QW1 A;  2J9W A;  3U5S A;  3V5Z A;  1NSG B;  4BEM J;  1OW6 A;  4YL3 A;  3HNI A;  2KNH A;  3JRM O;  4PK4 A;  5JVE A;  3T6B A;  3DD7 A;  2C04 A;  1MMN A;  1YA7 O;  2WL8 A;  2R7O A;  3EZH A;  4GEH A;  3EH2 A;  5JS5 A;  1ZHX A;  4U5B E;  2MWQ A;  2G62 A;  3U8P A;  2AWC A;  2EPL X;  3EGD B;  1OCZ C;  5K0I A;  3VM6 A;  1A7D A;  3POV A;  2CGE A;  4Z9J A;  1AUE A;  3IQT A;  3DJN B;  1QVX A;  4BEJ A;  2KQ9 A;  2HSQ A;  3HTK C;  2YL7 A;  4H54 A;  2ZD9 A;  4X0R A;  2Y69 C;  5F5F A;  1LVK A;  1NG1 A;  4JC7 A;  2P1A A;  3AG4 C;  3V5X A;  4J7T A;  1LKX A;  3LNR A;  3HNL A;  1QPU A;  3JTL O;  4RBN A;  4ANJ A;  2QY9 A;  3ABK C;  1U89 A;  4CSA A;  3I5Q A;  5L0D A;  3O39 A;  2XLM A;  3FOO A;  2KK1 A;  3OEO A;  1H9T A;  4QI2 A;  2WVQ A;  4OIN F;  4IAO A;  2A1D D;  5T3W A;  2CW0 F;  2AVK A;  3EH1 A;  4CBE A;  4MTF A;  2R25 A;  2ZXP A;  3HNJ A;  2H7V C;  3NYM A;  3C7J A;  2KW3 C;  1D1C A;  2LQG A;  3AGU A;  3SEO A;  2IXN A;  3RYL A;  3LUT B;  2H7B A;  4HEA J;  1TKN A;  1ZHW A;  3L0I A;  1RMV A;  1OCR C;  5EHH A;  3E70 C;  1MQV A;  1ZU5 A;  3JYY A;  4OIO F;  1A7V A;  1GM5 A;  4I1O B;  2Q4F A;  4MVM A;  1NFN A;  2Z15 A;  1D0Z A;  1M2V A;  4L6R A;  3MYI A;  4MTO A;  1Y6D A;  2DYR C;  4IGG A;  3SZR A;  4CX9 A;  3RH3 A;  3NMJ A;  3F46 A;  1HY5 A;  2EIL C;  4EHP A;  1G5Z A;  2QNL A;  4FX5 A;  4ULV A;  2V3C C;  3BRJ A;  5COF A;  1LE2 A;  1QQ3 A;  2YEV A;  3V7O A;  5AC5 A;  1E85 A;  3LLI A;  1OW8 A;  3H2U A;  1O87 A;  1YA9 A;  5JLI A;  3CZ6 A;  1PV3 A;  3DAG A;  3FMS A;  2LK4 A;  3X2Q C;  2Q7R A;  2OOC A;  5TJ5 E;  2FAP B;  1ZU4 A;  1DOW A;  1BR4 A;  1HE1 A;  2EPK X;  3JSZ A;  4YL0 A;  4NCQ A;  4XLP F;  3HLZ A;  1V4A A;  1J8Y F;  2MYS A;  1VB5 A;  2F22 A;  3DJU B;  4BJ6 C;  2A68 F;  3Q7G A;  1A41 A;  4MND A;  4XEK A;  3W8I A;  3R7C A;  2EPN A;  3DM5 A;  1H6G A;  2YZS A;  1HMD A;  1YJG A;  2Q00 A;  4XEV A;  3AQB A;  4XLN F;  3WAQ A;  4OIR F;  2Y3D A;  1Q0D A;  1C17 M;  4KBL A;  3ZQY A;  4AE4 B;  1M57 C;  3B71 A;  4JJG A;  1OW7 A;  4AL0 A;  2PBE A;  3OWT A;  4DVY P;  3O10 A;  5KYX A;  3WG7 C;  2XL8 A;  4IB4 A;  5L0H A;  2Q3T A;  2GA0 A;  4CS9 C;  1E86 A;  1SF8 A;  1TQG A;  4A2N B;  5A6B A;  4C7O A;  2VC9 A;  2KJG A;  4IJJ A;  4CDA A;  3DE9 A;  2NUT A;  4EIY A;  1B68 A;  1RKC A;  2IYL D;  2VAS A;  3BEH A;  3RIP A;  3ITF A;  3KKB A;  4DOZ A;  4O7G A;  2OCC C;  2VH3 A;  5L3Q A;  4U5E E;  2EPM X;  2ZXW C;  4BJ1 A;  2JPU A;  2XSE A;  2J0W A;  4K1O A;  1CGO A;  1S05 A;  2B0H A;  4KNW A;  4YJW A;  2HV6 A;  3RW0 A;  4D4X A;  2EIJ C;  3UGP A;  1YZC A;  2PX0 A;  4CDY A;  4JTD B;  1FMV A;  4Q7C A;  4ER9 A;  3A9C A;  1A7E A;  4RD9 A;  1T9K A;  1FTS A;  1LI7 A;  4MVS A;  2GAQ A;  1M2O A;  3IQ6 A;  3M79 A;  3N0T A;  4U5D E;  1BBH A;  3K7D A;  3CEX A;  3LES A;  1WWP A;  1G4U S;  1J8M F;  1VOM A;  1N1C A;  1YYX A;  1Z3I X;  3DZA A;  3UMH A;  1ORY A;  2ASR A;  2WB7 A;  3CAX A;  4MW3 A;  3IQ5 A;  2YRF A;  1PD0 A;  4PR9 A;  3SXZ A;  3WOD F;  3B0P A;  3ZSU A;  4N06 A;  5KYU B;  3FAJ A;  1ORS C;  3S0X A;  1DOV A;  4QI0 A;  2Y3B A;  3IHU A;  1ZHY A;  5F5H A;  2AU5 A;  5KYY A;  1WN0 A;  5JP7 A;  1ST6 A;  4J32 B;  3IEE A;  2QLA A;  3LAY A;  4KNV A;  4ULW A;  4CJG A;  4DRJ B;  4E18 A;  5E3A A;  3JZ0 A;  3L34 A;  5B3S C;  4YL1 A;  2J7P A;  2GFH A;  3KYI A;  1FNT c;  3FXH A;  2X0C A;  3EHM A;  3DAF A;  1MMG A;  4H4K C;  1EI7 A;  1QZX A;  1ZHZ A;  3NRH A;  2YLG A;  4JRZ A;  4ZLD A;  2P0N A;  3RQF A;  2XXA B;  2DB4 A;  2I8B A;  4KI2 A;  1FMW A;  4Z9H A;  1YLM A;  4O6M A;  3ZQV A;  3KYJ A;  4C3B A;  4EWC A;  2BE5 F;  4YT8 A;  5CI9 A;  5A6J A;  1AVO B;  3A11 A;  2QTV A;  4KC9 A;  5BQG A;  1LE4 A;  2ETS A;  2IBF A;  1T6Q A;  1WTY A;  2A0U A;  3VRC A;  2GDC A;  1JPN A;  2NSF A;  4NY3 A;  2YL0 A;  1NU9 C;  3C8Z A;  3NMK A;  3TJ5 A;  4LDR A;  1MNE A;  4JIO A;  3ASN C;  4OIQ F;  3S27 A;  1FAP B;  5DQZ A;  2PF4 E;  4MVQ A;  3HKK A;  4MVU A;  3G50 A;  1JAF A;  2H7O A;  2VCC A;  4J30 B;  2LIG A;  1OKK D;  2J9B A;  2PNO A;  4U5F E;  3N24 A;  4I44 A;  1EA8 A;  1K05 A;  1RJ9 A;  2R7Q A;  3NG1 A;  4PJM A;  1TWH A;  1T6U A;  1YAR O;  3ZVR A;  4AL1 A;  5L0G A;  1C02 A;  1EQ1 A;  4K0D A;  1AEP A;  2J45 A;  4MS2 A;  1TFK B;  1TWC A;  1SMY F;  3GEH A;  2LCH A;  1R5I D;  4PJN A;  3ZIB A;  4RDA A;  1CGM E;  4Q5S F;  3ATP A;  2IXP A;  2CNW D;  1KNY A;  3EHN A;  1VLS A;  1GQA A;  3K66 A;  3QVY A;  4BJ5 C;  2KGO A;  1APC A;  4O6N A;  1WGW A;  3RVY A;  3T6J A;  1U0B B;  4E0H A;  3B0V C;  3NDB B;  2P61 A;  5D91 A;  3I5P A;  3C8G A;  1KTM A;  3U0C A;  1E2X A;  1K04 A;  1YAU O;  3LEV A;  4DVZ A;  2R7S A;  1WAS A;  4A4A A;  4GQH A;  1ZYR F;  1SYQ A;  2Q9C A;  2XS8 A;  5B1A C;  2G3V A;  2M64 A;  2O9X A;  2W4M A;  1VYK A;  1Z7Q c;  5L0C A;  1Z63 A;  3MFN A;  3NKE A;  3NYL A;  3U9J A;  4XQ1 A;  2HSB A;  4PJJ A;  2EIM C;  2KSF A;  4PAC A;  3QVZ A;  5L0J A;  3RF3 A;  2V26 A;  4U5H A;  4EBB A;  4JTC B;  5KYW A;  2HJM A;  2J9U A;  2YQY A;  2NG1 A;  1OCC C;  3EG9 A;  4MTG A;  4U9D A;  4G7H F;  2MHR A;  1L3P A;  3M1C B;  5B3I A;  3W4Y A;  1ZVZ A;  3SYN A;  2YVK A;  2DYS C;  4J7Y A;  4B6I A;  4XPW A;  3VF0 A;  3PDM P;  1OKK A;  1QSP A;  2A0B A;  2YL3 A;  4R32 A;  2VCA A;  5AC4 A;  1HMO A;  3Q7L A;  5CIV A;  4DRH B;  5JSL A;  2YWA A;  4E17 A;  3GEE A;  2IOQ A;  3RKO F;  3RVZ A;  1VK5 A;  3Q6N A;  3S29 A;  5A6A A;  3L8J A;  3MYF A;  4UDV A;  4EKW A;  4AE4 A;  4N4W A;  3G4X A;  3PCV A;  3RQE A;  1ZHT A;  3EQL F;  3DKA A;  2RD9 A;  1F1M A;  2OJE D;  5L0I A;  3ABL C;  3HJC A;  3RQG A;  4E7S A;  2L9J A;  3GM1 A;  3MBG A;  4IAR A;  3KMI A;  3X1O A;  1LS4 A;  2I15 A;  1IW7 F;  4JVS A;  2YHS A;  1T01 A;  2PX3 A;  4HFF B;  1NFO A;  3EGX A;  2QUP A;  4DXW A;  3N2Z B;  1CPR A;  1O5H A;  1YYJ A;  3MLG A;  4O79 A;  2B0J A;  2IXO A;  2R7R A;  3W8H A;  2HS5 A;  1E84 A;  3AG1 C;  5FCL A;  4M63 A;  2OKU A;  2WVN A;  4IRU A;  1K40 A;  4C3E A;  1I4Z A;  2OJQ A;  3W2W A;  4IWB A;  1Q0G A;  4BG0 A;  1VLT A;  2LFD A;  2PP4 A;  5EGY A;  4G7Z F;  1HW2 A;  1M56 C;  3M4C A;  1NU7 D;  4I3M A;  1SR2 A;  2BC5 A;  3E9V A;  4WGZ A;  2W9Y A;  4PFP A;  3SP1 A;  3U2L A;  3M15 A;  2XL4 A;  5KYX B;  1Z6A A;  4OD5 A;  3TQO A;  5E3C A;  5L3V A;  1D1B A;  4HFK B;  1V55 C;  1LS1 A;  4DBQ A;  2L6H A;  4MVR A;  2XLH A;  2J0X A;  2KC3 A;  3EPV A;  4EBJ A;  1WAT A;  2R9R B;  2ZXR A;  4AX2 A;  1I4Y A;  2XL6 A;  2NUP B;  1OR3 A;  2XLW A;  3AOU A;  3PMR A;  5AGF A;  3EFO B;  4CSA C;  1BDJ B;  3B29 A;  4MVO A;  2Q9A A;  2IM8 A;  3UGO A;  1OXK A;  1NBB A;  1PD1 A;  3JCU Q;  3QZC A;  5JT4 A;  3VAY A;  1O3U A;  4WJ0 A;  2YL1 A;  1MMA A;  4YWQ A;  1EKY A;  3G4Z A;  3T4R A;  3DM9 B;  3LLK A;  3JSE O;  3K6B A;  4MVZ A;  2OU6 A;  1Y4C A;  2QE9 A;  1H7I A;  1RKE A;  1OCO C;  3AGT A;  3QW0 A;  4W8K A;  1OR2 A;  2C03 A;  3ZDL A;  2HMQ A;  1D0X A;  1V74 B;  3AG3 C;  1BR1 A;  3IPM O;  1PCX A;  3JYH A;  3U9M A;  2R02 A;  1XZP A;  2YLD A;  4LLE A;  1R4T A;  3GWN A;  3SNH A;  2XXA A;  3K33 A;  2A6E F;  2R7W A;  2XLV A;  2LD6 A;  3GM3 A;  1UFB A;  3Q6M A;  4NTB A;  1FFH A;  3GEI A;  1RXQ A;  4F4B A;  3TUL A;  2XLD A;  5COM A;  2AP3 A;  1VMA A;  3EGD A;  3GM2 A;  4QDL A;  3S84 A;  1L7C A;  1TR2 A;  1C03 A;  2DGJ A;  2HKV A;  2Q9B A;  2R7T A;  5BQI A;  1OXB A;  2JX0 A;  5JUA A;  3AJM A;  4LAC B;  4O6Y A;  4N6H A;  2RSE B;  3KPH A;  1QKR A;  2UUH A;  2XLE A;  3HNK A;  3LEO A;  5A6K A;  5KYY B;  4P9F A;  1KU2 A;  3AG2 C;  1FR0 A;  3U8V A;  2JD3 A;  4AK9 A;  1YZA A;  3T6G B;  3NMI A;  5KYN A;  3QTH A;  4JTA B;  4DBR A;  3MX3 A;  4YN0 B;  2Y39 A;  5IY5 C;  4IAQ A;  3OA1 A;  4G0H A;  1CGN A;  1D0Y A;  1ZW2 A;  2XRH A;  2HFI A;  2G3K A;  2OEV A;  3ZWI A;  4CDV A;  3ABM C;  4CS8 A;  5JRA A;  4BJT A;  1YVI A;  1JPJ A;  2WZF A;  3TD7 A;  1TWA A;  4HE8 D;  4CJO A;  4XTK A;  3KH2 A;  3DE8 A;  4CIP A;  3RFY A;  5A69 A;  2XS1 A;  1BR2 A;  2YLI A;  1JRA A;  2R7U A;  1Q0F A;  4JJF A;  3ZTM A;  2L6F A;  2XLO A;  4K7B A;  5DS4 A;  1CPQ A;  4E7Z A;  2L81 A;  2OEX A;  3W2V A;  3DMD A;  1S7Z A;  4C3D A;  3GOD A;  3K1I A;  5CI8 A;  5HV9 A;  3WHN A;  2WZL A;  1JR8 A;  1RJ9 B;  2YKZ A;  4JW1 A;  5HSW A;  2R05 A;  3CQZ A;  3H65 A;  5BUO A;  2P7V A;  1VTM P;  3DWW A;  1W2W A;  4JUR I;  2DI3 A;  3U2M A;  3O55 A;  4G7O F;  1TWG A;  2CCY A;  1Z5Z A; 
#chains in the Genus database with same CATH homology
 1LS4 A;  1BZ4 A;  1B68 A;  2KC3 A;  1NFO A;  3S84 A;  1OR3 A;  1LE4 A;  1LPE A;  1GS9 A;  3R2P A;  1NFN A;  1H7I A;  1OR2 A;  1EA8 A;  1EQ1 A;  1LE2 A;  1AEP A;  1YA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...