1NB5I

Crystal structure of stefin a in complex with cathepsin h
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin H
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 98
sequence length 98
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nb5I00
3PXMA 2OCTA 3Q2PA 1ROAA 4EYCA 5EQLA 1G96A 3GAXA 1IV9A 1CYUA 3UL5A 4CCVA 2W9QA 1KWIA 3PYJA 2CH9A 1NB5I 1NB3I 3QRDA 3KFQC 1N5HA 4TX4A 5LC6A 5ELJA 1N9JA 1GD3A 3PS8A 4N6NB 5A0OB 1FA3A 1CYVA 1FUWA 1EQKA 1M9GA 1RN7A 3MWZA 1A67A 1LXEA 2O9UX 3L0RA 1WNHA 2W9PA 1R4CA 1N5PA 5LC7A 1A90A 2KXGA 4LZIA 4IT7A 1CEWI 4N6LA 1YVBI 4N6TA 2BO9B 1GD4A 1TIJA 1MOLA 3KSED 4N6MA 1PFPA 1MNLA 1DVDA 4N6V0 3UL6A 1STFI 4ZM8A 3IMAB 3NX0A 5ELUA 4N6OB 3K9MC 3LH4A 3SVAA 1IV7A 1DVCA 4N6UA 3S67A
chains in the Genus database with same CATH superfamily
4J8TA 1O7PB 2F86B 3SOYA 4BL2A 1IYYA 4X2OA 2CHCA 1K28A 3Q2PA 3OX9A 1W2ZA 1B2XA 2OOVA 1GS3A 4CDLA 4ORLA 3FLJA 3X3ZA 1IQ8A 3EBTA 1W7CA 2RCDA 1RHLA 4FMAA 1T5YA 3DXOA 4J5GA 2RFRA 2O3OA 3GAXA 1B2UA 5BU4A 1IV9A 5DRVA 3Q3FA 4HM6B 1WMPA 1CYUA 2UX0A 2FGTA 3KSPA 3UL5A 3E99A 3OWYA 4XM4A 2C10A 3F9SA 2L1SA 2BMOB 3JUNA 1TU5A 2RNTA 2Z76A 3X42A 3ZFZA 2HMJB 4H61A 4R1KA 2F98A 4L7KA 3WHOA 1TUHA 4R9KA 2CG1A 3NM2A 1IQXA 2P0MA 3N54B 1L5GB 3X3XA 1NB3I 3RGAA 3QRDA 2XGNA 4L8PA 4RNTA 4FMBA 1BNIA 4R80A 3MHEA 5I97A 2BHMA 1OCVA 1N9JA 1D6ZA 3PS8A 1JN5A 2XR8B 1BUQA 2IUKA 1OHOA 1W2B2 1DETA 1OF5A 2HMLB 4GSPA 4OK0A 1CYVA 4LMIA 3BNCA 5STDA 1V57A 1RN1A 1EKMA 2OWPA 1YJW3 1JBSA 4KFDA 4BTYA 4MMXB 2W03A 4Q53A 2OTJ3 3NUVA 1IQYA 3MWZA 1IVWA 2GU1A 1LXEA 1QAKA 1MWSA 1SPUA 3MSOA 3L0RA 3LXUX 7RNTA 1WNHA 3LTBA 3X41A 1RDSA 1R4CA 1KSIA 5IEOA 4WYKB 1BGSA 3A76A 5AEWB 2KXGA 2RBIA 3EHCA 1RNTA 3N8BA 3CCU3 1RCKA 3GRDA 2RSXA 2FNQA 2K54A 4MEIA 3J7Yd 1RGFA 1QALA 3AMOA 2BIRA 3LOYA 2WOFA 5JPUA 1W01A 1CEWI 3BNBA 1NU3A 3LT8A 1O7MB 1O7WB 1GSPA 3IPTA 2GSPA 3G8ZA 3CCQ3 1UW1A 4N6TA 3SLUA 3U97A 3NQYA 1TIJA 1MOLA 4XBYA 1JKGB 3I563 4HM1B 3KSED 2W04A 3F7XA 1RGEA 1TFKA 1PFPA 1TP6A 4JRFA 1DE3A 1VQ53 1EUIC 1OPYA 3HIIA 1I0XA 2BMQB 2L4VA 1KC84 1AQZA 1IT7A 1YI23 3B4OA 3IMAB 4XBXA 3D5IA 3MG1A 1W00A 2YX9A 1FW7A 4EXRA 1RGLA 3DZLA 1OGZA 4K61A 1LOWA 2GBWB 1VZZA 4WHAA 4I5QA 1ULJB 2W2CA 3N9HA 1STDA 2E2VA 4KT3B 3SXXA 5BVBA 3K9MC 3LH4A 1BIRA 1UDII 1FZUA 3FG4A 2B1XB 1SJWA 3LT9A 4RZMA 1QVF2 3HZPA 3EC9A 3KN4A 4N6UA 3CPW2 2AAEA 2KF3A 2IA7A 5D81A 1FGQA 1BNEA 1BSDA 1SARA 1GYBA 1V74A 1HZ1A 2BMRB 1TTOA 3NV0B 4KZ1A 1UCLA 3PXMA 5G2GA 5M1AA 2OQEA 5M18A 2W6JH 1SQWA 5AYRB 3AGNA 3FKAA 1VQ83 3G0KA 1B21A 1TRPA 3BIRA 1BRNL 3DH2A 1BRJA 1DMQA 2YFJB 4K1VA 4RNZA 1ASKA 5CLKA 1I2FA 2ML6A 4J9AA 3D4AA 1Q7Y4 3LTCA 2STDA 1ROVA 3FG1A 4MMYB 4CCVA 2XSHB 4FMCA 1AVKA 3T8UA 2IUJA 1JBRA 1BRGA 1GY7A 2C4BA 1Q9EA 1GY5A 2XFSA 3VF1A 3AHWA 1C54A 2XH9A 1W6CA 1Q864 1FGMA 1PU4A 1RGAA 3S28A 1GMPA 2F5WA 4BIRA 1NB5I 3G16A 1QMAA 9RNTA 4BL3A 2CK3H 1UUWB 4RNYA 3HX8A 1BNRA 2CFDA 3IJEB 3KFQC 3NQZA 4GHOA 3ER7A 1N5HA 3DGNA 1MWUA 5ELJA 1Q40B 2WO0A 2XFTA 4FCJA 1JB4A 2K3DA 2CW9A 4AKYA 4N6NB 3JUPA 3OXAA 1WTHA 1Y4KA 4HM2B 4LYLB 1A2PA 3MG3A 2P05A 3V92A 5IG4A 5BIRA 3KCHA 4G1MB 3ZG5A 1YNVX 3DGMA 3OWUA 4XBTA 4PEJA 1HKXA 2KF5A 4OVMA 1A2KA 1RTUA 3LTAA 1I2EA 1FGOA 2W9PA 3CC23 1V58A 1GMQA 2CFWA 4O2HA 4HYZA 3GWRA 2JDIH 1NDOB 1I8VA 4HAAA 4WP5A 5LC7A 3HI7A 3KE7A 4BTXA 1X1XA 2BU4A 4HKVB 4R9LA 1W6YA 1F8NA 4LZIA 2ZL8A 3LYGA 3CD63 5IF6A 1M904 3QK9A 1I0VA 7GSPA 3PCRA 1QVG2 1HU9A 1UI7A 5JBSA 2ZDJA 4XDWA 3JUOA 3DGYA 3WA3A 1VQQA 3CU3A 1RN4A 2SARA 2RGQA 3KIIA 4HVNA 3WDGB 1CH0A 1TFOA 1VQK3 2BNGA 1RCLA 3MYTA 1E3RA 1E3VA 3GZYB 3S27A 3F8HA 3DM8A 3SX1A 3DGOA 3PCSA 1DVDA 3FSDA 1IVUA 1OUNA 1STFI 4N6V0 1ISKA 2GEXA 2LYXA 4ZM8A 1JRQA 1HYFA 1OF5B 1UCKA 2LQVA 2WOHA 1BNGA 1BVIA 2OOVC 4H3UA 1OGXA 5CXOA 4CJNA 1M1K4 3EBYA 3NX0A 1T3BA 1JB5A 3SYUA 4AKZA 5ELUA 1RGGA 3JVCA 4K90B 2CKFB 3F8XA 4WYKA 4HZ9B 5AIGA 2YFIB 2Z6BA 5EVHA 1B3SA 3UNLA 2HMNB 3LZAA 2J8XB 1GY6A 2MF7A 2CFLA 1DMNA 1NO3A 1QJGA 2PZVA 5BXQA 4HBRA 1DVCA 4U13A 5IG3A 1VQP3 1VQ63 1IU7A 1B27A 3S67A 2FXTA 2CFKA 1QAFA 2CX0A 2ML5A 2SBLA 4IPBA 4DKIA 2Z7AA 3EN1B 5KP4A 1G02A 1K41A 3CXC2 1FGRA 1IK3A 2F5MA 1ULIB 6GSPA 1LQMB 1AY7A 1JKGA 1LOVA 3H51A 3S29A 3VSYA 1UCJA 1RGCA 3ECFA 4EYCA 3GZRA 1MWTA 2W0QA 3B4PA 1BOXA 1IDPA 5EQLA 3UB1A 1BNJA 1BNFA 1SIIA 4N3VA 1RKYA 3I553 3M8CA 1LVNA 1BRHA 1FUSA 1GOYA 3EN8A 1UCIA 4FMDA 1EA2A 1AR0A 1K9M4 3CMA3 5RNTA 1T2HA 1WMOA 2MC8A 2INXA 1VQO3 3B7CA 1BANA 4NHFA 3VGNA 3PYJA 1DMMA 1YVSA 2CH9A 2CFGA 4XB5A 3HOHA 2P0XA 3K5TA 4GL6A 1UUVB 3BNEA 1X1WA 3S5CA 1B2MA 1YGWA 1O7GB 2UGIA 1VQN3 4BU4A 3PGBA 4MMZB 1VQ73 4TX4A 1KQS2 1C7HA 2HMOB 1BRIA 3NBBA 5FGOA 1ZS7A 2HMMB 1LRAA 6RNTA 3NV0A 1GD3A 2BT3A 3GZBA 1RRLA 4LEHA 3SEDA 1AV4A 3WMDA 1W4NA 5A0OB 3I0YA 4HM7B 1ZGXA 2KCDA 1JV2B 2XF3A 2ZHXB 3CCJ3 3LTDA 1M9GA 2XGLA 1EQKA 1O7NB 1U8CB 3CCR3 3UJMA 3DUKA 3URPA 2R41A 4HZBB 1A67A 1RLSA 1MGRA 2O9UX 4HM0B 3FF0A 3MPHA 3FGYA 1IT8A 1VQ43 3WR2A 5CK6A 4X2HA 5AI1A 1PYLA 3K7CA 2QGUA 1BRSA 1JB2A 1NJI4 2W56A 4KFFA 5G1LA 1X1YA 4FR9A 2V1LA 4QWTA 4BTWA 1WMNA 2C11A 3EX9A 1WQLB 4O3VA 1O7HB 1OHSA 4IT7A 4J5KA 1GOVA 4EBGA 3RNTA 1UGIA 4N6LA 1BSEA 2H0IA 3CC43 1IVXA 1N9EA 2D1WA 1BSCA 3H3HA 4ILFA 2BO9B 1GD4A 4HM3B 1LQGC 3D5GA 2KAAA 5CF2A 3F40A 1MGWA 1CQSA 1VQL3 2KRTA 3BNDA 4N6MA 4STDA 3CCV3 3AHSA 1MNLA 2F99A 3WODG 3SOAA 5IG5A 2R4IA 2K0MA 3FH1A 5FW5A 3UL6A 1B2SA 2PNCA 2IMJA 2OQEC 1EEJA 1UI8A 4I4KA 3GSPA 2P38A 3A5EA 7STDA 1E97A 2WGOA 3WA2X 1M1XB 1ZX2A 1BSBA 5AYSC 2KF6A 4FCZA 3PZWA 3WOFB 2ZA4A 1BNSA 3ROBA 5IEPA 1Q7HA 4EV5A 4N6OB 1JBTA 2CX1A 4HM5B 3T0UA 5D82A 5KP1A 2XEPA 1AVLA 1RJOA 2M7OA 1S5AA 3CCL3 3SVAA 5JPPA 1IV7A 4OUQA 5CF1A 3MKIA 3V99A 2F4YA 3CC73 2GBXB 4R4KA 4WFOA 1YIJ3 1YGEA 1U5OA 3K63A 2OCTA 1GOUA 1JN5B 3BLZA 3EB8A 1Q824 4NREA 3NXJA 1OHPA 1RMSA 1ROAA 1BU4A 1LNHA 2KF4A 2Q07A 5AIFA 3X40A 3ZG0A 3NBJA 1RSNA 3OW22 5KP3A 1I3FA 1G96A 2H0HA 3CCE3 3DMCA 1W02A 1YJN3 1JJ22 3OV4A 1OACA 3EQQB 2OTL3 3X3YA 1JNQA 1SIHA 1R4YA 2Y73A 3DY5A 3DGLA 3GZXB 3G4S3 3CME3 1NNVA 2P09A 3F7SA 1W6GA 1KWIA 1LNIA 3CCM3 1B2ZA 1D6YA 2WGQA 4LGQA 5IENA 3OWSA 3NM7A 3RGRA 1PY3A 1IVVA 1LOYA 1Z1SA 2CC3A 4KVHA 4EC6A 5IW9A 4K1UA 3CPOA 5AEUB 1FGTA 5HOHA 3AMOB 1US1A 3KZTA 1BRKA 5AIHA 3FF2A 2AADA 2E2UA 1RGKA 3NHXA 5LC6A 2CWTA 4MJDA 3FG3A 6STDA 4O02B 4L8OA 2B24B 2GEYA 1GMRA 1D6UA 4HJLB 1I3IA 1N8QA 3B8LA 3EF8A 4JF8A 1FA3A 4WWUC 1K734 1FUWA 4XDVA 3U1WA 3Q1CA 1FUTA 1RN7A 3G6E3 3G713 1MWRA 1VQ93 1K8A4 1G0TA 4FCMA 1N8R4 2Z77A 3LMLA 5G1KA 1FYSA 1S723 2CIUA 3EJVA 1I70A 2CWUA 4EV2A 3O8YA 5AIIA 4LSOA 1I2GA 3TDGA 3JUMA 2JQ5A 1N5PA 2H0GA 3D79A 3FCSB 1A90A 1BUJA 4IIAA 3F14A 2XRXB 2A15A 2HOHA 3V98A 1DYUA 2GXFA 2IY2A 1YJ93 1UUGB 2I9WA 2CWVA 4O8SA 2QEX3 1YVBI 3ALAA 2XSOB 3RDEA 5M19A 3KKGA 5TGNA 1YIT3 1Q42A 1KD14 1RNBA 1NWWA 3BB9A 1A2VA 4KFEA 5GSPA 3CNXA 3CNMA 4AEQA 5D83A 3Q90A 1T2IA 5EEOA 5IERA 8RNTA 2YFLB 3T8NA 1Q814 1B20A 1YHQ3 3NBRA 2QA43 1VQM3 1BAOA 4HOHA 2CG0A 2HMKB 3HK4A 1BSAA 3MG2A 1OH0A 1UGHI 1TRQA 4GB5A 5IG0A 3EE1A 2Y74A 3K0ZA 5DREA 2GU3A 4NPBA 1LOXA 4HM8B 3STDA 4EW5A 1W5ZA 5HGRA 8CHOA 2D42A 2F56A 3BU4A 2E2TA 3WOEB 4CPKA 4RBNA 1Q40A 3JUQA 3FZWA 3D3LA 3CCS3 1X1UA 1TJDA 1JZOA 2W56B 1RGHA 2QIYA 2UUGC 1EG9B 3AGOA 1ZO2A 2W9QA 2IYJA 3D9RA 1JZDA 3HIGA 1RRHA 1J2BA 4HM4B
chains in the Genus database with same CATH topology
4J8TA 1O7PB 2F86B 3SOYA 4X2OA 2CHCA 1K28A 3Q2PA 3OX9A 1W2ZA 2OOVA 1GS3A 4CDLA 4ORLA 3FLJA 3X3ZA 1IQ8A 3EBTA 1W7CA 2RCDA 4FMAA 1T5YA 3DXOA 2RFRA 2O3OA 3GAXA 1IV9A 5DRVA 4HM6B 1WMPA 1CYUA 2UX0A 2FGTA 3KSPA 3UL5A 3E99A 3OWYA 4XM4A 2C10A 3F9SA 3JUNA 2BMOB 1TU5A 2Z76A 3X42A 2HMJB 4H61A 4R1KA 2F98A 4L7KA 1TUHA 4R9KA 2CG1A 3NM2A 1IQXA 2P0MA 3N54B 1L5GB 3X3XA 1NB3I 3RGAA 3QRDA 2XGNA 4L8PA 4FMBA 4R80A 3MHEA 2BHMA 1OCVA 1N9JA 1D6ZA 3PS8A 1JN5A 2XR8B 1BUQA 2IUKA 1OHOA 1W2B2 4OK0A 1OF5A 2HMLB 1CYVA 4LMIA 3BNCA 5STDA 1YJW3 2OWPA 1EKMA 2OTJ3 4KFDA 4BTYA 4MMXB 2W03A 4Q53A 3NUVA 1IQYA 3MWZA 1IVWA 2GU1A 1LXEA 1QAKA 1SPUA 3MSOA 3L0RA 3LXUX 1WNHA 3LTBA 3X41A 1R4CA 1KSIA 5IEOA 4WYKB 3A76A 5AEWB 2KXGA 3EHCA 3N8BA 3CCU3 3GRDA 2RSXA 2FNQA 2K54A 4MEIA 3J7Yd 5JPUA 1QALA 3AMOA 3LOYA 1VQ73 2WOFA 1W01A 1CEWI 3BNBA 1NU3A 3LT8A 1O7MB 1O7WB 3IPTA 3CCQ3 3G8ZA 1UW1A 4N6TA 3SLUA 3U97A 3NQYA 1TIJA 1MOLA 4XBYA 1JKGB 3I563 4HM1B 3KSED 2W04A 3F7XA 1TFKA 1PFPA 1TP6A 4JRFA 1VQ53 1OPYA 3HIIA 2L4VA 2BMQB 1KC84 1IT7A 1YI23 3B4OA 3IMAB 4XBXA 3MG1A 1W00A 2YX9A 4EXRA 3DZLA 1OGZA 4K61A 2GBWB 1VZZA 4WHAA 1ULJB 2W2CA 3N9HA 1STDA 2E2VA 5BVBA 3SXXA 3K9MC 3LH4A 3FG4A 2B1XB 1SJWA 3LT9A 4RZMA 1QVF2 3HZPA 3EC9A 3KN4A 4N6UA 3CPW2 2IA7A 5D81A 1FGQA 1GYBA 1V74A 2BMRB 5G2GA 3NV0B 4KZ1A 3PXMA 2OQEA 2W6JH 1SQWA 5AYRB 1VQ83 3FKAA 3G0KA 4RNZA 1DMQA 2YFJB 4K1VA 5CLKA 1ASKA 2ML6A 4J9AA 1Q7Y4 3LTCA 2STDA 1ROVA 3FG1A 4MMYB 4CCVA 2XSHB 4FMCA 1AVKA 3T8UA 2IUJA 1GY7A 1GY5A 2XFSA 3VF1A 2XH9A 1W6CA 1Q864 1FGMA 1PU4A 3S28A 1NB5I 3G16A 1QMAA 2CK3H 1UUWB 4RNYA 3HX8A 2CFDA 3IJEB 3KFQC 3NQZA 3ER7A 1N5HA 3DGNA 5ELJA 1Q40B 2WO0A 2XFTA 4FCJA 1JB4A 2CW9A 4AKYA 4N6NB 3JUPA 3OXAA 1WTHA 1Y4KA 4HM2B 3MG3A 2P05A 3V92A 5IG4A 4G1MB 3DGMA 3OWUA 4XBTA 4PEJA 1HKXA 4OVMA 1A2KA 3LTAA 1FGOA 2W9PA 3CC23 2CFWA 4O2HA 4HYZA 3GWRA 2JDIH 1NDOB 4WP5A 5LC7A 3HI7A 3KE7A 4BTXA 4HKVB 4R9LA 1W6YA 1F8NA 4LZIA 2ZL8A 3LYGA 3CD63 5IF6A 1M904 3QK9A 3PCRA 1QVG2 1HU9A 1UI7A 5JBSA 2ZDJA 4XDWA 3JUOA 3WA3A 4HVNA 3CU3A 3WDGB 3KIIA 2RGQA 1TFOA 1VQK3 2BNGA 3MYTA 1E3RA 1E3VA 3GZYB 3S27A 3F8HA 3DM8A 3SX1A 3DGOA 3PCSA 1DVDA 3FSDA 1IVUA 1OUNA 1STFI 4N6V0 1ISKA 2GEXA 2LYXA 4ZM8A 1JRQA 1OF5B 2LQVA 2WOHA 2OOVC 4H3UA 1OGXA 5CXOA 1M1K4 3EBYA 3NX0A 1JB5A 4AKZA 5ELUA 3JVCA 4K90B 2CKFB 3F8XA 4WYKA 4HZ9B 5AIGA 2YFIB 2Z6BA 5EVHA 3UNLA 2HMNB 3LZAA 1GY6A 2MF7A 2CFLA 1DMNA 1NO3A 1QJGA 2PZVA 5BXQA 4HBRA 1DVCA 4U13A 5IG3A 1VQP3 1VQ63 1IU7A 3S67A 2FXTA 2CFKA 2SBLA 1QAFA 2ML5A 4IPBA 2Z7AA 3EN1B 5KP4A 1K41A 3CXC2 1FGRA 1IK3A 1ULIB 1JKGA 3H51A 3S29A 3VSYA 3ECFA 4EYCA 3GZRA 3B4PA 2W0QA 1IDPA 5EQLA 3UB1A 1SIIA 4N3VA 1RKYA 3I553 3M8CA 1LVNA 3EN8A 4FMDA 1EA2A 1AR0A 1K9M4 3CMA3 1WMOA 2MC8A 2INXA 1VQO3 3B7CA 4NHFA 3VGNA 3PYJA 1DMMA 2CH9A 4XB5A 2CFGA 2P0XA 3K5TA 4GL6A 1UUVB 3BNEA 3S5CA 1O7GB 1VQN3 3PGBA 4MMZB 1KQS2 4TX4A 1C7HA 2HMOB 5FGOA 3NBBA 2HMMB 3NV0A 1GD3A 2BT3A 3GZBA 1RRLA 4LEHA 3SEDA 1AV4A 3WMDA 1W4NA 5A0OB 3I0YA 4HM7B 2KCDA 1JV2B 2XF3A 3CCJ3 3LTDA 1M9GA 2XGLA 1EQKA 1O7NB 1U8CB 3CCR3 3UJMA 3DUKA 1A67A 4HZBB 4HM0B 2O9UX 3FF0A 3MPHA 3FGYA 1IT8A 1VQ43 5CK6A 4X2HA 5AI1A 3K7CA 2QGUA 1JB2A 1NJI4 2W56A 4KFFA 4FR9A 2V1LA 4QWTA 4BTWA 1WMNA 2C11A 3EX9A 1WQLB 4O3VA 1O7HB 1OHSA 4IT7A 4EBGA 4N6LA 3CC43 1IVXA 1N9EA 2D1WA 3H3HA 2BO9B 1GD4A 4HM3B 5CF2A 3F40A 1CQSA 1VQL3 2KRTA 3BNDA 4N6MA 4STDA 3CCV3 1MNLA 2F99A 3WODG 3SOAA 5IG5A 2R4IA 2K0MA 3FH1A 5FW5A 3UL6A 2PNCA 2IMJA 2OQEC 1UI8A 4I4KA 2P38A 7STDA 1E97A 2WGOA 3WA2X 1M1XB 1ZX2A 5AYSC 4FCZA 3PZWA 3WOFB 3ROBA 5IEPA 4EV5A 4N6OB 4HM5B 3T0UA 5D82A 5KP1A 2XEPA 1AVLA 1RJOA 2M7OA 1S5AA 3CCL3 3SVAA 5JPPA 1IV7A 4OUQA 5CF1A 3MKIA 3V99A 3CC73 2GBXB 4R4KA 4WFOA 1YIJ3 1YGEA 1U5OA 3K63A 2OCTA 1JN5B 3BLZA 3EB8A 1Q824 4NREA 3NXJA 1OHPA 1ROAA 1LNHA 2Q07A 5AIFA 3X40A 3OW22 3NBJA 5KP3A 1G96A 3CCE3 3DMCA 1W02A 1YJN3 1JJ22 3OV4A 1OACA 3EQQB 2OTL3 3X3YA 1JNQA 1SIHA 2Y73A 3GZXB 3DY5A 3DGLA 3G4S3 3CME3 2P09A 3F7SA 1W6GA 1KWIA 3CCM3 1D6YA 2WGQA 4LGQA 5IENA 3OWSA 3NM7A 3RGRA 1IVVA 1Z1SA 2CC3A 4KVHA 4EC6A 5IW9A 4K1UA 3CPOA 5AEUB 1FGTA 3AMOB 1US1A 3KZTA 5AIHA 3FF2A 2E2UA 3NHXA 5LC6A 2CWTA 4MJDA 3FG3A 6STDA 4O02B 4L8OA 2B24B 2GEYA 1D6UA 4HJLB 3EF8A 1N8QA 3B8LA 4JF8A 1FA3A 4WWUC 1K734 1FUWA 4XDVA 3U1WA 3Q1CA 1RN7A 3G6E3 3G713 1VQ93 1K8A4 4FCMA 1N8R4 2Z77A 3LMLA 1S723 2CIUA 3EJVA 2CWUA 4EV2A 3O8YA 5AIIA 4LSOA 3TDGA 3JUMA 2JQ5A 1N5PA 3FCSB 1A90A 4IIAA 3F14A 2XRXB 2A15A 3V98A 1DYUA 2GXFA 1YJ93 2I9WA 2CWVA 4O8SA 2QEX3 1YVBI 3ALAA 2XSOB 3RDEA 1YIT3 3KKGA 5TGNA 1Q42A 1KD14 1NWWA 3BB9A 1A2VA 4KFEA 3CNXA 3CNMA 4AEQA 5D83A 3Q90A 5IERA 5EEOA 2YFLB 3T8NA 1Q814 1YHQ3 3NBRA 2QA43 1VQM3 2CG0A 2HMKB 3HK4A 3MG2A 1OH0A 4GB5A 5IG0A 3EE1A 2Y74A 3K0ZA 5DREA 2GU3A 1LOXA 4HM8B 3STDA 1W5ZA 5HGRA 8CHOA 2D42A 3WOEB 2E2TA 4RBNA 1Q40A 3JUQA 3FZWA 3D3LA 3CCS3 5I97A 2W56B 3D9RA 2QIYA 3HIGA 1EG9B 1ZO2A 2W9QA 1RRHA 1J2BA 4HM4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXM A;  2OCT A;  3Q2P A;  1ROA A;  4EYC A;  5EQL A;  1G96 A;  3GAX A;  1IV9 A;  1CYU A;  3UL5 A;  4CCV A;  2W9Q A;  1KWI A;  3PYJ A;  2CH9 A;  1NB5 I;  1NB3 I;  3QRD A;  3KFQ C;  1N5H A;  4TX4 A;  5LC6 A;  5ELJ A;  1N9J A;  1GD3 A;  3PS8 A;  4N6N B;  5A0O B;  1FA3 A;  1CYV A;  1FUW A;  1EQK A;  1M9G A;  1RN7 A;  3MWZ A;  1A67 A;  1LXE A;  2O9U X;  3L0R A;  1WNH A;  2W9P A;  1R4C A;  1N5P A;  5LC7 A;  1A90 A;  2KXG A;  4LZI A;  4IT7 A;  1CEW I;  4N6L A;  1YVB I;  4N6T A;  2BO9 B;  1GD4 A;  1TIJ A;  1MOL A;  3KSE D;  4N6M A;  1PFP A;  1MNL A;  1DVD A;  4N6V 0;  3UL6 A;  1STF I;  4ZM8 A;  3IMA B;  3NX0 A;  5ELU A;  4N6O B;  3K9M C;  3LH4 A;  3SVA A;  1IV7 A;  1DVC A;  4N6U A;  3S67 A; 
#chains in the Genus database with same CATH topology
 4J8T A;  1O7P B;  2F86 B;  3SOY A;  4BL2 A;  1IYY A;  4X2O A;  2CHC A;  1K28 A;  3Q2P A;  3OX9 A;  1W2Z A;  1B2X A;  2OOV A;  1GS3 A;  4CDL A;  4ORL A;  3FLJ A;  3X3Z A;  1IQ8 A;  3EBT A;  1W7C A;  2RCD A;  1RHL A;  4FMA A;  1T5Y A;  3DXO A;  4J5G A;  2RFR A;  2O3O A;  3GAX A;  1B2U A;  5BU4 A;  1IV9 A;  5DRV A;  3Q3F A;  4HM6 B;  1WMP A;  1CYU A;  2UX0 A;  2FGT A;  3KSP A;  3UL5 A;  3E99 A;  3OWY A;  4XM4 A;  2C10 A;  3F9S A;  2L1S A;  2BMO B;  3JUN A;  1TU5 A;  2RNT A;  2Z76 A;  3X42 A;  3ZFZ A;  2HMJ B;  4H61 A;  4R1K A;  2F98 A;  4L7K A;  3WHO A;  1TUH A;  4R9K A;  2CG1 A;  3NM2 A;  1IQX A;  2P0M A;  3N54 B;  1L5G B;  3X3X A;  1NB3 I;  3RGA A;  3QRD A;  2XGN A;  4L8P A;  4RNT A;  4FMB A;  1BNI A;  4R80 A;  3MHE A;  5I97 A;  2BHM A;  1OCV A;  1N9J A;  1D6Z A;  3PS8 A;  1JN5 A;  2XR8 B;  1BUQ A;  2IUK A;  1OHO A;  1W2B 2;  1DET A;  1OF5 A;  2HML B;  4GSP A;  4OK0 A;  1CYV A;  4LMI A;  3BNC A;  5STD A;  1V57 A;  1RN1 A;  1EKM A;  2OWP A;  1YJW 3;  1JBS A;  4KFD A;  4BTY A;  4MMX B;  2W03 A;  4Q53 A;  2OTJ 3;  3NUV A;  1IQY A;  3MWZ A;  1IVW A;  2GU1 A;  1LXE A;  1QAK A;  1MWS A;  1SPU A;  3MSO A;  3L0R A;  3LXU X;  7RNT A;  1WNH A;  3LTB A;  3X41 A;  1RDS A;  1R4C A;  1KSI A;  5IEO A;  4WYK B;  1BGS A;  3A76 A;  5AEW B;  2KXG A;  2RBI A;  3EHC A;  1RNT A;  3N8B A;  3CCU 3;  1RCK A;  3GRD A;  2RSX A;  2FNQ A;  2K54 A;  4MEI A;  3J7Y d;  1RGF A;  1QAL A;  3AMO A;  2BIR A;  3LOY A;  2WOF A;  5JPU A;  1W01 A;  1CEW I;  3BNB A;  1NU3 A;  3LT8 A;  1O7M B;  1O7W B;  1GSP A;  3IPT A;  2GSP A;  3G8Z A;  3CCQ 3;  1UW1 A;  4N6T A;  3SLU A;  3U97 A;  3NQY A;  1TIJ A;  1MOL A;  4XBY A;  1JKG B;  3I56 3;  4HM1 B;  3KSE D;  2W04 A;  3F7X A;  1RGE A;  1TFK A;  1PFP A;  1TP6 A;  4JRF A;  1DE3 A;  1VQ5 3;  1EUI C;  1OPY A;  3HII A;  1I0X A;  2BMQ B;  2L4V A;  1KC8 4;  1AQZ A;  1IT7 A;  1YI2 3;  3B4O A;  3IMA B;  4XBX A;  3D5I A;  3MG1 A;  1W00 A;  2YX9 A;  1FW7 A;  4EXR A;  1RGL A;  3DZL A;  1OGZ A;  4K61 A;  1LOW A;  2GBW B;  1VZZ A;  4WHA A;  4I5Q A;  1ULJ B;  2W2C A;  3N9H A;  1STD A;  2E2V A;  4KT3 B;  3SXX A;  5BVB A;  3K9M C;  3LH4 A;  1BIR A;  1UDI I;  1FZU A;  3FG4 A;  2B1X B;  1SJW A;  3LT9 A;  4RZM A;  1QVF 2;  3HZP A;  3EC9 A;  3KN4 A;  4N6U A;  3CPW 2;  2AAE A;  2KF3 A;  2IA7 A;  5D81 A;  1FGQ A;  1BNE A;  1BSD A;  1SAR A;  1GYB A;  1V74 A;  1HZ1 A;  2BMR B;  1TTO A;  3NV0 B;  4KZ1 A;  1UCL A;  3PXM A;  5G2G A;  5M1A A;  2OQE A;  5M18 A;  2W6J H;  1SQW A;  5AYR B;  3AGN A;  3FKA A;  1VQ8 3;  3G0K A;  1B21 A;  1TRP A;  3BIR A;  1BRN L;  3DH2 A;  1BRJ A;  1DMQ A;  2YFJ B;  4K1V A;  4RNZ A;  1ASK A;  5CLK A;  1I2F A;  2ML6 A;  4J9A A;  3D4A A;  1Q7Y 4;  3LTC A;  2STD A;  1ROV A;  3FG1 A;  4MMY B;  4CCV A;  2XSH B;  4FMC A;  1AVK A;  3T8U A;  2IUJ A;  1JBR A;  1BRG A;  1GY7 A;  2C4B A;  1Q9E A;  1GY5 A;  2XFS A;  3VF1 A;  3AHW A;  1C54 A;  2XH9 A;  1W6C A;  1Q86 4;  1FGM A;  1PU4 A;  1RGA A;  3S28 A;  1GMP A;  2F5W A;  4BIR A;  1NB5 I;  3G16 A;  1QMA A;  9RNT A;  4BL3 A;  2CK3 H;  1UUW B;  4RNY A;  3HX8 A;  1BNR A;  2CFD A;  3IJE B;  3KFQ C;  3NQZ A;  4GHO A;  3ER7 A;  1N5H A;  3DGN A;  1MWU A;  5ELJ A;  1Q40 B;  2WO0 A;  2XFT A;  4FCJ A;  1JB4 A;  2K3D A;  2CW9 A;  4AKY A;  4N6N B;  3JUP A;  3OXA A;  1WTH A;  1Y4K A;  4HM2 B;  4LYL B;  1A2P A;  3MG3 A;  2P05 A;  3V92 A;  5IG4 A;  5BIR A;  3KCH A;  4G1M B;  3ZG5 A;  1YNV X;  3DGM A;  3OWU A;  4XBT A;  4PEJ A;  1HKX A;  2KF5 A;  4OVM A;  1A2K A;  1RTU A;  3LTA A;  1I2E A;  1FGO A;  2W9P A;  3CC2 3;  1V58 A;  1GMQ A;  2CFW A;  4O2H A;  4HYZ A;  3GWR A;  2JDI H;  1NDO B;  1I8V A;  4HAA A;  4WP5 A;  5LC7 A;  3HI7 A;  3KE7 A;  4BTX A;  1X1X A;  2BU4 A;  4HKV B;  4R9L A;  1W6Y A;  1F8N A;  4LZI A;  2ZL8 A;  3LYG A;  3CD6 3;  5IF6 A;  1M90 4;  3QK9 A;  1I0V A;  7GSP A;  3PCR A;  1QVG 2;  1HU9 A;  1UI7 A;  5JBS A;  2ZDJ A;  4XDW A;  3JUO A;  3DGY A;  3WA3 A;  1VQQ A;  3CU3 A;  1RN4 A;  2SAR A;  2RGQ A;  3KII A;  4HVN A;  3WDG B;  1CH0 A;  1TFO A;  1VQK 3;  2BNG A;  1RCL A;  3MYT A;  1E3R A;  1E3V A;  3GZY B;  3S27 A;  3F8H A;  3DM8 A;  3SX1 A;  3DGO A;  3PCS A;  1DVD A;  3FSD A;  1IVU A;  1OUN A;  1STF I;  4N6V 0;  1ISK A;  2GEX A;  2LYX A;  4ZM8 A;  1JRQ A;  1HYF A;  1OF5 B;  1UCK A;  2LQV A;  2WOH A;  1BNG A;  1BVI A;  2OOV C;  4H3U A;  1OGX A;  5CXO A;  4CJN A;  1M1K 4;  3EBY A;  3NX0 A;  1T3B A;  1JB5 A;  3SYU A;  4AKZ A;  5ELU A;  1RGG A;  3JVC A;  4K90 B;  2CKF B;  3F8X A;  4WYK A;  4HZ9 B;  5AIG A;  2YFI B;  2Z6B A;  5EVH A;  1B3S A;  3UNL A;  2HMN B;  3LZA A;  2J8X B;  1GY6 A;  2MF7 A;  2CFL A;  1DMN A;  1NO3 A;  1QJG A;  2PZV A;  5BXQ A;  4HBR A;  1DVC A;  4U13 A;  5IG3 A;  1VQP 3;  1VQ6 3;  1IU7 A;  1B27 A;  3S67 A;  2FXT A;  2CFK A;  1QAF A;  2CX0 A;  2ML5 A;  2SBL A;  4IPB A;  4DKI A;  2Z7A A;  3EN1 B;  5KP4 A;  1G02 A;  1K41 A;  3CXC 2;  1FGR A;  1IK3 A;  2F5M A;  1ULI B;  6GSP A;  1LQM B;  1AY7 A;  1JKG A;  1LOV A;  3H51 A;  3S29 A;  3VSY A;  1UCJ A;  1RGC A;  3ECF A;  4EYC A;  3GZR A;  1MWT A;  2W0Q A;  3B4P A;  1BOX A;  1IDP A;  5EQL A;  3UB1 A;  1BNJ A;  1BNF A;  1SII A;  4N3V A;  1RKY A;  3I55 3;  3M8C A;  1LVN A;  1BRH A;  1FUS A;  1GOY A;  3EN8 A;  1UCI A;  4FMD A;  1EA2 A;  1AR0 A;  1K9M 4;  3CMA 3;  5RNT A;  1T2H A;  1WMO A;  2MC8 A;  2INX A;  1VQO 3;  3B7C A;  1BAN A;  4NHF A;  3VGN A;  3PYJ A;  1DMM A;  1YVS A;  2CH9 A;  2CFG A;  4XB5 A;  3HOH A;  2P0X A;  3K5T A;  4GL6 A;  1UUV B;  3BNE A;  1X1W A;  3S5C A;  1B2M A;  1YGW A;  1O7G B;  2UGI A;  1VQN 3;  4BU4 A;  3PGB A;  4MMZ B;  1VQ7 3;  4TX4 A;  1KQS 2;  1C7H A;  2HMO B;  1BRI A;  3NBB A;  5FGO A;  1ZS7 A;  2HMM B;  1LRA A;  6RNT A;  3NV0 A;  1GD3 A;  2BT3 A;  3GZB A;  1RRL A;  4LEH A;  3SED A;  1AV4 A;  3WMD A;  1W4N A;  5A0O B;  3I0Y A;  4HM7 B;  1ZGX A;  2KCD A;  1JV2 B;  2XF3 A;  2ZHX B;  3CCJ 3;  3LTD A;  1M9G A;  2XGL A;  1EQK A;  1O7N B;  1U8C B;  3CCR 3;  3UJM A;  3DUK A;  3URP A;  2R41 A;  4HZB B;  1A67 A;  1RLS A;  1MGR A;  2O9U X;  4HM0 B;  3FF0 A;  3MPH A;  3FGY A;  1IT8 A;  1VQ4 3;  3WR2 A;  5CK6 A;  4X2H A;  5AI1 A;  1PYL A;  3K7C A;  2QGU A;  1BRS A;  1JB2 A;  1NJI 4;  2W56 A;  4KFF A;  5G1L A;  1X1Y A;  4FR9 A;  2V1L A;  4QWT A;  4BTW A;  1WMN A;  2C11 A;  3EX9 A;  1WQL B;  4O3V A;  1O7H B;  1OHS A;  4IT7 A;  4J5K A;  1GOV A;  4EBG A;  3RNT A;  1UGI A;  4N6L A;  1BSE A;  2H0I A;  3CC4 3;  1IVX A;  1N9E A;  2D1W A;  1BSC A;  3H3H A;  4ILF A;  2BO9 B;  1GD4 A;  4HM3 B;  1LQG C;  3D5G A;  2KAA A;  5CF2 A;  3F40 A;  1MGW A;  1CQS A;  1VQL 3;  2KRT A;  3BND A;  4N6M A;  4STD A;  3CCV 3;  3AHS A;  1MNL A;  2F99 A;  3WOD G;  3SOA A;  5IG5 A;  2R4I A;  2K0M A;  3FH1 A;  5FW5 A;  3UL6 A;  1B2S A;  2PNC A;  2IMJ A;  2OQE C;  1EEJ A;  1UI8 A;  4I4K A;  3GSP A;  2P38 A;  3A5E A;  7STD A;  1E97 A;  2WGO A;  3WA2 X;  1M1X B;  1ZX2 A;  1BSB A;  5AYS C;  2KF6 A;  4FCZ A;  3PZW A;  3WOF B;  2ZA4 A;  1BNS A;  3ROB A;  5IEP A;  1Q7H A;  4EV5 A;  4N6O B;  1JBT A;  2CX1 A;  4HM5 B;  3T0U A;  5D82 A;  5KP1 A;  2XEP A;  1AVL A;  1RJO A;  2M7O A;  1S5A A;  3CCL 3;  3SVA A;  5JPP A;  1IV7 A;  4OUQ A;  5CF1 A;  3MKI A;  3V99 A;  2F4Y A;  3CC7 3;  2GBX B;  4R4K A;  4WFO A;  1YIJ 3;  1YGE A;  1U5O A;  3K63 A;  2OCT A;  1GOU A;  1JN5 B;  3BLZ A;  3EB8 A;  1Q82 4;  4NRE A;  3NXJ A;  1OHP A;  1RMS A;  1ROA A;  1BU4 A;  1LNH A;  2KF4 A;  2Q07 A;  5AIF A;  3X40 A;  3ZG0 A;  3NBJ A;  1RSN A;  3OW2 2;  5KP3 A;  1I3F A;  1G96 A;  2H0H A;  3CCE 3;  3DMC A;  1W02 A;  1YJN 3;  1JJ2 2;  3OV4 A;  1OAC A;  3EQQ B;  2OTL 3;  3X3Y A;  1JNQ A;  1SIH A;  1R4Y A;  2Y73 A;  3DY5 A;  3DGL A;  3GZX B;  3G4S 3;  3CME 3;  1NNV A;  2P09 A;  3F7S A;  1W6G A;  1KWI A;  1LNI A;  3CCM 3;  1B2Z A;  1D6Y A;  2WGQ A;  4LGQ A;  5IEN A;  3OWS A;  3NM7 A;  3RGR A;  1PY3 A;  1IVV A;  1LOY A;  1Z1S A;  2CC3 A;  4KVH A;  4EC6 A;  5IW9 A;  4K1U A;  3CPO A;  5AEU B;  1FGT A;  5HOH A;  3AMO B;  1US1 A;  3KZT A;  1BRK A;  5AIH A;  3FF2 A;  2AAD A;  2E2U A;  1RGK A;  3NHX A;  5LC6 A;  2CWT A;  4MJD A;  3FG3 A;  6STD A;  4O02 B;  4L8O A;  2B24 B;  2GEY A;  1GMR A;  1D6U A;  4HJL B;  1I3I A;  1N8Q A;  3B8L A;  3EF8 A;  4JF8 A;  1FA3 A;  4WWU C;  1K73 4;  1FUW A;  4XDV A;  3U1W A;  3Q1C A;  1FUT A;  1RN7 A;  3G6E 3;  3G71 3;  1MWR A;  1VQ9 3;  1K8A 4;  1G0T A;  4FCM A;  1N8R 4;  2Z77 A;  3LML A;  5G1K A;  1FYS A;  1S72 3;  2CIU A;  3EJV A;  1I70 A;  2CWU A;  4EV2 A;  3O8Y A;  5AII A;  4LSO A;  1I2G A;  3TDG A;  3JUM A;  2JQ5 A;  1N5P A;  2H0G A;  3D79 A;  3FCS B;  1A90 A;  1BUJ A;  4IIA A;  3F14 A;  2XRX B;  2A15 A;  2HOH A;  3V98 A;  1DYU A;  2GXF A;  2IY2 A;  1YJ9 3;  1UUG B;  2I9W A;  2CWV A;  4O8S A;  2QEX 3;  1YVB I;  3ALA A;  2XSO B;  3RDE A;  5M19 A;  3KKG A;  5TGN A;  1YIT 3;  1Q42 A;  1KD1 4;  1RNB A;  1NWW A;  3BB9 A;  1A2V A;  4KFE A;  5GSP A;  3CNX A;  3CNM A;  4AEQ A;  5D83 A;  3Q90 A;  1T2I A;  5EEO A;  5IER A;  8RNT A;  2YFL B;  3T8N A;  1Q81 4;  1B20 A;  1YHQ 3;  3NBR A;  2QA4 3;  1VQM 3;  1BAO A;  4HOH A;  2CG0 A;  2HMK B;  3HK4 A;  1BSA A;  3MG2 A;  1OH0 A;  1UGH I;  1TRQ A;  4GB5 A;  5IG0 A;  3EE1 A;  2Y74 A;  3K0Z A;  5DRE A;  2GU3 A;  4NPB A;  1LOX A;  4HM8 B;  3STD A;  4EW5 A;  1W5Z A;  5HGR A;  8CHO A;  2D42 A;  2F56 A;  3BU4 A;  2E2T A;  3WOE B;  4CPK A;  4RBN A;  1Q40 A;  3JUQ A;  3FZW A;  3D3L A;  3CCS 3;  1X1U A;  1TJD A;  1JZO A;  2W56 B;  1RGH A;  2QIY A;  2UUG C;  1EG9 B;  3AGO A;  1ZO2 A;  2W9Q A;  2IYJ A;  3D9R A;  1JZD A;  3HIG A;  1RRH A;  1J2B A;  4HM4 B; 
#chains in the Genus database with same CATH homology
 4J8T A;  1O7P B;  2F86 B;  3SOY A;  4X2O A;  2CHC A;  1K28 A;  3Q2P A;  3OX9 A;  1W2Z A;  2OOV A;  1GS3 A;  4CDL A;  4ORL A;  3FLJ A;  3X3Z A;  1IQ8 A;  3EBT A;  1W7C A;  2RCD A;  4FMA A;  1T5Y A;  3DXO A;  2RFR A;  2O3O A;  3GAX A;  1IV9 A;  5DRV A;  4HM6 B;  1WMP A;  1CYU A;  2UX0 A;  2FGT A;  3KSP A;  3UL5 A;  3E99 A;  3OWY A;  4XM4 A;  2C10 A;  3F9S A;  3JUN A;  2BMO B;  1TU5 A;  2Z76 A;  3X42 A;  2HMJ B;  4H61 A;  4R1K A;  2F98 A;  4L7K A;  1TUH A;  4R9K A;  2CG1 A;  3NM2 A;  1IQX A;  2P0M A;  3N54 B;  1L5G B;  3X3X A;  1NB3 I;  3RGA A;  3QRD A;  2XGN A;  4L8P A;  4FMB A;  4R80 A;  3MHE A;  2BHM A;  1OCV A;  1N9J A;  1D6Z A;  3PS8 A;  1JN5 A;  2XR8 B;  1BUQ A;  2IUK A;  1OHO A;  1W2B 2;  4OK0 A;  1OF5 A;  2HML B;  1CYV A;  4LMI A;  3BNC A;  5STD A;  1YJW 3;  2OWP A;  1EKM A;  2OTJ 3;  4KFD A;  4BTY A;  4MMX B;  2W03 A;  4Q53 A;  3NUV A;  1IQY A;  3MWZ A;  1IVW A;  2GU1 A;  1LXE A;  1QAK A;  1SPU A;  3MSO A;  3L0R A;  3LXU X;  1WNH A;  3LTB A;  3X41 A;  1R4C A;  1KSI A;  5IEO A;  4WYK B;  3A76 A;  5AEW B;  2KXG A;  3EHC A;  3N8B A;  3CCU 3;  3GRD A;  2RSX A;  2FNQ A;  2K54 A;  4MEI A;  3J7Y d;  5JPU A;  1QAL A;  3AMO A;  3LOY A;  1VQ7 3;  2WOF A;  1W01 A;  1CEW I;  3BNB A;  1NU3 A;  3LT8 A;  1O7M B;  1O7W B;  3IPT A;  3CCQ 3;  3G8Z A;  1UW1 A;  4N6T A;  3SLU A;  3U97 A;  3NQY A;  1TIJ A;  1MOL A;  4XBY A;  1JKG B;  3I56 3;  4HM1 B;  3KSE D;  2W04 A;  3F7X A;  1TFK A;  1PFP A;  1TP6 A;  4JRF A;  1VQ5 3;  1OPY A;  3HII A;  2L4V A;  2BMQ B;  1KC8 4;  1IT7 A;  1YI2 3;  3B4O A;  3IMA B;  4XBX A;  3MG1 A;  1W00 A;  2YX9 A;  4EXR A;  3DZL A;  1OGZ A;  4K61 A;  2GBW B;  1VZZ A;  4WHA A;  1ULJ B;  2W2C A;  3N9H A;  1STD A;  2E2V A;  5BVB A;  3SXX A;  3K9M C;  3LH4 A;  3FG4 A;  2B1X B;  1SJW A;  3LT9 A;  4RZM A;  1QVF 2;  3HZP A;  3EC9 A;  3KN4 A;  4N6U A;  3CPW 2;  2IA7 A;  5D81 A;  1FGQ A;  1GYB A;  1V74 A;  2BMR B;  5G2G A;  3NV0 B;  4KZ1 A;  3PXM A;  2OQE A;  2W6J H;  1SQW A;  5AYR B;  1VQ8 3;  3FKA A;  3G0K A;  4RNZ A;  1DMQ A;  2YFJ B;  4K1V A;  5CLK A;  1ASK A;  2ML6 A;  4J9A A;  1Q7Y 4;  3LTC A;  2STD A;  1ROV A;  3FG1 A;  4MMY B;  4CCV A;  2XSH B;  4FMC A;  1AVK A;  3T8U A;  2IUJ A;  1GY7 A;  1GY5 A;  2XFS A;  3VF1 A;  2XH9 A;  1W6C A;  1Q86 4;  1FGM A;  1PU4 A;  3S28 A;  1NB5 I;  3G16 A;  1QMA A;  2CK3 H;  1UUW B;  4RNY A;  3HX8 A;  2CFD A;  3IJE B;  3KFQ C;  3NQZ A;  3ER7 A;  1N5H A;  3DGN A;  5ELJ A;  1Q40 B;  2WO0 A;  2XFT A;  4FCJ A;  1JB4 A;  2CW9 A;  4AKY A;  4N6N B;  3JUP A;  3OXA A;  1WTH A;  1Y4K A;  4HM2 B;  3MG3 A;  2P05 A;  3V92 A;  5IG4 A;  4G1M B;  3DGM A;  3OWU A;  4XBT A;  4PEJ A;  1HKX A;  4OVM A;  1A2K A;  3LTA A;  1FGO A;  2W9P A;  3CC2 3;  2CFW A;  4O2H A;  4HYZ A;  3GWR A;  2JDI H;  1NDO B;  4WP5 A;  5LC7 A;  3HI7 A;  3KE7 A;  4BTX A;  4HKV B;  4R9L A;  1W6Y A;  1F8N A;  4LZI A;  2ZL8 A;  3LYG A;  3CD6 3;  5IF6 A;  1M90 4;  3QK9 A;  3PCR A;  1QVG 2;  1HU9 A;  1UI7 A;  5JBS A;  2ZDJ A;  4XDW A;  3JUO A;  3WA3 A;  4HVN A;  3CU3 A;  3WDG B;  3KII A;  2RGQ A;  1TFO A;  1VQK 3;  2BNG A;  3MYT A;  1E3R A;  1E3V A;  3GZY B;  3S27 A;  3F8H A;  3DM8 A;  3SX1 A;  3DGO A;  3PCS A;  1DVD A;  3FSD A;  1IVU A;  1OUN A;  1STF I;  4N6V 0;  1ISK A;  2GEX A;  2LYX A;  4ZM8 A;  1JRQ A;  1OF5 B;  2LQV A;  2WOH A;  2OOV C;  4H3U A;  1OGX A;  5CXO A;  1M1K 4;  3EBY A;  3NX0 A;  1JB5 A;  4AKZ A;  5ELU A;  3JVC A;  4K90 B;  2CKF B;  3F8X A;  4WYK A;  4HZ9 B;  5AIG A;  2YFI B;  2Z6B A;  5EVH A;  3UNL A;  2HMN B;  3LZA A;  1GY6 A;  2MF7 A;  2CFL A;  1DMN A;  1NO3 A;  1QJG A;  2PZV A;  5BXQ A;  4HBR A;  1DVC A;  4U13 A;  5IG3 A;  1VQP 3;  1VQ6 3;  1IU7 A;  3S67 A;  2FXT A;  2CFK A;  2SBL A;  1QAF A;  2ML5 A;  4IPB A;  2Z7A A;  3EN1 B;  5KP4 A;  1K41 A;  3CXC 2;  1FGR A;  1IK3 A;  1ULI B;  1JKG A;  3H51 A;  3S29 A;  3VSY A;  3ECF A;  4EYC A;  3GZR A;  3B4P A;  2W0Q A;  1IDP A;  5EQL A;  3UB1 A;  1SII A;  4N3V A;  1RKY A;  3I55 3;  3M8C A;  1LVN A;  3EN8 A;  4FMD A;  1EA2 A;  1AR0 A;  1K9M 4;  3CMA 3;  1WMO A;  2MC8 A;  2INX A;  1VQO 3;  3B7C A;  4NHF A;  3VGN A;  3PYJ A;  1DMM A;  2CH9 A;  4XB5 A;  2CFG A;  2P0X A;  3K5T A;  4GL6 A;  1UUV B;  3BNE A;  3S5C A;  1O7G B;  1VQN 3;  3PGB A;  4MMZ B;  1KQS 2;  4TX4 A;  1C7H A;  2HMO B;  5FGO A;  3NBB A;  2HMM B;  3NV0 A;  1GD3 A;  2BT3 A;  3GZB A;  1RRL A;  4LEH A;  3SED A;  1AV4 A;  3WMD A;  1W4N A;  5A0O B;  3I0Y A;  4HM7 B;  2KCD A;  1JV2 B;  2XF3 A;  3CCJ 3;  3LTD A;  1M9G A;  2XGL A;  1EQK A;  1O7N B;  1U8C B;  3CCR 3;  3UJM A;  3DUK A;  1A67 A;  4HZB B;  4HM0 B;  2O9U X;  3FF0 A;  3MPH A;  3FGY A;  1IT8 A;  1VQ4 3;  5CK6 A;  4X2H A;  5AI1 A;  3K7C A;  2QGU A;  1JB2 A;  1NJI 4;  2W56 A;  4KFF A;  4FR9 A;  2V1L A;  4QWT A;  4BTW A;  1WMN A;  2C11 A;  3EX9 A;  1WQL B;  4O3V A;  1O7H B;  1OHS A;  4IT7 A;  4EBG A;  4N6L A;  3CC4 3;  1IVX A;  1N9E A;  2D1W A;  3H3H A;  2BO9 B;  1GD4 A;  4HM3 B;  5CF2 A;  3F40 A;  1CQS A;  1VQL 3;  2KRT A;  3BND A;  4N6M A;  4STD A;  3CCV 3;  1MNL A;  2F99 A;  3WOD G;  3SOA A;  5IG5 A;  2R4I A;  2K0M A;  3FH1 A;  5FW5 A;  3UL6 A;  2PNC A;  2IMJ A;  2OQE C;  1UI8 A;  4I4K A;  2P38 A;  7STD A;  1E97 A;  2WGO A;  3WA2 X;  1M1X B;  1ZX2 A;  5AYS C;  4FCZ A;  3PZW A;  3WOF B;  3ROB A;  5IEP A;  4EV5 A;  4N6O B;  4HM5 B;  3T0U A;  5D82 A;  5KP1 A;  2XEP A;  1AVL A;  1RJO A;  2M7O A;  1S5A A;  3CCL 3;  3SVA A;  5JPP A;  1IV7 A;  4OUQ A;  5CF1 A;  3MKI A;  3V99 A;  3CC7 3;  2GBX B;  4R4K A;  4WFO A;  1YIJ 3;  1YGE A;  1U5O A;  3K63 A;  2OCT A;  1JN5 B;  3BLZ A;  3EB8 A;  1Q82 4;  4NRE A;  3NXJ A;  1OHP A;  1ROA A;  1LNH A;  2Q07 A;  5AIF A;  3X40 A;  3OW2 2;  3NBJ A;  5KP3 A;  1G96 A;  3CCE 3;  3DMC A;  1W02 A;  1YJN 3;  1JJ2 2;  3OV4 A;  1OAC A;  3EQQ B;  2OTL 3;  3X3Y A;  1JNQ A;  1SIH A;  2Y73 A;  3GZX B;  3DY5 A;  3DGL A;  3G4S 3;  3CME 3;  2P09 A;  3F7S A;  1W6G A;  1KWI A;  3CCM 3;  1D6Y A;  2WGQ A;  4LGQ A;  5IEN A;  3OWS A;  3NM7 A;  3RGR A;  1IVV A;  1Z1S A;  2CC3 A;  4KVH A;  4EC6 A;  5IW9 A;  4K1U A;  3CPO A;  5AEU B;  1FGT A;  3AMO B;  1US1 A;  3KZT A;  5AIH A;  3FF2 A;  2E2U A;  3NHX A;  5LC6 A;  2CWT A;  4MJD A;  3FG3 A;  6STD A;  4O02 B;  4L8O A;  2B24 B;  2GEY A;  1D6U A;  4HJL B;  3EF8 A;  1N8Q A;  3B8L A;  4JF8 A;  1FA3 A;  4WWU C;  1K73 4;  1FUW A;  4XDV A;  3U1W A;  3Q1C A;  1RN7 A;  3G6E 3;  3G71 3;  1VQ9 3;  1K8A 4;  4FCM A;  1N8R 4;  2Z77 A;  3LML A;  1S72 3;  2CIU A;  3EJV A;  2CWU A;  4EV2 A;  3O8Y A;  5AII A;  4LSO A;  3TDG A;  3JUM A;  2JQ5 A;  1N5P A;  3FCS B;  1A90 A;  4IIA A;  3F14 A;  2XRX B;  2A15 A;  3V98 A;  1DYU A;  2GXF A;  1YJ9 3;  2I9W A;  2CWV A;  4O8S A;  2QEX 3;  1YVB I;  3ALA A;  2XSO B;  3RDE A;  1YIT 3;  3KKG A;  5TGN A;  1Q42 A;  1KD1 4;  1NWW A;  3BB9 A;  1A2V A;  4KFE A;  3CNX A;  3CNM A;  4AEQ A;  5D83 A;  3Q90 A;  5IER A;  5EEO A;  2YFL B;  3T8N A;  1Q81 4;  1YHQ 3;  3NBR A;  2QA4 3;  1VQM 3;  2CG0 A;  2HMK B;  3HK4 A;  3MG2 A;  1OH0 A;  4GB5 A;  5IG0 A;  3EE1 A;  2Y74 A;  3K0Z A;  5DRE A;  2GU3 A;  1LOX A;  4HM8 B;  3STD A;  1W5Z A;  5HGR A;  8CHO A;  2D42 A;  3WOE B;  2E2T A;  4RBN A;  1Q40 A;  3JUQ A;  3FZW A;  3D3L A;  3CCS 3;  5I97 A;  2W56 B;  3D9R A;  2QIY A;  3HIG A;  1EG9 B;  1ZO2 A;  2W9Q A;  1RRH A;  1J2B A;  4HM4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...