3I563

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3i56300
3I563 1JJ22 1N8R4 1VQL3 1VQ93 3CCS3 1QVF2 1YI23 1YIJ3 2QEX3 3CD63 3CC23 1K734 1Q864 1S723 1Q7Y4 3G4S3 1VQ83 3OW22 1M904 1VQ53 1VQN3 3CXC2 3CMA3 3G713 1M1K4 3CCR3 3CCM3 3CCV3 3CC73 1VQO3 3CME3 1YIT3 1VQK3 1KD14 3CCE3 2QA43 1VQP3 1VQ63 2OTJ3 1VQ73 1NJI4 1QVG2 1VQM3 1KC84 3I553 1K8A4 1K9M4 1KQS2 1VQ43 3CPW2 3G6E3 1YJ93 2OTL3 1YJN3 1YJW3 1YHQ3 3CCU3 3CCL3 3CCQ3 1W2B2 1Q824 3CCJ3 3CC43 1Q814
chains in the Genus database with same CATH superfamily
4FMBA 1N8R4 2XGLA 3D9RA 3PZWA 1GMPA 1QALA 1IU7A 7STDA 1W6YA 1K734 1UW1A 3GZYB 2UUGC 1BRIA 3Q2PA 2CH9A 1IVXA 1GD3A 3Q1CA 2WGQA 3N8BA 3FLJA 3HIGA 3QRDA 3K0ZA 1NWWA 3GWRA 4GL6A 4HM3B 3HK4A 2W2CA 4FR9A 5DREA 3ROBA 1VQP3 1QVG2 3NHXA 2XFSA 3VSYA 1B21A 3I553 3D4AA 3MKIA 3LTDA 3KSED 3D3LA 2LYXA 5EQLA 1W6GA 1BANA 1FGTA 1RTUA 1WQLB 2CFWA 3LH4A 3DGLA 3CCU3 3NBJA 3OV4A 3LTBA 2IUKA 1I2EA 3CCJ3 3F7SA 3UNLA 3F8HA 2ZHXB 1ULJB 3WA3A 1UUWB 1FW7A 3SOYA 2GEXA 1MWRA 2I9WA 1MWTA 2PZVA 3EN1B 3S67A 1VQQA 1R4YA 2MC8A 3NX0A 3U1WA 1BNRA 4KFDA 1FUWA 1X1WA 2ZL8A 1Z1SA 1V58A 1VQ83 4ZM8A 1TFKA 1I70A 2SARA 1M1K4 1GY5A 2HMMB 3OWUA 2D1WA 1QAKA 1EUIC 1LOWA 1LQMB 2R4IA 2WO0A 2YFLB 1IVWA 3MSOA 5HOHA 4LEHA 2QA43 1BNEA 3OX9A 5CXOA 3OWSA 1BAOA 1I0VA 4J9AA 1JB4A 3T8UA 3FG3A 1RCKA 2HMOB 2XF3A 2RSXA 3TDGA 3VGNA 5IG4A 1VQ43 1BRGA 2IY2A 1IK3A 2WOFA 3FGYA 3WA2X 3IPTA 2CIUA 4OVMA 2B24B 3UL5A 3ALAA 3X3YA 1N8QA 4N6UA 1RNTA 3DUKA 1UGHI 2HMLB 3JUOA 3K5TA 4IPBA 1FZUA 4IT7A 2IUJA 3FH1A 1FGMA 1ZO2A 1QVF2 2W56B 5HGRA 4AKZA 3CNMA 3AMOA 1QAFA 3EJVA 4N6OB 1RCLA 1VZZA 1MGRA 1O7MB 1IYYA 5BU4A 3BNEA 1Q40B 4OK0A 1UI8A 2JQ5A 3F14A 3SEDA 2CWTA 1Q7HA 1E3VA 3GAXA 1C54A 1LOXA 2YFIB 3NQZA 3CNXA 1JBSA 1IQXA 5G2GA 5STDA 1U5OA 1K28A 4KFFA 8RNTA 1B27A 4BU4A 2LQVA 1RN1A 1TUHA 2W03A 3SVAA 1ROAA 1YNVX 5IEPA 1S723 1IVVA 1OGXA 5DRVA 5IF6A 2XSOB 4FMDA 4KT3B 1LOYA 3V92A 3UJMA 1CEWI 1WTHA 3K63A 5AIGA 1BOXA 4EW5A 5AEWB 1UI7A 1PY3A 2YFJB 1UDII 1IT8A 4HZ9B 1JKGA 5KP3A 4EV5A 1VQK3 4HM0B 3S28A 3J7Yd 4R80A 1NNVA 4OUQA 1KC84 2MF7A 4XBYA 5IERA 1SIIA 1U8CB 4HM7B 1YJ93 3WDGB 1I0XA 1X1UA 4RNZA 3CPOA 3PGBA 2HOHA 2W9PA 1DMQA 4XDWA 3A76A 5JBSA 2L4VA 2C11A 1BSBA 5AIHA 4K90B 3T0UA 1I3FA 1ZGXA 2CK3H 4J8TA 4R1KA 3DXOA 4KFEA 2CFGA 1JZOA 3EN8A 1OHOA 1IVUA 1BNIA 3CD63 4LGQA 2KF6A 3MG3A 1ISKA 2H0IA 3FKAA 1JN5A 3WOFB 1OF5B 3G4S3 3DGMA 3CXC2 4L8PA 3PXMA 1BGSA 1RMSA 3BB9A 3JUQA 1BNSA 3LXUX 4X2HA 4XBTA 5AIIA 1QJGA 2YX9A 4HM2B 1GSPA 1I2FA 4JF8A 3ER7A 3X3XA 2GU3A 4RZMA 4WYKB 3AHSA 9RNTA 3LTAA 2HMJB 1N5HA 1A2PA 5D83A 3L0RA 2F86B 1CH0A 3D79A 4HVNA 3PYJA 1W00A 4GHOA 3EBTA 1MWSA 3F40A 1RGEA 4KZ1A 5AYSC 3B7CA 4HKVB 2CHCA 1WNHA 5G1LA 3V99A 1BSDA 1NDOB 2H0HA 3CC23 3FCSB 1AV4A 4QWTA 2R41A 4XBXA 4N6TA 4N6V0 1VQN3 3JUPA 3GRDA 3O8YA 2AADA 1TTOA 3CME3 1BUJA 2RNTA 4CJNA 1TIJA 3DGYA 1STFI 3K7CA 1B3SA 3NM2A 1LXEA 2OCTA 1VQM3 4EXRA 4N6MA 1ASKA 2JDIH 1CYVA 1RLSA 1W2ZA 3NV0B 4WWUC 2P05A 2KCDA 2OTL3 2J8XB 2CFKA 2RBIA 5M1AA 3A5EA 3NBBA 2RCDA 3PCSA 3S29A 1KWIA 2XGNA 3E99A 5G1KA 3ZG5A 3CCL3 1KSIA 1JBTA 3V98A 3LYGA 1RGFA 1DMMA 3EHCA 1NO3A 1TRQA 1GS3A 1T2IA 1MWUA 3JUMA 5I97A 3FF0A 1VQL3 3KIIA 2XH9A 2CWVA 5LC6A 2KRTA 2C4BA 4BL2A 1M904 2QIYA 5AI1A 2F56A 3G713 3IJEB 2W9QA 1RRLA 1OHPA 5GSPA 1FUTA 2STDA 4EYCA 1YGWA 2CW9A 3Q90A 3LTCA 4CDLA 5ELUA 1B2XA 1TFOA 4U13A 1DVDA 1UCJA 4HM1B 4I5QA 1RGCA 3BLZA 4EV2A 2IMJA 5IG5A 1BU4A 2KF4A 4NPBA 1BRHA 1LNHA 1O7GB 2KF3A 4DKIA 2Y74A 3KCHA 3MHEA 8CHOA 1RGGA 4BIRA 2W56A 2OOVA 3G16A 3WODG 2XSHB 4MEIA 2UX0A 1BRSA 5CF2A 1RDSA 1V57A 2F5MA 2W0QA 4LMIA 1AY7A 1GD4A 2BMRB 4H61A 1NB3I 4N6LA 2AAEA 3RNTA 3ZFZA 1LNIA 1Q40A 5M18A 3LZAA 1SQWA 1YGEA 1PYLA 6RNTA 1TRPA 1GOVA 3CC73 1KD14 1J2BA 1RGAA 3DH2A 3EC9A 5BXQA 1VQ63 1D6YA 1Q9EA 1B20A 1K9M4 1BRKA 2P0XA 1JNQA 1HKXA 1O7WB 2OWPA 3OWYA 3CPW2 2BMOB 3MPHA 1EQKA 2BO9B 1Q824 4Q53A 1IT7A 5EEOA 3UL6A 1B2SA 3NXJA 3B4OA 1I2GA 4X2OA 3N9HA 1LVNA 1STDA 5KP1A 3GZRA 1FGRA 5CLKA 5D81A 1N9JA 4O02B 2F99A 5FW5A 1JZDA 1UCKA 3OW22 1JB5A 4HOHA 4R4KA 1FGQA 1GY7A 1N9EA 1GYBA 1W5ZA 3WR2A 3UB1A 2Q07A 4HAAA 3S27A 5LC7A 4KVHA 4LZIA 2CG1A 3U97A 4XM4A 1YJN3 1N5PA 2CX0A 1RHLA 5IG0A 1RRHA 2GBXB 4PEJA 3AGNA 1BUQA 5CF1A 2ZDJA 2Z77A 3BNCA 3LOYA 1DETA 3MG2A 3QK9A 2E2TA 3BNDA 5CK6A 1LRAA 1BRJA 1OF5A 1G0TA 3BNBA 3DY5A 1WMPA 2BU4A 1C7HA 1BNFA 1LOVA 2P38A 3MG1A 1Q7Y4 4L7KA 2E2UA 1YVBI 4BTYA 1JBRA 2BIRA 1BSCA 2CG0A 3BU4A 5IW9A 3NBRA 3KFQC 4WYKA 3G8ZA 1ZX2A 1IV7A 2CFDA 1FA3A 1D6UA 1K8A4 1BVIA 1OUNA 4TX4A 1EG9B 4G1MB 1B2UA 3MYTA 4FMCA 2WOHA 4BTWA 3SX1A 4FMAA 1JRQA 1RGHA 3PCRA 1WMOA 4O8SA 3X42A 4JRFA 1UCLA 2PNCA 4HJLB 1DE3A 5TGNA 1A2KA 1GMQA 1A90A 5BVBA 1EEJA 1I8VA 3B4PA 4FCJA 3CCS3 1ULIB 2C10A 1DYUA 1G96A 2FXTA 1GY6A 1RJOA 2P0MA 4MMYB 1NU3A 3HOHA 4HBRA 3X41A 5IG3A 1VQ53 2OQEC 3CMA3 3HIIA 1O7HB 2UGIA 5D82A 1V74A 3G0KA 1L5GB 3CCV3 1IQ8A 2ML5A 2E2VA 2KAAA 5A0OB 2OTJ3 1G02A 1W6CA 2B1XB 1BRNL 1HYFA 3D5IA 3DMCA 3NM7A 1O7NB 1PFPA 2KF5A 6GSPA 1UCIA 1OACA 2F5WA 3LT8A 3F8XA 3GZXB 2FGTA 3DM8A 3DZLA 2FNQA 3HX8A 2XR8B 4ORLA 1CQSA 3SYUA 2K3DA 4CPKA 4XDVA 1MNLA 2CX1A 3DGOA 1ROVA 1MOLA 2V1LA 4FCZA 3SXXA 3ZG0A 5IENA 3RDEA 4K1UA 1W4NA 2BT3A 2BHMA 2H0GA 4NHFA 4J5GA 4NREA 1SARA 5JPUA 1Q864 3LMLA 3KN4A 1Y4KA 3F7XA 4O2HA 1PU4A 1AVLA 3CU3A 4HM6B 1A67A 3IMAB 4K1VA 4BTXA 1OCVA 2CKFB 1Q42A 1ZS7A 4GB5A 3SOAA 3HI7A 1B2ZA 1RGKA 1HZ1A 1UUVB 3KE7A 1QMAA 2GEYA 3HZPA 3X3ZA 2W04A 3FSDA 4WP5A 2HMKB 2L1SA 4RNTA 2GBWB 1IV9A 1T3BA 1JJ22 1M1XB 1OH0A 4N6NB 2SBLA 3NUVA 3I0YA 4EBGA 1S5AA 2O9UX 4WHAA 4AKYA 1CYUA 4HM8B 3VF1A 1UUGB 3WMDA 2CWUA 2A15A 3T8NA 4STDA 1E3RA 2ML6A 3H51A 1O7PB 1SJWA 4FCMA 4LSOA 5RNTA 1EA2A 2Y73A 1W01A 3DGNA 1SPUA 1VQ73 1SIHA 1FGOA 3ECFA 2IYJA 3G6E3 3EQQB 4RBNA 3EE1A 4R9LA 1OPYA 5AIFA 5BIRA 3N54B 2XEPA 2F98A 3OXAA 4K61A 3WOEB 1RSNA 7GSPA 3D5GA 3AHWA 4LYLB 5KP4A 3F9SA 4BL3A 3CCQ3 1B2MA 2GSPA 1X1XA 1BSAA 3EX9A 3I563 4WFOA 3RGRA 3GSPA 3KZTA 1VQ93 2Z6BA 3Q3FA 4CCVA 1YI23 1E97A 2M7OA 4IIAA 4I4KA 1I3IA 4AEQA 3STDA 1JV2B 4ILFA 1D6ZA 1WMNA 5FGOA 1GOYA 2INXA 2GXFA 2CC3A 4HZBB 3RGAA 4EC6A 2K0MA 3AMOB 2ZA4A 1AR0A 4MJDA 1US1A 3LT9A 1NJI4 2F4YA 1KQS2 3FG4A 1TJDA 3GZBA 3EF8A 4L8OA 7RNTA 1YJW3 1YHQ3 2QGUA 6STDA 1RNBA 1W2B2 1DMNA 2KXGA 2RFRA 2BNGA 3CC43 1HU9A 3KKGA 1NB5I 2OQEA 1IQYA 2BMQB 2IA7A 4H3UA 1MGWA 1FYSA 2QEX3 2OOVC 2CFLA 4HYZA 1X1YA 5JPPA 1BNGA 3PS8A 5AEUB 1A2VA 1IDPA 3SLUA 1K41A 4J5KA 3CCR3 1RN7A 3KSPA 4XB5A 1DVCA 2HMNB 4MMZB 1W02A 3X40A 3S5CA 3BIRA 1R4CA 3B8LA 3NQYA 3URPA 3FF2A 1W7CA 1JKGB 4MMXB 3H3HA 1BSEA 3FZWA 4O3VA 1YVSA 5IEOA 1BIRA 3WHOA 2RGQA 3EB8A 5EVHA 2WGOA 4RNYA 2Z76A 2P09A 5AYRB 1T5YA 4R9KA 3AGOA 3K9MC 4HM4B 1AVKA 1YIJ3 2XRXB 3JUNA 5ELJA 2W6JH 5M19A 1RKYA 2GU1A 3MWZA 2O3OA 1VQO3 3CCM3 1YIT3 4HM5B 1UGIA 2D42A 1JN5B 2XFTA 3CCE3 1GOUA 1TU5A 3NV0A 1BNJA 4N3VA 1LQGC 1EKMA 1JB2A 2Z7AA 3EBYA 1GMRA 3FG1A 1OHSA 1F8NA 3M8CA 1RGLA 1AQZA 1TP6A 1RN4A 1M9GA 2K54A 1FUSA 3JVCA 1OGZA 4GSPA 1T2HA 1Q814
chains in the Genus database with same CATH topology
4FMBA 1N8R4 2XGLA 3D9RA 3PZWA 1QALA 1IU7A 7STDA 1W6YA 1K734 1UW1A 3GZYB 3Q2PA 2CH9A 1IVXA 1GD3A 3Q1CA 2WGQA 3N8BA 3FLJA 3HIGA 3QRDA 3K0ZA 1NWWA 3GWRA 4GL6A 4HM3B 3HK4A 2W2CA 4FR9A 5DREA 3ROBA 1VQP3 1QVG2 3NHXA 2XFSA 3VSYA 3I553 3MKIA 3LTDA 3KSED 3D3LA 2LYXA 5EQLA 1W6GA 1FGTA 1WQLB 2CFWA 3LH4A 3DGLA 3CCU3 3NBJA 3OV4A 3LTBA 2IUKA 3CCJ3 3F7SA 3UNLA 3F8HA 3WA3A 1ULJB 1UUWB 3SOYA 2GEXA 2I9WA 2PZVA 3EN1B 3S67A 2MC8A 3U1WA 3NX0A 4KFDA 1FUWA 2ZL8A 1Z1SA 1VQ83 4ZM8A 1TFKA 1M1K4 1GY5A 2HMMB 3OWUA 2D1WA 1QAKA 2R4IA 2WO0A 2QA43 2YFLB 1IVWA 3MSOA 4LEHA 3OX9A 5CXOA 3OWSA 4J9AA 1JB4A 3T8UA 3FG3A 3TDGA 2HMOB 2XF3A 2RSXA 3VGNA 5IG4A 1VQ43 1IK3A 2WOFA 3FGYA 3WA2X 3IPTA 2CIUA 4OVMA 2B24B 3UL5A 3ALAA 3X3YA 1N8QA 4N6UA 4IPBA 3DUKA 3JUOA 2HMLB 3K5TA 4IT7A 2IUJA 3FH1A 1FGMA 1ZO2A 1QVF2 2W56B 5HGRA 4AKZA 3CNMA 3AMOA 1QAFA 3EJVA 4N6OB 1VZZA 1O7MB 3BNEA 1Q40B 4OK0A 1UI8A 2JQ5A 3F14A 3SEDA 2CWTA 1E3VA 3GAXA 1LOXA 2YFIB 3NQZA 3CNXA 1IQXA 5G2GA 5STDA 1U5OA 1K28A 4KFFA 2LQVA 1TUHA 2W03A 3SVAA 1ROAA 5IEPA 1S723 1IVVA 1OGXA 5DRVA 5IF6A 2XSOB 4FMDA 3V92A 3UJMA 1CEWI 1WTHA 3K63A 5AIGA 5AEWB 1UI7A 2YFJB 4HZ9B 5KP3A 1IT8A 4EV5A 1JKGA 1VQK3 4HM0B 3S28A 3J7Yd 4R80A 4OUQA 1KC84 2MF7A 4XBYA 5IERA 1SIIA 1U8CB 4HM7B 1YJ93 3WDGB 4RNZA 3CPOA 3PGBA 2W9PA 1DMQA 4XDWA 3A76A 5JBSA 2L4VA 2C11A 5AIHA 4K90B 3T0UA 2CK3H 4J8TA 4R1KA 3DXOA 4KFEA 2CFGA 3EN8A 1OHOA 1IVUA 3CD63 4LGQA 3MG3A 1ISKA 3FKAA 1JN5A 3WOFB 1OF5B 3G4S3 3DGMA 3CXC2 4L8PA 3PXMA 3BB9A 3LXUX 3JUQA 4X2HA 5AIIA 4XBTA 1QJGA 2YX9A 4HM2B 4JF8A 3ER7A 3X3XA 2GU3A 4RZMA 4WYKB 3LTAA 2HMJB 1N5HA 5D83A 3L0RA 2F86B 4HVNA 3PYJA 1W00A 4KZ1A 3EBTA 3F40A 5AYSC 3B7CA 4HKVB 2CHCA 1WNHA 3V99A 3CC23 1NDOB 3FCSB 1AV4A 4QWTA 4XBXA 4N6TA 4N6V0 1VQN3 3JUPA 3GRDA 3O8YA 3CME3 1TIJA 1STFI 3K7CA 3NM2A 1LXEA 2OCTA 1VQM3 4EXRA 4N6MA 1ASKA 2JDIH 1CYVA 1W2ZA 3NV0B 4WWUC 2P05A 2KCDA 2OTL3 2CFKA 3NBBA 2RCDA 3PCSA 3S29A 1KWIA 2XGNA 3E99A 3CCL3 1KSIA 3V98A 3LYGA 1DMMA 3EHCA 1NO3A 1GS3A 3JUMA 1VQL3 5I97A 3FF0A 3KIIA 2XH9A 2CWVA 5LC6A 2KRTA 1M904 2QIYA 5AI1A 3G713 3IJEB 2W9QA 1RRLA 1OHPA 2STDA 4EYCA 2CW9A 3Q90A 3LTCA 4CDLA 5ELUA 4U13A 1TFOA 1DVDA 4HM1B 4EV2A 3BLZA 2IMJA 5IG5A 8CHOA 1LNHA 1O7GB 2Y74A 3MHEA 2W56A 2OOVA 3G16A 3WODG 2XSHB 4MEIA 2UX0A 5CF2A 2W0QA 4LMIA 4N6LA 1GD4A 2BMRB 4H61A 1NB3I 1Q40A 3LZAA 1SQWA 1YGEA 3CC73 1KD14 1J2BA 3EC9A 5BXQA 1VQ63 1D6YA 1K9M4 2P0XA 1JNQA 1HKXA 1O7WB 2OWPA 3OWYA 3CPW2 2BMOB 3MPHA 1EQKA 2BO9B 1Q824 4Q53A 1IT7A 5EEOA 3UL6A 3NXJA 3B4OA 4X2OA 3N9HA 1LVNA 1STDA 5KP1A 3GZRA 1FGRA 5CLKA 5D81A 1N9JA 4O02B 2F99A 5FW5A 3OW22 1JB5A 4R4KA 1FGQA 1GY7A 1N9EA 1GYBA 1W5ZA 3UB1A 2Q07A 3S27A 5LC7A 4KVHA 4LZIA 2CG1A 3U97A 4XM4A 1YJN3 1N5PA 5IG0A 1RRHA 2GBXB 4PEJA 1BUQA 5CF1A 2ZDJA 2Z77A 3BNCA 3LOYA 3MG2A 3QK9A 2E2TA 3BNDA 5CK6A 1OF5A 3BNBA 3DY5A 1WMPA 1C7HA 2P38A 3MG1A 1Q7Y4 4L7KA 2E2UA 1YVBI 4BTYA 5IW9A 2CG0A 3NBRA 3KFQC 4WYKA 3G8ZA 1ZX2A 1IV7A 2CFDA 1FA3A 1D6UA 1K8A4 1OUNA 4TX4A 1EG9B 4G1MB 3MYTA 4FMCA 2WOHA 4BTWA 3SX1A 4FMAA 1JRQA 3PCRA 4O8SA 1WMOA 3X42A 4JRFA 2PNCA 4HJLB 5TGNA 1A2KA 1A90A 5BVBA 3B4PA 4FCJA 3CCS3 1ULIB 2C10A 1DYUA 1G96A 2FXTA 1GY6A 1RJOA 2P0MA 4MMYB 1NU3A 4HBRA 3X41A 5IG3A 1VQ53 2OQEC 3CMA3 3HIIA 1O7HB 5D82A 3CCV3 1V74A 3G0KA 1L5GB 1IQ8A 2ML5A 2E2VA 5A0OB 2OTJ3 2B1XB 1W6CA 3NM7A 3DMCA 1O7NB 1PFPA 1OACA 3LT8A 3F8XA 3GZXB 2FGTA 3DM8A 3DZLA 2FNQA 3HX8A 2XR8B 4ORLA 1CQSA 4XDVA 1MNLA 3DGOA 1ROVA 1MOLA 2V1LA 4FCZA 3SXXA 5IENA 3RDEA 4K1UA 1W4NA 2BT3A 2BHMA 4NHFA 4NREA 1Q864 5JPUA 3LMLA 3KN4A 1Y4KA 3F7XA 4O2HA 1PU4A 1AVLA 3CU3A 4HM6B 1A67A 3IMAB 4K1VA 4BTXA 1OCVA 2CKFB 1Q42A 4GB5A 3SOAA 3HI7A 1UUVB 3KE7A 1QMAA 2GEYA 3HZPA 3X3ZA 2W04A 3FSDA 4WP5A 2HMKB 2GBWB 1IV9A 1JJ22 1M1XB 1OH0A 4N6NB 2SBLA 3NUVA 3I0YA 4EBGA 1S5AA 2O9UX 4WHAA 4AKYA 1CYUA 4HM8B 3VF1A 3WMDA 2CWUA 2A15A 3T8NA 4STDA 1E3RA 2ML6A 3H51A 1O7PB 1SJWA 4FCMA 4LSOA 1EA2A 2Y73A 1W01A 3DGNA 1SPUA 1VQ73 1SIHA 1FGOA 3ECFA 3G6E3 3EQQB 4RBNA 3EE1A 4R9LA 1OPYA 5AIFA 3N54B 2XEPA 2F98A 3OXAA 4K61A 3WOEB 3CCQ3 5KP4A 3F9SA 3EX9A 3I563 4WFOA 3RGRA 3KZTA 1VQ93 2Z6BA 4CCVA 1YI23 1E97A 2M7OA 4IIAA 4I4KA 4AEQA 3STDA 1JV2B 1D6ZA 1WMNA 5FGOA 2GXFA 2CC3A 4HZBB 3RGAA 4EC6A 2K0MA 3AMOB 1AR0A 4MJDA 1US1A 3LT9A 1NJI4 1KQS2 3FG4A 3GZBA 3EF8A 4L8OA 1YJW3 1YHQ3 2QGUA 6STDA 1W2B2 1DMNA 2KXGA 2RFRA 2BNGA 3CC43 1HU9A 3KKGA 1NB5I 2OQEA 1IQYA 2BMQB 2IA7A 4H3UA 2QEX3 2OOVC 2CFLA 4HYZA 5JPPA 3PS8A 5AEUB 1A2VA 1IDPA 3SLUA 1K41A 3CCR3 1RN7A 3KSPA 4XB5A 1DVCA 2HMNB 4MMZB 1W02A 3X40A 3S5CA 1R4CA 3B8LA 3NQYA 3FF2A 1W7CA 1JKGB 4MMXB 3H3HA 3FZWA 5IEOA 2RGQA 3EB8A 5EVHA 2WGOA 4RNYA 2Z76A 2P09A 5AYRB 1T5YA 4R9KA 3K9MC 4HM4B 1YIJ3 1AVKA 2XRXB 3JUNA 5ELJA 2W6JH 1RKYA 2GU1A 3MWZA 2O3OA 1VQO3 3CCM3 1YIT3 4HM5B 2D42A 1JN5B 2XFTA 3CCE3 1TU5A 3NV0A 4N3VA 1EKMA 1JB2A 2Z7AA 3EBYA 3FG1A 1OHSA 1F8NA 3M8CA 1TP6A 1M9GA 2K54A 3JVCA 1OGZA 4O3VA 2INXA 1Q814
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 3;  1JJ2 2;  1N8R 4;  1VQL 3;  1VQ9 3;  3CCS 3;  1QVF 2;  1YI2 3;  1YIJ 3;  2QEX 3;  3CD6 3;  3CC2 3;  1K73 4;  1Q86 4;  1S72 3;  1Q7Y 4;  3G4S 3;  1VQ8 3;  3OW2 2;  1M90 4;  1VQ5 3;  1VQN 3;  3CXC 2;  3CMA 3;  3G71 3;  1M1K 4;  3CCR 3;  3CCM 3;  3CCV 3;  3CC7 3;  1VQO 3;  3CME 3;  1YIT 3;  1VQK 3;  1KD1 4;  3CCE 3;  2QA4 3;  1VQP 3;  1VQ6 3;  2OTJ 3;  1VQ7 3;  1NJI 4;  1QVG 2;  1VQM 3;  1KC8 4;  3I55 3;  1K8A 4;  1K9M 4;  1KQS 2;  1VQ4 3;  3CPW 2;  3G6E 3;  1YJ9 3;  2OTL 3;  1YJN 3;  1YJW 3;  1YHQ 3;  3CCU 3;  3CCL 3;  3CCQ 3;  1W2B 2;  1Q82 4;  3CCJ 3;  3CC4 3;  1Q81 4; 
#chains in the Genus database with same CATH topology
 4FMB A;  1N8R 4;  2XGL A;  3D9R A;  3PZW A;  1GMP A;  1QAL A;  1IU7 A;  7STD A;  1W6Y A;  1K73 4;  1UW1 A;  3GZY B;  2UUG C;  1BRI A;  3Q2P A;  2CH9 A;  1IVX A;  1GD3 A;  3Q1C A;  2WGQ A;  3N8B A;  3FLJ A;  3HIG A;  3QRD A;  3K0Z A;  1NWW A;  3GWR A;  4GL6 A;  4HM3 B;  3HK4 A;  2W2C A;  4FR9 A;  5DRE A;  3ROB A;  1VQP 3;  1QVG 2;  3NHX A;  2XFS A;  3VSY A;  1B21 A;  3I55 3;  3D4A A;  3MKI A;  3LTD A;  3KSE D;  3D3L A;  2LYX A;  5EQL A;  1W6G A;  1BAN A;  1FGT A;  1RTU A;  1WQL B;  2CFW A;  3LH4 A;  3DGL A;  3CCU 3;  3NBJ A;  3OV4 A;  3LTB A;  2IUK A;  1I2E A;  3CCJ 3;  3F7S A;  3UNL A;  3F8H A;  2ZHX B;  1ULJ B;  3WA3 A;  1UUW B;  1FW7 A;  3SOY A;  2GEX A;  1MWR A;  2I9W A;  1MWT A;  2PZV A;  3EN1 B;  3S67 A;  1VQQ A;  1R4Y A;  2MC8 A;  3NX0 A;  3U1W A;  1BNR A;  4KFD A;  1FUW A;  1X1W A;  2ZL8 A;  1Z1S A;  1V58 A;  1VQ8 3;  4ZM8 A;  1TFK A;  1I70 A;  2SAR A;  1M1K 4;  1GY5 A;  2HMM B;  3OWU A;  2D1W A;  1QAK A;  1EUI C;  1LOW A;  1LQM B;  2R4I A;  2WO0 A;  2YFL B;  1IVW A;  3MSO A;  5HOH A;  4LEH A;  2QA4 3;  1BNE A;  3OX9 A;  5CXO A;  3OWS A;  1BAO A;  1I0V A;  4J9A A;  1JB4 A;  3T8U A;  3FG3 A;  1RCK A;  2HMO B;  2XF3 A;  2RSX A;  3TDG A;  3VGN A;  5IG4 A;  1VQ4 3;  1BRG A;  2IY2 A;  1IK3 A;  2WOF A;  3FGY A;  3WA2 X;  3IPT A;  2CIU A;  4OVM A;  2B24 B;  3UL5 A;  3ALA A;  3X3Y A;  1N8Q A;  4N6U A;  1RNT A;  3DUK A;  1UGH I;  2HML B;  3JUO A;  3K5T A;  4IPB A;  1FZU A;  4IT7 A;  2IUJ A;  3FH1 A;  1FGM A;  1ZO2 A;  1QVF 2;  2W56 B;  5HGR A;  4AKZ A;  3CNM A;  3AMO A;  1QAF A;  3EJV A;  4N6O B;  1RCL A;  1VZZ A;  1MGR A;  1O7M B;  1IYY A;  5BU4 A;  3BNE A;  1Q40 B;  4OK0 A;  1UI8 A;  2JQ5 A;  3F14 A;  3SED A;  2CWT A;  1Q7H A;  1E3V A;  3GAX A;  1C54 A;  1LOX A;  2YFI B;  3NQZ A;  3CNX A;  1JBS A;  1IQX A;  5G2G A;  5STD A;  1U5O A;  1K28 A;  4KFF A;  8RNT A;  1B27 A;  4BU4 A;  2LQV A;  1RN1 A;  1TUH A;  2W03 A;  3SVA A;  1ROA A;  1YNV X;  5IEP A;  1S72 3;  1IVV A;  1OGX A;  5DRV A;  5IF6 A;  2XSO B;  4FMD A;  4KT3 B;  1LOY A;  3V92 A;  3UJM A;  1CEW I;  1WTH A;  3K63 A;  5AIG A;  1BOX A;  4EW5 A;  5AEW B;  1UI7 A;  1PY3 A;  2YFJ B;  1UDI I;  1IT8 A;  4HZ9 B;  1JKG A;  5KP3 A;  4EV5 A;  1VQK 3;  4HM0 B;  3S28 A;  3J7Y d;  4R80 A;  1NNV A;  4OUQ A;  1KC8 4;  2MF7 A;  4XBY A;  5IER A;  1SII A;  1U8C B;  4HM7 B;  1YJ9 3;  3WDG B;  1I0X A;  1X1U A;  4RNZ A;  3CPO A;  3PGB A;  2HOH A;  2W9P A;  1DMQ A;  4XDW A;  3A76 A;  5JBS A;  2L4V A;  2C11 A;  1BSB A;  5AIH A;  4K90 B;  3T0U A;  1I3F A;  1ZGX A;  2CK3 H;  4J8T A;  4R1K A;  3DXO A;  4KFE A;  2CFG A;  1JZO A;  3EN8 A;  1OHO A;  1IVU A;  1BNI A;  3CD6 3;  4LGQ A;  2KF6 A;  3MG3 A;  1ISK A;  2H0I A;  3FKA A;  1JN5 A;  3WOF B;  1OF5 B;  3G4S 3;  3DGM A;  3CXC 2;  4L8P A;  3PXM A;  1BGS A;  1RMS A;  3BB9 A;  3JUQ A;  1BNS A;  3LXU X;  4X2H A;  4XBT A;  5AII A;  1QJG A;  2YX9 A;  4HM2 B;  1GSP A;  1I2F A;  4JF8 A;  3ER7 A;  3X3X A;  2GU3 A;  4RZM A;  4WYK B;  3AHS A;  9RNT A;  3LTA A;  2HMJ B;  1N5H A;  1A2P A;  5D83 A;  3L0R A;  2F86 B;  1CH0 A;  3D79 A;  4HVN A;  3PYJ A;  1W00 A;  4GHO A;  3EBT A;  1MWS A;  3F40 A;  1RGE A;  4KZ1 A;  5AYS C;  3B7C A;  4HKV B;  2CHC A;  1WNH A;  5G1L A;  3V99 A;  1BSD A;  1NDO B;  2H0H A;  3CC2 3;  3FCS B;  1AV4 A;  4QWT A;  2R41 A;  4XBX A;  4N6T A;  4N6V 0;  1VQN 3;  3JUP A;  3GRD A;  3O8Y A;  2AAD A;  1TTO A;  3CME 3;  1BUJ A;  2RNT A;  4CJN A;  1TIJ A;  3DGY A;  1STF I;  3K7C A;  1B3S A;  3NM2 A;  1LXE A;  2OCT A;  1VQM 3;  4EXR A;  4N6M A;  1ASK A;  2JDI H;  1CYV A;  1RLS A;  1W2Z A;  3NV0 B;  4WWU C;  2P05 A;  2KCD A;  2OTL 3;  2J8X B;  2CFK A;  2RBI A;  5M1A A;  3A5E A;  3NBB A;  2RCD A;  3PCS A;  3S29 A;  1KWI A;  2XGN A;  3E99 A;  5G1K A;  3ZG5 A;  3CCL 3;  1KSI A;  1JBT A;  3V98 A;  3LYG A;  1RGF A;  1DMM A;  3EHC A;  1NO3 A;  1TRQ A;  1GS3 A;  1T2I A;  1MWU A;  3JUM A;  5I97 A;  3FF0 A;  1VQL 3;  3KII A;  2XH9 A;  2CWV A;  5LC6 A;  2KRT A;  2C4B A;  4BL2 A;  1M90 4;  2QIY A;  5AI1 A;  2F56 A;  3G71 3;  3IJE B;  2W9Q A;  1RRL A;  1OHP A;  5GSP A;  1FUT A;  2STD A;  4EYC A;  1YGW A;  2CW9 A;  3Q90 A;  3LTC A;  4CDL A;  5ELU A;  1B2X A;  1TFO A;  4U13 A;  1DVD A;  1UCJ A;  4HM1 B;  4I5Q A;  1RGC A;  3BLZ A;  4EV2 A;  2IMJ A;  5IG5 A;  1BU4 A;  2KF4 A;  4NPB A;  1BRH A;  1LNH A;  1O7G B;  2KF3 A;  4DKI A;  2Y74 A;  3KCH A;  3MHE A;  8CHO A;  1RGG A;  4BIR A;  2W56 A;  2OOV A;  3G16 A;  3WOD G;  2XSH B;  4MEI A;  2UX0 A;  1BRS A;  5CF2 A;  1RDS A;  1V57 A;  2F5M A;  2W0Q A;  4LMI A;  1AY7 A;  1GD4 A;  2BMR B;  4H61 A;  1NB3 I;  4N6L A;  2AAE A;  3RNT A;  3ZFZ A;  1LNI A;  1Q40 A;  5M18 A;  3LZA A;  1SQW A;  1YGE A;  1PYL A;  6RNT A;  1TRP A;  1GOV A;  3CC7 3;  1KD1 4;  1J2B A;  1RGA A;  3DH2 A;  3EC9 A;  5BXQ A;  1VQ6 3;  1D6Y A;  1Q9E A;  1B20 A;  1K9M 4;  1BRK A;  2P0X A;  1JNQ A;  1HKX A;  1O7W B;  2OWP A;  3OWY A;  3CPW 2;  2BMO B;  3MPH A;  1EQK A;  2BO9 B;  1Q82 4;  4Q53 A;  1IT7 A;  5EEO A;  3UL6 A;  1B2S A;  3NXJ A;  3B4O A;  1I2G A;  4X2O A;  3N9H A;  1LVN A;  1STD A;  5KP1 A;  3GZR A;  1FGR A;  5CLK A;  5D81 A;  1N9J A;  4O02 B;  2F99 A;  5FW5 A;  1JZD A;  1UCK A;  3OW2 2;  1JB5 A;  4HOH A;  4R4K A;  1FGQ A;  1GY7 A;  1N9E A;  1GYB A;  1W5Z A;  3WR2 A;  3UB1 A;  2Q07 A;  4HAA A;  3S27 A;  5LC7 A;  4KVH A;  4LZI A;  2CG1 A;  3U97 A;  4XM4 A;  1YJN 3;  1N5P A;  2CX0 A;  1RHL A;  5IG0 A;  1RRH A;  2GBX B;  4PEJ A;  3AGN A;  1BUQ A;  5CF1 A;  2ZDJ A;  2Z77 A;  3BNC A;  3LOY A;  1DET A;  3MG2 A;  3QK9 A;  2E2T A;  3BND A;  5CK6 A;  1LRA A;  1BRJ A;  1OF5 A;  1G0T A;  3BNB A;  3DY5 A;  1WMP A;  2BU4 A;  1C7H A;  1BNF A;  1LOV A;  2P38 A;  3MG1 A;  1Q7Y 4;  4L7K A;  2E2U A;  1YVB I;  4BTY A;  1JBR A;  2BIR A;  1BSC A;  2CG0 A;  3BU4 A;  5IW9 A;  3NBR A;  3KFQ C;  4WYK A;  3G8Z A;  1ZX2 A;  1IV7 A;  2CFD A;  1FA3 A;  1D6U A;  1K8A 4;  1BVI A;  1OUN A;  4TX4 A;  1EG9 B;  4G1M B;  1B2U A;  3MYT A;  4FMC A;  2WOH A;  4BTW A;  3SX1 A;  4FMA A;  1JRQ A;  1RGH A;  3PCR A;  1WMO A;  4O8S A;  3X42 A;  4JRF A;  1UCL A;  2PNC A;  4HJL B;  1DE3 A;  5TGN A;  1A2K A;  1GMQ A;  1A90 A;  5BVB A;  1EEJ A;  1I8V A;  3B4P A;  4FCJ A;  3CCS 3;  1ULI B;  2C10 A;  1DYU A;  1G96 A;  2FXT A;  1GY6 A;  1RJO A;  2P0M A;  4MMY B;  1NU3 A;  3HOH A;  4HBR A;  3X41 A;  5IG3 A;  1VQ5 3;  2OQE C;  3CMA 3;  3HII A;  1O7H B;  2UGI A;  5D82 A;  1V74 A;  3G0K A;  1L5G B;  3CCV 3;  1IQ8 A;  2ML5 A;  2E2V A;  2KAA A;  5A0O B;  2OTJ 3;  1G02 A;  1W6C A;  2B1X B;  1BRN L;  1HYF A;  3D5I A;  3DMC A;  3NM7 A;  1O7N B;  1PFP A;  2KF5 A;  6GSP A;  1UCI A;  1OAC A;  2F5W A;  3LT8 A;  3F8X A;  3GZX B;  2FGT A;  3DM8 A;  3DZL A;  2FNQ A;  3HX8 A;  2XR8 B;  4ORL A;  1CQS A;  3SYU A;  2K3D A;  4CPK A;  4XDV A;  1MNL A;  2CX1 A;  3DGO A;  1ROV A;  1MOL A;  2V1L A;  4FCZ A;  3SXX A;  3ZG0 A;  5IEN A;  3RDE A;  4K1U A;  1W4N A;  2BT3 A;  2BHM A;  2H0G A;  4NHF A;  4J5G A;  4NRE A;  1SAR A;  5JPU A;  1Q86 4;  3LML A;  3KN4 A;  1Y4K A;  3F7X A;  4O2H A;  1PU4 A;  1AVL A;  3CU3 A;  4HM6 B;  1A67 A;  3IMA B;  4K1V A;  4BTX A;  1OCV A;  2CKF B;  1Q42 A;  1ZS7 A;  4GB5 A;  3SOA A;  3HI7 A;  1B2Z A;  1RGK A;  1HZ1 A;  1UUV B;  3KE7 A;  1QMA A;  2GEY A;  3HZP A;  3X3Z A;  2W04 A;  3FSD A;  4WP5 A;  2HMK B;  2L1S A;  4RNT A;  2GBW B;  1IV9 A;  1T3B A;  1JJ2 2;  1M1X B;  1OH0 A;  4N6N B;  2SBL A;  3NUV A;  3I0Y A;  4EBG A;  1S5A A;  2O9U X;  4WHA A;  4AKY A;  1CYU A;  4HM8 B;  3VF1 A;  1UUG B;  3WMD A;  2CWU A;  2A15 A;  3T8N A;  4STD A;  1E3R A;  2ML6 A;  3H51 A;  1O7P B;  1SJW A;  4FCM A;  4LSO A;  5RNT A;  1EA2 A;  2Y73 A;  1W01 A;  3DGN A;  1SPU A;  1VQ7 3;  1SIH A;  1FGO A;  3ECF A;  2IYJ A;  3G6E 3;  3EQQ B;  4RBN A;  3EE1 A;  4R9L A;  1OPY A;  5AIF A;  5BIR A;  3N54 B;  2XEP A;  2F98 A;  3OXA A;  4K61 A;  3WOE B;  1RSN A;  7GSP A;  3D5G A;  3AHW A;  4LYL B;  5KP4 A;  3F9S A;  4BL3 A;  3CCQ 3;  1B2M A;  2GSP A;  1X1X A;  1BSA A;  3EX9 A;  3I56 3;  4WFO A;  3RGR A;  3GSP A;  3KZT A;  1VQ9 3;  2Z6B A;  3Q3F A;  4CCV A;  1YI2 3;  1E97 A;  2M7O A;  4IIA A;  4I4K A;  1I3I A;  4AEQ A;  3STD A;  1JV2 B;  4ILF A;  1D6Z A;  1WMN A;  5FGO A;  1GOY A;  2INX A;  2GXF A;  2CC3 A;  4HZB B;  3RGA A;  4EC6 A;  2K0M A;  3AMO B;  2ZA4 A;  1AR0 A;  4MJD A;  1US1 A;  3LT9 A;  1NJI 4;  2F4Y A;  1KQS 2;  3FG4 A;  1TJD A;  3GZB A;  3EF8 A;  4L8O A;  7RNT A;  1YJW 3;  1YHQ 3;  2QGU A;  6STD A;  1RNB A;  1W2B 2;  1DMN A;  2KXG A;  2RFR A;  2BNG A;  3CC4 3;  1HU9 A;  3KKG A;  1NB5 I;  2OQE A;  1IQY A;  2BMQ B;  2IA7 A;  4H3U A;  1MGW A;  1FYS A;  2QEX 3;  2OOV C;  2CFL A;  4HYZ A;  1X1Y A;  5JPP A;  1BNG A;  3PS8 A;  5AEU B;  1A2V A;  1IDP A;  3SLU A;  1K41 A;  4J5K A;  3CCR 3;  1RN7 A;  3KSP A;  4XB5 A;  1DVC A;  2HMN B;  4MMZ B;  1W02 A;  3X40 A;  3S5C A;  3BIR A;  1R4C A;  3B8L A;  3NQY A;  3URP A;  3FF2 A;  1W7C A;  1JKG B;  4MMX B;  3H3H A;  1BSE A;  3FZW A;  4O3V A;  1YVS A;  5IEO A;  1BIR A;  3WHO A;  2RGQ A;  3EB8 A;  5EVH A;  2WGO A;  4RNY A;  2Z76 A;  2P09 A;  5AYR B;  1T5Y A;  4R9K A;  3AGO A;  3K9M C;  4HM4 B;  1AVK A;  1YIJ 3;  2XRX B;  3JUN A;  5ELJ A;  2W6J H;  5M19 A;  1RKY A;  2GU1 A;  3MWZ A;  2O3O A;  1VQO 3;  3CCM 3;  1YIT 3;  4HM5 B;  1UGI A;  2D42 A;  1JN5 B;  2XFT A;  3CCE 3;  1GOU A;  1TU5 A;  3NV0 A;  1BNJ A;  4N3V A;  1LQG C;  1EKM A;  1JB2 A;  2Z7A A;  3EBY A;  1GMR A;  3FG1 A;  1OHS A;  1F8N A;  3M8C A;  1RGL A;  1AQZ A;  1TP6 A;  1RN4 A;  1M9G A;  2K54 A;  1FUS A;  3JVC A;  1OGZ A;  4GSP A;  1T2H A;  1Q81 4; 
#chains in the Genus database with same CATH homology
 4FMB A;  1N8R 4;  2XGL A;  3D9R A;  3PZW A;  1QAL A;  1IU7 A;  7STD A;  1W6Y A;  1K73 4;  1UW1 A;  3GZY B;  3Q2P A;  2CH9 A;  1IVX A;  1GD3 A;  3Q1C A;  2WGQ A;  3N8B A;  3FLJ A;  3HIG A;  3QRD A;  3K0Z A;  1NWW A;  3GWR A;  4GL6 A;  4HM3 B;  3HK4 A;  2W2C A;  4FR9 A;  5DRE A;  3ROB A;  1VQP 3;  1QVG 2;  3NHX A;  2XFS A;  3VSY A;  3I55 3;  3MKI A;  3LTD A;  3KSE D;  3D3L A;  2LYX A;  5EQL A;  1W6G A;  1FGT A;  1WQL B;  2CFW A;  3LH4 A;  3DGL A;  3CCU 3;  3NBJ A;  3OV4 A;  3LTB A;  2IUK A;  3CCJ 3;  3F7S A;  3UNL A;  3F8H A;  3WA3 A;  1ULJ B;  1UUW B;  3SOY A;  2GEX A;  2I9W A;  2PZV A;  3EN1 B;  3S67 A;  2MC8 A;  3U1W A;  3NX0 A;  4KFD A;  1FUW A;  2ZL8 A;  1Z1S A;  1VQ8 3;  4ZM8 A;  1TFK A;  1M1K 4;  1GY5 A;  2HMM B;  3OWU A;  2D1W A;  1QAK A;  2R4I A;  2WO0 A;  2QA4 3;  2YFL B;  1IVW A;  3MSO A;  4LEH A;  3OX9 A;  5CXO A;  3OWS A;  4J9A A;  1JB4 A;  3T8U A;  3FG3 A;  3TDG A;  2HMO B;  2XF3 A;  2RSX A;  3VGN A;  5IG4 A;  1VQ4 3;  1IK3 A;  2WOF A;  3FGY A;  3WA2 X;  3IPT A;  2CIU A;  4OVM A;  2B24 B;  3UL5 A;  3ALA A;  3X3Y A;  1N8Q A;  4N6U A;  4IPB A;  3DUK A;  3JUO A;  2HML B;  3K5T A;  4IT7 A;  2IUJ A;  3FH1 A;  1FGM A;  1ZO2 A;  1QVF 2;  2W56 B;  5HGR A;  4AKZ A;  3CNM A;  3AMO A;  1QAF A;  3EJV A;  4N6O B;  1VZZ A;  1O7M B;  3BNE A;  1Q40 B;  4OK0 A;  1UI8 A;  2JQ5 A;  3F14 A;  3SED A;  2CWT A;  1E3V A;  3GAX A;  1LOX A;  2YFI B;  3NQZ A;  3CNX A;  1IQX A;  5G2G A;  5STD A;  1U5O A;  1K28 A;  4KFF A;  2LQV A;  1TUH A;  2W03 A;  3SVA A;  1ROA A;  5IEP A;  1S72 3;  1IVV A;  1OGX A;  5DRV A;  5IF6 A;  2XSO B;  4FMD A;  3V92 A;  3UJM A;  1CEW I;  1WTH A;  3K63 A;  5AIG A;  5AEW B;  1UI7 A;  2YFJ B;  4HZ9 B;  5KP3 A;  1IT8 A;  4EV5 A;  1JKG A;  1VQK 3;  4HM0 B;  3S28 A;  3J7Y d;  4R80 A;  4OUQ A;  1KC8 4;  2MF7 A;  4XBY A;  5IER A;  1SII A;  1U8C B;  4HM7 B;  1YJ9 3;  3WDG B;  4RNZ A;  3CPO A;  3PGB A;  2W9P A;  1DMQ A;  4XDW A;  3A76 A;  5JBS A;  2L4V A;  2C11 A;  5AIH A;  4K90 B;  3T0U A;  2CK3 H;  4J8T A;  4R1K A;  3DXO A;  4KFE A;  2CFG A;  3EN8 A;  1OHO A;  1IVU A;  3CD6 3;  4LGQ A;  3MG3 A;  1ISK A;  3FKA A;  1JN5 A;  3WOF B;  1OF5 B;  3G4S 3;  3DGM A;  3CXC 2;  4L8P A;  3PXM A;  3BB9 A;  3LXU X;  3JUQ A;  4X2H A;  5AII A;  4XBT A;  1QJG A;  2YX9 A;  4HM2 B;  4JF8 A;  3ER7 A;  3X3X A;  2GU3 A;  4RZM A;  4WYK B;  3LTA A;  2HMJ B;  1N5H A;  5D83 A;  3L0R A;  2F86 B;  4HVN A;  3PYJ A;  1W00 A;  4KZ1 A;  3EBT A;  3F40 A;  5AYS C;  3B7C A;  4HKV B;  2CHC A;  1WNH A;  3V99 A;  3CC2 3;  1NDO B;  3FCS B;  1AV4 A;  4QWT A;  4XBX A;  4N6T A;  4N6V 0;  1VQN 3;  3JUP A;  3GRD A;  3O8Y A;  3CME 3;  1TIJ A;  1STF I;  3K7C A;  3NM2 A;  1LXE A;  2OCT A;  1VQM 3;  4EXR A;  4N6M A;  1ASK A;  2JDI H;  1CYV A;  1W2Z A;  3NV0 B;  4WWU C;  2P05 A;  2KCD A;  2OTL 3;  2CFK A;  3NBB A;  2RCD A;  3PCS A;  3S29 A;  1KWI A;  2XGN A;  3E99 A;  3CCL 3;  1KSI A;  3V98 A;  3LYG A;  1DMM A;  3EHC A;  1NO3 A;  1GS3 A;  3JUM A;  1VQL 3;  5I97 A;  3FF0 A;  3KII A;  2XH9 A;  2CWV A;  5LC6 A;  2KRT A;  1M90 4;  2QIY A;  5AI1 A;  3G71 3;  3IJE B;  2W9Q A;  1RRL A;  1OHP A;  2STD A;  4EYC A;  2CW9 A;  3Q90 A;  3LTC A;  4CDL A;  5ELU A;  4U13 A;  1TFO A;  1DVD A;  4HM1 B;  4EV2 A;  3BLZ A;  2IMJ A;  5IG5 A;  8CHO A;  1LNH A;  1O7G B;  2Y74 A;  3MHE A;  2W56 A;  2OOV A;  3G16 A;  3WOD G;  2XSH B;  4MEI A;  2UX0 A;  5CF2 A;  2W0Q A;  4LMI A;  4N6L A;  1GD4 A;  2BMR B;  4H61 A;  1NB3 I;  1Q40 A;  3LZA A;  1SQW A;  1YGE A;  3CC7 3;  1KD1 4;  1J2B A;  3EC9 A;  5BXQ A;  1VQ6 3;  1D6Y A;  1K9M 4;  2P0X A;  1JNQ A;  1HKX A;  1O7W B;  2OWP A;  3OWY A;  3CPW 2;  2BMO B;  3MPH A;  1EQK A;  2BO9 B;  1Q82 4;  4Q53 A;  1IT7 A;  5EEO A;  3UL6 A;  3NXJ A;  3B4O A;  4X2O A;  3N9H A;  1LVN A;  1STD A;  5KP1 A;  3GZR A;  1FGR A;  5CLK A;  5D81 A;  1N9J A;  4O02 B;  2F99 A;  5FW5 A;  3OW2 2;  1JB5 A;  4R4K A;  1FGQ A;  1GY7 A;  1N9E A;  1GYB A;  1W5Z A;  3UB1 A;  2Q07 A;  3S27 A;  5LC7 A;  4KVH A;  4LZI A;  2CG1 A;  3U97 A;  4XM4 A;  1YJN 3;  1N5P A;  5IG0 A;  1RRH A;  2GBX B;  4PEJ A;  1BUQ A;  5CF1 A;  2ZDJ A;  2Z77 A;  3BNC A;  3LOY A;  3MG2 A;  3QK9 A;  2E2T A;  3BND A;  5CK6 A;  1OF5 A;  3BNB A;  3DY5 A;  1WMP A;  1C7H A;  2P38 A;  3MG1 A;  1Q7Y 4;  4L7K A;  2E2U A;  1YVB I;  4BTY A;  5IW9 A;  2CG0 A;  3NBR A;  3KFQ C;  4WYK A;  3G8Z A;  1ZX2 A;  1IV7 A;  2CFD A;  1FA3 A;  1D6U A;  1K8A 4;  1OUN A;  4TX4 A;  1EG9 B;  4G1M B;  3MYT A;  4FMC A;  2WOH A;  4BTW A;  3SX1 A;  4FMA A;  1JRQ A;  3PCR A;  4O8S A;  1WMO A;  3X42 A;  4JRF A;  2PNC A;  4HJL B;  5TGN A;  1A2K A;  1A90 A;  5BVB A;  3B4P A;  4FCJ A;  3CCS 3;  1ULI B;  2C10 A;  1DYU A;  1G96 A;  2FXT A;  1GY6 A;  1RJO A;  2P0M A;  4MMY B;  1NU3 A;  4HBR A;  3X41 A;  5IG3 A;  1VQ5 3;  2OQE C;  3CMA 3;  3HII A;  1O7H B;  5D82 A;  3CCV 3;  1V74 A;  3G0K A;  1L5G B;  1IQ8 A;  2ML5 A;  2E2V A;  5A0O B;  2OTJ 3;  2B1X B;  1W6C A;  3NM7 A;  3DMC A;  1O7N B;  1PFP A;  1OAC A;  3LT8 A;  3F8X A;  3GZX B;  2FGT A;  3DM8 A;  3DZL A;  2FNQ A;  3HX8 A;  2XR8 B;  4ORL A;  1CQS A;  4XDV A;  1MNL A;  3DGO A;  1ROV A;  1MOL A;  2V1L A;  4FCZ A;  3SXX A;  5IEN A;  3RDE A;  4K1U A;  1W4N A;  2BT3 A;  2BHM A;  4NHF A;  4NRE A;  1Q86 4;  5JPU A;  3LML A;  3KN4 A;  1Y4K A;  3F7X A;  4O2H A;  1PU4 A;  1AVL A;  3CU3 A;  4HM6 B;  1A67 A;  3IMA B;  4K1V A;  4BTX A;  1OCV A;  2CKF B;  1Q42 A;  4GB5 A;  3SOA A;  3HI7 A;  1UUV B;  3KE7 A;  1QMA A;  2GEY A;  3HZP A;  3X3Z A;  2W04 A;  3FSD A;  4WP5 A;  2HMK B;  2GBW B;  1IV9 A;  1JJ2 2;  1M1X B;  1OH0 A;  4N6N B;  2SBL A;  3NUV A;  3I0Y A;  4EBG A;  1S5A A;  2O9U X;  4WHA A;  4AKY A;  1CYU A;  4HM8 B;  3VF1 A;  3WMD A;  2CWU A;  2A15 A;  3T8N A;  4STD A;  1E3R A;  2ML6 A;  3H51 A;  1O7P B;  1SJW A;  4FCM A;  4LSO A;  1EA2 A;  2Y73 A;  1W01 A;  3DGN A;  1SPU A;  1VQ7 3;  1SIH A;  1FGO A;  3ECF A;  3G6E 3;  3EQQ B;  4RBN A;  3EE1 A;  4R9L A;  1OPY A;  5AIF A;  3N54 B;  2XEP A;  2F98 A;  3OXA A;  4K61 A;  3WOE B;  3CCQ 3;  5KP4 A;  3F9S A;  3EX9 A;  3I56 3;  4WFO A;  3RGR A;  3KZT A;  1VQ9 3;  2Z6B A;  4CCV A;  1YI2 3;  1E97 A;  2M7O A;  4IIA A;  4I4K A;  4AEQ A;  3STD A;  1JV2 B;  1D6Z A;  1WMN A;  5FGO A;  2GXF A;  2CC3 A;  4HZB B;  3RGA A;  4EC6 A;  2K0M A;  3AMO B;  1AR0 A;  4MJD A;  1US1 A;  3LT9 A;  1NJI 4;  1KQS 2;  3FG4 A;  3GZB A;  3EF8 A;  4L8O A;  1YJW 3;  1YHQ 3;  2QGU A;  6STD A;  1W2B 2;  1DMN A;  2KXG A;  2RFR A;  2BNG A;  3CC4 3;  1HU9 A;  3KKG A;  1NB5 I;  2OQE A;  1IQY A;  2BMQ B;  2IA7 A;  4H3U A;  2QEX 3;  2OOV C;  2CFL A;  4HYZ A;  5JPP A;  3PS8 A;  5AEU B;  1A2V A;  1IDP A;  3SLU A;  1K41 A;  3CCR 3;  1RN7 A;  3KSP A;  4XB5 A;  1DVC A;  2HMN B;  4MMZ B;  1W02 A;  3X40 A;  3S5C A;  1R4C A;  3B8L A;  3NQY A;  3FF2 A;  1W7C A;  1JKG B;  4MMX B;  3H3H A;  3FZW A;  5IEO A;  2RGQ A;  3EB8 A;  5EVH A;  2WGO A;  4RNY A;  2Z76 A;  2P09 A;  5AYR B;  1T5Y A;  4R9K A;  3K9M C;  4HM4 B;  1YIJ 3;  1AVK A;  2XRX B;  3JUN A;  5ELJ A;  2W6J H;  1RKY A;  2GU1 A;  3MWZ A;  2O3O A;  1VQO 3;  3CCM 3;  1YIT 3;  4HM5 B;  2D42 A;  1JN5 B;  2XFT A;  3CCE 3;  1TU5 A;  3NV0 A;  4N3V A;  1EKM A;  1JB2 A;  2Z7A A;  3EBY A;  3FG1 A;  1OHS A;  1F8N A;  3M8C A;  1TP6 A;  1M9G A;  2K54 A;  3JVC A;  1OGZ A;  4O3V A;  2INX A;  1Q81 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...