1RHLA

Ribonuclease t1 complexed with 2'gmp/g23a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAAYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Hydrogen-exchange stabilities of RNase T1 and variants with buried and solvent-exposed Ala --> Gly mutations in the helix.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rhlA00
3AHWA 2F5WA 3Q3FA 1BNEA 1RGGA 1RCKA 7RNTA 3SYUA 1GOYA 6RNTA 1I70A 1BUJA 1B3SA 1DE3A 1BGSA 1X1UA 1BRIA 1MGWA 4J5GA 2BU4A 2F5MA 3KCHA 5BIRA 1IYYA 1LOVA 1BNJA 2AAEA 3AHSA 3RNTA 2BIRA 1GOUA 1I0XA 1RGEA 3D5IA 1GMRA 3D5GA 1RCLA 1GOVA 1X1WA 4J5KA 3A5EA 3GSPA 1GSPA 1C54A 6GSPA 3D4AA 1BU4A 1YGWA 1BIRA 1I2EA 4HAAA 2KF6A 4BU4A 1CH0A 1BNIA 2F4YA 1BNRA 1PYLA 1YVSA 1JBSA 1RNTA 1BRNL 2GSPA 1BNGA 2F56A 1MGRA 1B2UA 1B27A 5BU4A 1LOWA 1LRAA 1B2ZA 1BRJA 1LNIA 2KF4A 1T2HA 3HOHA 1B2MA 1T2IA 1BRGA 1RGCA 2KF5A 1RGFA 1RTUA 1BRSA 1RLSA 1I0VA 1RGHA 1UCJA 2ZA4A 1FUSA 1BSCA 2C4BA 1BNFA 2SARA 1BRKA 3URPA 1TTOA 1GMQA 1RSNA 1RMSA 3BU4A 1BSAA 1AQZA 3WHOA 1BRHA 3BIRA 3WR2A 1UCKA 1ZGXA 5HOHA 1FYSA 1RNBA 1JBRA 3AGOA 2RBIA 9RNTA 1I2FA 1FUTA 1Q9EA 1RGKA 5GSPA 1R4YA 1BANA 4RNTA 1HZ1A 2KF3A 1G02A 1TRPA 1DETA 1RN4A 1UCLA 4HOHA 1I8VA 3DH2A 1B2XA 1B2SA 5RNTA 8RNTA 1BSDA 1PY3A 1X1YA 1I3FA 1BOXA 3DGYA 1FW7A 4GHOA 1A2PA 1SARA 1JBTA 1TRQA 2HOHA 3AGNA 1HYFA 1RDSA 1B21A 1BAOA 1I3IA 1UCIA 1BSEA 1BNSA 1RGAA 1LOYA 1I2GA 2AADA 2KAAA 1X1XA 7GSPA 1BVIA 1GMPA 1FZUA 1YNVX 1B20A 1RN1A 2RNTA 4GSPA 1BSBA 4BIRA 1RGLA 1AY7A 1RHLA
chains in the Genus database with same CATH superfamily
3AHWA 2Z76A 1FGOA 2CWVA 4KFDA 3NV0A 3EE1A 5M1AA 4EYCA 4HZBB 1GD3A 2QA43 1A90A 1W4NA 1JKGB 3WA3A 2MF7A 3DUKA 1W2B2 3SYUA 1N5HA 2WOFA 3AMOA 3IJEB 3NQZA 5CF2A 2CWUA 1SJWA 3KE7A 1IQ8A 1QAKA 1IVXA 1BUJA 5BVBA 3UL5A 5IEOA 2W9QA 3CNXA 1YJ93 1EA2A 3LXUX 4WFOA 4J5GA 3ECFA 1EQKA 1JKGA 2IUKA 2F98A 2CG0A 2OOVC 3LT9A 1SQWA 4XDVA 3CPW2 3BLZA 4BL3A 3AHSA 4FMDA 2SBLA 1WQLB 1GOUA 1LQMB 1RGEA 3DZLA 3Q2PA 4X2HA 3D5GA 3BNEA 2XFTA 1JZOA 1NJI4 4J5KA 2O9UX 3EX9A 1IT7A 1HKXA 3D4AA 1BU4A 3HIGA 2CX1A 4I5QA 1I2EA 1IVWA 2CC3A 1VQL3 3N8BA 1YJW3 1YVBI 3IPTA 1QVF2 4LZIA 3K63A 5A0OB 1VQ93 4HM0B 1TU5A 1BNRA 5D82A 1NNVA 1RNTA 4MMZB 1VZZA 2IMJA 2F56A 2CFLA 2V1LA 5KP1A 1UGIA 2XSOB 3FGYA 2W6JH 1S5AA 2D42A 4XM4A 4STDA 1O7NB 1W00A 3N54B 5D83A 1IVUA 3HOHA 3K5TA 3MWZA 4N6NB 5EEOA 4MMYB 1RGCA 2KF5A 4NHFA 2CK3H 3VSYA 2ZA4A 1QVG2 3CNMA 1IQYA 3PXMA 3S5CA 2UUGC 1Q40B 5KP4A 4MMXB 5AEWB 2CWTA 2SARA 2QGUA 2R4IA 1BRKA 4X2OA 1OH0A 1RMSA 1OPYA 1K41A 4N3VA 2GU3A 3WHOA 4CPKA 3L0RA 1BRHA 3D9RA 1EUIC 1NDOB 2OQEA 3V98A 3Q1CA 3PCSA 3G4S3 3OWUA 5HOHA 4H61A 3AGOA 1S723 2RBIA 3GWRA 3LTCA 2OOVA 4WYKA 3X3ZA 1QALA 5STDA 3GZRA 1RGKA 5GSPA 1LQGC 3KSED 3T8UA 2JDIH 1FGQA 5M19A 4MJDA 2BMRB 4HOHA 4N6MA 1R4CA 3KN4A 3IMAB 5IENA 2HMLB 1STFI 4XB5A 5TGNA 1I3FA 3S27A 3STDA 2W56A 5JPUA 2FXTA 3DGLA 4HJLB 3BNCA 4BTXA 3AGNA 5JBSA 1JN5B 1ZX2A 1AR0A 1WNHA 2A15A 3X3YA 3CD63 3CCE3 1M1K4 1GY6A 3OWSA 2Z7AA 3WODG 3F40A 4WHAA 2B1XB 1BNSA 3EJVA 1VQP3 4L7KA 1M9GA 4HZ9B 1JN5A 5AIFA 4XDWA 1GYBA 3X3XA 1W02A 1YNVX 5M18A 2GBXB 1YGEA 2RNTA 3CPOA 3FG1A 5CLKA 1BSBA 1D6ZA 2CFDA 2H0HA 2HMKB 1LNHA 2P38A 1RGLA 2OTL3 3DM8A 2GEXA 1W6GA 2RCDA 3N9HA 2UX0A 3FKAA 1K28A 3MPHA 1TFKA 3NM7A 3OXAA 3K0ZA 4FCMA 1BNEA 7RNTA 1RCKA 1ROVA 1W2ZA 2E2VA 4TX4A 4AKYA 2ZDJA 3K7CA 4XBYA 3X42A 3GRDA 1MNLA 3F9SA 1TIJA 2XF3A 1MOLA 3CCQ3 2CHCA 4L8PA 3FF2A 2F5MA 3KCHA 2JQ5A 3FG3A 2XFSA 3F7XA 3HK4A 3OX9A 1IYYA 2ML6A 1LOVA 1IDPA 3LOYA 4O3VA 4O2HA 1BNJA 3I553 3RDEA 4HM8B 2BIRA 3EN8A 1VQ83 1I0XA 3MG1A 3PCRA 1IVVA 1Q824 4AKZA 3OW22 2CIUA 3MHEA 3SXXA 1GOVA 1QJGA 2YFLB 3MKIA 4HYZA 5CK6A 4NPBA 4G1MB 1OF5B 1BIRA 2CFWA 1AVLA 1GD4A 1JV2B 2K3DA 4R9KA 4BU4A 3LTAA 5BXQA 7STDA 5IG5A 1ISKA 2F4YA 1DMMA 1MWRA 3EF8A 4R9LA 1Q7HA 4KT3B 3CCM3 2GSPA 1BRNL 3UNLA 3H3HA 4R80A 1MGRA 1OUNA 3CCU3 1OF5A 2RGQA 3GZYB 4IIAA 3UJMA 1B2ZA 3JUNA 1BRJA 2QIYA 4FMAA 1B2MA 3TDGA 1UDII 3JUMA 5AIGA 1PFPA 1O7GB 3RGAA 1I0VA 4HM2B 5IW9A 5G2GA 1K734 2KCDA 2C4BA 4L8OA 2PNCA 1VQK3 4EV5A 4FR9A 2BT3A 3URPA 3BNDA 1RSNA 3DY5A 3BU4A 1BSAA 3HI7A 1NO3A 4K1VA 1U8CB 3BIRA 3WR2A 1UCKA 5EQLA 4HVNA 5IF6A 1FYSA 1F8NA 1RNBA 1V57A 4U13A 3OV4A 3EB8A 3BB9A 1I2FA 1W01A 2BMOB 2O3OA 5I97A 1IT8A 1RRHA 1R4YA 1IK3A 1BANA 3LMLA 3VGNA 2P0XA 2KF3A 1G02A 4N6OB 4BTWA 5IERA 3WOFB 1UCLA 4KFEA 3B4OA 3DH2A 1UUGB 2BHMA 5RNTA 1PY3A 1EEJA 1M1XB 1BOXA 3DXOA 1QMAA 3DGYA 2GBWB 2WO0A 4GHOA 4AEQA 3ZG5A 1LOXA 1SARA 1WMPA 1YIJ3 1EKMA 6STDA 4ZM8A 1N5PA 4N6LA 3RGRA 1RDSA 5AYRB 1RRLA 1YJN3 2XH9A 3MSOA 4CCVA 3HIIA 1JNQA 3K9MC 1UCIA 3KFQC 3WA2X 1N8R4 2AADA 1Q42A 2BNGA 1Q40A 4J9AA 4CDLA 2OTJ3 3ZFZA 4WP5A 7GSPA 4N6UA 3X41A 1ULIB 1BVIA 1WTHA 3U97A 5IG3A 1B20A 1RN1A 1Z1SA 1FGTA 3M8CA 4LSOA 4N6TA 2IUJA 1JJ22 4BIRA 2K0MA 5IG0A 3SVAA 3CC73 4O02B 1OGXA 1O7WB 1IU7A 2F5WA 1TFOA 3FG4A 4DKIA 1KC84 1MWUA 1N9JA 3Q3FA 3HZPA 2OCTA 1RGGA 1IV7A 2L4VA 1SPUA 1G96A 1I70A 1UI8A 2F99A 2B24B 4LGQA 1DE3A 1BGSA 3MG2A 4LEHA 4QWTA 4ORLA 4N6V0 3CCV3 1BRIA 2BU4A 1W6CA 4HKVB 2YFIB 2E2UA 4EW5A 2GU1A 4NREA 1JZDA 2H0IA 3FZWA 3T0UA 2KXGA 3G0KA 4Q53A 1VQ53 3V99A 1DVDA 4O8SA 1VQM3 1WMNA 1RCLA 2XGNA 1O7HB 1W5ZA 1NWWA 2QEX3 1N8QA 2WGOA 4IT7A 6GSPA 3CC43 1UI7A 3KIIA 1SIHA 2L1SA 3SLUA 4HAAA 1GY7A 1O7MB 3NM2A 4R1KA 2PZVA 4J8TA 3UL6A 1CH0A 1BNIA 3F8XA 3G16A 3BNBA 3LT8A 4KFFA 4KZ1A 1PYLA 5DREA 1JBSA 5AIIA 2W03A 3MYTA 4K61A 1STDA 3WMDA 3EN1B 1QAFA 3O8YA 3EBYA 1B2UA 4GB5A 1A2KA 2ML5A 5LC7A 1US1A 1LOWA 1LRAA 3D3LA 5G1KA 3V92A 1LNIA 2CX0A 4K1UA 1T2HA 4FMBA 3X40A 1T2IA 1BRGA 1FGMA 2XRXB 3QRDA 4WWUC 3CU3A 1RGFA 2Z6BA 1RTUA 1BRSA 1W6YA 2XGLA 2CH9A 1YIT3 1FUSA 4HM6B 1BSCA 2XR8B 5HGRA 4OUQA 1KSIA 3SOAA 5ELJA 2LYXA 1BNFA 1VQ63 2INXA 1ZO2A 2GXFA 3ZG0A 3GZBA 2W0QA 3ER7A 4FCJA 3U1WA 1ZS7A 2K54A 1AQZA 3SX1A 3JUPA 1TUHA 1YI23 2CFGA 2XEPA 4HM7B 3DGOA 1ZGXA 2W04A 2MC8A 5IG4A 2J8XB 4HM4B 5AIHA 2IA7A 9RNTA 4RNYA 2E2TA 1IQXA 2C10A 3G6E3 5DRVA 2Z77A 1CEWI 4RNTA 4GL6A 1HZ1A 1UUWB 5JPPA 1TRPA 1DETA 2FNQA 1RN4A 1DVCA 1I8VA 1JRQA 3PYJA 1B2XA 1B2SA 3FF0A 1BSDA 1X1YA 3LTBA 1GY5A 1Q814 1MWSA 1JBTA 3GAXA 1TRQA 1Y4KA 1NU3A 2HOHA 1V74A 3CCR3 1E97A 1HYFA 2P09A 1JB4A 2IY2A 1MWTA 3KZTA 1OCVA 2LQVA 4HM5B 1VQO3 2I9WA 3PZWA 1I3IA 2OQEC 4RZMA 1BSEA 1CYVA 1VQ73 1KWIA 1JB2A 1RGAA 1LOYA 1U5OA 1I2GA 2BMQB 2KAAA 3A76A 1VQN3 1Q7Y4 3PS8A 4HM3B 3FSDA 4EXRA 3WDGB 5EVHA 2CG1A 5AEUB 1GMPA 1C7HA 1CQSA 2D1WA 4K90B 3CCS3 3NUVA 3JVCA 2HMOB 1GS3A 3CME3 1JB5A 1D6UA 1ULJB 2XSHB 3NXJA 1AY7A 1LXEA 1RHLA 4MEIA 3I0YA 1TP6A 2OWPA 3LH4A 4R4KA 1AV4A 3LZAA 1NB5I 2C11A 3I563 1GOYA 3NBBA 3DGMA 5CF1A 2HMMB 3OWYA 1D6YA 3WOEB 6RNTA 3ROBA 1FGRA 1B3SA 2UGIA 2W9PA 3UB1A 1VQ43 1RN7A 2F86B 1YHQ3 2CKFB 3PGBA 1DMNA 1X1UA 4PEJA 1MGWA 2M7OA 1RJOA 3EHCA 3S29A 5BIRA 1Q864 2IYJA 3VF1A 3H51A 3KKGA 2AAEA 1HU9A 3RNTA 5D81A 1O7PB 3D5IA 3MG3A 2WOHA 1GMRA 3LTDA 3QK9A 5CXOA 2ZL8A 1E3VA 1X1WA 1DYUA 4WYKB 3A5EA 3GSPA 1GSPA 1IV9A 1UUVB 4EBGA 1C54A 1YGWA 3G713 2YFJB 3B4PA 1CYUA 3SOYA 1OHSA 1UGHI 2KF6A 1A67A 1OHOA 3E99A 3S67A 2Y74A 3SEDA 1ROAA 3FCSB 1EG9B 1YVSA 1KQS2 3NX0A 1BNGA 2W56B 4JF8A 3G8ZA 1B27A 3GZXB 5BU4A 2HMJB 2ZHXB 3T8NA 4IPBA 3NBJA 2RFRA 2KF4A 3F14A 3HX8A 2H0GA 2R41A 5FGOA 5AYSC 2RSXA 2P0MA 1RLSA 1RGHA 1UCJA 2YX9A 3DGNA 3EBTA 1M904 4CJNA 1T5YA 4JRFA 3CMA3 1UW1A 4BL2A 3D79A 3NHXA 5ELUA 1TTOA 5FW5A 1GMQA 1VQQA 4LMIA 3LYGA 3DMCA 1AVKA 1OHPA 4OVMA 3B8LA 1KD14 4HBRA 1JBRA 4I4KA 5LC6A 1FA3A 2W2CA 5IEPA 3F7SA 4OK0A 1FUTA 1L5GB 3NBRA 1Q9EA 2GEYA 3ALAA 3EC9A 1DMQA 1OGZA 2HMNB 1TJDA 1W7CA 3S28A 3J7Yd 1E3RA 1K8A4 1SIIA 3CXC2 8RNTA 4LYLB 1LVNA 4H3UA 5KP3A 1FW7A 2STDA 2KRTA 4FMCA 3FH1A 1A2PA 1PU4A 3EQQB 2CW9A 4XBTA 1G0TA 1BUQA 1WMOA 5AI1A 3JUOA 3KSPA 4XBXA 3Q90A 4BTYA 1B21A 2WGQA 3CC23 1V58A 1BAOA 5G1LA 2Y73A 1OACA 3CCL3 1FUWA 1J2BA 4EC6A 4EV2A 4HM1B 1K9M4 3NQYA 4FCZA 3B7CA 1NB3I 1X1XA 3F8HA 4KVHA 3NV0B 1RKYA 4RBNA 2P05A 4ILFA 1T3BA 1ASKA 3CCJ3 2CFKA 1FZUA 2BO9B 3AMOB 4RNZA 1N9EA 1A2VA 3FLJA 8CHOA 3JUQA 2FGTA 2Q07A 4GSPA
chains in the Genus database with same CATH topology
3AHWA 2F5WA 3Q3FA 1BNEA 1RGGA 1RCKA 7RNTA 3SYUA 1GOYA 6RNTA 1I70A 1BUJA 1B3SA 1DE3A 1BGSA 1X1UA 1BRIA 1MGWA 4J5GA 2BU4A 2F5MA 3KCHA 5BIRA 1IYYA 1LOVA 1BNJA 2AAEA 3AHSA 3RNTA 2BIRA 1GOUA 1I0XA 1RGEA 3D5IA 1GMRA 3D5GA 1RCLA 1GOVA 1X1WA 4J5KA 3A5EA 3GSPA 1GSPA 1C54A 6GSPA 3D4AA 1BU4A 1YGWA 1BIRA 1I2EA 4HAAA 2KF6A 4BU4A 1CH0A 1BNIA 2F4YA 1BNRA 1PYLA 1YVSA 1JBSA 1RNTA 1BRNL 2GSPA 1BNGA 2F56A 1MGRA 1B2UA 1B27A 5BU4A 1LOWA 1LRAA 1B2ZA 1BRJA 1LNIA 2KF4A 1T2HA 3HOHA 1B2MA 1T2IA 1BRGA 1RGCA 2KF5A 1RGFA 1RTUA 1BRSA 1RLSA 1I0VA 1RGHA 1UCJA 2ZA4A 1FUSA 1BSCA 2C4BA 1BNFA 2SARA 1BRKA 3URPA 1TTOA 1GMQA 1RSNA 1RMSA 3BU4A 1BSAA 1AQZA 3WHOA 1BRHA 3BIRA 3WR2A 1UCKA 1ZGXA 5HOHA 1FYSA 1RNBA 1JBRA 3AGOA 2RBIA 9RNTA 1I2FA 1FUTA 1Q9EA 1RGKA 5GSPA 1R4YA 1BANA 4RNTA 1HZ1A 2KF3A 1G02A 1TRPA 1DETA 1RN4A 1UCLA 4HOHA 1I8VA 3DH2A 1B2XA 1B2SA 5RNTA 8RNTA 1BSDA 1PY3A 1X1YA 1I3FA 1BOXA 3DGYA 1FW7A 4GHOA 1A2PA 1SARA 1JBTA 1TRQA 2HOHA 3AGNA 1HYFA 1RDSA 1B21A 1BAOA 1I3IA 1UCIA 1BSEA 1BNSA 1RGAA 1LOYA 1I2GA 2AADA 2KAAA 1X1XA 7GSPA 1BVIA 1GMPA 1FZUA 1YNVX 1B20A 1RN1A 2RNTA 4GSPA 1BSBA 4BIRA 1RGLA 1AY7A 1RHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHW A;  2F5W A;  3Q3F A;  1BNE A;  1RGG A;  1RCK A;  7RNT A;  3SYU A;  1GOY A;  6RNT A;  1I70 A;  1BUJ A;  1B3S A;  1DE3 A;  1BGS A;  1X1U A;  1BRI A;  1MGW A;  4J5G A;  2BU4 A;  2F5M A;  3KCH A;  5BIR A;  1IYY A;  1LOV A;  1BNJ A;  2AAE A;  3AHS A;  3RNT A;  2BIR A;  1GOU A;  1I0X A;  1RGE A;  3D5I A;  1GMR A;  3D5G A;  1RCL A;  1GOV A;  1X1W A;  4J5K A;  3A5E A;  3GSP A;  1GSP A;  1C54 A;  6GSP A;  3D4A A;  1BU4 A;  1YGW A;  1BIR A;  1I2E A;  4HAA A;  2KF6 A;  4BU4 A;  1CH0 A;  1BNI A;  2F4Y A;  1BNR A;  1PYL A;  1YVS A;  1JBS A;  1RNT A;  1BRN L;  2GSP A;  1BNG A;  2F56 A;  1MGR A;  1B2U A;  1B27 A;  5BU4 A;  1LOW A;  1LRA A;  1B2Z A;  1BRJ A;  1LNI A;  2KF4 A;  1T2H A;  3HOH A;  1B2M A;  1T2I A;  1BRG A;  1RGC A;  2KF5 A;  1RGF A;  1RTU A;  1BRS A;  1RLS A;  1I0V A;  1RGH A;  1UCJ A;  2ZA4 A;  1FUS A;  1BSC A;  2C4B A;  1BNF A;  2SAR A;  1BRK A;  3URP A;  1TTO A;  1GMQ A;  1RSN A;  1RMS A;  3BU4 A;  1BSA A;  1AQZ A;  3WHO A;  1BRH A;  3BIR A;  3WR2 A;  1UCK A;  1ZGX A;  5HOH A;  1FYS A;  1RNB A;  1JBR A;  3AGO A;  2RBI A;  9RNT A;  1I2F A;  1FUT A;  1Q9E A;  1RGK A;  5GSP A;  1R4Y A;  1BAN A;  4RNT A;  1HZ1 A;  2KF3 A;  1G02 A;  1TRP A;  1DET A;  1RN4 A;  1UCL A;  4HOH A;  1I8V A;  3DH2 A;  1B2X A;  1B2S A;  5RNT A;  8RNT A;  1BSD A;  1PY3 A;  1X1Y A;  1I3F A;  1BOX A;  3DGY A;  1FW7 A;  4GHO A;  1A2P A;  1SAR A;  1JBT A;  1TRQ A;  2HOH A;  3AGN A;  1HYF A;  1RDS A;  1B21 A;  1BAO A;  1I3I A;  1UCI A;  1BSE A;  1BNS A;  1RGA A;  1LOY A;  1I2G A;  2AAD A;  2KAA A;  1X1X A;  7GSP A;  1BVI A;  1GMP A;  1FZU A;  1YNV X;  1B20 A;  1RN1 A;  2RNT A;  4GSP A;  1BSB A;  4BIR A;  1RGL A;  1AY7 A;  1RHL A; 
#chains in the Genus database with same CATH topology
 3AHW A;  2Z76 A;  1FGO A;  2CWV A;  4KFD A;  3NV0 A;  3EE1 A;  5M1A A;  4EYC A;  4HZB B;  1GD3 A;  2QA4 3;  1A90 A;  1W4N A;  1JKG B;  3WA3 A;  2MF7 A;  3DUK A;  1W2B 2;  3SYU A;  1N5H A;  2WOF A;  3AMO A;  3IJE B;  3NQZ A;  5CF2 A;  2CWU A;  1SJW A;  3KE7 A;  1IQ8 A;  1QAK A;  1IVX A;  1BUJ A;  5BVB A;  3UL5 A;  5IEO A;  2W9Q A;  3CNX A;  1YJ9 3;  1EA2 A;  3LXU X;  4WFO A;  4J5G A;  3ECF A;  1EQK A;  1JKG A;  2IUK A;  2F98 A;  2CG0 A;  2OOV C;  3LT9 A;  1SQW A;  4XDV A;  3CPW 2;  3BLZ A;  4BL3 A;  3AHS A;  4FMD A;  2SBL A;  1WQL B;  1GOU A;  1LQM B;  1RGE A;  3DZL A;  3Q2P A;  4X2H A;  3D5G A;  3BNE A;  2XFT A;  1JZO A;  1NJI 4;  4J5K A;  2O9U X;  3EX9 A;  1IT7 A;  1HKX A;  3D4A A;  1BU4 A;  3HIG A;  2CX1 A;  4I5Q A;  1I2E A;  1IVW A;  2CC3 A;  1VQL 3;  3N8B A;  1YJW 3;  1YVB I;  3IPT A;  1QVF 2;  4LZI A;  3K63 A;  5A0O B;  1VQ9 3;  4HM0 B;  1TU5 A;  1BNR A;  5D82 A;  1NNV A;  1RNT A;  4MMZ B;  1VZZ A;  2IMJ A;  2F56 A;  2CFL A;  2V1L A;  5KP1 A;  1UGI A;  2XSO B;  3FGY A;  2W6J H;  1S5A A;  2D42 A;  4XM4 A;  4STD A;  1O7N B;  1W00 A;  3N54 B;  5D83 A;  1IVU A;  3HOH A;  3K5T A;  3MWZ A;  4N6N B;  5EEO A;  4MMY B;  1RGC A;  2KF5 A;  4NHF A;  2CK3 H;  3VSY A;  2ZA4 A;  1QVG 2;  3CNM A;  1IQY A;  3PXM A;  3S5C A;  2UUG C;  1Q40 B;  5KP4 A;  4MMX B;  5AEW B;  2CWT A;  2SAR A;  2QGU A;  2R4I A;  1BRK A;  4X2O A;  1OH0 A;  1RMS A;  1OPY A;  1K41 A;  4N3V A;  2GU3 A;  3WHO A;  4CPK A;  3L0R A;  1BRH A;  3D9R A;  1EUI C;  1NDO B;  2OQE A;  3V98 A;  3Q1C A;  3PCS A;  3G4S 3;  3OWU A;  5HOH A;  4H61 A;  3AGO A;  1S72 3;  2RBI A;  3GWR A;  3LTC A;  2OOV A;  4WYK A;  3X3Z A;  1QAL A;  5STD A;  3GZR A;  1RGK A;  5GSP A;  1LQG C;  3KSE D;  3T8U A;  2JDI H;  1FGQ A;  5M19 A;  4MJD A;  2BMR B;  4HOH A;  4N6M A;  1R4C A;  3KN4 A;  3IMA B;  5IEN A;  2HML B;  1STF I;  4XB5 A;  5TGN A;  1I3F A;  3S27 A;  3STD A;  2W56 A;  5JPU A;  2FXT A;  3DGL A;  4HJL B;  3BNC A;  4BTX A;  3AGN A;  5JBS A;  1JN5 B;  1ZX2 A;  1AR0 A;  1WNH A;  2A15 A;  3X3Y A;  3CD6 3;  3CCE 3;  1M1K 4;  1GY6 A;  3OWS A;  2Z7A A;  3WOD G;  3F40 A;  4WHA A;  2B1X B;  1BNS A;  3EJV A;  1VQP 3;  4L7K A;  1M9G A;  4HZ9 B;  1JN5 A;  5AIF A;  4XDW A;  1GYB A;  3X3X A;  1W02 A;  1YNV X;  5M18 A;  2GBX B;  1YGE A;  2RNT A;  3CPO A;  3FG1 A;  5CLK A;  1BSB A;  1D6Z A;  2CFD A;  2H0H A;  2HMK B;  1LNH A;  2P38 A;  1RGL A;  2OTL 3;  3DM8 A;  2GEX A;  1W6G A;  2RCD A;  3N9H A;  2UX0 A;  3FKA A;  1K28 A;  3MPH A;  1TFK A;  3NM7 A;  3OXA A;  3K0Z A;  4FCM A;  1BNE A;  7RNT A;  1RCK A;  1ROV A;  1W2Z A;  2E2V A;  4TX4 A;  4AKY A;  2ZDJ A;  3K7C A;  4XBY A;  3X42 A;  3GRD A;  1MNL A;  3F9S A;  1TIJ A;  2XF3 A;  1MOL A;  3CCQ 3;  2CHC A;  4L8P A;  3FF2 A;  2F5M A;  3KCH A;  2JQ5 A;  3FG3 A;  2XFS A;  3F7X A;  3HK4 A;  3OX9 A;  1IYY A;  2ML6 A;  1LOV A;  1IDP A;  3LOY A;  4O3V A;  4O2H A;  1BNJ A;  3I55 3;  3RDE A;  4HM8 B;  2BIR A;  3EN8 A;  1VQ8 3;  1I0X A;  3MG1 A;  3PCR A;  1IVV A;  1Q82 4;  4AKZ A;  3OW2 2;  2CIU A;  3MHE A;  3SXX A;  1GOV A;  1QJG A;  2YFL B;  3MKI A;  4HYZ A;  5CK6 A;  4NPB A;  4G1M B;  1OF5 B;  1BIR A;  2CFW A;  1AVL A;  1GD4 A;  1JV2 B;  2K3D A;  4R9K A;  4BU4 A;  3LTA A;  5BXQ A;  7STD A;  5IG5 A;  1ISK A;  2F4Y A;  1DMM A;  1MWR A;  3EF8 A;  4R9L A;  1Q7H A;  4KT3 B;  3CCM 3;  2GSP A;  1BRN L;  3UNL A;  3H3H A;  4R80 A;  1MGR A;  1OUN A;  3CCU 3;  1OF5 A;  2RGQ A;  3GZY B;  4IIA A;  3UJM A;  1B2Z A;  3JUN A;  1BRJ A;  2QIY A;  4FMA A;  1B2M A;  3TDG A;  1UDI I;  3JUM A;  5AIG A;  1PFP A;  1O7G B;  3RGA A;  1I0V A;  4HM2 B;  5IW9 A;  5G2G A;  1K73 4;  2KCD A;  2C4B A;  4L8O A;  2PNC A;  1VQK 3;  4EV5 A;  4FR9 A;  2BT3 A;  3URP A;  3BND A;  1RSN A;  3DY5 A;  3BU4 A;  1BSA A;  3HI7 A;  1NO3 A;  4K1V A;  1U8C B;  3BIR A;  3WR2 A;  1UCK A;  5EQL A;  4HVN A;  5IF6 A;  1FYS A;  1F8N A;  1RNB A;  1V57 A;  4U13 A;  3OV4 A;  3EB8 A;  3BB9 A;  1I2F A;  1W01 A;  2BMO B;  2O3O A;  5I97 A;  1IT8 A;  1RRH A;  1R4Y A;  1IK3 A;  1BAN A;  3LML A;  3VGN A;  2P0X A;  2KF3 A;  1G02 A;  4N6O B;  4BTW A;  5IER A;  3WOF B;  1UCL A;  4KFE A;  3B4O A;  3DH2 A;  1UUG B;  2BHM A;  5RNT A;  1PY3 A;  1EEJ A;  1M1X B;  1BOX A;  3DXO A;  1QMA A;  3DGY A;  2GBW B;  2WO0 A;  4GHO A;  4AEQ A;  3ZG5 A;  1LOX A;  1SAR A;  1WMP A;  1YIJ 3;  1EKM A;  6STD A;  4ZM8 A;  1N5P A;  4N6L A;  3RGR A;  1RDS A;  5AYR B;  1RRL A;  1YJN 3;  2XH9 A;  3MSO A;  4CCV A;  3HII A;  1JNQ A;  3K9M C;  1UCI A;  3KFQ C;  3WA2 X;  1N8R 4;  2AAD A;  1Q42 A;  2BNG A;  1Q40 A;  4J9A A;  4CDL A;  2OTJ 3;  3ZFZ A;  4WP5 A;  7GSP A;  4N6U A;  3X41 A;  1ULI B;  1BVI A;  1WTH A;  3U97 A;  5IG3 A;  1B20 A;  1RN1 A;  1Z1S A;  1FGT A;  3M8C A;  4LSO A;  4N6T A;  2IUJ A;  1JJ2 2;  4BIR A;  2K0M A;  5IG0 A;  3SVA A;  3CC7 3;  4O02 B;  1OGX A;  1O7W B;  1IU7 A;  2F5W A;  1TFO A;  3FG4 A;  4DKI A;  1KC8 4;  1MWU A;  1N9J A;  3Q3F A;  3HZP A;  2OCT A;  1RGG A;  1IV7 A;  2L4V A;  1SPU A;  1G96 A;  1I70 A;  1UI8 A;  2F99 A;  2B24 B;  4LGQ A;  1DE3 A;  1BGS A;  3MG2 A;  4LEH A;  4QWT A;  4ORL A;  4N6V 0;  3CCV 3;  1BRI A;  2BU4 A;  1W6C A;  4HKV B;  2YFI B;  2E2U A;  4EW5 A;  2GU1 A;  4NRE A;  1JZD A;  2H0I A;  3FZW A;  3T0U A;  2KXG A;  3G0K A;  4Q53 A;  1VQ5 3;  3V99 A;  1DVD A;  4O8S A;  1VQM 3;  1WMN A;  1RCL A;  2XGN A;  1O7H B;  1W5Z A;  1NWW A;  2QEX 3;  1N8Q A;  2WGO A;  4IT7 A;  6GSP A;  3CC4 3;  1UI7 A;  3KII A;  1SIH A;  2L1S A;  3SLU A;  4HAA A;  1GY7 A;  1O7M B;  3NM2 A;  4R1K A;  2PZV A;  4J8T A;  3UL6 A;  1CH0 A;  1BNI A;  3F8X A;  3G16 A;  3BNB A;  3LT8 A;  4KFF A;  4KZ1 A;  1PYL A;  5DRE A;  1JBS A;  5AII A;  2W03 A;  3MYT A;  4K61 A;  1STD A;  3WMD A;  3EN1 B;  1QAF A;  3O8Y A;  3EBY A;  1B2U A;  4GB5 A;  1A2K A;  2ML5 A;  5LC7 A;  1US1 A;  1LOW A;  1LRA A;  3D3L A;  5G1K A;  3V92 A;  1LNI A;  2CX0 A;  4K1U A;  1T2H A;  4FMB A;  3X40 A;  1T2I A;  1BRG A;  1FGM A;  2XRX B;  3QRD A;  4WWU C;  3CU3 A;  1RGF A;  2Z6B A;  1RTU A;  1BRS A;  1W6Y A;  2XGL A;  2CH9 A;  1YIT 3;  1FUS A;  4HM6 B;  1BSC A;  2XR8 B;  5HGR A;  4OUQ A;  1KSI A;  3SOA A;  5ELJ A;  2LYX A;  1BNF A;  1VQ6 3;  2INX A;  1ZO2 A;  2GXF A;  3ZG0 A;  3GZB A;  2W0Q A;  3ER7 A;  4FCJ A;  3U1W A;  1ZS7 A;  2K54 A;  1AQZ A;  3SX1 A;  3JUP A;  1TUH A;  1YI2 3;  2CFG A;  2XEP A;  4HM7 B;  3DGO A;  1ZGX A;  2W04 A;  2MC8 A;  5IG4 A;  2J8X B;  4HM4 B;  5AIH A;  2IA7 A;  9RNT A;  4RNY A;  2E2T A;  1IQX A;  2C10 A;  3G6E 3;  5DRV A;  2Z77 A;  1CEW I;  4RNT A;  4GL6 A;  1HZ1 A;  1UUW B;  5JPP A;  1TRP A;  1DET A;  2FNQ A;  1RN4 A;  1DVC A;  1I8V A;  1JRQ A;  3PYJ A;  1B2X A;  1B2S A;  3FF0 A;  1BSD A;  1X1Y A;  3LTB A;  1GY5 A;  1Q81 4;  1MWS A;  1JBT A;  3GAX A;  1TRQ A;  1Y4K A;  1NU3 A;  2HOH A;  1V74 A;  3CCR 3;  1E97 A;  1HYF A;  2P09 A;  1JB4 A;  2IY2 A;  1MWT A;  3KZT A;  1OCV A;  2LQV A;  4HM5 B;  1VQO 3;  2I9W A;  3PZW A;  1I3I A;  2OQE C;  4RZM A;  1BSE A;  1CYV A;  1VQ7 3;  1KWI A;  1JB2 A;  1RGA A;  1LOY A;  1U5O A;  1I2G A;  2BMQ B;  2KAA A;  3A76 A;  1VQN 3;  1Q7Y 4;  3PS8 A;  4HM3 B;  3FSD A;  4EXR A;  3WDG B;  5EVH A;  2CG1 A;  5AEU B;  1GMP A;  1C7H A;  1CQS A;  2D1W A;  4K90 B;  3CCS 3;  3NUV A;  3JVC A;  2HMO B;  1GS3 A;  3CME 3;  1JB5 A;  1D6U A;  1ULJ B;  2XSH B;  3NXJ A;  1AY7 A;  1LXE A;  1RHL A;  4MEI A;  3I0Y A;  1TP6 A;  2OWP A;  3LH4 A;  4R4K A;  1AV4 A;  3LZA A;  1NB5 I;  2C11 A;  3I56 3;  1GOY A;  3NBB A;  3DGM A;  5CF1 A;  2HMM B;  3OWY A;  1D6Y A;  3WOE B;  6RNT A;  3ROB A;  1FGR A;  1B3S A;  2UGI A;  2W9P A;  3UB1 A;  1VQ4 3;  1RN7 A;  2F86 B;  1YHQ 3;  2CKF B;  3PGB A;  1DMN A;  1X1U A;  4PEJ A;  1MGW A;  2M7O A;  1RJO A;  3EHC A;  3S29 A;  5BIR A;  1Q86 4;  2IYJ A;  3VF1 A;  3H51 A;  3KKG A;  2AAE A;  1HU9 A;  3RNT A;  5D81 A;  1O7P B;  3D5I A;  3MG3 A;  2WOH A;  1GMR A;  3LTD A;  3QK9 A;  5CXO A;  2ZL8 A;  1E3V A;  1X1W A;  1DYU A;  4WYK B;  3A5E A;  3GSP A;  1GSP A;  1IV9 A;  1UUV B;  4EBG A;  1C54 A;  1YGW A;  3G71 3;  2YFJ B;  3B4P A;  1CYU A;  3SOY A;  1OHS A;  1UGH I;  2KF6 A;  1A67 A;  1OHO A;  3E99 A;  3S67 A;  2Y74 A;  3SED A;  1ROA A;  3FCS B;  1EG9 B;  1YVS A;  1KQS 2;  3NX0 A;  1BNG A;  2W56 B;  4JF8 A;  3G8Z A;  1B27 A;  3GZX B;  5BU4 A;  2HMJ B;  2ZHX B;  3T8N A;  4IPB A;  3NBJ A;  2RFR A;  2KF4 A;  3F14 A;  3HX8 A;  2H0G A;  2R41 A;  5FGO A;  5AYS C;  2RSX A;  2P0M A;  1RLS A;  1RGH A;  1UCJ A;  2YX9 A;  3DGN A;  3EBT A;  1M90 4;  4CJN A;  1T5Y A;  4JRF A;  3CMA 3;  1UW1 A;  4BL2 A;  3D79 A;  3NHX A;  5ELU A;  1TTO A;  5FW5 A;  1GMQ A;  1VQQ A;  4LMI A;  3LYG A;  3DMC A;  1AVK A;  1OHP A;  4OVM A;  3B8L A;  1KD1 4;  4HBR A;  1JBR A;  4I4K A;  5LC6 A;  1FA3 A;  2W2C A;  5IEP A;  3F7S A;  4OK0 A;  1FUT A;  1L5G B;  3NBR A;  1Q9E A;  2GEY A;  3ALA A;  3EC9 A;  1DMQ A;  1OGZ A;  2HMN B;  1TJD A;  1W7C A;  3S28 A;  3J7Y d;  1E3R A;  1K8A 4;  1SII A;  3CXC 2;  8RNT A;  4LYL B;  1LVN A;  4H3U A;  5KP3 A;  1FW7 A;  2STD A;  2KRT A;  4FMC A;  3FH1 A;  1A2P A;  1PU4 A;  3EQQ B;  2CW9 A;  4XBT A;  1G0T A;  1BUQ A;  1WMO A;  5AI1 A;  3JUO A;  3KSP A;  4XBX A;  3Q90 A;  4BTY A;  1B21 A;  2WGQ A;  3CC2 3;  1V58 A;  1BAO A;  5G1L A;  2Y73 A;  1OAC A;  3CCL 3;  1FUW A;  1J2B A;  4EC6 A;  4EV2 A;  4HM1 B;  1K9M 4;  3NQY A;  4FCZ A;  3B7C A;  1NB3 I;  1X1X A;  3F8H A;  4KVH A;  3NV0 B;  1RKY A;  4RBN A;  2P05 A;  4ILF A;  1T3B A;  1ASK A;  3CCJ 3;  2CFK A;  1FZU A;  2BO9 B;  3AMO B;  4RNZ A;  1N9E A;  1A2V A;  3FLJ A;  8CHO A;  3JUQ A;  2FGT A;  2Q07 A;  4GSP A; 
#chains in the Genus database with same CATH homology
 3AHW A;  2F5W A;  3Q3F A;  1BNE A;  1RGG A;  1RCK A;  7RNT A;  3SYU A;  1GOY A;  6RNT A;  1I70 A;  1BUJ A;  1B3S A;  1DE3 A;  1BGS A;  1X1U A;  1BRI A;  1MGW A;  4J5G A;  2BU4 A;  2F5M A;  3KCH A;  5BIR A;  1IYY A;  1LOV A;  1BNJ A;  2AAE A;  3AHS A;  3RNT A;  2BIR A;  1GOU A;  1I0X A;  1RGE A;  3D5I A;  1GMR A;  3D5G A;  1RCL A;  1GOV A;  1X1W A;  4J5K A;  3A5E A;  3GSP A;  1GSP A;  1C54 A;  6GSP A;  3D4A A;  1BU4 A;  1YGW A;  1BIR A;  1I2E A;  4HAA A;  2KF6 A;  4BU4 A;  1CH0 A;  1BNI A;  2F4Y A;  1BNR A;  1PYL A;  1YVS A;  1JBS A;  1RNT A;  1BRN L;  2GSP A;  1BNG A;  2F56 A;  1MGR A;  1B2U A;  1B27 A;  5BU4 A;  1LOW A;  1LRA A;  1B2Z A;  1BRJ A;  1LNI A;  2KF4 A;  1T2H A;  3HOH A;  1B2M A;  1T2I A;  1BRG A;  1RGC A;  2KF5 A;  1RGF A;  1RTU A;  1BRS A;  1RLS A;  1I0V A;  1RGH A;  1UCJ A;  2ZA4 A;  1FUS A;  1BSC A;  2C4B A;  1BNF A;  2SAR A;  1BRK A;  3URP A;  1TTO A;  1GMQ A;  1RSN A;  1RMS A;  3BU4 A;  1BSA A;  1AQZ A;  3WHO A;  1BRH A;  3BIR A;  3WR2 A;  1UCK A;  1ZGX A;  5HOH A;  1FYS A;  1RNB A;  1JBR A;  3AGO A;  2RBI A;  9RNT A;  1I2F A;  1FUT A;  1Q9E A;  1RGK A;  5GSP A;  1R4Y A;  1BAN A;  4RNT A;  1HZ1 A;  2KF3 A;  1G02 A;  1TRP A;  1DET A;  1RN4 A;  1UCL A;  4HOH A;  1I8V A;  3DH2 A;  1B2X A;  1B2S A;  5RNT A;  8RNT A;  1BSD A;  1PY3 A;  1X1Y A;  1I3F A;  1BOX A;  3DGY A;  1FW7 A;  4GHO A;  1A2P A;  1SAR A;  1JBT A;  1TRQ A;  2HOH A;  3AGN A;  1HYF A;  1RDS A;  1B21 A;  1BAO A;  1I3I A;  1UCI A;  1BSE A;  1BNS A;  1RGA A;  1LOY A;  1I2G A;  2AAD A;  2KAA A;  1X1X A;  7GSP A;  1BVI A;  1GMP A;  1FZU A;  1YNV X;  1B20 A;  1RN1 A;  2RNT A;  4GSP A;  1BSB A;  4BIR A;  1RGL A;  1AY7 A;  1RHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...