1A2KA

Gdpran-ntf2 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport/nuclear protein
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Structural basis for molecular recognition between nuclear transport factor 2 (NTF2) and the GDP-bound form of the Ras-family GTPase Ran.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 36
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a2kA00
5FW5A 5CF2A 4L7KA 3KKGA 3MHEA 2RGQA 3NUVA 4HZBB 4L8PA 4H3UA 2YFIB 3NHXA 4XB5A 1BUQA 4R9LA 2CHCA 3BLZA 4LGQA 2GEYA 3CPOA 1DMMA 4N3VA 3ER7A 1OH0A 4XBXA 3RGRA 5IG5A 4HM8B 1JKGB 1VZZA 5IENA 3OWSA 3JUPA 5AIIA 4ORLA 2W2CA 1W01A 3VSYA 1SJWA 3GZXB 4STDA 3D9RA 2K54A 2F98A 4OUQA 3FKAA 5DREA 1HKXA 3NXJA 4HM4B 3OXAA 1OHSA 5HGRA 1IDPA 5CF1A 2HMLB 5JPPA 3EX9A 3KZTA 3STDA 1O7GB 3MYTA 5IG3A 1ASKA 2QGUA 4K1UA 5G2GA 3MG2A 2I9WA 3FGYA 1S5AA 2B1XB 1QMAA 3F8HA 3EHCA 1O7PB 3F9SA 3BB9A 4K1VA 3UJMA 1JN5B 2XR8B 1GYBA 4Q53A 4XDVA 2HMOB 2XRXB 1WQLB 2PZVA 3HZPA 1AR0A 1Q40B 3FZWA 3F8XA 2RFRA 5KP4A 3GRDA 3HX8A 3EF8A 1E97A 3EJVA 3MG1A 5IEOA 4KVHA 1NWWA 5IERA 3EQQB 4HM6B 4HM7B 2OWPA 3G8ZA 3GWRA 4WWUC 1ZX2A 3B7CA 1Z1SA 4I4KA 5AIFA 4R1KA 3LZAA 5BVBA 3DUKA 4WYKB 3NV0B 2HMMB 3EN8A 3H51A 4FCJA 5KP1A 3MG3A 2HMKB 1JKGA 3CU3A 1ULJB 8CHOA 5TGNA 1CQSA 4LEHA 3FH1A 3EBYA 2UX0A 3S5CA 1E3VA 2R4IA 1K41A 4RZMA 3CNMA 2GXFA 4HKVB 3F14A 4HM0B 4X2HA 3FLJA 1U5OA 2F86B 2QIYA 3I0YA 5KP3A 3B8LA 1GY6A 3EN1B 4J8TA 2YFJB 3B4PA 5D81A 3E99A 1EG9B 3KSPA 4PEJA 5AEWB 3SOAA 2GEXA 1JB4A 3GZBA 1GY7A 1OGXA 4HM5B 3T8UA 5IF6A 5IEPA 2BNGA 2STDA 3H3HA 3JUQA 1QJGA 4U13A 5D83A 1O7HB 1NU3A 4IIAA 4XM4A 7STDA 3ECFA 4HM2B 1A2KA 3IPTA 3ROBA 5STDA 2Z7AA 5CLKA 1JN5A 5AI1A 3NBRA 1OF5A 1TP6A 4XDWA 3B4OA 1UUWB 2XSOB 1NDOB 3OX9A 6STDA 3UNLA 5CK6A 5CXOA 1STDA 2F99A 5EVHA 3DM8A 1OHPA 1OCVA 3A76A 3MSOA 1DMQA 2BMQB 3NM2A 1C7HA 2GBXB 2BMOB 3G0KA 1ZO2A 3JUOA 5IG4A 1GY5A 4HM1B 4WYKA 3NV0A 1O7WB 2IMJA 3GZRA 3DMCA 1DMNA 3RGAA 3JUNA 1W02A 1ULIB 3KE7A 3FF2A 4HZ9B 2HMNB 1JB2A 3VGNA 3GZYB 4XBYA 2INXA 2A15A 3HK4A 5DRVA 3SEDA 1EA2A 4HJLB 3WMDA 3M8CA 5D82A 1O7NB 4XBTA 2Z76A 5AEUB 3OWYA 3SOYA 1W00A 2BMRB 4HVNA 4X2OA 3K7CA 2CKFB 3F7SA 2Z77A 1OGZA 1OPYA 3T8NA 1GS3A 2GBWB 3F7XA 4CDLA 4MJDA 4FCMA 3JUMA 1E3RA 1UUVB 3EC9A 3DXOA 5AIHA 4GB5A 2YFLB 4J9AA 4OVMA 1OUNA 2HMJB 3K0ZA 1Q42A 2B24B 1W6YA 1JB5A 5IG0A 1ISKA 1Q40A 4HM3B 4R9KA 3OWUA 3CNXA 3FF0A 3LYGA 3Q90A 3OV4A 1TUHA 2JQ5A 5AIGA 1O7MB 2RCDA 3MKIA 1OF5B 5JPUA 4LMIA 3G16A 1OHOA 3DZLA 3EBTA 3F40A 2XSHB 5BXQA 4WP5A 4L8OA 3FSDA
chains in the Genus database with same CATH superfamily
5FW5A 5CF2A 4L7KA 2OOVC 3KKGA 3HOHA 3MHEA 4O8SA 5AYSC 3I553 3DGOA 2F56A 2RGQA 3NUVA 2J8XB 2WOFA 1GD4A 1I0VA 4HZBB 2CX1A 1TFOA 3ZG0A 4L8PA 3U97A 3WOEB 2D42A 3SLUA 1VQO3 4H3UA 2YFIB 4N6UA 3NHXA 4KT3B 4XB5A 3SX1A 4BTWA 3Q2PA 1BUQA 4R9LA 1FGTA 1R4CA 3CME3 1T2IA 5JBSA 2CHCA 2CC3A 4WFOA 1K8A4 2XF3A 3BLZA 3D3LA 2E2TA 4I5QA 4GL6A 1W4NA 4JRFA 4LGQA 3FG4A 1MNLA 4BTXA 2OTL3 2GEYA 3CPOA 4NHFA 2F4YA 1IVVA 1DMMA 4CCVA 3AGOA 4N3VA 1TTOA 1CEWI 3DGYA 3ER7A 2QEX3 1BSAA 1RDSA 1OH0A 4CJNA 1FZUA 4MMXB 4XBXA 1L5GB 3RGRA 4HYZA 4HM8B 5IG5A 1JKGB 2R41A 1NB3I 2ML5A 1CYUA 1VZZA 1UI8A 5IENA 3OWSA 1B2UA 2RNTA 2XGLA 3NM7A 3L0RA 5I97A 3JUPA 1VQN3 5AIIA 4ORLA 2W2CA 1RGGA 2V1LA 2W03A 3CCU3 1B2ZA 1M1XB 1WMOA 4RNZA 2CFLA 4DKIA 1W01A 2LYXA 4N6LA 1FUWA 2OOVA 2ZDJA 1TJDA 1LXEA 3VSYA 1LQMB 1DVCA 1SJWA 3D4AA 1N8R4 3GZXB 4STDA 3D9RA 1BNRA 2K54A 1IT8A 1HZ1A 2OTJ3 2XGNA 2W56A 2F98A 3CPW2 1RRHA 1FGOA 4OUQA 1QALA 3GSPA 3PXMA 4FMDA 3X42A 3K9MC 3FKAA 5DREA 1VQ83 1WNHA 1JBTA 1GOUA 4EXRA 1Y4KA 3KSED 3PCSA 1FW7A 1HKXA 3NXJA 2WOHA 4HM4B 3OXAA 3KFQC 1OHSA 4KFDA 1LRAA 1BRGA 5HGRA 1IDPA 3CC23 1QAKA 9RNTA 3X41A 3BNBA 3JVCA 2ML6A 3KN4A 5CF1A 2ZA4A 2HMLB 1US1A 4MMZB 1BVIA 5JPPA 2OQEC 3EX9A 1RTUA 2CK3H 3KZTA 3PCRA 4FMAA 1YJW3 3LT9A 3STDA 1CYVA 1O7GB 1RN7A 3MYTA 5IG3A 1RGLA 1ASKA 1GSPA 2QGUA 4K1UA 4KFFA 3LH4A 1I2EA 4RBNA 3NX0A 3S27A 4ZM8A 1BSDA 5IW9A 5G2GA 3MG2A 2I9WA 3BIRA 3FGYA 1NB5I 1YGEA 1S5AA 1W2ZA 1YIJ3 1UCLA 3GAXA 3NQZA 4R80A 6GSPA 1IT7A 1A90A 2B1XB 3S28A 1QMAA 1STFI 1UCIA 1UCKA 2RBIA 3BNEA 3F8HA 3CCV3 1Q7Y4 1IYYA 3EHCA 1O7PB 3F9SA 3LOYA 3CC73 5M19A 1VQ73 3BB9A 1MGWA 3CCM3 3SYUA 2IYJA 4K1VA 2UUGC 3BNCA 1JN5B 3UJMA 1R4YA 1W7CA 1TRQA 1SQWA 1GYBA 2XR8B 1FYSA 4Q53A 1LOYA 1I3FA 1BIRA 1F8NA 1AVKA 2CFWA 4IT7A 4TX4A 2HMOB 4XDVA 2XRXB 1WQLB 1B20A 2GSPA 3HIIA 1YJ93 3FCSB 1N8QA 2PZVA 2GU3A 3HZPA 1JJ22 1LOXA 1BRKA 3UL6A 1AR0A 2BHMA 1X1WA 3FG3A 4AKYA 2P0MA 3QK9A 1ROVA 1FUTA 4G1MB 1Q40B 3FZWA 2XFTA 3N8BA 3F8XA 2RFRA 5KP4A 1RMSA 1I2GA 3GRDA 2OQEA 1B2SA 3HX8A 1JRQA 3DY5A 3EF8A 1E97A 3EJVA 3MG1A 3G6E3 1BRSA 5IEOA 4KVHA 1NWWA 1DVDA 1FGQA 2M7OA 5IERA 3WDGB 1EUIC 3EQQB 3WA3A 1N5HA 4HM6B 4HM7B 2OWPA 3G8ZA 3WOFB 1YIT3 1PFPA 2KAAA 3GWRA 4HOHA 4WWUC 1ZX2A 2CWUA 3OW22 1RGFA 3EE1A 3MWZA 1A67A 1KSIA 1EKMA 3B7CA 1ZGXA 1Z1SA 4I4KA 4R4KA 1VQP3 3AHWA 2ZL8A 1RLSA 1MWRA 4R1KA 2W9PA 3BNDA 2PNCA 3LZAA 4JF8A 5AIFA 1TFKA 5BVBA 1T3BA 2OCTA 2F5MA 2GU1A 2Y73A 1BRNL 1DETA 1BNIA 1GOYA 3DUKA 2HMMB 1V57A 3NV0B 4FMBA 4WYKB 2AAEA 1TU5A 3EN8A 1W6GA 1BAOA 3H51A 3RNTA 3DGMA 2W9QA 2ZHXB 3MG3A 4FCJA 4FMCA 5KP1A 1K734 2HMKB 1JV2B 4N6V0 3S67A 1BRIA 1JKGA 3HI7A 1UW1A 1IVXA 3CU3A 3G4S3 1VQK3 1ULJB 3DH2A 4FCZA 8CHOA 1N5PA 5TGNA 1NNVA 4RNYA 1CQSA 4LEHA 1UGIA 3T0UA 3FH1A 3LMLA 3EBYA 4EW5A 3IMAB 2UX0A 1FGRA 1E3VA 1IVUA 2R4IA 1K41A 3S5CA 1D6YA 4RZMA 4BL2A 2SBLA 3KCHA 3CNMA 2GXFA 3A5EA 4O3VA 4HKVB 2WGOA 1I70A 3F14A 4HM0B 1Q864 4X2HA 1AVLA 1JNQA 3FLJA 1U5OA 2F86B 2QIYA 3AGNA 5M1AA 3N54B 2KF6A 4AEQA 1YJN3 3I0YA 1NJI4 3D5IA 3LTCA 5KP3A 4K61A 3S29A 1BSBA 1YVBI 2CFGA 3B8LA 4BIRA 1X1XA 1IQ8A 3D79A 3SVAA 1V58A 5M18A 5BU4A 1AV4A 1BRHA 1GY6A 1YNVX 1K28A 3X40A 3EN1B 4J8TA 2CWTA 2YFJB 2RSXA 3B4PA 1WTHA 3CXC2 5D81A 1RCKA 1HYFA 1MWUA 1EG9B 3E99A 3KSPA 4PEJA 4QWTA 5AEWB 1IK3A 2KXGA 3SOAA 2GEXA 1JB4A 2WGQA 1BUJA 2XH9A 3GZBA 4O2HA 1GY7A 3ZG5A 1G02A 3FG1A 2SARA 1B3SA 1LOVA 1OGXA 3X3ZA 1A2PA 3EB8A 1B27A 4HM5B 3T8UA 2W56B 4AKZA 4EV5A 4KZ1A 4BTYA 2BNGA 7RNTA 5IEPA 5IF6A 2STDA 2XEPA 3H3HA 3JUQA 1RSNA 1QJGA 1QVG2 1BSEA 1CH0A 4U13A 5D83A 1O7HB 1AY7A 3CCL3 1NU3A 1UI7A 4IIAA 3ZFZA 4XM4A 1G96A 7STDA 1RGEA 2QA43 2C4BA 3ECFA 1RGHA 4HM2B 1A2KA 3DGLA 1N9EA 3IPTA 3ROBA 2BO9B 5STDA 2Z7AA 1PY3A 5CLKA 1JN5A 1RNTA 5BIRA 1JZOA 3DGNA 5AYRB 1SARA 5AI1A 2CFKA 2L4VA 4LYLB 3NBRA 3IJEB 3NBBA 3MPHA 3HIGA 1OF5A 1TP6A 1MOLA 4XDWA 3B4OA 1UUWB 1IQYA 2XSOB 4LZIA 3RDEA 1NDOB 2L1SA 1YI23 2YX9A 3OX9A 4N6TA 3CD63 1QVF2 1X1YA 6STDA 1TIJA 5RNTA 3CCQ3 1BNSA 2CG0A 3UNLA 1BNJA 5CK6A 3D5GA 1V74A 1Q824 4CPKA 1K9M4 2P09A 5CXOA 2BIRA 5LC6A 1I2FA 1C54A 1AQZA 2WO0A 1STDA 2E2VA 2F99A 2KF4A 1KWIA 2W0QA 3AMOB 5EVHA 2K0MA 1M9GA 2H0HA 2CFDA 3DM8A 1PYLA 5G1LA 2FNQA 1OHPA 4NPBA 3UL5A 1OCVA 2E2UA 3A76A 3G713 2O9UX 5GSPA 3MSOA 4ILFA 1DMQA 3CCJ3 2CWVA 1EEJA 2BMQB 3NM2A 1M1K4 1RN4A 2D1WA 3ALAA 3O8YA 2CIUA 1VQM3 1LVNA 1C7HA 1W2B2 1W5ZA 3PZWA 1RGCA 1Q9EA 2GBXB 1SIIA 2H0IA 2BMOB 1RGAA 4GHOA 1DYUA 4BU4A 1S723 3G0KA 1RNBA 1ZO2A 1VQ93 3JUOA 1JBSA 5IG4A 2KF5A 1GY5A 4HM1B 3CC43 1KC84 1YGWA 1GMRA 1WMPA 3NBJA 1BSCA 5EQLA 1VQQA 4WYKA 3NV0A 1O7WB 2IMJA 3GZRA 1FUSA 3DMCA 1DMNA 2KCDA 1I8VA 3RGAA 3JUNA 1W02A 1JBRA 1ULIB 3N9HA 3PGBA 3KE7A 3FF2A 1B21A 2LQVA 3Q1CA 4HZ9B 1M904 3V98A 2C10A 2H0GA 1BANA 3V92A 3SXXA 1FA3A 2C11A 2FXTA 1RGKA 2MF7A 5ELUA 1IVWA 1RHLA 2HMNB 1LNIA 3BU4A 1DE3A 3V99A 1JB2A 1UCJA 2CX0A 5LC7A 1VQ43 2Q07A 3J7Yd 1BRJA 1GD3A 3VGNA 1D6UA 3LT8A 1SPUA 3Q3FA 3GZYB 4XBYA 3LXUX 1RRLA 1BNEA 1A2VA 1RJOA 2INXA 1EQKA 4H61A 2CH9A 2A15A 4EYCA 4IPBA 1QAFA 3HK4A 1I0XA 3CCR3 5DRVA 4LSOA 1MGRA 1N9JA 3SEDA 1IU7A 1EA2A 2P0XA 4HJLB 1B2MA 3AHSA 3WMDA 4RNTA 6RNTA 1WMNA 3M8CA 5D82A 2JDIH 1O7NB 4XBTA 2Z76A 5AEUB 1SIHA 4N6NB 3OWYA 3UB1A 3SOYA 1W00A 2BMRB 4HVNA 8RNTA 4X2OA 4NREA 3K7CA 2CKFB 3F7SA 3X3YA 3LTAA 2Z77A 1OGZA 5ELJA 3WHOA 5EEOA 3X3XA 2P38A 5FGOA 3URPA 1OPYA 4MEIA 3U1WA 3T8NA 1KD14 1GS3A 2HOHA 4HBRA 2AADA 2GBWB 3F7XA 1BGSA 2IUJA 3CCS3 2XFSA 1BU4A 4CDLA 7GSPA 5A0OB 5HOHA 1T2HA 1BNFA 4MJDA 3PYJA 4FCMA 3JUMA 2FGTA 2KF3A 3VF1A 2P05A 1T5YA 1YVSA 3K5TA 3CCE3 2KRTA 4EV2A 3WODG 1E3RA 1IQXA 1UUVB 4J5GA 3EC9A 3DXOA 1IV9A 1W6CA 1X1UA 4GB5A 5AIHA 1HU9A 2YFLB 4J9AA 4OVMA 1VQL3 1GMPA 1BNGA 1LOWA 1MWSA 1OUNA 3WR2A 2IY2A 3NQYA 2HMJB 3K0ZA 1Q42A 3WA2X 1BOXA 4O02B 1ZS7A 1PU4A 1B2XA 1Q814 2W6JH 4HAAA 1RN1A 1D6ZA 3PS8A 1LNHA 2B24B 3QRDA 3KIIA 1FGMA 1W6YA 1MWTA 4WHAA 5G1KA 2MC8A 3I563 1JB5A 5IG0A 3LTBA 1ISKA 1Q40A 4HM3B 4R9KA 1UUGB 3OWUA 4K90B 1RCLA 4KFEA 3CNXA 3AMOA 1J2BA 3FF0A 4EBGA 2IUKA 1GMQA 3TDGA 2W04A 3LYGA 1YHQ3 1UDII 2CW9A 1OACA 3Q90A 4MMYB 1ROAA 3OV4A 1TUHA 2JQ5A 2IA7A 1LQGC 4FR9A 5AIGA 1O7MB 1G0TA 2UGIA 2RCDA 3MKIA 4N6OB 1OF5B 4N6MA 2BT3A 1I3IA 5JPUA 4J5KA 1VQ53 4LMIA 1RKYA 3CMA3 2CG1A 4GSPA 3LTDA 1UGHI 3G16A 1OHOA 1TRPA 3K63A 1VQ63 3DZLA 1KQS2 4EC6A 1NO3A 2BU4A 2F5WA 2Y74A 3EBTA 2K3DA 1JZDA 3F40A 1IV7A 1GOVA 2XSHB 5BXQA 1Q7HA 1U8CB 4BL3A 4OK0A 4WP5A 2O3OA 4L8OA 2Z6BA 3FSDA
chains in the Genus database with same CATH topology
5FW5A 5CF2A 4L7KA 2OOVC 3KKGA 3MHEA 4O8SA 5AYSC 3I553 3DGOA 2RGQA 3NUVA 2WOFA 1GD4A 4HZBB 1TFOA 4L8PA 3U97A 3WOEB 2D42A 3SLUA 1VQO3 4H3UA 2YFIB 4N6UA 3NHXA 4XB5A 3SX1A 4BTWA 3Q2PA 1BUQA 4R9LA 1FGTA 1R4CA 3CME3 5JBSA 2CHCA 2CC3A 4WFOA 1K8A4 2XF3A 3BLZA 3D3LA 2E2TA 4GL6A 1W4NA 4JRFA 4LGQA 3FG4A 1MNLA 4BTXA 2OTL3 2GEYA 3CPOA 4NHFA 1IVVA 1DMMA 4CCVA 4N3VA 1CEWI 3ER7A 2QEX3 1OH0A 4MMXB 4XBXA 1L5GB 3RGRA 4HYZA 4HM8B 5IG5A 1JKGB 1NB3I 2ML5A 1CYUA 1VZZA 1UI8A 5IENA 3OWSA 3NM7A 2XGLA 3L0RA 5I97A 3JUPA 1VQN3 5AIIA 4ORLA 2W2CA 2V1LA 2W03A 3CCU3 1M1XB 1WMOA 4RNZA 2CFLA 1W01A 2LYXA 4N6LA 1FUWA 2OOVA 2ZDJA 1LXEA 3VSYA 1DVCA 1SJWA 1N8R4 3GZXB 4STDA 3D9RA 2K54A 1IT8A 2OTJ3 2XGNA 2W56A 2F98A 3CPW2 1RRHA 1FGOA 4OUQA 1QALA 3PXMA 4FMDA 3X42A 3K9MC 3FKAA 5DREA 1VQ83 1WNHA 4EXRA 1Y4KA 3KSED 3PCSA 1HKXA 3NXJA 2WOHA 4HM4B 3OXAA 3KFQC 1OHSA 4KFDA 5HGRA 3CC23 1IDPA 1QAKA 3X41A 3BNBA 3JVCA 2ML6A 3KN4A 5CF1A 2HMLB 1US1A 4MMZB 5JPPA 2OQEC 3EX9A 2CK3H 3KZTA 3PCRA 4FMAA 1YJW3 3LT9A 3STDA 1CYVA 1O7GB 1RN7A 3MYTA 5IG3A 1ASKA 2QGUA 4K1UA 4KFFA 3LH4A 4RBNA 3NX0A 3S27A 4ZM8A 5IW9A 5G2GA 3MG2A 2I9WA 3FGYA 1NB5I 1YGEA 1S5AA 1W2ZA 1YIJ3 3GAXA 3NQZA 4R80A 1IT7A 1A90A 2B1XB 3S28A 1QMAA 1STFI 3F8HA 3BNEA 1Q7Y4 1VQ63 3CCV3 3EHCA 1O7PB 3F9SA 3LOYA 3CC73 1VQ73 3BB9A 3CCM3 4K1VA 3BNCA 3UJMA 1JN5B 1W7CA 1SQWA 2XR8B 1GYBA 4Q53A 1F8NA 4XDVA 1AVKA 2CFWA 4IT7A 4TX4A 2HMOB 2XRXB 1WQLB 3HIIA 1YJ93 3FCSB 1N8QA 2PZVA 2GU3A 3HZPA 1JJ22 1LOXA 3UL6A 1AR0A 2BHMA 3FG3A 4AKYA 2P0MA 3QK9A 1ROVA 4G1MB 1Q40B 3FZWA 2XFTA 3N8BA 3F8XA 2RFRA 5KP4A 2OQEA 3GRDA 3HX8A 1JRQA 3DY5A 3EF8A 1E97A 3EJVA 3MG1A 3G6E3 5IEOA 4KVHA 1NWWA 1DVDA 1FGQA 2M7OA 5IERA 3WDGB 3EQQB 3WA3A 1N5HA 4HM6B 4HM7B 2OWPA 3G8ZA 3WOFB 1YIT3 1PFPA 3GWRA 4WWUC 1ZX2A 2CWUA 3OW22 3EE1A 3MWZA 1A67A 1KSIA 1EKMA 3B7CA 1Z1SA 4I4KA 4R4KA 1VQP3 2ZL8A 5AIFA 4R1KA 2W9PA 3BNDA 2PNCA 3LZAA 4JF8A 1TFKA 5BVBA 2Y73A 2OCTA 2GU1A 3DUKA 4WYKB 3NV0B 2HMMB 4FMBA 1TU5A 3EN8A 1W6GA 3H51A 3DGMA 2W9QA 4FCJA 3MG3A 5KP1A 4FMCA 1K734 2HMKB 1JV2B 4N6V0 3S67A 3HI7A 1JKGA 1UW1A 1IVXA 3CU3A 3G4S3 1VQK3 1ULJB 4FCZA 8CHOA 1N5PA 5TGNA 4RNYA 1CQSA 4LEHA 3T0UA 3FH1A 3LMLA 3EBYA 3IMAB 2UX0A 1FGRA 1E3VA 1IVUA 2R4IA 1K41A 3S5CA 1D6YA 4RZMA 2SBLA 3CNMA 2GXFA 4O3VA 4HKVB 2WGOA 3F14A 4HM0B 1Q864 4X2HA 1AVLA 1JNQA 3FLJA 1U5OA 2F86B 2QIYA 4AEQA 1YJN3 3N54B 3I0YA 1NJI4 3LTCA 5KP3A 4K61A 3S29A 2CFGA 1YVBI 3B8LA 1IQ8A 3SVAA 1AV4A 1GY6A 1K28A 3X40A 3EN1B 4J8TA 2CWTA 2YFJB 2RSXA 3B4PA 1WTHA 3CXC2 5D81A 3E99A 1EG9B 3KSPA 4PEJA 4QWTA 5AEWB 1IK3A 2KXGA 3SOAA 2GEXA 1JB4A 2WGQA 2XH9A 3GZBA 4O2HA 1GY7A 3FG1A 1OGXA 3X3ZA 3EB8A 4AKZA 4HM5B 3T8UA 2W56B 4EV5A 5IEPA 4KZ1A 4BTYA 2BNGA 5IF6A 2STDA 2XEPA 3H3HA 3JUQA 1QJGA 1QVG2 4U13A 5D83A 1O7HB 3CCL3 1NU3A 1UI7A 4IIAA 4XM4A 1G96A 7STDA 2QA43 3ECFA 4HM2B 1A2KA 3DGLA 1N9EA 3IPTA 3ROBA 2BO9B 5STDA 2Z7AA 5CLKA 1JN5A 3DGNA 5AYRB 5AI1A 2CFKA 2L4VA 3NBRA 3IJEB 3NBBA 3MPHA 3HIGA 1OF5A 1TP6A 1MOLA 4XDWA 3B4OA 1UUWB 1IQYA 2XSOB 4LZIA 3RDEA 1NDOB 1YI23 2YX9A 3OX9A 4N6TA 3CD63 1QVF2 6STDA 1TIJA 3CCQ3 2CG0A 3UNLA 5CK6A 1V74A 1Q824 1K9M4 2P09A 5CXOA 5LC6A 2WO0A 1STDA 2E2VA 2F99A 2W0QA 3AMOB 1KWIA 5EVHA 2K0MA 1M9GA 2CFDA 3DM8A 2FNQA 1OHPA 3UL5A 1OCVA 2E2UA 3A76A 3G713 2O9UX 3CCJ3 3MSOA 1DMQA 2CWVA 2BMQB 3NM2A 1M1K4 2D1WA 3ALAA 3O8YA 2CIUA 1VQM3 1LVNA 1C7HA 1W2B2 1W5ZA 3PZWA 2GBXB 1SIIA 2BMOB 1DYUA 1S723 3G0KA 1ZO2A 1VQ93 3JUOA 5IG4A 1GY5A 4HM1B 3CC43 1KC84 1WMPA 3NBJA 5EQLA 4WYKA 3NV0A 1O7WB 2IMJA 3GZRA 3DMCA 1DMNA 2KCDA 3RGAA 3JUNA 1W02A 1ULIB 3N9HA 3PGBA 3KE7A 3FF2A 2LQVA 4HZ9B 3Q1CA 1M904 3V98A 2C10A 3V92A 3SXXA 1FA3A 2C11A 2FXTA 2MF7A 5ELUA 1IVWA 2HMNB 3V99A 1JB2A 5LC7A 1VQ43 2Q07A 3J7Yd 1GD3A 3VGNA 1D6UA 3LT8A 1SPUA 3GZYB 4XBYA 3LXUX 1RRLA 2INXA 1A2VA 1RJOA 1EQKA 4H61A 2CH9A 2A15A 4EYCA 4IPBA 1QAFA 3HK4A 3CCR3 5DRVA 4LSOA 1N9JA 3SEDA 1IU7A 1EA2A 2P0XA 4HJLB 3WMDA 1WMNA 3M8CA 5D82A 2JDIH 1O7NB 4XBTA 2Z76A 5AEUB 1SIHA 4N6NB 3OWYA 3UB1A 3SOYA 1W00A 2BMRB 4HVNA 4X2OA 4NREA 3K7CA 2CKFB 3F7SA 3X3YA 3LTAA 2Z77A 1OGZA 5ELJA 5EEOA 3X3XA 2P38A 5FGOA 1OPYA 4MEIA 3U1WA 3T8NA 1KD14 1GS3A 4HBRA 2GBWB 3F7XA 2IUJA 3CCS3 2XFSA 4CDLA 5A0OB 4MJDA 3PYJA 4FCMA 3JUMA 2FGTA 3VF1A 2P05A 1T5YA 3K5TA 3CCE3 2KRTA 4EV2A 3WODG 1E3RA 1IQXA 1UUVB 3EC9A 3DXOA 1IV9A 1W6CA 5AIHA 4GB5A 1HU9A 2YFLB 4J9AA 4OVMA 1VQL3 1OUNA 3NQYA 2HMJB 3K0ZA 1Q42A 3WA2X 4O02B 1PU4A 1Q814 2W6JH 1D6ZA 3PS8A 1LNHA 2B24B 3QRDA 3KIIA 1FGMA 1W6YA 4WHAA 3I563 2MC8A 1JB5A 5IG0A 3LTBA 1ISKA 1Q40A 4HM3B 4R9KA 3OWUA 4K90B 4KFEA 3CNXA 3AMOA 1J2BA 3FF0A 4EBGA 2IUKA 3TDGA 2W04A 3LYGA 1YHQ3 2CW9A 1OACA 3Q90A 4MMYB 1ROAA 3OV4A 1TUHA 2JQ5A 2IA7A 4FR9A 5AIGA 1O7MB 2RCDA 3MKIA 4N6OB 1OF5B 4N6MA 2BT3A 5JPUA 1VQ53 4LMIA 1RKYA 3CMA3 2CG1A 3LTDA 3G16A 1OHOA 3K63A 3DZLA 1KQS2 4EC6A 1NO3A 3EBTA 2Y74A 3F40A 1IV7A 2XSHB 5BXQA 1U8CB 4OK0A 4WP5A 2O3OA 4L8OA 2Z6BA 3FSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW5 A;  5CF2 A;  4L7K A;  3KKG A;  3MHE A;  2RGQ A;  3NUV A;  4HZB B;  4L8P A;  4H3U A;  2YFI B;  3NHX A;  4XB5 A;  1BUQ A;  4R9L A;  2CHC A;  3BLZ A;  4LGQ A;  2GEY A;  3CPO A;  1DMM A;  4N3V A;  3ER7 A;  1OH0 A;  4XBX A;  3RGR A;  5IG5 A;  4HM8 B;  1JKG B;  1VZZ A;  5IEN A;  3OWS A;  3JUP A;  5AII A;  4ORL A;  2W2C A;  1W01 A;  3VSY A;  1SJW A;  3GZX B;  4STD A;  3D9R A;  2K54 A;  2F98 A;  4OUQ A;  3FKA A;  5DRE A;  1HKX A;  3NXJ A;  4HM4 B;  3OXA A;  1OHS A;  5HGR A;  1IDP A;  5CF1 A;  2HML B;  5JPP A;  3EX9 A;  3KZT A;  3STD A;  1O7G B;  3MYT A;  5IG3 A;  1ASK A;  2QGU A;  4K1U A;  5G2G A;  3MG2 A;  2I9W A;  3FGY A;  1S5A A;  2B1X B;  1QMA A;  3F8H A;  3EHC A;  1O7P B;  3F9S A;  3BB9 A;  4K1V A;  3UJM A;  1JN5 B;  2XR8 B;  1GYB A;  4Q53 A;  4XDV A;  2HMO B;  2XRX B;  1WQL B;  2PZV A;  3HZP A;  1AR0 A;  1Q40 B;  3FZW A;  3F8X A;  2RFR A;  5KP4 A;  3GRD A;  3HX8 A;  3EF8 A;  1E97 A;  3EJV A;  3MG1 A;  5IEO A;  4KVH A;  1NWW A;  5IER A;  3EQQ B;  4HM6 B;  4HM7 B;  2OWP A;  3G8Z A;  3GWR A;  4WWU C;  1ZX2 A;  3B7C A;  1Z1S A;  4I4K A;  5AIF A;  4R1K A;  3LZA A;  5BVB A;  3DUK A;  4WYK B;  3NV0 B;  2HMM B;  3EN8 A;  3H51 A;  4FCJ A;  5KP1 A;  3MG3 A;  2HMK B;  1JKG A;  3CU3 A;  1ULJ B;  8CHO A;  5TGN A;  1CQS A;  4LEH A;  3FH1 A;  3EBY A;  2UX0 A;  3S5C A;  1E3V A;  2R4I A;  1K41 A;  4RZM A;  3CNM A;  2GXF A;  4HKV B;  3F14 A;  4HM0 B;  4X2H A;  3FLJ A;  1U5O A;  2F86 B;  2QIY A;  3I0Y A;  5KP3 A;  3B8L A;  1GY6 A;  3EN1 B;  4J8T A;  2YFJ B;  3B4P A;  5D81 A;  3E99 A;  1EG9 B;  3KSP A;  4PEJ A;  5AEW B;  3SOA A;  2GEX A;  1JB4 A;  3GZB A;  1GY7 A;  1OGX A;  4HM5 B;  3T8U A;  5IF6 A;  5IEP A;  2BNG A;  2STD A;  3H3H A;  3JUQ A;  1QJG A;  4U13 A;  5D83 A;  1O7H B;  1NU3 A;  4IIA A;  4XM4 A;  7STD A;  3ECF A;  4HM2 B;  1A2K A;  3IPT A;  3ROB A;  5STD A;  2Z7A A;  5CLK A;  1JN5 A;  5AI1 A;  3NBR A;  1OF5 A;  1TP6 A;  4XDW A;  3B4O A;  1UUW B;  2XSO B;  1NDO B;  3OX9 A;  6STD A;  3UNL A;  5CK6 A;  5CXO A;  1STD A;  2F99 A;  5EVH A;  3DM8 A;  1OHP A;  1OCV A;  3A76 A;  3MSO A;  1DMQ A;  2BMQ B;  3NM2 A;  1C7H A;  2GBX B;  2BMO B;  3G0K A;  1ZO2 A;  3JUO A;  5IG4 A;  1GY5 A;  4HM1 B;  4WYK A;  3NV0 A;  1O7W B;  2IMJ A;  3GZR A;  3DMC A;  1DMN A;  3RGA A;  3JUN A;  1W02 A;  1ULI B;  3KE7 A;  3FF2 A;  4HZ9 B;  2HMN B;  1JB2 A;  3VGN A;  3GZY B;  4XBY A;  2INX A;  2A15 A;  3HK4 A;  5DRV A;  3SED A;  1EA2 A;  4HJL B;  3WMD A;  3M8C A;  5D82 A;  1O7N B;  4XBT A;  2Z76 A;  5AEU B;  3OWY A;  3SOY A;  1W00 A;  2BMR B;  4HVN A;  4X2O A;  3K7C A;  2CKF B;  3F7S A;  2Z77 A;  1OGZ A;  1OPY A;  3T8N A;  1GS3 A;  2GBW B;  3F7X A;  4CDL A;  4MJD A;  4FCM A;  3JUM A;  1E3R A;  1UUV B;  3EC9 A;  3DXO A;  5AIH A;  4GB5 A;  2YFL B;  4J9A A;  4OVM A;  1OUN A;  2HMJ B;  3K0Z A;  1Q42 A;  2B24 B;  1W6Y A;  1JB5 A;  5IG0 A;  1ISK A;  1Q40 A;  4HM3 B;  4R9K A;  3OWU A;  3CNX A;  3FF0 A;  3LYG A;  3Q90 A;  3OV4 A;  1TUH A;  2JQ5 A;  5AIG A;  1O7M B;  2RCD A;  3MKI A;  1OF5 B;  5JPU A;  4LMI A;  3G16 A;  1OHO A;  3DZL A;  3EBT A;  3F40 A;  2XSH B;  5BXQ A;  4WP5 A;  4L8O A;  3FSD A; 
#chains in the Genus database with same CATH topology
 5FW5 A;  5CF2 A;  4L7K A;  2OOV C;  3KKG A;  3HOH A;  3MHE A;  4O8S A;  5AYS C;  3I55 3;  3DGO A;  2F56 A;  2RGQ A;  3NUV A;  2J8X B;  2WOF A;  1GD4 A;  1I0V A;  4HZB B;  2CX1 A;  1TFO A;  3ZG0 A;  4L8P A;  3U97 A;  3WOE B;  2D42 A;  3SLU A;  1VQO 3;  4H3U A;  2YFI B;  4N6U A;  3NHX A;  4KT3 B;  4XB5 A;  3SX1 A;  4BTW A;  3Q2P A;  1BUQ A;  4R9L A;  1FGT A;  1R4C A;  3CME 3;  1T2I A;  5JBS A;  2CHC A;  2CC3 A;  4WFO A;  1K8A 4;  2XF3 A;  3BLZ A;  3D3L A;  2E2T A;  4I5Q A;  4GL6 A;  1W4N A;  4JRF A;  4LGQ A;  3FG4 A;  1MNL A;  4BTX A;  2OTL 3;  2GEY A;  3CPO A;  4NHF A;  2F4Y A;  1IVV A;  1DMM A;  4CCV A;  3AGO A;  4N3V A;  1TTO A;  1CEW I;  3DGY A;  3ER7 A;  2QEX 3;  1BSA A;  1RDS A;  1OH0 A;  4CJN A;  1FZU A;  4MMX B;  4XBX A;  1L5G B;  3RGR A;  4HYZ A;  4HM8 B;  5IG5 A;  1JKG B;  2R41 A;  1NB3 I;  2ML5 A;  1CYU A;  1VZZ A;  1UI8 A;  5IEN A;  3OWS A;  1B2U A;  2RNT A;  2XGL A;  3NM7 A;  3L0R A;  5I97 A;  3JUP A;  1VQN 3;  5AII A;  4ORL A;  2W2C A;  1RGG A;  2V1L A;  2W03 A;  3CCU 3;  1B2Z A;  1M1X B;  1WMO A;  4RNZ A;  2CFL A;  4DKI A;  1W01 A;  2LYX A;  4N6L A;  1FUW A;  2OOV A;  2ZDJ A;  1TJD A;  1LXE A;  3VSY A;  1LQM B;  1DVC A;  1SJW A;  3D4A A;  1N8R 4;  3GZX B;  4STD A;  3D9R A;  1BNR A;  2K54 A;  1IT8 A;  1HZ1 A;  2OTJ 3;  2XGN A;  2W56 A;  2F98 A;  3CPW 2;  1RRH A;  1FGO A;  4OUQ A;  1QAL A;  3GSP A;  3PXM A;  4FMD A;  3X42 A;  3K9M C;  3FKA A;  5DRE A;  1VQ8 3;  1WNH A;  1JBT A;  1GOU A;  4EXR A;  1Y4K A;  3KSE D;  3PCS A;  1FW7 A;  1HKX A;  3NXJ A;  2WOH A;  4HM4 B;  3OXA A;  3KFQ C;  1OHS A;  4KFD A;  1LRA A;  1BRG A;  5HGR A;  1IDP A;  3CC2 3;  1QAK A;  9RNT A;  3X41 A;  3BNB A;  3JVC A;  2ML6 A;  3KN4 A;  5CF1 A;  2ZA4 A;  2HML B;  1US1 A;  4MMZ B;  1BVI A;  5JPP A;  2OQE C;  3EX9 A;  1RTU A;  2CK3 H;  3KZT A;  3PCR A;  4FMA A;  1YJW 3;  3LT9 A;  3STD A;  1CYV A;  1O7G B;  1RN7 A;  3MYT A;  5IG3 A;  1RGL A;  1ASK A;  1GSP A;  2QGU A;  4K1U A;  4KFF A;  3LH4 A;  1I2E A;  4RBN A;  3NX0 A;  3S27 A;  4ZM8 A;  1BSD A;  5IW9 A;  5G2G A;  3MG2 A;  2I9W A;  3BIR A;  3FGY A;  1NB5 I;  1YGE A;  1S5A A;  1W2Z A;  1YIJ 3;  1UCL A;  3GAX A;  3NQZ A;  4R80 A;  6GSP A;  1IT7 A;  1A90 A;  2B1X B;  3S28 A;  1QMA A;  1STF I;  1UCI A;  1UCK A;  2RBI A;  3BNE A;  3F8H A;  3CCV 3;  1Q7Y 4;  1IYY A;  3EHC A;  1O7P B;  3F9S A;  3LOY A;  3CC7 3;  5M19 A;  1VQ7 3;  3BB9 A;  1MGW A;  3CCM 3;  3SYU A;  2IYJ A;  4K1V A;  2UUG C;  3BNC A;  1JN5 B;  3UJM A;  1R4Y A;  1W7C A;  1TRQ A;  1SQW A;  1GYB A;  2XR8 B;  1FYS A;  4Q53 A;  1LOY A;  1I3F A;  1BIR A;  1F8N A;  1AVK A;  2CFW A;  4IT7 A;  4TX4 A;  2HMO B;  4XDV A;  2XRX B;  1WQL B;  1B20 A;  2GSP A;  3HII A;  1YJ9 3;  3FCS B;  1N8Q A;  2PZV A;  2GU3 A;  3HZP A;  1JJ2 2;  1LOX A;  1BRK A;  3UL6 A;  1AR0 A;  2BHM A;  1X1W A;  3FG3 A;  4AKY A;  2P0M A;  3QK9 A;  1ROV A;  1FUT A;  4G1M B;  1Q40 B;  3FZW A;  2XFT A;  3N8B A;  3F8X A;  2RFR A;  5KP4 A;  1RMS A;  1I2G A;  3GRD A;  2OQE A;  1B2S A;  3HX8 A;  1JRQ A;  3DY5 A;  3EF8 A;  1E97 A;  3EJV A;  3MG1 A;  3G6E 3;  1BRS A;  5IEO A;  4KVH A;  1NWW A;  1DVD A;  1FGQ A;  2M7O A;  5IER A;  3WDG B;  1EUI C;  3EQQ B;  3WA3 A;  1N5H A;  4HM6 B;  4HM7 B;  2OWP A;  3G8Z A;  3WOF B;  1YIT 3;  1PFP A;  2KAA A;  3GWR A;  4HOH A;  4WWU C;  1ZX2 A;  2CWU A;  3OW2 2;  1RGF A;  3EE1 A;  3MWZ A;  1A67 A;  1KSI A;  1EKM A;  3B7C A;  1ZGX A;  1Z1S A;  4I4K A;  4R4K A;  1VQP 3;  3AHW A;  2ZL8 A;  1RLS A;  1MWR A;  4R1K A;  2W9P A;  3BND A;  2PNC A;  3LZA A;  4JF8 A;  5AIF A;  1TFK A;  5BVB A;  1T3B A;  2OCT A;  2F5M A;  2GU1 A;  2Y73 A;  1BRN L;  1DET A;  1BNI A;  1GOY A;  3DUK A;  2HMM B;  1V57 A;  3NV0 B;  4FMB A;  4WYK B;  2AAE A;  1TU5 A;  3EN8 A;  1W6G A;  1BAO A;  3H51 A;  3RNT A;  3DGM A;  2W9Q A;  2ZHX B;  3MG3 A;  4FCJ A;  4FMC A;  5KP1 A;  1K73 4;  2HMK B;  1JV2 B;  4N6V 0;  3S67 A;  1BRI A;  1JKG A;  3HI7 A;  1UW1 A;  1IVX A;  3CU3 A;  3G4S 3;  1VQK 3;  1ULJ B;  3DH2 A;  4FCZ A;  8CHO A;  1N5P A;  5TGN A;  1NNV A;  4RNY A;  1CQS A;  4LEH A;  1UGI A;  3T0U A;  3FH1 A;  3LML A;  3EBY A;  4EW5 A;  3IMA B;  2UX0 A;  1FGR A;  1E3V A;  1IVU A;  2R4I A;  1K41 A;  3S5C A;  1D6Y A;  4RZM A;  4BL2 A;  2SBL A;  3KCH A;  3CNM A;  2GXF A;  3A5E A;  4O3V A;  4HKV B;  2WGO A;  1I70 A;  3F14 A;  4HM0 B;  1Q86 4;  4X2H A;  1AVL A;  1JNQ A;  3FLJ A;  1U5O A;  2F86 B;  2QIY A;  3AGN A;  5M1A A;  3N54 B;  2KF6 A;  4AEQ A;  1YJN 3;  3I0Y A;  1NJI 4;  3D5I A;  3LTC A;  5KP3 A;  4K61 A;  3S29 A;  1BSB A;  1YVB I;  2CFG A;  3B8L A;  4BIR A;  1X1X A;  1IQ8 A;  3D79 A;  3SVA A;  1V58 A;  5M18 A;  5BU4 A;  1AV4 A;  1BRH A;  1GY6 A;  1YNV X;  1K28 A;  3X40 A;  3EN1 B;  4J8T A;  2CWT A;  2YFJ B;  2RSX A;  3B4P A;  1WTH A;  3CXC 2;  5D81 A;  1RCK A;  1HYF A;  1MWU A;  1EG9 B;  3E99 A;  3KSP A;  4PEJ A;  4QWT A;  5AEW B;  1IK3 A;  2KXG A;  3SOA A;  2GEX A;  1JB4 A;  2WGQ A;  1BUJ A;  2XH9 A;  3GZB A;  4O2H A;  1GY7 A;  3ZG5 A;  1G02 A;  3FG1 A;  2SAR A;  1B3S A;  1LOV A;  1OGX A;  3X3Z A;  1A2P A;  3EB8 A;  1B27 A;  4HM5 B;  3T8U A;  2W56 B;  4AKZ A;  4EV5 A;  4KZ1 A;  4BTY A;  2BNG A;  7RNT A;  5IEP A;  5IF6 A;  2STD A;  2XEP A;  3H3H A;  3JUQ A;  1RSN A;  1QJG A;  1QVG 2;  1BSE A;  1CH0 A;  4U13 A;  5D83 A;  1O7H B;  1AY7 A;  3CCL 3;  1NU3 A;  1UI7 A;  4IIA A;  3ZFZ A;  4XM4 A;  1G96 A;  7STD A;  1RGE A;  2QA4 3;  2C4B A;  3ECF A;  1RGH A;  4HM2 B;  1A2K A;  3DGL A;  1N9E A;  3IPT A;  3ROB A;  2BO9 B;  5STD A;  2Z7A A;  1PY3 A;  5CLK A;  1JN5 A;  1RNT A;  5BIR A;  1JZO A;  3DGN A;  5AYR B;  1SAR A;  5AI1 A;  2CFK A;  2L4V A;  4LYL B;  3NBR A;  3IJE B;  3NBB A;  3MPH A;  3HIG A;  1OF5 A;  1TP6 A;  1MOL A;  4XDW A;  3B4O A;  1UUW B;  1IQY A;  2XSO B;  4LZI A;  3RDE A;  1NDO B;  2L1S A;  1YI2 3;  2YX9 A;  3OX9 A;  4N6T A;  3CD6 3;  1QVF 2;  1X1Y A;  6STD A;  1TIJ A;  5RNT A;  3CCQ 3;  1BNS A;  2CG0 A;  3UNL A;  1BNJ A;  5CK6 A;  3D5G A;  1V74 A;  1Q82 4;  4CPK A;  1K9M 4;  2P09 A;  5CXO A;  2BIR A;  5LC6 A;  1I2F A;  1C54 A;  1AQZ A;  2WO0 A;  1STD A;  2E2V A;  2F99 A;  2KF4 A;  1KWI A;  2W0Q A;  3AMO B;  5EVH A;  2K0M A;  1M9G A;  2H0H A;  2CFD A;  3DM8 A;  1PYL A;  5G1L A;  2FNQ A;  1OHP A;  4NPB A;  3UL5 A;  1OCV A;  2E2U A;  3A76 A;  3G71 3;  2O9U X;  5GSP A;  3MSO A;  4ILF A;  1DMQ A;  3CCJ 3;  2CWV A;  1EEJ A;  2BMQ B;  3NM2 A;  1M1K 4;  1RN4 A;  2D1W A;  3ALA A;  3O8Y A;  2CIU A;  1VQM 3;  1LVN A;  1C7H A;  1W2B 2;  1W5Z A;  3PZW A;  1RGC A;  1Q9E A;  2GBX B;  1SII A;  2H0I A;  2BMO B;  1RGA A;  4GHO A;  1DYU A;  4BU4 A;  1S72 3;  3G0K A;  1RNB A;  1ZO2 A;  1VQ9 3;  3JUO A;  1JBS A;  5IG4 A;  2KF5 A;  1GY5 A;  4HM1 B;  3CC4 3;  1KC8 4;  1YGW A;  1GMR A;  1WMP A;  3NBJ A;  1BSC A;  5EQL A;  1VQQ A;  4WYK A;  3NV0 A;  1O7W B;  2IMJ A;  3GZR A;  1FUS A;  3DMC A;  1DMN A;  2KCD A;  1I8V A;  3RGA A;  3JUN A;  1W02 A;  1JBR A;  1ULI B;  3N9H A;  3PGB A;  3KE7 A;  3FF2 A;  1B21 A;  2LQV A;  3Q1C A;  4HZ9 B;  1M90 4;  3V98 A;  2C10 A;  2H0G A;  1BAN A;  3V92 A;  3SXX A;  1FA3 A;  2C11 A;  2FXT A;  1RGK A;  2MF7 A;  5ELU A;  1IVW A;  1RHL A;  2HMN B;  1LNI A;  3BU4 A;  1DE3 A;  3V99 A;  1JB2 A;  1UCJ A;  2CX0 A;  5LC7 A;  1VQ4 3;  2Q07 A;  3J7Y d;  1BRJ A;  1GD3 A;  3VGN A;  1D6U A;  3LT8 A;  1SPU A;  3Q3F A;  3GZY B;  4XBY A;  3LXU X;  1RRL A;  1BNE A;  1A2V A;  1RJO A;  2INX A;  1EQK A;  4H61 A;  2CH9 A;  2A15 A;  4EYC A;  4IPB A;  1QAF A;  3HK4 A;  1I0X A;  3CCR 3;  5DRV A;  4LSO A;  1MGR A;  1N9J A;  3SED A;  1IU7 A;  1EA2 A;  2P0X A;  4HJL B;  1B2M A;  3AHS A;  3WMD A;  4RNT A;  6RNT A;  1WMN A;  3M8C A;  5D82 A;  2JDI H;  1O7N B;  4XBT A;  2Z76 A;  5AEU B;  1SIH A;  4N6N B;  3OWY A;  3UB1 A;  3SOY A;  1W00 A;  2BMR B;  4HVN A;  8RNT A;  4X2O A;  4NRE A;  3K7C A;  2CKF B;  3F7S A;  3X3Y A;  3LTA A;  2Z77 A;  1OGZ A;  5ELJ A;  3WHO A;  5EEO A;  3X3X A;  2P38 A;  5FGO A;  3URP A;  1OPY A;  4MEI A;  3U1W A;  3T8N A;  1KD1 4;  1GS3 A;  2HOH A;  4HBR A;  2AAD A;  2GBW B;  3F7X A;  1BGS A;  2IUJ A;  3CCS 3;  2XFS A;  1BU4 A;  4CDL A;  7GSP A;  5A0O B;  5HOH A;  1T2H A;  1BNF A;  4MJD A;  3PYJ A;  4FCM A;  3JUM A;  2FGT A;  2KF3 A;  3VF1 A;  2P05 A;  1T5Y A;  1YVS A;  3K5T A;  3CCE 3;  2KRT A;  4EV2 A;  3WOD G;  1E3R A;  1IQX A;  1UUV B;  4J5G A;  3EC9 A;  3DXO A;  1IV9 A;  1W6C A;  1X1U A;  4GB5 A;  5AIH A;  1HU9 A;  2YFL B;  4J9A A;  4OVM A;  1VQL 3;  1GMP A;  1BNG A;  1LOW A;  1MWS A;  1OUN A;  3WR2 A;  2IY2 A;  3NQY A;  2HMJ B;  3K0Z A;  1Q42 A;  3WA2 X;  1BOX A;  4O02 B;  1ZS7 A;  1PU4 A;  1B2X A;  1Q81 4;  2W6J H;  4HAA A;  1RN1 A;  1D6Z A;  3PS8 A;  1LNH A;  2B24 B;  3QRD A;  3KII A;  1FGM A;  1W6Y A;  1MWT A;  4WHA A;  5G1K A;  2MC8 A;  3I56 3;  1JB5 A;  5IG0 A;  3LTB A;  1ISK A;  1Q40 A;  4HM3 B;  4R9K A;  1UUG B;  3OWU A;  4K90 B;  1RCL A;  4KFE A;  3CNX A;  3AMO A;  1J2B A;  3FF0 A;  4EBG A;  2IUK A;  1GMQ A;  3TDG A;  2W04 A;  3LYG A;  1YHQ 3;  1UDI I;  2CW9 A;  1OAC A;  3Q90 A;  4MMY B;  1ROA A;  3OV4 A;  1TUH A;  2JQ5 A;  2IA7 A;  1LQG C;  4FR9 A;  5AIG A;  1O7M B;  1G0T A;  2UGI A;  2RCD A;  3MKI A;  4N6O B;  1OF5 B;  4N6M A;  2BT3 A;  1I3I A;  5JPU A;  4J5K A;  1VQ5 3;  4LMI A;  1RKY A;  3CMA 3;  2CG1 A;  4GSP A;  3LTD A;  1UGH I;  3G16 A;  1OHO A;  1TRP A;  3K63 A;  1VQ6 3;  3DZL A;  1KQS 2;  4EC6 A;  1NO3 A;  2BU4 A;  2F5W A;  2Y74 A;  3EBT A;  2K3D A;  1JZD A;  3F40 A;  1IV7 A;  1GOV A;  2XSH B;  5BXQ A;  1Q7H A;  1U8C B;  4BL3 A;  4OK0 A;  4WP5 A;  2O3O A;  4L8O A;  2Z6B A;  3FSD A; 
#chains in the Genus database with same CATH homology
 5FW5 A;  5CF2 A;  4L7K A;  2OOV C;  3KKG A;  3MHE A;  4O8S A;  5AYS C;  3I55 3;  3DGO A;  2RGQ A;  3NUV A;  2WOF A;  1GD4 A;  4HZB B;  1TFO A;  4L8P A;  3U97 A;  3WOE B;  2D42 A;  3SLU A;  1VQO 3;  4H3U A;  2YFI B;  4N6U A;  3NHX A;  4XB5 A;  3SX1 A;  4BTW A;  3Q2P A;  1BUQ A;  4R9L A;  1FGT A;  1R4C A;  3CME 3;  5JBS A;  2CHC A;  2CC3 A;  4WFO A;  1K8A 4;  2XF3 A;  3BLZ A;  3D3L A;  2E2T A;  4GL6 A;  1W4N A;  4JRF A;  4LGQ A;  3FG4 A;  1MNL A;  4BTX A;  2OTL 3;  2GEY A;  3CPO A;  4NHF A;  1IVV A;  1DMM A;  4CCV A;  4N3V A;  1CEW I;  3ER7 A;  2QEX 3;  1OH0 A;  4MMX B;  4XBX A;  1L5G B;  3RGR A;  4HYZ A;  4HM8 B;  5IG5 A;  1JKG B;  1NB3 I;  2ML5 A;  1CYU A;  1VZZ A;  1UI8 A;  5IEN A;  3OWS A;  3NM7 A;  2XGL A;  3L0R A;  5I97 A;  3JUP A;  1VQN 3;  5AII A;  4ORL A;  2W2C A;  2V1L A;  2W03 A;  3CCU 3;  1M1X B;  1WMO A;  4RNZ A;  2CFL A;  1W01 A;  2LYX A;  4N6L A;  1FUW A;  2OOV A;  2ZDJ A;  1LXE A;  3VSY A;  1DVC A;  1SJW A;  1N8R 4;  3GZX B;  4STD A;  3D9R A;  2K54 A;  1IT8 A;  2OTJ 3;  2XGN A;  2W56 A;  2F98 A;  3CPW 2;  1RRH A;  1FGO A;  4OUQ A;  1QAL A;  3PXM A;  4FMD A;  3X42 A;  3K9M C;  3FKA A;  5DRE A;  1VQ8 3;  1WNH A;  4EXR A;  1Y4K A;  3KSE D;  3PCS A;  1HKX A;  3NXJ A;  2WOH A;  4HM4 B;  3OXA A;  3KFQ C;  1OHS A;  4KFD A;  5HGR A;  3CC2 3;  1IDP A;  1QAK A;  3X41 A;  3BNB A;  3JVC A;  2ML6 A;  3KN4 A;  5CF1 A;  2HML B;  1US1 A;  4MMZ B;  5JPP A;  2OQE C;  3EX9 A;  2CK3 H;  3KZT A;  3PCR A;  4FMA A;  1YJW 3;  3LT9 A;  3STD A;  1CYV A;  1O7G B;  1RN7 A;  3MYT A;  5IG3 A;  1ASK A;  2QGU A;  4K1U A;  4KFF A;  3LH4 A;  4RBN A;  3NX0 A;  3S27 A;  4ZM8 A;  5IW9 A;  5G2G A;  3MG2 A;  2I9W A;  3FGY A;  1NB5 I;  1YGE A;  1S5A A;  1W2Z A;  1YIJ 3;  3GAX A;  3NQZ A;  4R80 A;  1IT7 A;  1A90 A;  2B1X B;  3S28 A;  1QMA A;  1STF I;  3F8H A;  3BNE A;  1Q7Y 4;  1VQ6 3;  3CCV 3;  3EHC A;  1O7P B;  3F9S A;  3LOY A;  3CC7 3;  1VQ7 3;  3BB9 A;  3CCM 3;  4K1V A;  3BNC A;  3UJM A;  1JN5 B;  1W7C A;  1SQW A;  2XR8 B;  1GYB A;  4Q53 A;  1F8N A;  4XDV A;  1AVK A;  2CFW A;  4IT7 A;  4TX4 A;  2HMO B;  2XRX B;  1WQL B;  3HII A;  1YJ9 3;  3FCS B;  1N8Q A;  2PZV A;  2GU3 A;  3HZP A;  1JJ2 2;  1LOX A;  3UL6 A;  1AR0 A;  2BHM A;  3FG3 A;  4AKY A;  2P0M A;  3QK9 A;  1ROV A;  4G1M B;  1Q40 B;  3FZW A;  2XFT A;  3N8B A;  3F8X A;  2RFR A;  5KP4 A;  2OQE A;  3GRD A;  3HX8 A;  1JRQ A;  3DY5 A;  3EF8 A;  1E97 A;  3EJV A;  3MG1 A;  3G6E 3;  5IEO A;  4KVH A;  1NWW A;  1DVD A;  1FGQ A;  2M7O A;  5IER A;  3WDG B;  3EQQ B;  3WA3 A;  1N5H A;  4HM6 B;  4HM7 B;  2OWP A;  3G8Z A;  3WOF B;  1YIT 3;  1PFP A;  3GWR A;  4WWU C;  1ZX2 A;  2CWU A;  3OW2 2;  3EE1 A;  3MWZ A;  1A67 A;  1KSI A;  1EKM A;  3B7C A;  1Z1S A;  4I4K A;  4R4K A;  1VQP 3;  2ZL8 A;  5AIF A;  4R1K A;  2W9P A;  3BND A;  2PNC A;  3LZA A;  4JF8 A;  1TFK A;  5BVB A;  2Y73 A;  2OCT A;  2GU1 A;  3DUK A;  4WYK B;  3NV0 B;  2HMM B;  4FMB A;  1TU5 A;  3EN8 A;  1W6G A;  3H51 A;  3DGM A;  2W9Q A;  4FCJ A;  3MG3 A;  5KP1 A;  4FMC A;  1K73 4;  2HMK B;  1JV2 B;  4N6V 0;  3S67 A;  3HI7 A;  1JKG A;  1UW1 A;  1IVX A;  3CU3 A;  3G4S 3;  1VQK 3;  1ULJ B;  4FCZ A;  8CHO A;  1N5P A;  5TGN A;  4RNY A;  1CQS A;  4LEH A;  3T0U A;  3FH1 A;  3LML A;  3EBY A;  3IMA B;  2UX0 A;  1FGR A;  1E3V A;  1IVU A;  2R4I A;  1K41 A;  3S5C A;  1D6Y A;  4RZM A;  2SBL A;  3CNM A;  2GXF A;  4O3V A;  4HKV B;  2WGO A;  3F14 A;  4HM0 B;  1Q86 4;  4X2H A;  1AVL A;  1JNQ A;  3FLJ A;  1U5O A;  2F86 B;  2QIY A;  4AEQ A;  1YJN 3;  3N54 B;  3I0Y A;  1NJI 4;  3LTC A;  5KP3 A;  4K61 A;  3S29 A;  2CFG A;  1YVB I;  3B8L A;  1IQ8 A;  3SVA A;  1AV4 A;  1GY6 A;  1K28 A;  3X40 A;  3EN1 B;  4J8T A;  2CWT A;  2YFJ B;  2RSX A;  3B4P A;  1WTH A;  3CXC 2;  5D81 A;  3E99 A;  1EG9 B;  3KSP A;  4PEJ A;  4QWT A;  5AEW B;  1IK3 A;  2KXG A;  3SOA A;  2GEX A;  1JB4 A;  2WGQ A;  2XH9 A;  3GZB A;  4O2H A;  1GY7 A;  3FG1 A;  1OGX A;  3X3Z A;  3EB8 A;  4AKZ A;  4HM5 B;  3T8U A;  2W56 B;  4EV5 A;  5IEP A;  4KZ1 A;  4BTY A;  2BNG A;  5IF6 A;  2STD A;  2XEP A;  3H3H A;  3JUQ A;  1QJG A;  1QVG 2;  4U13 A;  5D83 A;  1O7H B;  3CCL 3;  1NU3 A;  1UI7 A;  4IIA A;  4XM4 A;  1G96 A;  7STD A;  2QA4 3;  3ECF A;  4HM2 B;  1A2K A;  3DGL A;  1N9E A;  3IPT A;  3ROB A;  2BO9 B;  5STD A;  2Z7A A;  5CLK A;  1JN5 A;  3DGN A;  5AYR B;  5AI1 A;  2CFK A;  2L4V A;  3NBR A;  3IJE B;  3NBB A;  3MPH A;  3HIG A;  1OF5 A;  1TP6 A;  1MOL A;  4XDW A;  3B4O A;  1UUW B;  1IQY A;  2XSO B;  4LZI A;  3RDE A;  1NDO B;  1YI2 3;  2YX9 A;  3OX9 A;  4N6T A;  3CD6 3;  1QVF 2;  6STD A;  1TIJ A;  3CCQ 3;  2CG0 A;  3UNL A;  5CK6 A;  1V74 A;  1Q82 4;  1K9M 4;  2P09 A;  5CXO A;  5LC6 A;  2WO0 A;  1STD A;  2E2V A;  2F99 A;  2W0Q A;  3AMO B;  1KWI A;  5EVH A;  2K0M A;  1M9G A;  2CFD A;  3DM8 A;  2FNQ A;  1OHP A;  3UL5 A;  1OCV A;  2E2U A;  3A76 A;  3G71 3;  2O9U X;  3CCJ 3;  3MSO A;  1DMQ A;  2CWV A;  2BMQ B;  3NM2 A;  1M1K 4;  2D1W A;  3ALA A;  3O8Y A;  2CIU A;  1VQM 3;  1LVN A;  1C7H A;  1W2B 2;  1W5Z A;  3PZW A;  2GBX B;  1SII A;  2BMO B;  1DYU A;  1S72 3;  3G0K A;  1ZO2 A;  1VQ9 3;  3JUO A;  5IG4 A;  1GY5 A;  4HM1 B;  3CC4 3;  1KC8 4;  1WMP A;  3NBJ A;  5EQL A;  4WYK A;  3NV0 A;  1O7W B;  2IMJ A;  3GZR A;  3DMC A;  1DMN A;  2KCD A;  3RGA A;  3JUN A;  1W02 A;  1ULI B;  3N9H A;  3PGB A;  3KE7 A;  3FF2 A;  2LQV A;  4HZ9 B;  3Q1C A;  1M90 4;  3V98 A;  2C10 A;  3V92 A;  3SXX A;  1FA3 A;  2C11 A;  2FXT A;  2MF7 A;  5ELU A;  1IVW A;  2HMN B;  3V99 A;  1JB2 A;  5LC7 A;  1VQ4 3;  2Q07 A;  3J7Y d;  1GD3 A;  3VGN A;  1D6U A;  3LT8 A;  1SPU A;  3GZY B;  4XBY A;  3LXU X;  1RRL A;  2INX A;  1A2V A;  1RJO A;  1EQK A;  4H61 A;  2CH9 A;  2A15 A;  4EYC A;  4IPB A;  1QAF A;  3HK4 A;  3CCR 3;  5DRV A;  4LSO A;  1N9J A;  3SED A;  1IU7 A;  1EA2 A;  2P0X A;  4HJL B;  3WMD A;  1WMN A;  3M8C A;  5D82 A;  2JDI H;  1O7N B;  4XBT A;  2Z76 A;  5AEU B;  1SIH A;  4N6N B;  3OWY A;  3UB1 A;  3SOY A;  1W00 A;  2BMR B;  4HVN A;  4X2O A;  4NRE A;  3K7C A;  2CKF B;  3F7S A;  3X3Y A;  3LTA A;  2Z77 A;  1OGZ A;  5ELJ A;  5EEO A;  3X3X A;  2P38 A;  5FGO A;  1OPY A;  4MEI A;  3U1W A;  3T8N A;  1KD1 4;  1GS3 A;  4HBR A;  2GBW B;  3F7X A;  2IUJ A;  3CCS 3;  2XFS A;  4CDL A;  5A0O B;  4MJD A;  3PYJ A;  4FCM A;  3JUM A;  2FGT A;  3VF1 A;  2P05 A;  1T5Y A;  3K5T A;  3CCE 3;  2KRT A;  4EV2 A;  3WOD G;  1E3R A;  1IQX A;  1UUV B;  3EC9 A;  3DXO A;  1IV9 A;  1W6C A;  5AIH A;  4GB5 A;  1HU9 A;  2YFL B;  4J9A A;  4OVM A;  1VQL 3;  1OUN A;  3NQY A;  2HMJ B;  3K0Z A;  1Q42 A;  3WA2 X;  4O02 B;  1PU4 A;  1Q81 4;  2W6J H;  1D6Z A;  3PS8 A;  1LNH A;  2B24 B;  3QRD A;  3KII A;  1FGM A;  1W6Y A;  4WHA A;  3I56 3;  2MC8 A;  1JB5 A;  5IG0 A;  3LTB A;  1ISK A;  1Q40 A;  4HM3 B;  4R9K A;  3OWU A;  4K90 B;  4KFE A;  3CNX A;  3AMO A;  1J2B A;  3FF0 A;  4EBG A;  2IUK A;  3TDG A;  2W04 A;  3LYG A;  1YHQ 3;  2CW9 A;  1OAC A;  3Q90 A;  4MMY B;  1ROA A;  3OV4 A;  1TUH A;  2JQ5 A;  2IA7 A;  4FR9 A;  5AIG A;  1O7M B;  2RCD A;  3MKI A;  4N6O B;  1OF5 B;  4N6M A;  2BT3 A;  5JPU A;  1VQ5 3;  4LMI A;  1RKY A;  3CMA 3;  2CG1 A;  3LTD A;  3G16 A;  1OHO A;  3K63 A;  3DZL A;  1KQS 2;  4EC6 A;  1NO3 A;  3EBT A;  2Y74 A;  3F40 A;  1IV7 A;  2XSH B;  5BXQ A;  1U8C B;  4OK0 A;  4WP5 A;  2O3O A;  4L8O A;  2Z6B A;  3FSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...