3I563

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3i56300
1YHQ3 1JJ22 3CC43 3G713 1K734 3I553 1YJW3 1N8R4 1VQM3 3CCE3 1VQK3 1VQN3 1M904 3CC73 1QVF2 1YJ93 3CCR3 2QA43 1S723 1VQ53 3I563 1YIJ3 1VQP3 1K9M4 3CCM3 1VQO3 1W2B2 3CC23 3CCV3 3CCS3 3OW22 1Q864 2QEX3 1VQ93 1VQ63 1VQ73 1QVG2 1K8A4 3CXC2 3G4S3 3CME3 2OTL3 1NJI4 3CCQ3 3CPW2 1YIT3 1VQ83 1YJN3 3CCL3 1Q824 1KD14 3G6E3 1KQS2 1YI23 1Q814 3CCJ3 1VQ43 1VQL3 1KC84 1Q7Y4 3CD63 3CMA3 1M1K4 3CCU3 2OTJ3
chains in the Genus database with same CATH superfamily
5HGRA 4EW5A 3IPTA 1C7HA 3B7CA 2CWUA 1JBSA 1PFPA 3RDEA 3OWUA 4IPBA 2A15A 1GY6A 4HZ9B 1BNFA 3CC73 2ML6A 1TUHA 2W2CA 3Q3FA 1TTOA 4KZ1A 3OV4A 3STDA 3EF8A 1RGGA 1FGMA 4O2HA 2CWTA 3FG4A 2IA7A 4HVNA 1T2HA 1IDPA 4RNZA 4XBTA 3TDGA 1HZ1A 3CME3 1HU9A 4FCMA 3LTDA 3Q2PA 4N6TA 3G6E3 3NV0A 1F8NA 2C10A 1BSDA 1I2FA 3EN8A 1IVVA 2UGIA 1BU4A 1MGRA 2XH9A 3O8YA 2HMMB 1JZOA 3NXJA 1BNSA 1LXEA 3X3ZA 4EV5A 1OACA 2OQEC 2H0HA 1IU7A 4LSOA 1VQK3 1ROVA 3L0RA 4EV2A 2H0GA 3KKGA 3D79A 4NPBA 3SVAA 3Q1CA 4MMZB 2RCDA 4XBYA 3UL6A 3PZWA 1HYFA 1LRAA 1YGWA 3B4OA 3G8ZA 1JBRA 3BIRA 1A2PA 3MG2A 1QAFA 3K9MC 1UI7A 3AGOA 2XSOB 2UUGC 4BU4A 8CHOA 2ZDJA 1MWTA 4HBRA 2CIUA 1MWRA 4GB5A 3M8CA 2P05A 3K0ZA 2WO0A 1BANA 4J5KA 5IEOA 1IVXA 1AVLA 1ASKA 4R4KA 2BT3A 2SBLA 1K28A 3DGMA 3VF1A 1SJWA 2GEXA 2HMJB 4X2HA 3H3HA 5JBSA 3X3YA 3GZYB 4Q53A 3LT9A 3N54B 1T5YA 3V98A 1UUWB 1RGFA 4LZIA 1RGCA 2BMRB 5G1KA 2CC3A 2F5MA 1YIJ3 1D6UA 1WMNA 1W5ZA 2K0MA 3GZBA 1B2SA 1OHSA 3MKIA 4MJDA 3CC23 3CCV3 1DMNA 5I97A 3EHCA 4N3VA 3LZAA 3F8HA 2R41A 1JBTA 3IJEB 1OH0A 1VQ73 2OTL3 3AMOB 1VQ83 1W2ZA 1JRQA 1YVBI 3FCSB 1YJN3 3ZG5A 1BNGA 2CHCA 1IYYA 3PGBA 3GZRA 1UDII 2CX0A 1GY7A 4K90B 5A0OB 1UGIA 1UUGB 2UX0A 1I3FA 5CLKA 3F7XA 1VZZA 1W00A 1B20A 1BSBA 3EC9A 5FW5A 1UCIA 4IIAA 1N5HA 1W4NA 4H61A 5D83A 4ORLA 1PU4A 1STFI 2HOHA 3NBRA 2QA43 1FZUA 3JUPA 3CCM3 1VQO3 3URPA 2D1WA 3DY5A 3U97A 1QAKA 1LOWA 1X1UA 3OW22 1UCKA 1FUTA 2CFDA 1GD4A 4I4KA 4KT3B 3CXC2 3EBTA 1BRKA 3JUOA 1S5AA 3DH2A 1GOVA 4HKVB 1FYSA 3WHOA 2GU1A 1BOXA 1ULJB 2YFIB 4HM4B 4WYKB 5AYSC 6RNTA 2FXTA 2O3OA 7GSPA 3JUMA 3Q90A 1W02A 4N6MA 2Z76A 2BIRA 5DREA 3BNEA 2XRXB 3ALAA 3CU3A 3LTCA 1X1WA 2CX1A 5JPPA 4BL3A 2L4VA 3VGNA 4OUQA 4EYCA 1IK3A 5LC6A 2AAEA 1W7CA 2CFKA 1TRPA 1B27A 1UGHI 1STDA 1I2GA 1NWWA 3S27A 1VQ93 3HK4A 4LEHA 3G4S3 5IG3A 1WNHA 3JVCA 1LQGC 1LOYA 3K63A 2WOFA 3RNTA 5EVHA 3MHEA 1O7HB 1KC84 3PCRA 1FUSA 4J8TA 5IG5A 1TJDA 3AMOA 1J2BA 3A5EA 3UL5A 1JJ22 1TFKA 1D6ZA 2BMOB 2LQVA 4KVHA 4ILFA 4FR9A 1EUIC 1I2EA 3HOHA 1YNVX 2OCTA 1VQM3 4K1VA 1CYVA 2GU3A 4HJLB 5AIGA 3CCR3 5IW9A 4G1MB 3N8BA 1KWIA 1IQ8A 2Y73A 3FH1A 3KFQC 1B3SA 4MEIA 5IERA 4HM7B 1LNIA 2HMNB 1VQQA 3FLJA 2CH9A 1RDSA 1V58A 4FMDA 1ISKA 2YX9A 2RBIA 4FMCA 4BIRA 3F40A 4BL2A 4N6NB 8RNTA 1YVSA 4O3VA 2W03A 4JF8A 1SIIA 4J5GA 4FMBA 3DUKA 2D42A 3MG1A 5BIRA 1RN4A 2Z7AA 5CF2A 4HM5B 2QIYA 5CXOA 1FA3A 1ROAA 3F8XA 4WYKA 1A90A 2INXA 3PCSA 2E2TA 1W6YA 3QK9A 1YGEA 3BB9A 4MMYB 1W6CA 1G0TA 1BRNL 2HMOB 2OWPA 1DMMA 1BRGA 1OHPA 2IUKA 2CFLA 1IT7A 2WGQA 1E3RA 3NHXA 3NUVA 5ELJA 1IV7A 3PXMA 3ROBA 2J8XB 1W2B2 2W9PA 1JB5A 1Q7HA 1O7WB 1EA2A 4OVMA 1QALA 1NDOB 2C11A 2Q07A 3NX0A 4HAAA 1QVG2 1B2MA 3FG1A 3NQZA 1B2UA 2Z77A 4HM6B 2STDA 1FGTA 2B24B 1UI8A 5EQLA 4AKZA 3BU4A 5AEWB 3FG3A 4WP5A 1BGSA 3WODG 4HYZA 3CCJ3 1VQL3 5M18A 4RNTA 1I70A 4QWTA 5CF1A 3CD63 2GSPA 2W6JH 3UB1A 3AHWA 1K734 3KCHA 5AIFA 1YJW3 1AV4A 1CEWI 3F7SA 1I0XA 3KSPA 1I8VA 1DVDA 2FNQA 2E2VA 4N6UA 1IVUA 1R4YA 1U8CB 2E2UA 3OX9A 5IG0A 1Q42A 2RFRA 4JRFA 2IY2A 1AR0A 3X41A 4MMXB 3CCS3 5IG4A 4NHFA 1DVCA 2HMKB 3OWYA 1A2KA 1UW1A 2CW9A 2V1LA 3T0UA 3X40A 5AI1A 1IT8A 1TU5A 1OGXA 3LOYA 4RZMA 1AQZA 1SQWA 1UUVB 1BNRA 2KF6A 5D81A 5EEOA 3KN4A 2KXGA 3PYJA 2WOHA 2LYXA 1M1K4 4BTWA 1LOVA 1WMOA 2H0IA 2QGUA 3EQQB 5DRVA 1UCJA 1BIRA 1U5OA 4AKYA 2W9QA 3I553 1V57A 3RGRA 1EEJA 1N8R4 3SOAA 3JUNA 4TX4A 1AY7A 2BU4A 4HM8B 5G2GA 1L5GB 1QVF2 1YJ93 3NQYA 1RNTA 1T2IA 3F14A 4XB5A 3NM7A 4FCZA 3B4PA 3DMCA 1O7NB 2CFWA 1VQP3 2MF7A 6STDA 3J7Yd 3CNXA 3EJVA 1Q864 1EKMA 5AIHA 2JDIH 4IT7A 1JN5B 4AEQA 1G96A 1NJI4 4HZBB 6GSPA 1ZX2A 2GBXB 4XDVA 3G16A 4HM3B 3WA2X 9RNTA 3D5IA 2P09A 2ML5A 7STDA 2ZL8A 3CC43 3FF0A 5IEPA 3CMA3 3MPHA 3CCU3 4N6OB 4KFDA 1US1A 1JB4A 4PEJA 1EG9B 3V99A 2YFJB 5KP3A 2ZHXB 1BSCA 1SIHA 1X1XA 5AYRB 1GY5A 2OOVA 3K7CA 2K54A 4STDA 1FGRA 1N9EA 3EN1B 3WR2A 3LYGA 1JV2B 5HOHA 4O8SA 2RSXA 5GSPA 3S5CA 1CYUA 3HIGA 2W56B 3QRDA 1Q40B 4WFOA 1MWUA 1BUQA 3UNLA 3D5GA 3I0YA 7RNTA 1NO3A 2F86B 2C4BA 4K61A 5AIIA 4WHAA 1TRQA 1OHOA 3GRDA 4LGQA 3SYUA 5RNTA 2XFTA 1MOLA 2CG1A 2K3DA 1RRHA 2CG0A 2BHMA 4GL6A 1M1XB 1VQ43 1BAOA 3FSDA 4L7KA 3NM2A 3MG3A 4O02B 2XR8B 2RGQA 3LH4A 3G713 2B1XB 3KIIA 4KFEA 1Z1SA 2W04A 1E3VA 1V74A 2XGLA 3X42A 5STDA 5AEUB 4H3UA 3CCE3 1VQN3 1RN7A 1T3BA 2L1SA 2ZA4A 5D82A 1N9JA 1FGOA 3KSED 1IQXA 1K9M4 4XBXA 2WGOA 3N9HA 4OK0A 1PY3A 3G0KA 3V92A 3HX8A 1BRIA 1WTHA 3OWSA 1SPUA 2KF4A 4EXRA 1RGHA 3JUQA 3B8LA 2CKFB 3CNMA 4J9AA 1FW7A 1KQS2 1RTUA 1IVWA 1JN5A 4HM0B 4N6LA 2F4YA 1X1YA 2OTJ3 2XGNA 3GSPA 1JNQA 1CQSA 1LNHA 1O7PB 5M1AA 3BNCA 3LTBA 3FKAA 2Z6BA 2BMQB 1TP6A 4HM1B 3DM8A 1WQLB 2HMLB 2KAAA 5IENA 2BO9B 3D3LA 3GAXA 3A76A 2OQEA 2GBWB 3F9SA 3CPOA 1EQKA 3MYTA 1W6GA 2P0MA 1YIT3 4R1KA 2W56A 4CPKA 1BSAA 1Q40A 1RLSA 1Q824 3EX9A 2O9UX 2IUJA 1M9GA 1D6YA 4GHOA 4FMAA 5KP4A 5TGNA 2YFLB 1A2VA 1RGEA 1MNLA 3WA3A 1BRHA 1OF5B 2P38A 3UJMA 3SOYA 1K41A 3DGOA 5BVBA 1RRLA 1NB5I 1GOYA 1ZGXA 2XF3A 2IYJA 4L8OA 5G1LA 3ZFZA 1I0VA 1NNVA 1B2XA 1QJGA 1ZS7A 2RNTA 3VSYA 2KRTA 1S723 1JKGB 2R4IA 5KP1A 1GOUA 1RGLA 3S29A 3AHSA 4L8PA 4LYLB 3S67A 3FF2A 1PYLA 1E97A 2FGTA 4R9LA 5FGOA 1K8A4 5JPUA 3DZLA 3CPW2 3BNBA 1HKXA 1O7MB 3U1WA 3CCL3 1GD3A 4I5QA 2F5WA 1RCKA 1RGKA 1OCVA 1B21A 2XSHB 5M19A 3LMLA 4HM2B 3EB8A 1N8QA 1JZDA 4CCVA 1B2ZA 1RCLA 2P0XA 2SARA 3SEDA 1OPYA 4R80A 3AGNA 1NU3A 1DETA 4BTXA 1BNJA 1RSNA 1RKYA 1Y4KA 1M904 2PZVA 1OUNA 4X2OA 3BNDA 3S28A 1GMPA 5CK6A 2AADA 1DYUA 3D4AA 2MC8A 3LXUX 3SLUA 4CDLA 3BLZA 4LMIA 2M7OA 1BUJA 3K5TA 4BTYA 4GSPA 3RGAA 1RGAA 2GEYA 2KF3A 4K1UA 5IF6A 3HI7A 2CK3H 3WDGB 1BNEA 3WOFB 2W0QA 4U13A 1KD14 3FZWA 1MGWA 5ELUA 3HIIA 1Q814 1IV9A 1NB3I 1N5PA 1FGQA 4ZM8A 1RN1A 1TFOA 1TIJA 3DGNA 2BNGA 3GZXB 3KE7A 4KFFA 1YHQ3 4DKIA 1C54A 3ER7A 2I9WA 4R9KA 1Q7Y4 4EC6A 1KSIA 1SARA 3NBBA 3EE1A 3HZPA 1AVKA 1ULIB 1OF5A 2GXFA 3FGYA 3WMDA 1OGZA 3X3XA 3DGYA 3I563 1VQ53 1FUWA 3T8UA 4HOHA 3NV0B 1VQ63 2QEX3 1LOXA 4EBGA 1BSEA 3GWRA 3OXAA 1DMQA 4RBNA 1GYBA 5BXQA 3CCQ3 1LQMB 1JKGA 2Y74A 3T8NA 4N6V0 2OOVC 1GMRA 1RHLA 1YI23 5LC7A 3DXOA 3H51A 1R4CA 2XEPA 1JB2A 1GS3A 1QMAA 1BRSA 3IMAB 1W01A 3WOEB 3SX1A 3ZG0A 1RMSA 4WWUC 2KCDA 3SXXA 1CH0A 4XM4A 1Q9EA 2KF5A 3E99A 1BVIA 1G02A 3EBYA 4NREA 4CJNA 1DE3A 3PS8A 1GMQA 1RJOA 1UCLA 2JQ5A 3DGLA 1RNBA 4XDWA 1WMPA 2F99A 3MSOA 2CFGA 2CWVA 2F56A 2PNCA 1BRJA 2XFSA 1BNIA 1GSPA 3LTAA 2IMJA 1ZO2A 2F98A 4FCJA 5BU4A 4RNYA 3KZTA 1LVNA 1MWSA 3LT8A 1A67A 3NBJA 1O7GB 1I3IA 3D9RA 3MWZA 1IQYA 3ECFA
chains in the Genus database with same CATH topology
5HGRA 3IPTA 1C7HA 3B7CA 2CWUA 1PFPA 3RDEA 3OWUA 4IPBA 2A15A 1GY6A 4HZ9B 3CC73 2ML6A 1TUHA 2W2CA 4KZ1A 3OV4A 3STDA 3EF8A 4O2HA 1FGMA 2CWTA 3FG4A 2IA7A 4HVNA 1IDPA 4RNZA 4XBTA 3TDGA 3CME3 1HU9A 4FCMA 3LTDA 3Q2PA 4N6TA 3G6E3 3NV0A 1F8NA 2C10A 3EN8A 1IVVA 2XH9A 3O8YA 2HMMB 3NXJA 3X3ZA 1LXEA 4EV5A 1OACA 2OQEC 1IU7A 4LSOA 1VQK3 1ROVA 3L0RA 4EV2A 3KKGA 3SVAA 3Q1CA 4MMZB 2RCDA 4XBYA 3UL6A 3PZWA 3G8ZA 3B4OA 3MG2A 1QAFA 3K9MC 1UI7A 2XSOB 8CHOA 2ZDJA 4HBRA 2CIUA 4GB5A 3M8CA 2P05A 3K0ZA 2WO0A 5IEOA 1IVXA 1AVLA 1ASKA 4R4KA 2BT3A 2SBLA 1K28A 3DGMA 3VF1A 1SJWA 2GEXA 2HMJB 4X2HA 3H3HA 5JBSA 3X3YA 3GZYB 4Q53A 3LT9A 3N54B 1T5YA 3V98A 1UUWB 4LZIA 2BMRB 2CC3A 1YIJ3 1D6UA 1WMNA 1W5ZA 2K0MA 3GZBA 1OHSA 3MKIA 4MJDA 3CC23 3CCV3 1DMNA 5I97A 3EHCA 4N3VA 3LZAA 3F8HA 3IJEB 1OH0A 1VQ73 2OTL3 3AMOB 1VQ83 1W2ZA 1JRQA 1YVBI 3FCSB 1YJN3 2CHCA 3PGBA 3GZRA 4K90B 1GY7A 5A0OB 2UX0A 5CLKA 3F7XA 1VZZA 1W00A 3EC9A 5FW5A 4IIAA 1N5HA 1W4NA 4H61A 5D83A 4ORLA 1PU4A 1STFI 3NBRA 2QA43 3JUPA 3CCM3 1VQO3 2D1WA 3DY5A 3U97A 1QAKA 3OW22 2CFDA 1GD4A 4I4KA 3CXC2 3EBTA 3JUOA 1S5AA 4HKVB 2GU1A 5AYSC 1ULJB 2YFIB 4HM4B 4WYKB 2FXTA 2O3OA 3JUMA 3Q90A 1W02A 4N6MA 2Z76A 5DREA 3BNEA 2XRXB 3ALAA 3CU3A 3LTCA 5JPPA 2L4VA 3VGNA 4OUQA 4EYCA 1IK3A 5LC6A 1W7CA 2CFKA 1STDA 1NWWA 3S27A 1VQ93 3HK4A 4LEHA 3G4S3 5IG3A 1WNHA 3JVCA 3K63A 2WOFA 5EVHA 3MHEA 1O7HB 1KC84 3PCRA 4J8TA 5IG5A 3AMOA 1J2BA 3UL5A 1JJ22 1TFKA 1D6ZA 2BMOB 2LQVA 4KVHA 4FR9A 2OCTA 1VQM3 4K1VA 1CYVA 2GU3A 4HJLB 5AIGA 3CCR3 5IW9A 4G1MB 3N8BA 1KWIA 1IQ8A 2Y73A 3FH1A 3KFQC 4MEIA 5IERA 4HM7B 2HMNB 3FLJA 2CH9A 4FMDA 1ISKA 2YX9A 4FMCA 3F40A 4N6NB 4O3VA 2W03A 4JF8A 1SIIA 4FMBA 3DUKA 2D42A 3MG1A 5CF2A 2Z7AA 4HM5B 2QIYA 5CXOA 1FA3A 1ROAA 3F8XA 4WYKA 1A90A 2INXA 3PCSA 2E2TA 1W6YA 3QK9A 1YGEA 3BB9A 4MMYB 1W6CA 2HMOB 2OWPA 1DMMA 1OHPA 2IUKA 2WGQA 1IT7A 2CFLA 1E3RA 3NHXA 3NUVA 5ELJA 1IV7A 3PXMA 3ROBA 1W2B2 2W9PA 1JB5A 4OVMA 1O7WB 1EA2A 1QALA 1NDOB 2C11A 2Q07A 3NX0A 1QVG2 3FG1A 3NQZA 2Z77A 4HM6B 2STDA 1FGTA 2B24B 1UI8A 5EQLA 4AKZA 5AEWB 3FG3A 4WP5A 3WODG 4HYZA 3CCJ3 1VQL3 4QWTA 5CF1A 3CD63 2W6JH 3UB1A 1K734 5AIFA 1YJW3 1AV4A 1CEWI 3F7SA 1DVDA 3KSPA 2FNQA 2E2VA 4N6UA 1IVUA 1U8CB 2E2UA 3OX9A 5IG0A 1Q42A 2RFRA 4JRFA 1AR0A 3X41A 4MMXB 3CCS3 5IG4A 4NHFA 1DVCA 2HMKB 3OWYA 1A2KA 1UW1A 2CW9A 2V1LA 3T0UA 3X40A 5AI1A 1IT8A 1TU5A 1OGXA 3LOYA 4RZMA 1UUVB 1SQWA 5D81A 5EEOA 3KN4A 2KXGA 3PYJA 2WOHA 2LYXA 1M1K4 4BTWA 1WMOA 3EQQB 5DRVA 2QGUA 1U5OA 4AKYA 3I553 2W9QA 1N8R4 3RGRA 3SOAA 3JUNA 4TX4A 4HM8B 5G2GA 1L5GB 1QVF2 1YJ93 3NQYA 3F14A 4XB5A 3NM7A 4FCZA 3B4PA 3DMCA 1O7NB 2CFWA 1VQP3 2MF7A 6STDA 3J7Yd 3CNXA 3EJVA 1Q864 1EKMA 5AIHA 2JDIH 4IT7A 1JN5B 4AEQA 1G96A 1NJI4 4HZBB 1ZX2A 2GBXB 4XDVA 3G16A 4HM3B 3WA2X 2P09A 2ML5A 7STDA 2ZL8A 3CC43 3FF0A 5IEPA 3CMA3 3MPHA 3CCU3 4N6OB 4KFDA 1US1A 1JB4A 4PEJA 1EG9B 3V99A 2YFJB 5KP3A 1SIHA 2OOVA 5AYRB 1GY5A 3K7CA 2K54A 4STDA 1FGRA 1N9EA 3EN1B 3LYGA 1JV2B 4O8SA 2RSXA 3S5CA 1CYUA 3HIGA 2W56B 3QRDA 1Q40B 4WFOA 1BUQA 3UNLA 3I0YA 1NO3A 2F86B 4K61A 5AIIA 4WHAA 1OHOA 3GRDA 4LGQA 2XFTA 1MOLA 2CG1A 1RRHA 2CG0A 2BHMA 4GL6A 1M1XB 1VQ43 3FSDA 4L7KA 3NM2A 3MG3A 4O02B 2XR8B 2RGQA 3LH4A 3G713 2B1XB 3KIIA 4KFEA 1Z1SA 2XGLA 2W04A 1E3VA 1V74A 3X42A 5STDA 5AEUB 4H3UA 3CCE3 1VQN3 1RN7A 5D82A 1N9JA 1FGOA 3KSED 1IQXA 1K9M4 4XBXA 2WGOA 3N9HA 4OK0A 3V92A 3G0KA 3HX8A 1WTHA 3OWSA 1SPUA 4EXRA 3JUQA 3B8LA 2CKFB 3CNMA 4J9AA 1KQS2 1IVWA 1JN5A 4HM0B 4N6LA 2OTJ3 2XGNA 1JNQA 1CQSA 1LNHA 1O7PB 3BNCA 3LTBA 3FKAA 2Z6BA 2BMQB 1TP6A 4HM1B 3DM8A 1WQLB 2HMLB 5IENA 2BO9B 3D3LA 3GAXA 3A76A 2OQEA 2GBWB 3F9SA 3CPOA 1EQKA 3MYTA 1W6GA 2P0MA 1YIT3 4R1KA 2W56A 1Q40A 1Q824 3EX9A 2O9UX 2IUJA 1M9GA 1D6YA 4FMAA 5KP4A 5TGNA 2YFLB 1A2VA 1MNLA 3WA3A 2P38A 1OF5B 3UJMA 3SOYA 1K41A 3DGOA 1RRLA 1NB5I 2XF3A 4L8OA 1QJGA 1S723 3VSYA 2KRTA 1JKGB 2R4IA 5KP1A 3S29A 4L8PA 3S67A 3FF2A 2FGTA 1E97A 4R9LA 5FGOA 1K8A4 5JPUA 3DZLA 3CPW2 3BNBA 1HKXA 1O7MB 3U1WA 3CCL3 1GD3A 1OCVA 2XSHB 3LMLA 4HM2B 3EB8A 1N8QA 4CCVA 2P0XA 3SEDA 1OPYA 4R80A 1NU3A 4BTXA 1RKYA 1Y4KA 1M904 2PZVA 1OUNA 4X2OA 3BNDA 3S28A 5CK6A 5BVBA 1DYUA 2MC8A 3LXUX 3SLUA 4CDLA 3BLZA 4LMIA 2M7OA 3K5TA 4BTYA 3RGAA 2GEYA 4K1UA 5IF6A 3HI7A 2CK3H 3WDGB 3WOFB 2W0QA 4U13A 1KD14 3FZWA 5ELUA 3HIIA 1Q814 1IV9A 1NB3I 1N5PA 1FGQA 4ZM8A 1TFOA 1TIJA 3DGNA 2BNGA 3GZXB 3KE7A 4KFFA 1YHQ3 3ER7A 2I9WA 4R9KA 4EC6A 1KSIA 3NBBA 3EE1A 3HZPA 1AVKA 1ULIB 1OF5A 2GXFA 3FGYA 3WMDA 1OGZA 3X3XA 3I563 1VQ53 1FUWA 3T8UA 3NV0B 1VQ63 2QEX3 1LOXA 4EBGA 3GWRA 3OXAA 1DMQA 4RBNA 1GYBA 5BXQA 3CCQ3 2Y74A 1JKGA 3T8NA 4N6V0 2OOVC 1YI23 5LC7A 3DXOA 3H51A 1R4CA 2XEPA 1JB2A 1GS3A 1QMAA 3IMAB 1W01A 3WOEB 3SX1A 4WWUC 2KCDA 3SXXA 4XM4A 3E99A 3EBYA 4NREA 3PS8A 1RJOA 2JQ5A 3DGLA 4XDWA 1WMPA 2F99A 3MSOA 2CFGA 2CWVA 2PNCA 2XFSA 3LTAA 2IMJA 1ZO2A 2F98A 4FCJA 4RNYA 3KZTA 1LVNA 3LT8A 1A67A 3NBJA 1O7GB 3D9RA 3MWZA 1Q7Y4 1IQYA 3ECFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ 3;  1JJ2 2;  3CC4 3;  3G71 3;  1K73 4;  3I55 3;  1YJW 3;  1N8R 4;  1VQM 3;  3CCE 3;  1VQK 3;  1VQN 3;  1M90 4;  3CC7 3;  1QVF 2;  1YJ9 3;  3CCR 3;  2QA4 3;  1S72 3;  1VQ5 3;  3I56 3;  1YIJ 3;  1VQP 3;  1K9M 4;  3CCM 3;  1VQO 3;  1W2B 2;  3CC2 3;  3CCV 3;  3CCS 3;  3OW2 2;  1Q86 4;  2QEX 3;  1VQ9 3;  1VQ6 3;  1VQ7 3;  1QVG 2;  1K8A 4;  3CXC 2;  3G4S 3;  3CME 3;  2OTL 3;  1NJI 4;  3CCQ 3;  3CPW 2;  1YIT 3;  1VQ8 3;  1YJN 3;  3CCL 3;  1Q82 4;  1KD1 4;  3G6E 3;  1KQS 2;  1YI2 3;  1Q81 4;  3CCJ 3;  1VQ4 3;  1VQL 3;  1KC8 4;  1Q7Y 4;  3CD6 3;  3CMA 3;  1M1K 4;  3CCU 3;  2OTJ 3; 
#chains in the Genus database with same CATH topology
 5HGR A;  4EW5 A;  3IPT A;  1C7H A;  3B7C A;  2CWU A;  1JBS A;  1PFP A;  3RDE A;  3OWU A;  4IPB A;  2A15 A;  1GY6 A;  4HZ9 B;  1BNF A;  3CC7 3;  2ML6 A;  1TUH A;  2W2C A;  3Q3F A;  1TTO A;  4KZ1 A;  3OV4 A;  3STD A;  3EF8 A;  1RGG A;  1FGM A;  4O2H A;  2CWT A;  3FG4 A;  2IA7 A;  4HVN A;  1T2H A;  1IDP A;  4RNZ A;  4XBT A;  3TDG A;  1HZ1 A;  3CME 3;  1HU9 A;  4FCM A;  3LTD A;  3Q2P A;  4N6T A;  3G6E 3;  3NV0 A;  1F8N A;  2C10 A;  1BSD A;  1I2F A;  3EN8 A;  1IVV A;  2UGI A;  1BU4 A;  1MGR A;  2XH9 A;  3O8Y A;  2HMM B;  1JZO A;  3NXJ A;  1BNS A;  1LXE A;  3X3Z A;  4EV5 A;  1OAC A;  2OQE C;  2H0H A;  1IU7 A;  4LSO A;  1VQK 3;  1ROV A;  3L0R A;  4EV2 A;  2H0G A;  3KKG A;  3D79 A;  4NPB A;  3SVA A;  3Q1C A;  4MMZ B;  2RCD A;  4XBY A;  3UL6 A;  3PZW A;  1HYF A;  1LRA A;  1YGW A;  3B4O A;  3G8Z A;  1JBR A;  3BIR A;  1A2P A;  3MG2 A;  1QAF A;  3K9M C;  1UI7 A;  3AGO A;  2XSO B;  2UUG C;  4BU4 A;  8CHO A;  2ZDJ A;  1MWT A;  4HBR A;  2CIU A;  1MWR A;  4GB5 A;  3M8C A;  2P05 A;  3K0Z A;  2WO0 A;  1BAN A;  4J5K A;  5IEO A;  1IVX A;  1AVL A;  1ASK A;  4R4K A;  2BT3 A;  2SBL A;  1K28 A;  3DGM A;  3VF1 A;  1SJW A;  2GEX A;  2HMJ B;  4X2H A;  3H3H A;  5JBS A;  3X3Y A;  3GZY B;  4Q53 A;  3LT9 A;  3N54 B;  1T5Y A;  3V98 A;  1UUW B;  1RGF A;  4LZI A;  1RGC A;  2BMR B;  5G1K A;  2CC3 A;  2F5M A;  1YIJ 3;  1D6U A;  1WMN A;  1W5Z A;  2K0M A;  3GZB A;  1B2S A;  1OHS A;  3MKI A;  4MJD A;  3CC2 3;  3CCV 3;  1DMN A;  5I97 A;  3EHC A;  4N3V A;  3LZA A;  3F8H A;  2R41 A;  1JBT A;  3IJE B;  1OH0 A;  1VQ7 3;  2OTL 3;  3AMO B;  1VQ8 3;  1W2Z A;  1JRQ A;  1YVB I;  3FCS B;  1YJN 3;  3ZG5 A;  1BNG A;  2CHC A;  1IYY A;  3PGB A;  3GZR A;  1UDI I;  2CX0 A;  1GY7 A;  4K90 B;  5A0O B;  1UGI A;  1UUG B;  2UX0 A;  1I3F A;  5CLK A;  3F7X A;  1VZZ A;  1W00 A;  1B20 A;  1BSB A;  3EC9 A;  5FW5 A;  1UCI A;  4IIA A;  1N5H A;  1W4N A;  4H61 A;  5D83 A;  4ORL A;  1PU4 A;  1STF I;  2HOH A;  3NBR A;  2QA4 3;  1FZU A;  3JUP A;  3CCM 3;  1VQO 3;  3URP A;  2D1W A;  3DY5 A;  3U97 A;  1QAK A;  1LOW A;  1X1U A;  3OW2 2;  1UCK A;  1FUT A;  2CFD A;  1GD4 A;  4I4K A;  4KT3 B;  3CXC 2;  3EBT A;  1BRK A;  3JUO A;  1S5A A;  3DH2 A;  1GOV A;  4HKV B;  1FYS A;  3WHO A;  2GU1 A;  1BOX A;  1ULJ B;  2YFI B;  4HM4 B;  4WYK B;  5AYS C;  6RNT A;  2FXT A;  2O3O A;  7GSP A;  3JUM A;  3Q90 A;  1W02 A;  4N6M A;  2Z76 A;  2BIR A;  5DRE A;  3BNE A;  2XRX B;  3ALA A;  3CU3 A;  3LTC A;  1X1W A;  2CX1 A;  5JPP A;  4BL3 A;  2L4V A;  3VGN A;  4OUQ A;  4EYC A;  1IK3 A;  5LC6 A;  2AAE A;  1W7C A;  2CFK A;  1TRP A;  1B27 A;  1UGH I;  1STD A;  1I2G A;  1NWW A;  3S27 A;  1VQ9 3;  3HK4 A;  4LEH A;  3G4S 3;  5IG3 A;  1WNH A;  3JVC A;  1LQG C;  1LOY A;  3K63 A;  2WOF A;  3RNT A;  5EVH A;  3MHE A;  1O7H B;  1KC8 4;  3PCR A;  1FUS A;  4J8T A;  5IG5 A;  1TJD A;  3AMO A;  1J2B A;  3A5E A;  3UL5 A;  1JJ2 2;  1TFK A;  1D6Z A;  2BMO B;  2LQV A;  4KVH A;  4ILF A;  4FR9 A;  1EUI C;  1I2E A;  3HOH A;  1YNV X;  2OCT A;  1VQM 3;  4K1V A;  1CYV A;  2GU3 A;  4HJL B;  5AIG A;  3CCR 3;  5IW9 A;  4G1M B;  3N8B A;  1KWI A;  1IQ8 A;  2Y73 A;  3FH1 A;  3KFQ C;  1B3S A;  4MEI A;  5IER A;  4HM7 B;  1LNI A;  2HMN B;  1VQQ A;  3FLJ A;  2CH9 A;  1RDS A;  1V58 A;  4FMD A;  1ISK A;  2YX9 A;  2RBI A;  4FMC A;  4BIR A;  3F40 A;  4BL2 A;  4N6N B;  8RNT A;  1YVS A;  4O3V A;  2W03 A;  4JF8 A;  1SII A;  4J5G A;  4FMB A;  3DUK A;  2D42 A;  3MG1 A;  5BIR A;  1RN4 A;  2Z7A A;  5CF2 A;  4HM5 B;  2QIY A;  5CXO A;  1FA3 A;  1ROA A;  3F8X A;  4WYK A;  1A90 A;  2INX A;  3PCS A;  2E2T A;  1W6Y A;  3QK9 A;  1YGE A;  3BB9 A;  4MMY B;  1W6C A;  1G0T A;  1BRN L;  2HMO B;  2OWP A;  1DMM A;  1BRG A;  1OHP A;  2IUK A;  2CFL A;  1IT7 A;  2WGQ A;  1E3R A;  3NHX A;  3NUV A;  5ELJ A;  1IV7 A;  3PXM A;  3ROB A;  2J8X B;  1W2B 2;  2W9P A;  1JB5 A;  1Q7H A;  1O7W B;  1EA2 A;  4OVM A;  1QAL A;  1NDO B;  2C11 A;  2Q07 A;  3NX0 A;  4HAA A;  1QVG 2;  1B2M A;  3FG1 A;  3NQZ A;  1B2U A;  2Z77 A;  4HM6 B;  2STD A;  1FGT A;  2B24 B;  1UI8 A;  5EQL A;  4AKZ A;  3BU4 A;  5AEW B;  3FG3 A;  4WP5 A;  1BGS A;  3WOD G;  4HYZ A;  3CCJ 3;  1VQL 3;  5M18 A;  4RNT A;  1I70 A;  4QWT A;  5CF1 A;  3CD6 3;  2GSP A;  2W6J H;  3UB1 A;  3AHW A;  1K73 4;  3KCH A;  5AIF A;  1YJW 3;  1AV4 A;  1CEW I;  3F7S A;  1I0X A;  3KSP A;  1I8V A;  1DVD A;  2FNQ A;  2E2V A;  4N6U A;  1IVU A;  1R4Y A;  1U8C B;  2E2U A;  3OX9 A;  5IG0 A;  1Q42 A;  2RFR A;  4JRF A;  2IY2 A;  1AR0 A;  3X41 A;  4MMX B;  3CCS 3;  5IG4 A;  4NHF A;  1DVC A;  2HMK B;  3OWY A;  1A2K A;  1UW1 A;  2CW9 A;  2V1L A;  3T0U A;  3X40 A;  5AI1 A;  1IT8 A;  1TU5 A;  1OGX A;  3LOY A;  4RZM A;  1AQZ A;  1SQW A;  1UUV B;  1BNR A;  2KF6 A;  5D81 A;  5EEO A;  3KN4 A;  2KXG A;  3PYJ A;  2WOH A;  2LYX A;  1M1K 4;  4BTW A;  1LOV A;  1WMO A;  2H0I A;  2QGU A;  3EQQ B;  5DRV A;  1UCJ A;  1BIR A;  1U5O A;  4AKY A;  2W9Q A;  3I55 3;  1V57 A;  3RGR A;  1EEJ A;  1N8R 4;  3SOA A;  3JUN A;  4TX4 A;  1AY7 A;  2BU4 A;  4HM8 B;  5G2G A;  1L5G B;  1QVF 2;  1YJ9 3;  3NQY A;  1RNT A;  1T2I A;  3F14 A;  4XB5 A;  3NM7 A;  4FCZ A;  3B4P A;  3DMC A;  1O7N B;  2CFW A;  1VQP 3;  2MF7 A;  6STD A;  3J7Y d;  3CNX A;  3EJV A;  1Q86 4;  1EKM A;  5AIH A;  2JDI H;  4IT7 A;  1JN5 B;  4AEQ A;  1G96 A;  1NJI 4;  4HZB B;  6GSP A;  1ZX2 A;  2GBX B;  4XDV A;  3G16 A;  4HM3 B;  3WA2 X;  9RNT A;  3D5I A;  2P09 A;  2ML5 A;  7STD A;  2ZL8 A;  3CC4 3;  3FF0 A;  5IEP A;  3CMA 3;  3MPH A;  3CCU 3;  4N6O B;  4KFD A;  1US1 A;  1JB4 A;  4PEJ A;  1EG9 B;  3V99 A;  2YFJ B;  5KP3 A;  2ZHX B;  1BSC A;  1SIH A;  1X1X A;  5AYR B;  1GY5 A;  2OOV A;  3K7C A;  2K54 A;  4STD A;  1FGR A;  1N9E A;  3EN1 B;  3WR2 A;  3LYG A;  1JV2 B;  5HOH A;  4O8S A;  2RSX A;  5GSP A;  3S5C A;  1CYU A;  3HIG A;  2W56 B;  3QRD A;  1Q40 B;  4WFO A;  1MWU A;  1BUQ A;  3UNL A;  3D5G A;  3I0Y A;  7RNT A;  1NO3 A;  2F86 B;  2C4B A;  4K61 A;  5AII A;  4WHA A;  1TRQ A;  1OHO A;  3GRD A;  4LGQ A;  3SYU A;  5RNT A;  2XFT A;  1MOL A;  2CG1 A;  2K3D A;  1RRH A;  2CG0 A;  2BHM A;  4GL6 A;  1M1X B;  1VQ4 3;  1BAO A;  3FSD A;  4L7K A;  3NM2 A;  3MG3 A;  4O02 B;  2XR8 B;  2RGQ A;  3LH4 A;  3G71 3;  2B1X B;  3KII A;  4KFE A;  1Z1S A;  2W04 A;  1E3V A;  1V74 A;  2XGL A;  3X42 A;  5STD A;  5AEU B;  4H3U A;  3CCE 3;  1VQN 3;  1RN7 A;  1T3B A;  2L1S A;  2ZA4 A;  5D82 A;  1N9J A;  1FGO A;  3KSE D;  1IQX A;  1K9M 4;  4XBX A;  2WGO A;  3N9H A;  4OK0 A;  1PY3 A;  3G0K A;  3V92 A;  3HX8 A;  1BRI A;  1WTH A;  3OWS A;  1SPU A;  2KF4 A;  4EXR A;  1RGH A;  3JUQ A;  3B8L A;  2CKF B;  3CNM A;  4J9A A;  1FW7 A;  1KQS 2;  1RTU A;  1IVW A;  1JN5 A;  4HM0 B;  4N6L A;  2F4Y A;  1X1Y A;  2OTJ 3;  2XGN A;  3GSP A;  1JNQ A;  1CQS A;  1LNH A;  1O7P B;  5M1A A;  3BNC A;  3LTB A;  3FKA A;  2Z6B A;  2BMQ B;  1TP6 A;  4HM1 B;  3DM8 A;  1WQL B;  2HML B;  2KAA A;  5IEN A;  2BO9 B;  3D3L A;  3GAX A;  3A76 A;  2OQE A;  2GBW B;  3F9S A;  3CPO A;  1EQK A;  3MYT A;  1W6G A;  2P0M A;  1YIT 3;  4R1K A;  2W56 A;  4CPK A;  1BSA A;  1Q40 A;  1RLS A;  1Q82 4;  3EX9 A;  2O9U X;  2IUJ A;  1M9G A;  1D6Y A;  4GHO A;  4FMA A;  5KP4 A;  5TGN A;  2YFL B;  1A2V A;  1RGE A;  1MNL A;  3WA3 A;  1BRH A;  1OF5 B;  2P38 A;  3UJM A;  3SOY A;  1K41 A;  3DGO A;  5BVB A;  1RRL A;  1NB5 I;  1GOY A;  1ZGX A;  2XF3 A;  2IYJ A;  4L8O A;  5G1L A;  3ZFZ A;  1I0V A;  1NNV A;  1B2X A;  1QJG A;  1ZS7 A;  2RNT A;  3VSY A;  2KRT A;  1S72 3;  1JKG B;  2R4I A;  5KP1 A;  1GOU A;  1RGL A;  3S29 A;  3AHS A;  4L8P A;  4LYL B;  3S67 A;  3FF2 A;  1PYL A;  1E97 A;  2FGT A;  4R9L A;  5FGO A;  1K8A 4;  5JPU A;  3DZL A;  3CPW 2;  3BNB A;  1HKX A;  1O7M B;  3U1W A;  3CCL 3;  1GD3 A;  4I5Q A;  2F5W A;  1RCK A;  1RGK A;  1OCV A;  1B21 A;  2XSH B;  5M19 A;  3LML A;  4HM2 B;  3EB8 A;  1N8Q A;  1JZD A;  4CCV A;  1B2Z A;  1RCL A;  2P0X A;  2SAR A;  3SED A;  1OPY A;  4R80 A;  3AGN A;  1NU3 A;  1DET A;  4BTX A;  1BNJ A;  1RSN A;  1RKY A;  1Y4K A;  1M90 4;  2PZV A;  1OUN A;  4X2O A;  3BND A;  3S28 A;  1GMP A;  5CK6 A;  2AAD A;  1DYU A;  3D4A A;  2MC8 A;  3LXU X;  3SLU A;  4CDL A;  3BLZ A;  4LMI A;  2M7O A;  1BUJ A;  3K5T A;  4BTY A;  4GSP A;  3RGA A;  1RGA A;  2GEY A;  2KF3 A;  4K1U A;  5IF6 A;  3HI7 A;  2CK3 H;  3WDG B;  1BNE A;  3WOF B;  2W0Q A;  4U13 A;  1KD1 4;  3FZW A;  1MGW A;  5ELU A;  3HII A;  1Q81 4;  1IV9 A;  1NB3 I;  1N5P A;  1FGQ A;  4ZM8 A;  1RN1 A;  1TFO A;  1TIJ A;  3DGN A;  2BNG A;  3GZX B;  3KE7 A;  4KFF A;  1YHQ 3;  4DKI A;  1C54 A;  3ER7 A;  2I9W A;  4R9K A;  1Q7Y 4;  4EC6 A;  1KSI A;  1SAR A;  3NBB A;  3EE1 A;  3HZP A;  1AVK A;  1ULI B;  1OF5 A;  2GXF A;  3FGY A;  3WMD A;  1OGZ A;  3X3X A;  3DGY A;  3I56 3;  1VQ5 3;  1FUW A;  3T8U A;  4HOH A;  3NV0 B;  1VQ6 3;  2QEX 3;  1LOX A;  4EBG A;  1BSE A;  3GWR A;  3OXA A;  1DMQ A;  4RBN A;  1GYB A;  5BXQ A;  3CCQ 3;  1LQM B;  1JKG A;  2Y74 A;  3T8N A;  4N6V 0;  2OOV C;  1GMR A;  1RHL A;  1YI2 3;  5LC7 A;  3DXO A;  3H51 A;  1R4C A;  2XEP A;  1JB2 A;  1GS3 A;  1QMA A;  1BRS A;  3IMA B;  1W01 A;  3WOE B;  3SX1 A;  3ZG0 A;  1RMS A;  4WWU C;  2KCD A;  3SXX A;  1CH0 A;  4XM4 A;  1Q9E A;  2KF5 A;  3E99 A;  1BVI A;  1G02 A;  3EBY A;  4NRE A;  4CJN A;  1DE3 A;  3PS8 A;  1GMQ A;  1RJO A;  1UCL A;  2JQ5 A;  3DGL A;  1RNB A;  4XDW A;  1WMP A;  2F99 A;  3MSO A;  2CFG A;  2CWV A;  2F56 A;  2PNC A;  1BRJ A;  2XFS A;  1BNI A;  1GSP A;  3LTA A;  2IMJ A;  1ZO2 A;  2F98 A;  4FCJ A;  5BU4 A;  4RNY A;  3KZT A;  1LVN A;  1MWS A;  3LT8 A;  1A67 A;  3NBJ A;  1O7G B;  1I3I A;  3D9R A;  3MWZ A;  1IQY A;  3ECF A; 
#chains in the Genus database with same CATH homology
 5HGR A;  3IPT A;  1C7H A;  3B7C A;  2CWU A;  1PFP A;  3RDE A;  3OWU A;  4IPB A;  2A15 A;  1GY6 A;  4HZ9 B;  3CC7 3;  2ML6 A;  1TUH A;  2W2C A;  4KZ1 A;  3OV4 A;  3STD A;  3EF8 A;  4O2H A;  1FGM A;  2CWT A;  3FG4 A;  2IA7 A;  4HVN A;  1IDP A;  4RNZ A;  4XBT A;  3TDG A;  3CME 3;  1HU9 A;  4FCM A;  3LTD A;  3Q2P A;  4N6T A;  3G6E 3;  3NV0 A;  1F8N A;  2C10 A;  3EN8 A;  1IVV A;  2XH9 A;  3O8Y A;  2HMM B;  3NXJ A;  3X3Z A;  1LXE A;  4EV5 A;  1OAC A;  2OQE C;  1IU7 A;  4LSO A;  1VQK 3;  1ROV A;  3L0R A;  4EV2 A;  3KKG A;  3SVA A;  3Q1C A;  4MMZ B;  2RCD A;  4XBY A;  3UL6 A;  3PZW A;  3G8Z A;  3B4O A;  3MG2 A;  1QAF A;  3K9M C;  1UI7 A;  2XSO B;  8CHO A;  2ZDJ A;  4HBR A;  2CIU A;  4GB5 A;  3M8C A;  2P05 A;  3K0Z A;  2WO0 A;  5IEO A;  1IVX A;  1AVL A;  1ASK A;  4R4K A;  2BT3 A;  2SBL A;  1K28 A;  3DGM A;  3VF1 A;  1SJW A;  2GEX A;  2HMJ B;  4X2H A;  3H3H A;  5JBS A;  3X3Y A;  3GZY B;  4Q53 A;  3LT9 A;  3N54 B;  1T5Y A;  3V98 A;  1UUW B;  4LZI A;  2BMR B;  2CC3 A;  1YIJ 3;  1D6U A;  1WMN A;  1W5Z A;  2K0M A;  3GZB A;  1OHS A;  3MKI A;  4MJD A;  3CC2 3;  3CCV 3;  1DMN A;  5I97 A;  3EHC A;  4N3V A;  3LZA A;  3F8H A;  3IJE B;  1OH0 A;  1VQ7 3;  2OTL 3;  3AMO B;  1VQ8 3;  1W2Z A;  1JRQ A;  1YVB I;  3FCS B;  1YJN 3;  2CHC A;  3PGB A;  3GZR A;  4K90 B;  1GY7 A;  5A0O B;  2UX0 A;  5CLK A;  3F7X A;  1VZZ A;  1W00 A;  3EC9 A;  5FW5 A;  4IIA A;  1N5H A;  1W4N A;  4H61 A;  5D83 A;  4ORL A;  1PU4 A;  1STF I;  3NBR A;  2QA4 3;  3JUP A;  3CCM 3;  1VQO 3;  2D1W A;  3DY5 A;  3U97 A;  1QAK A;  3OW2 2;  2CFD A;  1GD4 A;  4I4K A;  3CXC 2;  3EBT A;  3JUO A;  1S5A A;  4HKV B;  2GU1 A;  5AYS C;  1ULJ B;  2YFI B;  4HM4 B;  4WYK B;  2FXT A;  2O3O A;  3JUM A;  3Q90 A;  1W02 A;  4N6M A;  2Z76 A;  5DRE A;  3BNE A;  2XRX B;  3ALA A;  3CU3 A;  3LTC A;  5JPP A;  2L4V A;  3VGN A;  4OUQ A;  4EYC A;  1IK3 A;  5LC6 A;  1W7C A;  2CFK A;  1STD A;  1NWW A;  3S27 A;  1VQ9 3;  3HK4 A;  4LEH A;  3G4S 3;  5IG3 A;  1WNH A;  3JVC A;  3K63 A;  2WOF A;  5EVH A;  3MHE A;  1O7H B;  1KC8 4;  3PCR A;  4J8T A;  5IG5 A;  3AMO A;  1J2B A;  3UL5 A;  1JJ2 2;  1TFK A;  1D6Z A;  2BMO B;  2LQV A;  4KVH A;  4FR9 A;  2OCT A;  1VQM 3;  4K1V A;  1CYV A;  2GU3 A;  4HJL B;  5AIG A;  3CCR 3;  5IW9 A;  4G1M B;  3N8B A;  1KWI A;  1IQ8 A;  2Y73 A;  3FH1 A;  3KFQ C;  4MEI A;  5IER A;  4HM7 B;  2HMN B;  3FLJ A;  2CH9 A;  4FMD A;  1ISK A;  2YX9 A;  4FMC A;  3F40 A;  4N6N B;  4O3V A;  2W03 A;  4JF8 A;  1SII A;  4FMB A;  3DUK A;  2D42 A;  3MG1 A;  5CF2 A;  2Z7A A;  4HM5 B;  2QIY A;  5CXO A;  1FA3 A;  1ROA A;  3F8X A;  4WYK A;  1A90 A;  2INX A;  3PCS A;  2E2T A;  1W6Y A;  3QK9 A;  1YGE A;  3BB9 A;  4MMY B;  1W6C A;  2HMO B;  2OWP A;  1DMM A;  1OHP A;  2IUK A;  2WGQ A;  1IT7 A;  2CFL A;  1E3R A;  3NHX A;  3NUV A;  5ELJ A;  1IV7 A;  3PXM A;  3ROB A;  1W2B 2;  2W9P A;  1JB5 A;  4OVM A;  1O7W B;  1EA2 A;  1QAL A;  1NDO B;  2C11 A;  2Q07 A;  3NX0 A;  1QVG 2;  3FG1 A;  3NQZ A;  2Z77 A;  4HM6 B;  2STD A;  1FGT A;  2B24 B;  1UI8 A;  5EQL A;  4AKZ A;  5AEW B;  3FG3 A;  4WP5 A;  3WOD G;  4HYZ A;  3CCJ 3;  1VQL 3;  4QWT A;  5CF1 A;  3CD6 3;  2W6J H;  3UB1 A;  1K73 4;  5AIF A;  1YJW 3;  1AV4 A;  1CEW I;  3F7S A;  1DVD A;  3KSP A;  2FNQ A;  2E2V A;  4N6U A;  1IVU A;  1U8C B;  2E2U A;  3OX9 A;  5IG0 A;  1Q42 A;  2RFR A;  4JRF A;  1AR0 A;  3X41 A;  4MMX B;  3CCS 3;  5IG4 A;  4NHF A;  1DVC A;  2HMK B;  3OWY A;  1A2K A;  1UW1 A;  2CW9 A;  2V1L A;  3T0U A;  3X40 A;  5AI1 A;  1IT8 A;  1TU5 A;  1OGX A;  3LOY A;  4RZM A;  1UUV B;  1SQW A;  5D81 A;  5EEO A;  3KN4 A;  2KXG A;  3PYJ A;  2WOH A;  2LYX A;  1M1K 4;  4BTW A;  1WMO A;  3EQQ B;  5DRV A;  2QGU A;  1U5O A;  4AKY A;  3I55 3;  2W9Q A;  1N8R 4;  3RGR A;  3SOA A;  3JUN A;  4TX4 A;  4HM8 B;  5G2G A;  1L5G B;  1QVF 2;  1YJ9 3;  3NQY A;  3F14 A;  4XB5 A;  3NM7 A;  4FCZ A;  3B4P A;  3DMC A;  1O7N B;  2CFW A;  1VQP 3;  2MF7 A;  6STD A;  3J7Y d;  3CNX A;  3EJV A;  1Q86 4;  1EKM A;  5AIH A;  2JDI H;  4IT7 A;  1JN5 B;  4AEQ A;  1G96 A;  1NJI 4;  4HZB B;  1ZX2 A;  2GBX B;  4XDV A;  3G16 A;  4HM3 B;  3WA2 X;  2P09 A;  2ML5 A;  7STD A;  2ZL8 A;  3CC4 3;  3FF0 A;  5IEP A;  3CMA 3;  3MPH A;  3CCU 3;  4N6O B;  4KFD A;  1US1 A;  1JB4 A;  4PEJ A;  1EG9 B;  3V99 A;  2YFJ B;  5KP3 A;  1SIH A;  2OOV A;  5AYR B;  1GY5 A;  3K7C A;  2K54 A;  4STD A;  1FGR A;  1N9E A;  3EN1 B;  3LYG A;  1JV2 B;  4O8S A;  2RSX A;  3S5C A;  1CYU A;  3HIG A;  2W56 B;  3QRD A;  1Q40 B;  4WFO A;  1BUQ A;  3UNL A;  3I0Y A;  1NO3 A;  2F86 B;  4K61 A;  5AII A;  4WHA A;  1OHO A;  3GRD A;  4LGQ A;  2XFT A;  1MOL A;  2CG1 A;  1RRH A;  2CG0 A;  2BHM A;  4GL6 A;  1M1X B;  1VQ4 3;  3FSD A;  4L7K A;  3NM2 A;  3MG3 A;  4O02 B;  2XR8 B;  2RGQ A;  3LH4 A;  3G71 3;  2B1X B;  3KII A;  4KFE A;  1Z1S A;  2XGL A;  2W04 A;  1E3V A;  1V74 A;  3X42 A;  5STD A;  5AEU B;  4H3U A;  3CCE 3;  1VQN 3;  1RN7 A;  5D82 A;  1N9J A;  1FGO A;  3KSE D;  1IQX A;  1K9M 4;  4XBX A;  2WGO A;  3N9H A;  4OK0 A;  3V92 A;  3G0K A;  3HX8 A;  1WTH A;  3OWS A;  1SPU A;  4EXR A;  3JUQ A;  3B8L A;  2CKF B;  3CNM A;  4J9A A;  1KQS 2;  1IVW A;  1JN5 A;  4HM0 B;  4N6L A;  2OTJ 3;  2XGN A;  1JNQ A;  1CQS A;  1LNH A;  1O7P B;  3BNC A;  3LTB A;  3FKA A;  2Z6B A;  2BMQ B;  1TP6 A;  4HM1 B;  3DM8 A;  1WQL B;  2HML B;  5IEN A;  2BO9 B;  3D3L A;  3GAX A;  3A76 A;  2OQE A;  2GBW B;  3F9S A;  3CPO A;  1EQK A;  3MYT A;  1W6G A;  2P0M A;  1YIT 3;  4R1K A;  2W56 A;  1Q40 A;  1Q82 4;  3EX9 A;  2O9U X;  2IUJ A;  1M9G A;  1D6Y A;  4FMA A;  5KP4 A;  5TGN A;  2YFL B;  1A2V A;  1MNL A;  3WA3 A;  2P38 A;  1OF5 B;  3UJM A;  3SOY A;  1K41 A;  3DGO A;  1RRL A;  1NB5 I;  2XF3 A;  4L8O A;  1QJG A;  1S72 3;  3VSY A;  2KRT A;  1JKG B;  2R4I A;  5KP1 A;  3S29 A;  4L8P A;  3S67 A;  3FF2 A;  2FGT A;  1E97 A;  4R9L A;  5FGO A;  1K8A 4;  5JPU A;  3DZL A;  3CPW 2;  3BNB A;  1HKX A;  1O7M B;  3U1W A;  3CCL 3;  1GD3 A;  1OCV A;  2XSH B;  3LML A;  4HM2 B;  3EB8 A;  1N8Q A;  4CCV A;  2P0X A;  3SED A;  1OPY A;  4R80 A;  1NU3 A;  4BTX A;  1RKY A;  1Y4K A;  1M90 4;  2PZV A;  1OUN A;  4X2O A;  3BND A;  3S28 A;  5CK6 A;  5BVB A;  1DYU A;  2MC8 A;  3LXU X;  3SLU A;  4CDL A;  3BLZ A;  4LMI A;  2M7O A;  3K5T A;  4BTY A;  3RGA A;  2GEY A;  4K1U A;  5IF6 A;  3HI7 A;  2CK3 H;  3WDG B;  3WOF B;  2W0Q A;  4U13 A;  1KD1 4;  3FZW A;  5ELU A;  3HII A;  1Q81 4;  1IV9 A;  1NB3 I;  1N5P A;  1FGQ A;  4ZM8 A;  1TFO A;  1TIJ A;  3DGN A;  2BNG A;  3GZX B;  3KE7 A;  4KFF A;  1YHQ 3;  3ER7 A;  2I9W A;  4R9K A;  4EC6 A;  1KSI A;  3NBB A;  3EE1 A;  3HZP A;  1AVK A;  1ULI B;  1OF5 A;  2GXF A;  3FGY A;  3WMD A;  1OGZ A;  3X3X A;  3I56 3;  1VQ5 3;  1FUW A;  3T8U A;  3NV0 B;  1VQ6 3;  2QEX 3;  1LOX A;  4EBG A;  3GWR A;  3OXA A;  1DMQ A;  4RBN A;  1GYB A;  5BXQ A;  3CCQ 3;  2Y74 A;  1JKG A;  3T8N A;  4N6V 0;  2OOV C;  1YI2 3;  5LC7 A;  3DXO A;  3H51 A;  1R4C A;  2XEP A;  1JB2 A;  1GS3 A;  1QMA A;  3IMA B;  1W01 A;  3WOE B;  3SX1 A;  4WWU C;  2KCD A;  3SXX A;  4XM4 A;  3E99 A;  3EBY A;  4NRE A;  3PS8 A;  1RJO A;  2JQ5 A;  3DGL A;  4XDW A;  1WMP A;  2F99 A;  3MSO A;  2CFG A;  2CWV A;  2PNC A;  2XFS A;  3LTA A;  2IMJ A;  1ZO2 A;  2F98 A;  4FCJ A;  4RNY A;  3KZT A;  1LVN A;  3LT8 A;  1A67 A;  3NBJ A;  1O7G B;  3D9R A;  3MWZ A;  1Q7Y 4;  1IQY A;  3ECF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...