1RHLA

Ribonuclease t1 complexed with 2'gmp/g23a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAAYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Hydrogen-exchange stabilities of RNase T1 and variants with buried and solvent-exposed Ala --> Gly mutations in the helix.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rhlA00
1BNIA 1BANA 4BU4A 1IYYA 3KCHA 1R4YA 1RHLA 1BRHA 1JBTA 1FW7A 3DH2A 1RCLA 1B20A 3BIRA 1BIRA 1Q9EA 1RMSA 2BIRA 2KF6A 1BRIA 1I2GA 3BU4A 1JBSA 2AAEA 1LNIA 1C54A 1RGHA 2KAAA 1RSNA 2HOHA 1I2EA 1RGCA 4HOHA 4J5GA 1GOUA 1AQZA 3A5EA 1HZ1A 1I3FA 1FUSA 1RGAA 1DE3A 3WR2A 1BSEA 4RNTA 1BRNL 1T2HA 3D5IA 1LOYA 1GMRA 4GHOA 1BUJA 2KF4A 2KF3A 1GOYA 3AGNA 1BRJA 6RNTA 1BNEA 1UCLA 1RGGA 1TTOA 1B27A 1BNRA 1X1WA 1BNSA 1I2FA 1RCKA 1RTUA 1DETA 1YGWA 3DGYA 1X1YA 1BNGA 1UCJA 2F5MA 3AHWA 5BU4A 1BSBA 1BSCA 1GMQA 1B2ZA 1BSAA 1RN1A 3RNTA 1I3IA 1B2UA 7GSPA 1GSPA 1YNVX 1PYLA 1BRSA 1FYSA 1X1UA 1RLSA 3AHSA 1BOXA 1JBRA 3D5GA 3AGOA 1RGKA 1MGWA 1LOVA 1B2MA 1UCIA 2SARA 1BRGA 1I8VA 2RBIA 1CH0A 8RNTA 3SYUA 1X1XA 5GSPA 4GSPA 1TRQA 2ZA4A 4J5KA 1AY7A 2F4YA 1UCKA 2F56A 2RNTA 1FUTA 1RGLA 1B21A 1BVIA 3Q3FA 1B2SA 1I0VA 5BIRA 1BGSA 2GSPA 5HOHA 6GSPA 7RNTA 1LRAA 3D4AA 2AADA 1RGFA 3WHOA 1B3SA 1RNTA 1PY3A 1B2XA 1BAOA 1HYFA 1RGEA 1RDSA 4BIRA 1I0XA 4HAAA 1RNBA 3GSPA 1TRPA 1YVSA 5RNTA 1GMPA 1SARA 2C4BA 1GOVA 3URPA 1LOWA 9RNTA 2F5WA 1RN4A 1BNFA 1A2PA 1BSDA 2KF5A 1I70A 1T2IA 1FZUA 1MGRA 1BU4A 1G02A 1BRKA 1BNJA 2BU4A 3HOHA 1ZGXA
chains in the Genus database with same CATH superfamily
2QEX3 1O7GB 1RRLA 3NHXA 3LTBA 1L5GB 5M1AA 1VQN3 2P0MA 3G16A 3JUMA 5DREA 2GEXA 4BTYA 1VQM3 4XBTA 2CG1A 1YHQ3 3MHEA 1NWWA 1RHLA 4XDVA 3V99A 3X3XA 1VQ73 1NB5I 3NX0A 3FH1A 1AR0A 1UUVB 3B4OA 3LXUX 2OTJ3 3HZPA 2MC8A 1YJ93 4L8PA 2BIRA 4NPBA 3G713 2KF6A 1BRIA 1IU7A 1I2GA 2L1SA 1FGQA 2E2VA 3UL5A 1VQO3 1WTHA 2XGNA 1A2VA 1W6CA 3GZYB 4L7KA 2CH9A 1I2EA 1RGCA 3HIGA 1OF5A 3WMDA 1GOUA 4N3VA 1AVLA 3A5EA 3N54B 2OOVA 3SX1A 2E2TA 5A0OB 5M18A 2HMMB 4O2HA 4GL6A 1NDOB 1RGAA 2BT3A 3SEDA 1JNQA 1W01A 1EA2A 1N9EA 1T2HA 3D5IA 1LOYA 3PGBA 3MG1A 1GD4A 1Q40B 4GHOA 2KXGA 3S27A 1W2B2 1OPYA 5AI1A 2CK3H 4ORLA 5ELJA 3MPHA 1Q42A 3WA3A 1WQLB 4EYCA 1V57A 1UDII 3B8LA 1IQYA 1ZS7A 2XF3A 5BVBA 1S5AA 3MG2A 1BNSA 1JB4A 1I2FA 1RTUA 1DETA 1YGWA 2I9WA 3DGOA 1E97A 1X1YA 3E99A 2UGIA 3F14A 3FZWA 4FR9A 4KFEA 1A67A 1IT8A 1UCJA 3HX8A 3TDGA 2CKFB 2GU3A 4U13A 4MEIA 1BSBA 1EUIC 4N6NB 3U1WA 1BSCA 3LMLA 1YIJ3 1UGIA 3BNCA 1MOLA 3KSED 5CXOA 3EE1A 2OTL3 3CD63 1RRHA 1UI7A 1GSPA 1UGHI 7GSPA 1YNVX 1M9GA 3PCSA 7STDA 3EN1B 4HM1B 3HIIA 1GD3A 2H0IA 1Z1SA 3JUNA 1EG9B 2CFGA 1O7MB 1UI8A 5AEWB 1W5ZA 1U8CB 1B2MA 2E2UA 1CYUA 2D42A 1YJN3 1Q824 1K41A 1I8VA 2WOHA 1O7HB 3WODG 3NM2A 1MWRA 1TRQA 1M1K4 2ZA4A 4J5KA 5STDA 1NU3A 2BO9B 2F4YA 1JB5A 2IY2A 1ZX2A 3FLJA 5KP1A 1FUTA 1NJI4 1MWTA 1PU4A 3OX9A 1B21A 1QMAA 1BVIA 2XSHB 2CC3A 2W9PA 4GB5A 3OXAA 1BGSA 1US1A 5HOHA 2K0MA 1EKMA 3F8HA 3NQYA 2BNGA 3RGRA 5LC7A 1ULJB 4ZM8A 1TIJA 3CCR3 1HYFA 3IPTA 3F8XA 4HM2B 4N6MA 1JZOA 1TJDA 2PNCA 1STFI 3H51A 4LSOA 2Z7AA 1ROVA 5AIFA 3ZFZA 2OQEA 1RNBA 3EB8A 1GMPA 1VQP3 2W03A 1W7CA 3EJVA 4HVNA 3WOEB 1SIHA 3EX9A 1SJWA 2F5WA 1V74A 1VQ43 4LZIA 1BNFA 1U5OA 3UJMA 1YGEA 1T2IA 3FCSB 1MGRA 1BU4A 3HOHA 1BRKA 2BU4A 4G1MB 5CK6A 4WP5A 1ZGXA 2IYJA 1BANA 1W4NA 1EEJA 5IERA 3UNLA 1VQ63 1R4CA 1LVNA 4TX4A 3LZAA 1TFKA 3NXJA 4N6TA 3ALAA 3CCE3 2KCDA 5EQLA 1IYYA 1C7HA 1Q7HA 1MWSA 2A15A 2RFRA 3RDEA 5D83A 4AKYA 2ZDJA 5KP4A 2V1LA 3BU4A 4LYLB 1O7PB 3I553 4XDWA 2IUKA 3PXMA 3X40A 1C54A 2KAAA 1OHOA 1AV4A 1RSNA 1IQ8A 1IQXA 4HOHA 5I97A 4PEJA 1AQZA 2XEPA 2OCTA 2R4IA 1I3FA 2W2CA 1FUSA 4XM4A 2GBWB 3WR2A 1FA3A 3MG3A 1G0TA 3WOFB 4XBYA 1OCVA 3LTCA 5IEPA 1K8A4 5G1KA 1V58A 1VZZA 3EF8A 2KF3A 4K1UA 2XH9A 1GOYA 1TFOA 1YIT3 3AGNA 3NV0B 2H0HA 1BRJA 1IVXA 2FGTA 3T8NA 4BL3A 3EC9A 1LXEA 1VQ83 4X2OA 1RGGA 1MNLA 2F98A 3ECFA 1JRQA 1PFPA 1YI23 1X1WA 6STDA 2MF7A 2QA43 2W9QA 3D79A 2F5MA 3ROBA 3AHWA 2P09A 5FGOA 1GY5A 4EC6A 1TP6A 1SPUA 2CHCA 1VQQA 3MKIA 3OWUA 2JQ5A 4LEHA 2B1XB 3NBBA 4O02B 1N8R4 2QIYA 1IV7A 3DGLA 4H3UA 8CHOA 4HM3B 4KZ1A 1IK3A 1JKGB 3LH4A 1PYLA 1FYSA 4HM0B 4EW5A 1SQWA 1BOXA 3D5GA 3AGOA 2K54A 1RGKA 2O3OA 3Q90A 4WWUC 3CCQ3 2BMOB 2SARA 2L4VA 4CCVA 5CF2A 1CH0A 8RNTA 1X1XA 1AY7A 2CX1A 1QVG2 3LTDA 1IDPA 1UCKA 2J8XB 1K28A 3STDA 1RKYA 1RGLA 1ROAA 2XRXB 5LC6A 2GU1A 4MJDA 3I563 6GSPA 1ASKA 2R41A 3JUPA 5CLKA 1LRAA 4R4KA 5M19A 1RGFA 1N5PA 5IG0A 1IV9A 1RNTA 3FSDA 1BAOA 3AMOB 2BHMA 2OOVC 2CFWA 3MYTA 2Q07A 5D82A 1K9M4 3KE7A 4KVHA 1RGEA 1RDSA 3CC43 3F40A 1UUWB 1I0XA 4HAAA 1G96A 1DYUA 4JRFA 1TRPA 2CW9A 5RNTA 1SARA 1GOVA 4WYKB 3BB9A 2F86B 3K63A 2LQVA 1KSIA 1OH0A 1CQSA 4K61A 5JPPA 3K7CA 3RGAA 3A76A 2YFIB 3OW22 5AIIA 2STDA 3Q2PA 2WO0A 1BNIA 1CYVA 3EN8A 2CG0A 1Q864 3EBTA 2YFJB 3LTAA 5D81A 1FGTA 2IA7A 3SVAA 4CPKA 4HBRA 3CCJ3 1KC84 4BU4A 4IPBA 3KCHA 5G1LA 1R4YA 1A2KA 1BRHA 4HM5B 3EBYA 1JBTA 1LQMB 1KQS2 4EV5A 4H61A 1B20A 1RN7A 2Z6BA 1BIRA 4DKIA 1RMSA 1GY7A 1JKGA 4LMIA 5KP3A 4CJNA 4EBGA 2AAEA 3G8ZA 4HM8B 1LNIA 1Q40A 3CCL3 1RGHA 2H0GA 2WOFA 3JUQA 3N8BA 2XFSA 4J5GA 4RNZA 3UB1A 3D3LA 4I4KA 3LT8A 2Y73A 3CXC2 2F99A 3DZLA 1DE3A 1BSEA 4XB5A 1W02A 3KIIA 3F7XA 4AEQA 1GMRA 1VQL3 1WMNA 1BUJA 3PS8A 1UUGB 3LT9A 4X2HA 1VQK3 2ZHXB 3KFQC 3EQQB 2CFDA 3G4S3 1S723 2PZVA 4FCZA 6RNTA 1UCLA 3G0KA 1ZO2A 4NHFA 2D1WA 2Z76A 3HK4A 5AIHA 1RCKA 3DGYA 5DRVA 4IIAA 4EV2A 1STDA 2JDIH 3S67A 4Q53A 5BU4A 3O8YA 1GYBA 3AMOA 1GMQA 3KKGA 1MWUA 2Z77A 1RN1A 4HM6B 4KT3B 3RNTA 2W6JH 3B7CA 4FMCA 2BMRB 3WA2X 2OQEC 1QJGA 1OGZA 1I3IA 1Q7Y4 1WNHA 2W0QA 4OUQA 3LOYA 2XGLA 2IUJA 2W56B 1JZDA 3VSYA 3SXXA 3CPOA 4WYKA 1BRSA 1FGMA 3B4PA 4RBNA 1EQKA 4I5QA 1Q814 4HYZA 4N6UA 4O8SA 3DUKA 4ILFA 3X42A 3FG3A 1MGWA 1LOVA 3BNEA 4FMBA 1OHSA 1UCIA 2GXFA 1WMOA 2ML5A 2FNQA 3CU3A 1JJ22 3L0RA 3GZXB 3K5TA 2HMLB 4GSPA 4WFOA 3GRDA 3KSPA 1M1XB 1LOXA 3DM8A 5IF6A 2UUGC 3VF1A 2YFLB 5EVHA 3Q3FA 3V92A 1I0VA 5BIRA 3ZG5A 3DY5A 1O7NB 3X3ZA 2KRTA 7RNTA 1W6YA 1B3SA 3BNBA 4K90B 3ZG0A 1DMQA 1B2XA 1N5HA 2BMQB 1OHPA 3N9HA 4HKVB 4FMAA 1TUHA 4HZBB 4KFFA 4R1KA 3CCV3 3K0ZA 1FGRA 1JN5B 1GY6A 1QAFA 5AIGA 4N6LA 1OACA 4HM7B 3Q1CA 3GSPA 2CIUA 1Y4KA 1OUNA 3GZRA 1YVSA 4OVMA 4RNYA 3CPW2 3SOAA 1RJOA 3URPA 3NQZA 1AVKA 3CCM3 2C11A 2IMJA 2QGUA 1RN4A 1QALA 5IW9A 1CEWI 1N8QA 1A2PA 2KF5A 3FF0A 3IMAB 2Y74A 3SLUA 1BNJA 1UW1A 3H3HA 2RSXA 2ZL8A 1W2ZA 5IEOA 3D9RA 3FF2A 2C10A 1QVF2 5AYSC 3JUOA 3CC23 4R9LA 4O3VA 1HKXA 3GZBA 3CNMA 3IJEB 5JPUA 3CME3 3DGMA 2CFKA 3DGNA 2RCDA 3F7SA 1FW7A 1DMNA 1RCLA 3DH2A 1HU9A 2HMOB 2ML6A 1LQGC 3BIRA 3NM7A 1Q9EA 3QK9A 3VGNA 2W56A 3NUVA 1JBSA 3F9SA 3GWRA 5TGNA 1D6YA 4MMZB 3X3YA 1K734 2HOHA 5FW5A 2CFLA 4N6V0 3NV0A 1M904 5HGRA 4HZ9B 3PCRA 1DVCA 1HZ1A 4RZMA 4XBXA 3KZTA 4FCJA 3KN4A 4KFDA 4RNTA 3S28A 3PZWA 1BRNL 1ULIB 3GAXA 2CX0A 2UX0A 1NO3A 5JBSA 1VQ53 4R80A 2KF4A 1YJW3 2O9UX 2B24B 1GS3A 3CCS3 4K1VA 1T3BA 3NBRA 1BNEA 1TTOA 5EEOA 1B27A 2FXTA 4BTXA 3K9MC 1BNRA 3NBJA 3LYGA 1D6ZA 5ELUA 3T8UA 3CMA3 3I0YA 2W04A 5IG5A 3U97A 1BNGA 1NB3I 3ER7A 1D6UA 4L8OA 3MSOA 5AEUB 3X41A 3CC73 1N9JA 2P05A 4J9AA 2INXA 2OWPA 1B2ZA 1BSAA 4OK0A 2K3DA 1TU5A 1JN5A 1FGOA 4MMXB 4BL2A 3QRDA 5IG4A 1B2UA 3PYJA 3G6E3 1E3RA 1IVUA 2CWTA 1X1UA 5AYRB 1RLSA 4NREA 2WGQA 3AHSA 1OF5B 1IVWA 4LGQA 1JBRA 3FGYA 1JV2B 2HMNB 4HJLB 2YX9A 3WDGB 5CF1A 3DXOA 3CNXA 2HMKB 2LYXA 1BRGA 2HMJB 2RBIA 1T5YA 2CWVA 1IT7A 1QAKA 3SYUA 5GSPA 1WMPA 3FKAA 4MMYB 3S5CA 1SIIA 4WHAA 2F56A 1O7WB 2RNTA 5IG3A 1W00A 2XSOB 4IT7A 2WGOA 5IENA 1B2SA 5BXQA 1W6GA 1A90A 1BUQA 2GSPA 3EHCA 4AKZA 3D4AA 3BNDA 2AADA 3BLZA 3OWSA 3OWYA 1NNVA 4R9KA 1IVVA 3WHOA 2XR8B 2GBXB 4HM4B 1E3VA 1PY3A 2GEYA 3CCU3 1KWIA 1DMMA 2RGQA 2P0XA 4J8TA 3OV4A 1VQ93 4QWTA 3FG4A 4BTWA 1LNHA 1DVDA 2SBLA 2XFTA 3M8CA 4JF8A 4FMDA 4BIRA 1OGXA 4CDLA 1YVBI 3SOYA 2C4BA 1FUWA 1F8NA 3T0UA 3J7Yd 3MWZA 1LOWA 1KD14 1JB2A 1ISKA 9RNTA 2P38A 2CWUA 3HI7A 3JVCA 2M7OA 1BSDA 1I70A 4FCMA 3DMCA 1FZUA 3S29A 1G02A 3V98A 1J2BA 3FG1A 4EXRA 3UL6A 4STDA 4N6OB 5G2GA
chains in the Genus database with same CATH topology
1BNIA 1BANA 4BU4A 1IYYA 3KCHA 1R4YA 1RHLA 1BRHA 1JBTA 1FW7A 3DH2A 1RCLA 1B20A 3BIRA 1BIRA 1Q9EA 1RMSA 2BIRA 2KF6A 1BRIA 1I2GA 3BU4A 1JBSA 2AAEA 1LNIA 1C54A 1RGHA 2KAAA 1RSNA 2HOHA 1I2EA 1RGCA 4HOHA 4J5GA 1GOUA 1AQZA 3A5EA 1HZ1A 1I3FA 1FUSA 1RGAA 1DE3A 3WR2A 1BSEA 4RNTA 1BRNL 1T2HA 3D5IA 1LOYA 1GMRA 4GHOA 1BUJA 2KF4A 2KF3A 1GOYA 3AGNA 1BRJA 6RNTA 1BNEA 1UCLA 1RGGA 1TTOA 1B27A 1BNRA 1X1WA 1BNSA 1I2FA 1RCKA 1RTUA 1DETA 1YGWA 3DGYA 1X1YA 1BNGA 1UCJA 2F5MA 3AHWA 5BU4A 1BSBA 1BSCA 1GMQA 1B2ZA 1BSAA 1RN1A 3RNTA 1I3IA 1B2UA 7GSPA 1GSPA 1YNVX 1PYLA 1BRSA 1FYSA 1X1UA 1RLSA 3AHSA 1BOXA 1JBRA 3D5GA 3AGOA 1RGKA 1MGWA 1LOVA 1B2MA 1UCIA 2SARA 1BRGA 1I8VA 2RBIA 1CH0A 8RNTA 3SYUA 1X1XA 5GSPA 4GSPA 1TRQA 2ZA4A 4J5KA 1AY7A 2F4YA 1UCKA 2F56A 2RNTA 1FUTA 1RGLA 1B21A 1BVIA 3Q3FA 1B2SA 1I0VA 5BIRA 1BGSA 2GSPA 5HOHA 6GSPA 7RNTA 1LRAA 3D4AA 2AADA 1RGFA 3WHOA 1B3SA 1RNTA 1PY3A 1B2XA 1BAOA 1HYFA 1RGEA 1RDSA 4BIRA 1I0XA 4HAAA 1RNBA 3GSPA 1TRPA 1YVSA 5RNTA 1GMPA 1SARA 2C4BA 1GOVA 3URPA 1LOWA 9RNTA 2F5WA 1RN4A 1BNFA 1A2PA 1BSDA 2KF5A 1I70A 1T2IA 1FZUA 1MGRA 1BU4A 1G02A 1BRKA 1BNJA 2BU4A 3HOHA 1ZGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNI A;  1BAN A;  4BU4 A;  1IYY A;  3KCH A;  1R4Y A;  1RHL A;  1BRH A;  1JBT A;  1FW7 A;  3DH2 A;  1RCL A;  1B20 A;  3BIR A;  1BIR A;  1Q9E A;  1RMS A;  2BIR A;  2KF6 A;  1BRI A;  1I2G A;  3BU4 A;  1JBS A;  2AAE A;  1LNI A;  1C54 A;  1RGH A;  2KAA A;  1RSN A;  2HOH A;  1I2E A;  1RGC A;  4HOH A;  4J5G A;  1GOU A;  1AQZ A;  3A5E A;  1HZ1 A;  1I3F A;  1FUS A;  1RGA A;  1DE3 A;  3WR2 A;  1BSE A;  4RNT A;  1BRN L;  1T2H A;  3D5I A;  1LOY A;  1GMR A;  4GHO A;  1BUJ A;  2KF4 A;  2KF3 A;  1GOY A;  3AGN A;  1BRJ A;  6RNT A;  1BNE A;  1UCL A;  1RGG A;  1TTO A;  1B27 A;  1BNR A;  1X1W A;  1BNS A;  1I2F A;  1RCK A;  1RTU A;  1DET A;  1YGW A;  3DGY A;  1X1Y A;  1BNG A;  1UCJ A;  2F5M A;  3AHW A;  5BU4 A;  1BSB A;  1BSC A;  1GMQ A;  1B2Z A;  1BSA A;  1RN1 A;  3RNT A;  1I3I A;  1B2U A;  7GSP A;  1GSP A;  1YNV X;  1PYL A;  1BRS A;  1FYS A;  1X1U A;  1RLS A;  3AHS A;  1BOX A;  1JBR A;  3D5G A;  3AGO A;  1RGK A;  1MGW A;  1LOV A;  1B2M A;  1UCI A;  2SAR A;  1BRG A;  1I8V A;  2RBI A;  1CH0 A;  8RNT A;  3SYU A;  1X1X A;  5GSP A;  4GSP A;  1TRQ A;  2ZA4 A;  4J5K A;  1AY7 A;  2F4Y A;  1UCK A;  2F56 A;  2RNT A;  1FUT A;  1RGL A;  1B21 A;  1BVI A;  3Q3F A;  1B2S A;  1I0V A;  5BIR A;  1BGS A;  2GSP A;  5HOH A;  6GSP A;  7RNT A;  1LRA A;  3D4A A;  2AAD A;  1RGF A;  3WHO A;  1B3S A;  1RNT A;  1PY3 A;  1B2X A;  1BAO A;  1HYF A;  1RGE A;  1RDS A;  4BIR A;  1I0X A;  4HAA A;  1RNB A;  3GSP A;  1TRP A;  1YVS A;  5RNT A;  1GMP A;  1SAR A;  2C4B A;  1GOV A;  3URP A;  1LOW A;  9RNT A;  2F5W A;  1RN4 A;  1BNF A;  1A2P A;  1BSD A;  2KF5 A;  1I70 A;  1T2I A;  1FZU A;  1MGR A;  1BU4 A;  1G02 A;  1BRK A;  1BNJ A;  2BU4 A;  3HOH A;  1ZGX A; 
#chains in the Genus database with same CATH topology
 2QEX 3;  1O7G B;  1RRL A;  3NHX A;  3LTB A;  1L5G B;  5M1A A;  1VQN 3;  2P0M A;  3G16 A;  3JUM A;  5DRE A;  2GEX A;  4BTY A;  1VQM 3;  4XBT A;  2CG1 A;  1YHQ 3;  3MHE A;  1NWW A;  1RHL A;  4XDV A;  3V99 A;  3X3X A;  1VQ7 3;  1NB5 I;  3NX0 A;  3FH1 A;  1AR0 A;  1UUV B;  3B4O A;  3LXU X;  2OTJ 3;  3HZP A;  2MC8 A;  1YJ9 3;  4L8P A;  2BIR A;  4NPB A;  3G71 3;  2KF6 A;  1BRI A;  1IU7 A;  1I2G A;  2L1S A;  1FGQ A;  2E2V A;  3UL5 A;  1VQO 3;  1WTH A;  2XGN A;  1A2V A;  1W6C A;  3GZY B;  4L7K A;  2CH9 A;  1I2E A;  1RGC A;  3HIG A;  1OF5 A;  3WMD A;  1GOU A;  4N3V A;  1AVL A;  3A5E A;  3N54 B;  2OOV A;  3SX1 A;  2E2T A;  5A0O B;  5M18 A;  2HMM B;  4O2H A;  4GL6 A;  1NDO B;  1RGA A;  2BT3 A;  3SED A;  1JNQ A;  1W01 A;  1EA2 A;  1N9E A;  1T2H A;  3D5I A;  1LOY A;  3PGB A;  3MG1 A;  1GD4 A;  1Q40 B;  4GHO A;  2KXG A;  3S27 A;  1W2B 2;  1OPY A;  5AI1 A;  2CK3 H;  4ORL A;  5ELJ A;  3MPH A;  1Q42 A;  3WA3 A;  1WQL B;  4EYC A;  1V57 A;  1UDI I;  3B8L A;  1IQY A;  1ZS7 A;  2XF3 A;  5BVB A;  1S5A A;  3MG2 A;  1BNS A;  1JB4 A;  1I2F A;  1RTU A;  1DET A;  1YGW A;  2I9W A;  3DGO A;  1E97 A;  1X1Y A;  3E99 A;  2UGI A;  3F14 A;  3FZW A;  4FR9 A;  4KFE A;  1A67 A;  1IT8 A;  1UCJ A;  3HX8 A;  3TDG A;  2CKF B;  2GU3 A;  4U13 A;  4MEI A;  1BSB A;  1EUI C;  4N6N B;  3U1W A;  1BSC A;  3LML A;  1YIJ 3;  1UGI A;  3BNC A;  1MOL A;  3KSE D;  5CXO A;  3EE1 A;  2OTL 3;  3CD6 3;  1RRH A;  1UI7 A;  1GSP A;  1UGH I;  7GSP A;  1YNV X;  1M9G A;  3PCS A;  7STD A;  3EN1 B;  4HM1 B;  3HII A;  1GD3 A;  2H0I A;  1Z1S A;  3JUN A;  1EG9 B;  2CFG A;  1O7M B;  1UI8 A;  5AEW B;  1W5Z A;  1U8C B;  1B2M A;  2E2U A;  1CYU A;  2D42 A;  1YJN 3;  1Q82 4;  1K41 A;  1I8V A;  2WOH A;  1O7H B;  3WOD G;  3NM2 A;  1MWR A;  1TRQ A;  1M1K 4;  2ZA4 A;  4J5K A;  5STD A;  1NU3 A;  2BO9 B;  2F4Y A;  1JB5 A;  2IY2 A;  1ZX2 A;  3FLJ A;  5KP1 A;  1FUT A;  1NJI 4;  1MWT A;  1PU4 A;  3OX9 A;  1B21 A;  1QMA A;  1BVI A;  2XSH B;  2CC3 A;  2W9P A;  4GB5 A;  3OXA A;  1BGS A;  1US1 A;  5HOH A;  2K0M A;  1EKM A;  3F8H A;  3NQY A;  2BNG A;  3RGR A;  5LC7 A;  1ULJ B;  4ZM8 A;  1TIJ A;  3CCR 3;  1HYF A;  3IPT A;  3F8X A;  4HM2 B;  4N6M A;  1JZO A;  1TJD A;  2PNC A;  1STF I;  3H51 A;  4LSO A;  2Z7A A;  1ROV A;  5AIF A;  3ZFZ A;  2OQE A;  1RNB A;  3EB8 A;  1GMP A;  1VQP 3;  2W03 A;  1W7C A;  3EJV A;  4HVN A;  3WOE B;  1SIH A;  3EX9 A;  1SJW A;  2F5W A;  1V74 A;  1VQ4 3;  4LZI A;  1BNF A;  1U5O A;  3UJM A;  1YGE A;  1T2I A;  3FCS B;  1MGR A;  1BU4 A;  3HOH A;  1BRK A;  2BU4 A;  4G1M B;  5CK6 A;  4WP5 A;  1ZGX A;  2IYJ A;  1BAN A;  1W4N A;  1EEJ A;  5IER A;  3UNL A;  1VQ6 3;  1R4C A;  1LVN A;  4TX4 A;  3LZA A;  1TFK A;  3NXJ A;  4N6T A;  3ALA A;  3CCE 3;  2KCD A;  5EQL A;  1IYY A;  1C7H A;  1Q7H A;  1MWS A;  2A15 A;  2RFR A;  3RDE A;  5D83 A;  4AKY A;  2ZDJ A;  5KP4 A;  2V1L A;  3BU4 A;  4LYL B;  1O7P B;  3I55 3;  4XDW A;  2IUK A;  3PXM A;  3X40 A;  1C54 A;  2KAA A;  1OHO A;  1AV4 A;  1RSN A;  1IQ8 A;  1IQX A;  4HOH A;  5I97 A;  4PEJ A;  1AQZ A;  2XEP A;  2OCT A;  2R4I A;  1I3F A;  2W2C A;  1FUS A;  4XM4 A;  2GBW B;  3WR2 A;  1FA3 A;  3MG3 A;  1G0T A;  3WOF B;  4XBY A;  1OCV A;  3LTC A;  5IEP A;  1K8A 4;  5G1K A;  1V58 A;  1VZZ A;  3EF8 A;  2KF3 A;  4K1U A;  2XH9 A;  1GOY A;  1TFO A;  1YIT 3;  3AGN A;  3NV0 B;  2H0H A;  1BRJ A;  1IVX A;  2FGT A;  3T8N A;  4BL3 A;  3EC9 A;  1LXE A;  1VQ8 3;  4X2O A;  1RGG A;  1MNL A;  2F98 A;  3ECF A;  1JRQ A;  1PFP A;  1YI2 3;  1X1W A;  6STD A;  2MF7 A;  2QA4 3;  2W9Q A;  3D79 A;  2F5M A;  3ROB A;  3AHW A;  2P09 A;  5FGO A;  1GY5 A;  4EC6 A;  1TP6 A;  1SPU A;  2CHC A;  1VQQ A;  3MKI A;  3OWU A;  2JQ5 A;  4LEH A;  2B1X B;  3NBB A;  4O02 B;  1N8R 4;  2QIY A;  1IV7 A;  3DGL A;  4H3U A;  8CHO A;  4HM3 B;  4KZ1 A;  1IK3 A;  1JKG B;  3LH4 A;  1PYL A;  1FYS A;  4HM0 B;  4EW5 A;  1SQW A;  1BOX A;  3D5G A;  3AGO A;  2K54 A;  1RGK A;  2O3O A;  3Q90 A;  4WWU C;  3CCQ 3;  2BMO B;  2SAR A;  2L4V A;  4CCV A;  5CF2 A;  1CH0 A;  8RNT A;  1X1X A;  1AY7 A;  2CX1 A;  1QVG 2;  3LTD A;  1IDP A;  1UCK A;  2J8X B;  1K28 A;  3STD A;  1RKY A;  1RGL A;  1ROA A;  2XRX B;  5LC6 A;  2GU1 A;  4MJD A;  3I56 3;  6GSP A;  1ASK A;  2R41 A;  3JUP A;  5CLK A;  1LRA A;  4R4K A;  5M19 A;  1RGF A;  1N5P A;  5IG0 A;  1IV9 A;  1RNT A;  3FSD A;  1BAO A;  3AMO B;  2BHM A;  2OOV C;  2CFW A;  3MYT A;  2Q07 A;  5D82 A;  1K9M 4;  3KE7 A;  4KVH A;  1RGE A;  1RDS A;  3CC4 3;  3F40 A;  1UUW B;  1I0X A;  4HAA A;  1G96 A;  1DYU A;  4JRF A;  1TRP A;  2CW9 A;  5RNT A;  1SAR A;  1GOV A;  4WYK B;  3BB9 A;  2F86 B;  3K63 A;  2LQV A;  1KSI A;  1OH0 A;  1CQS A;  4K61 A;  5JPP A;  3K7C A;  3RGA A;  3A76 A;  2YFI B;  3OW2 2;  5AII A;  2STD A;  3Q2P A;  2WO0 A;  1BNI A;  1CYV A;  3EN8 A;  2CG0 A;  1Q86 4;  3EBT A;  2YFJ B;  3LTA A;  5D81 A;  1FGT A;  2IA7 A;  3SVA A;  4CPK A;  4HBR A;  3CCJ 3;  1KC8 4;  4BU4 A;  4IPB A;  3KCH A;  5G1L A;  1R4Y A;  1A2K A;  1BRH A;  4HM5 B;  3EBY A;  1JBT A;  1LQM B;  1KQS 2;  4EV5 A;  4H61 A;  1B20 A;  1RN7 A;  2Z6B A;  1BIR A;  4DKI A;  1RMS A;  1GY7 A;  1JKG A;  4LMI A;  5KP3 A;  4CJN A;  4EBG A;  2AAE A;  3G8Z A;  4HM8 B;  1LNI A;  1Q40 A;  3CCL 3;  1RGH A;  2H0G A;  2WOF A;  3JUQ A;  3N8B A;  2XFS A;  4J5G A;  4RNZ A;  3UB1 A;  3D3L A;  4I4K A;  3LT8 A;  2Y73 A;  3CXC 2;  2F99 A;  3DZL A;  1DE3 A;  1BSE A;  4XB5 A;  1W02 A;  3KII A;  3F7X A;  4AEQ A;  1GMR A;  1VQL 3;  1WMN A;  1BUJ A;  3PS8 A;  1UUG B;  3LT9 A;  4X2H A;  1VQK 3;  2ZHX B;  3KFQ C;  3EQQ B;  2CFD A;  3G4S 3;  1S72 3;  2PZV A;  4FCZ A;  6RNT A;  1UCL A;  3G0K A;  1ZO2 A;  4NHF A;  2D1W A;  2Z76 A;  3HK4 A;  5AIH A;  1RCK A;  3DGY A;  5DRV A;  4IIA A;  4EV2 A;  1STD A;  2JDI H;  3S67 A;  4Q53 A;  5BU4 A;  3O8Y A;  1GYB A;  3AMO A;  1GMQ A;  3KKG A;  1MWU A;  2Z77 A;  1RN1 A;  4HM6 B;  4KT3 B;  3RNT A;  2W6J H;  3B7C A;  4FMC A;  2BMR B;  3WA2 X;  2OQE C;  1QJG A;  1OGZ A;  1I3I A;  1Q7Y 4;  1WNH A;  2W0Q A;  4OUQ A;  3LOY A;  2XGL A;  2IUJ A;  2W56 B;  1JZD A;  3VSY A;  3SXX A;  3CPO A;  4WYK A;  1BRS A;  1FGM A;  3B4P A;  4RBN A;  1EQK A;  4I5Q A;  1Q81 4;  4HYZ A;  4N6U A;  4O8S A;  3DUK A;  4ILF A;  3X42 A;  3FG3 A;  1MGW A;  1LOV A;  3BNE A;  4FMB A;  1OHS A;  1UCI A;  2GXF A;  1WMO A;  2ML5 A;  2FNQ A;  3CU3 A;  1JJ2 2;  3L0R A;  3GZX B;  3K5T A;  2HML B;  4GSP A;  4WFO A;  3GRD A;  3KSP A;  1M1X B;  1LOX A;  3DM8 A;  5IF6 A;  2UUG C;  3VF1 A;  2YFL B;  5EVH A;  3Q3F A;  3V92 A;  1I0V A;  5BIR A;  3ZG5 A;  3DY5 A;  1O7N B;  3X3Z A;  2KRT A;  7RNT A;  1W6Y A;  1B3S A;  3BNB A;  4K90 B;  3ZG0 A;  1DMQ A;  1B2X A;  1N5H A;  2BMQ B;  1OHP A;  3N9H A;  4HKV B;  4FMA A;  1TUH A;  4HZB B;  4KFF A;  4R1K A;  3CCV 3;  3K0Z A;  1FGR A;  1JN5 B;  1GY6 A;  1QAF A;  5AIG A;  4N6L A;  1OAC A;  4HM7 B;  3Q1C A;  3GSP A;  2CIU A;  1Y4K A;  1OUN A;  3GZR A;  1YVS A;  4OVM A;  4RNY A;  3CPW 2;  3SOA A;  1RJO A;  3URP A;  3NQZ A;  1AVK A;  3CCM 3;  2C11 A;  2IMJ A;  2QGU A;  1RN4 A;  1QAL A;  5IW9 A;  1CEW I;  1N8Q A;  1A2P A;  2KF5 A;  3FF0 A;  3IMA B;  2Y74 A;  3SLU A;  1BNJ A;  1UW1 A;  3H3H A;  2RSX A;  2ZL8 A;  1W2Z A;  5IEO A;  3D9R A;  3FF2 A;  2C10 A;  1QVF 2;  5AYS C;  3JUO A;  3CC2 3;  4R9L A;  4O3V A;  1HKX A;  3GZB A;  3CNM A;  3IJE B;  5JPU A;  3CME 3;  3DGM A;  2CFK A;  3DGN A;  2RCD A;  3F7S A;  1FW7 A;  1DMN A;  1RCL A;  3DH2 A;  1HU9 A;  2HMO B;  2ML6 A;  1LQG C;  3BIR A;  3NM7 A;  1Q9E A;  3QK9 A;  3VGN A;  2W56 A;  3NUV A;  1JBS A;  3F9S A;  3GWR A;  5TGN A;  1D6Y A;  4MMZ B;  3X3Y A;  1K73 4;  2HOH A;  5FW5 A;  2CFL A;  4N6V 0;  3NV0 A;  1M90 4;  5HGR A;  4HZ9 B;  3PCR A;  1DVC A;  1HZ1 A;  4RZM A;  4XBX A;  3KZT A;  4FCJ A;  3KN4 A;  4KFD A;  4RNT A;  3S28 A;  3PZW A;  1BRN L;  1ULI B;  3GAX A;  2CX0 A;  2UX0 A;  1NO3 A;  5JBS A;  1VQ5 3;  4R80 A;  2KF4 A;  1YJW 3;  2O9U X;  2B24 B;  1GS3 A;  3CCS 3;  4K1V A;  1T3B A;  3NBR A;  1BNE A;  1TTO A;  5EEO A;  1B27 A;  2FXT A;  4BTX A;  3K9M C;  1BNR A;  3NBJ A;  3LYG A;  1D6Z A;  5ELU A;  3T8U A;  3CMA 3;  3I0Y A;  2W04 A;  5IG5 A;  3U97 A;  1BNG A;  1NB3 I;  3ER7 A;  1D6U A;  4L8O A;  3MSO A;  5AEU B;  3X41 A;  3CC7 3;  1N9J A;  2P05 A;  4J9A A;  2INX A;  2OWP A;  1B2Z A;  1BSA A;  4OK0 A;  2K3D A;  1TU5 A;  1JN5 A;  1FGO A;  4MMX B;  4BL2 A;  3QRD A;  5IG4 A;  1B2U A;  3PYJ A;  3G6E 3;  1E3R A;  1IVU A;  2CWT A;  1X1U A;  5AYR B;  1RLS A;  4NRE A;  2WGQ A;  3AHS A;  1OF5 B;  1IVW A;  4LGQ A;  1JBR A;  3FGY A;  1JV2 B;  2HMN B;  4HJL B;  2YX9 A;  3WDG B;  5CF1 A;  3DXO A;  3CNX A;  2HMK B;  2LYX A;  1BRG A;  2HMJ B;  2RBI A;  1T5Y A;  2CWV A;  1IT7 A;  1QAK A;  3SYU A;  5GSP A;  1WMP A;  3FKA A;  4MMY B;  3S5C A;  1SII A;  4WHA A;  2F56 A;  1O7W B;  2RNT A;  5IG3 A;  1W00 A;  2XSO B;  4IT7 A;  2WGO A;  5IEN A;  1B2S A;  5BXQ A;  1W6G A;  1A90 A;  1BUQ A;  2GSP A;  3EHC A;  4AKZ A;  3D4A A;  3BND A;  2AAD A;  3BLZ A;  3OWS A;  3OWY A;  1NNV A;  4R9K A;  1IVV A;  3WHO A;  2XR8 B;  2GBX B;  4HM4 B;  1E3V A;  1PY3 A;  2GEY A;  3CCU 3;  1KWI A;  1DMM A;  2RGQ A;  2P0X A;  4J8T A;  3OV4 A;  1VQ9 3;  4QWT A;  3FG4 A;  4BTW A;  1LNH A;  1DVD A;  2SBL A;  2XFT A;  3M8C A;  4JF8 A;  4FMD A;  4BIR A;  1OGX A;  4CDL A;  1YVB I;  3SOY A;  2C4B A;  1FUW A;  1F8N A;  3T0U A;  3J7Y d;  3MWZ A;  1LOW A;  1KD1 4;  1JB2 A;  1ISK A;  9RNT A;  2P38 A;  2CWU A;  3HI7 A;  3JVC A;  2M7O A;  1BSD A;  1I70 A;  4FCM A;  3DMC A;  1FZU A;  3S29 A;  1G02 A;  3V98 A;  1J2B A;  3FG1 A;  4EXR A;  3UL6 A;  4STD A;  4N6O B;  5G2G A; 
#chains in the Genus database with same CATH homology
 1BNI A;  1BAN A;  4BU4 A;  1IYY A;  3KCH A;  1R4Y A;  1RHL A;  1BRH A;  1JBT A;  1FW7 A;  3DH2 A;  1RCL A;  1B20 A;  3BIR A;  1BIR A;  1Q9E A;  1RMS A;  2BIR A;  2KF6 A;  1BRI A;  1I2G A;  3BU4 A;  1JBS A;  2AAE A;  1LNI A;  1C54 A;  1RGH A;  2KAA A;  1RSN A;  2HOH A;  1I2E A;  1RGC A;  4HOH A;  4J5G A;  1GOU A;  1AQZ A;  3A5E A;  1HZ1 A;  1I3F A;  1FUS A;  1RGA A;  1DE3 A;  3WR2 A;  1BSE A;  4RNT A;  1BRN L;  1T2H A;  3D5I A;  1LOY A;  1GMR A;  4GHO A;  1BUJ A;  2KF4 A;  2KF3 A;  1GOY A;  3AGN A;  1BRJ A;  6RNT A;  1BNE A;  1UCL A;  1RGG A;  1TTO A;  1B27 A;  1BNR A;  1X1W A;  1BNS A;  1I2F A;  1RCK A;  1RTU A;  1DET A;  1YGW A;  3DGY A;  1X1Y A;  1BNG A;  1UCJ A;  2F5M A;  3AHW A;  5BU4 A;  1BSB A;  1BSC A;  1GMQ A;  1B2Z A;  1BSA A;  1RN1 A;  3RNT A;  1I3I A;  1B2U A;  7GSP A;  1GSP A;  1YNV X;  1PYL A;  1BRS A;  1FYS A;  1X1U A;  1RLS A;  3AHS A;  1BOX A;  1JBR A;  3D5G A;  3AGO A;  1RGK A;  1MGW A;  1LOV A;  1B2M A;  1UCI A;  2SAR A;  1BRG A;  1I8V A;  2RBI A;  1CH0 A;  8RNT A;  3SYU A;  1X1X A;  5GSP A;  4GSP A;  1TRQ A;  2ZA4 A;  4J5K A;  1AY7 A;  2F4Y A;  1UCK A;  2F56 A;  2RNT A;  1FUT A;  1RGL A;  1B21 A;  1BVI A;  3Q3F A;  1B2S A;  1I0V A;  5BIR A;  1BGS A;  2GSP A;  5HOH A;  6GSP A;  7RNT A;  1LRA A;  3D4A A;  2AAD A;  1RGF A;  3WHO A;  1B3S A;  1RNT A;  1PY3 A;  1B2X A;  1BAO A;  1HYF A;  1RGE A;  1RDS A;  4BIR A;  1I0X A;  4HAA A;  1RNB A;  3GSP A;  1TRP A;  1YVS A;  5RNT A;  1GMP A;  1SAR A;  2C4B A;  1GOV A;  3URP A;  1LOW A;  9RNT A;  2F5W A;  1RN4 A;  1BNF A;  1A2P A;  1BSD A;  2KF5 A;  1I70 A;  1T2I A;  1FZU A;  1MGR A;  1BU4 A;  1G02 A;  1BRK A;  1BNJ A;  2BU4 A;  3HOH A;  1ZGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...