1NB5I

Crystal structure of stefin a in complex with cathepsin h
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin H
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 98
sequence length 98
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nb5I00
1IV9A 1CEWI 3Q2PA 4IT7A 1YVBI 2BO9B 1N5PA 3IMAB 3UL6A 1STFI 4CCVA 3PYJA 4N6OB 1A90A 3LH4A 1DVDA 1RN7A 2CH9A 1GD4A 4N6TA 4N6NB 2O9UX 1DVCA 5LC7A 3KFQC 1GD3A 5LC6A 1CYVA 1R4CA 3NX0A 2KXGA 4EYCA 5A0OB 4TX4A 1A67A 1G96A 3K9MC 1KWIA 5EQLA 1M9GA 5ELUA 3PXMA 1PFPA 1FUWA 1WNHA 1LXEA 2W9QA 3S67A 1N9JA 3GAXA 3MWZA 1NB3I 3PS8A 2OCTA 4N6LA 3UL5A 5ELJA 1MNLA 4N6V0 3SVAA 1EQKA 3QRDA 1TIJA 4N6MA 4LZIA 4N6UA 1IV7A 3L0RA 2W9PA 1FA3A 4ZM8A 3KSED 1MOLA 1CYUA 1N5HA 1ROAA 1NB5I
chains in the Genus database with same CATH superfamily
4LEHA 1IQYA 3EX9A 2LQVA 4FMCA 2E2TA 1C54A 1OF5A 4IT7A 1W6GA 1VQ93 2HMMB 3CNXA 3Q1CA 2BO9B 4KZ1A 4GSPA 2CFDA 1STFI 4CCVA 4OUQA 3AGOA 1LNIA 2OOVC 3SOAA 1A2PA 1MWRA 2P09A 1SQWA 3ZFZA 3EC9A 1YHQ3 1X1UA 4RNYA 4XB5A 2YFJB 2WOHA 3EN8A 1M1K4 3X40A 3G713 1DVDA 1A2KA 3Q90A 5KP3A 1RCLA 5IG4A 2C10A 5FGOA 2WOFA 3IJEB 1I70A 4GL6A 1EUIC 2KF3A 3HI7A 1ISKA 1Q864 2IUKA 2Z77A 4N6TA 1BUJA 1TJDA 1ULIB 1BIRA 4N6NB 1E97A 5JPUA 4GHOA 4KVHA 1BNSA 1O7GB 3EHCA 3KFQC 1IVWA 2CG0A 5AI1A 1SJWA 3B8LA 1Q40B 1YJ93 3NX0A 2KXGA 2YFIB 3FF0A 5BU4A 7GSPA 9RNTA 5AIFA 4FMDA 1KD14 2F98A 3URPA 3MKIA 4FCJA 1AVLA 1YVSA 1SIIA 2CIUA 4O02B 4XBYA 3F40A 3FZWA 4HZ9B 1B21A 1YJW3 1DETA 1HZ1A 1KWIA 1IVVA 2KAAA 2KF6A 2K3DA 1T2HA 2W04A 1M9GA 3HX8A 2L4VA 3CPW2 4L8OA 3DZLA 4R4KA 2IY2A 2KF4A 2SARA 2QGUA 5AYRB 2R4IA 3AGNA 2ZA4A 3NBRA 1GY7A 1M1XB 3VSYA 1Q9EA 1W4NA 3OXAA 1O7WB 3GZBA 1G02A 1O7NB 4IIAA 5IG5A 1D6ZA 4NHFA 1AY7A 1UUVB 3JUPA 1QAFA 3DH2A 1GOYA 1LXEA 3S67A 1STDA 1BNFA 3BNCA 3FG1A 1VQ83 1RGEA 1QVG2 2OTL3 4EV2A 2CFWA 1OUNA 1JBSA 4MMYB 3J7Yd 1SPUA 1QAKA 3SOYA 1B27A 1RCKA 1W00A 5ELJA 2RGQA 1FZUA 4U13A 2XH9A 1OGXA 3BNBA 2CHCA 1LOWA 3HIGA 1GSPA 2L1SA 3MG1A 1RMSA 5AYSC 4L7KA 4BU4A 3LMLA 3PCSA 1DE3A 1YI23 5CF2A 1JB4A 2FGTA 4H3UA 2OQEA 1IU7A 1I2EA 3UB1A 4LYLB 1L5GB 4J8TA 1NU3A 3WA3A 3HIIA 4J9AA 1ZX2A 3AHSA 3VF1A 4K61A 3U97A 4HJLB 5IG3A 1N8QA 3G6E3 1I0XA 4WFOA 1OH0A 3MSOA 1B2ZA 3SVAA 1GMQA 1YIJ3 3SX1A 2H0GA 4O3VA 1TIJA 4X2OA 1BGSA 2CWUA 2OQEC 3FF2A 2H0HA 5G1LA 1YNVX 3S5CA 4HOHA 1RJOA 2MF7A 1UUWB 3U1WA 1JBRA 3JUOA 1IV7A 1MGRA 1BSDA 2Q07A 3ECFA 4HAAA 2F56A 1BSEA 2W9PA 2CX1A 4ZM8A 4O2HA 1OHOA 2J8XB 2Y74A 3KSED 1UDII 3FG3A 1CYUA 1ROAA 1W2ZA 3FGYA 2R41A 3KZTA 2AADA 2IYJA 2GU3A 3Q2PA 1TFOA 5HGRA 1OACA 2W0QA 3VGNA 4NREA 1BNEA 1EA2A 1K41A 3G0KA 3IMAB 4MMZB 3UL6A 3LOYA 3F14A 3EN1B 3CCV3 5KP1A 1SARA 3T8NA 1VQP3 3E99A 3ER7A 3NM7A 1BOXA 4XDVA 1A90A 2F5WA 1JB5A 2CX0A 1CQSA 5RNTA 1QJGA 1R4YA 3I0YA 2BMOB 1RHLA 3NHXA 1K8A4 4HM6B 3X42A 4CDLA 2Z7AA 1RN1A 4STDA 1B2UA 2RFRA 2O9UX 1NJI4 1FUTA 1N9EA 1SIHA 2YFLB 5M1AA 1GD3A 1UGHI 3CCQ3 3ZG5A 4L8PA 1K9M4 1ZGXA 1B2SA 3DUKA 4EYCA 1VZZA 2KCDA 5A0OB 3SEDA 1ULJB 1WMPA 3H51A 3JVCA 3CPOA 1CH0A 1YGEA 2XGNA 3JUNA 2IUJA 3K9MC 3FSDA 1FGOA 2GU1A 5M19A 3OWUA 2F99A 3B7CA 3PGBA 4K1UA 1ZO2A 3LT9A 1E3VA 1US1A 1Q40A 1I0VA 6RNTA 2GEYA 3STDA 4N3VA 1TRPA 1X1XA 3RGAA 5CF1A 2BHMA 2CFLA 4RNTA 3WOFB 2CWTA 3EJVA 1BSCA 3JUQA 4J5GA 3F8XA 1GYBA 2UUGC 3WOEB 5AEWB 1V74A 1BRJA 1YIT3 1VQL3 3G8ZA 1WNHA 4R9KA 3GAXA 2INXA 4CPKA 3CCL3 1QVF2 1ASKA 1UCJA 2XFSA 1PYLA 3D9RA 2Y73A 3EBTA 1VQN3 4HM4B 2C11A 2BNGA 1AQZA 3UL5A 1JNQA 4N6LA 3FCSB 5HOHA 1V57A 3NBBA 4AKYA 3OW22 1LOYA 2JDIH 5CK6A 3T8UA 1VQM3 1FYSA 1KC84 3LTDA 2MC8A 2Z6BA 1B2MA 2OTJ3 2WGQA 3WR2A 1BAOA 7RNTA 3DGLA 2HMOB 4K90B 2RSXA 5D82A 2B1XB 3OV4A 4H61A 1UGIA 2QA43 2P05A 1Q7Y4 2IMJA 1DMNA 1W6YA 4QWTA 2WGOA 1I3FA 4GB5A 3TDGA 5KP4A 3CC73 2HOHA 1YJN3 1NO3A 5D83A 4AEQA 2XGLA 2PNCA 3NBJA 4R9LA 3RGRA 4LSOA 1BNGA 1NDOB 1QMAA 2E2VA 4OK0A 5IG0A 3EBYA 4N6MA 1M904 1NNVA 3KE7A 1BRSA 8RNTA 3MG2A 4N6UA 5CLKA 2B24B 3EB8A 2IA7A 5IENA 1LQMB 1IQXA 2LYXA 1FA3A 1W01A 3F8HA 3GZRA 5IW9A 1K28A 2RNTA 4KFDA 5D81A 1N8R4 1A2VA 3BNEA 1JRQA 1HYFA 4I4KA 3X3ZA 1LNHA 1IV9A 1VQQA 3LYGA 4HM2B 4CJNA 1O7HB 1CEWI 1UCLA 2RCDA 3CC43 1VQ43 4R80A 1Q7HA 1GY5A 3LT8A 1EG9B 1ZS7A 3HOHA 3K7CA 1BNRA 1N5PA 3DM8A 1S723 3LTCA 2WO0A 4G1MB 2XSOB 2I9WA 3Q3FA 2CFKA 4BTXA 4R1KA 3PCRA 1RDSA 2OWPA 3PYJA 2P0MA 1MGWA 8CHOA 1F8NA 3CU3A 4N6OB 1VQ63 2AAEA 2M7OA 3K5TA 3LH4A 1W2B2 4HM1B 4HM8B 4RNZA 1LRAA 2ZHXB 1BNIA 2CH9A 5AIHA 1OCVA 1GD4A 3G16A 2HMLB 3O8YA 2K0MA 5IERA 3UNLA 2D42A 1BRNL 3G4S3 5BVBA 3A76A 4BTYA 5LC7A 1LOXA 3V99A 3NQZA 4ORLA 5LC6A 3N54B 2ZDJA 3NM2A 1UI8A 1CYVA 4HZBB 1R4CA 5I97A 3CXC2 1V58A 1TTOA 1W02A 3CCR3 1BUQA 1BNJA 1FGRA 1E3RA 3FLJA 1RGFA 4TX4A 3S29A 2BT3A 1GOUA 3CME3 1TFKA 4BL2A 1A67A 3DMCA 3I553 1B3SA 3KN4A 4XBXA 5CXOA 5JBSA 1TUHA 2CW9A 1RGGA 4WYKA 7STDA 1RGAA 5IEPA 1BU4A 1DYUA 3QK9A 1X1YA 2RBIA 3AHWA 5ELUA 3PXMA 3WHOA 1S5AA 5IF6A 3UJMA 3EF8A 3DGNA 4AKZA 1JKGA 5G2GA 1KSIA 2BU4A 2W2CA 3MHEA 5AIGA 2ML5A 1PFPA 1WMOA 1IT8A 1TP6A 4O8SA 3CMA3 4WYKB 3X41A 1IT7A 2XSHB 3IPTA 2QEX3 1EKMA 3SXXA 1AR0A 3SLUA 3GZXB 6STDA 1JKGB 1I3IA 3PZWA 1PU4A 3LTBA 3PS8A 2OCTA 2CG1A 1BVIA 1O7MB 1OPYA 4DKIA 1B2XA 3FKAA 1BRIA 4EC6A 2FNQA 4WWUC 1HU9A 1X1WA 1LQGC 5DRVA 1WMNA 1DMMA 2SBLA 1UUGB 4EBGA 3JUMA 1VQ53 3WODG 4HYZA 1JV2B 3S28A 2F4YA 1MWTA 2K54A 3K63A 3NXJA 5TGNA 3CCS3 1RGCA 1Q824 1J2BA 2V1LA 2XEPA 2W6JH 4HM5B 4J5KA 5M18A 3CCJ3 1MWUA 1BSAA 3NV0B 4MMXB 3AMOA 3F7XA 1UI7A 3MYTA 2ZL8A 2Z76A 3HZPA 5BXQA 1EQKA 3WA2X 3MPHA 4RBNA 1K734 1LOVA 1OF5B 2PZVA 5JPPA 1VQO3 1DMQA 3KCHA 1Z1SA 4BTWA 2CC3A 1WTHA 4Q53A 3RDEA 1I8VA 1B20A 4FMAA 3AMOB 2HMKB 4JRFA 3LXUX 1Q42A 3DY5A 1N5HA 5STDA 4EW5A 3FH1A 1D6UA 1NB5I 3M8CA 4KFFA 1LVNA 1GS3A 1Q814 2BMQB 1TRQA 3BNDA 3DGYA 2GEXA 1YVBI 1W7CA 3F9SA 1IQ8A 4ILFA 2KRTA 1QALA 3SYUA 2FXTA 1RKYA 1GMPA 1JZDA 4KFEA 1RGKA 1AVKA 3X3YA 3BIRA 1OHSA 1D6YA 4XBTA 1MWSA 1T3BA 3KKGA 4XM4A 1JBTA 2D1WA 1RRLA 2A15A 1RN7A 3NQYA 4HM3B 1EEJA 1FUSA 2STDA 1HKXA 1RNTA 2XF3A 4IPBA 1VQ73 3OWSA 1FW7A 1UW1A 3LZAA 4LGQA 1IVUA 3H3HA 4WP5A 1UCIA 3OWYA 4RZMA 1DVCA 1OHPA 2GXFA 1G0TA 1I2FA 4KT3B 1VQK3 4OVMA 3DGOA 4FMBA 4I5QA 3D5IA 5AEUB 3DXOA 1UCKA 1T5YA 1ROVA 3D4AA 1BANA 3ROBA 3GWRA 2H0IA 2GBXB 5BIRA 1G96A 1FGMA 3KSPA 4BIRA 3KIIA 4EV5A 1AV4A 2GSPA 1BSBA 5EQLA 3DGMA 5IEOA 3CCU3 1BRKA 3ALAA 3GSPA 3N8BA 4BL3A 3FG4A 1GOVA 4NPBA 1GY6A 3D79A 5G1KA 3BB9A 2UGIA 3F7SA 6GSPA 3GZYB 3A5EA 2ML6A 3GRDA 2XFTA 5AIIA 3V92A 1RNBA 2CKFB 5DREA 2F5MA 1O7PB 1FUWA 3MG3A 1T2IA 2W9QA 3B4PA 1N9JA 1W5ZA 3ZG0A 3CD63 1JN5A 1RSNA 4X2HA 3MWZA 1RTUA 1RN4A 3X3XA 1Y4KA 1NB3I 1PY3A 4JF8A 4XDWA 2XRXB 4K1VA 2UX0A 4MJDA 3WDGB 3BU4A 2F86B 1KQS2 3I563 1W6CA 2CK3H 3V98A 1MNLA 4WHAA 2KF5A 3OX9A 2GBWB 2W03A 2JQ5A 4HM0B 3D3LA 3EQQB 1JN5B 1I2GA 1JZOA 3BLZA 3LTAA 1IDPA 4FCMA 5FW5A 2W56A 3WMDA 2CFGA 4HKVB 1IK3A 5EEOA 4FR9A 3B4OA 2O3OA 4N6V0 3NUVA 2QIYA 1FGQA 3RNTA 3CCM3 3T0UA 3CNMA 2BMRB 2XR8B 1TU5A 3K0ZA 1OGZA 4LMIA 1IYYA 2BIRA 3N9HA 1U5OA 2HMJB 2HMNB 2W56B 2P38A 3D5GA 4HVNA 1U8CB 3CC23 1JJ22 3QRDA 1GMRA 1IVXA 1RGHA 2CWVA 2YX9A 4LZIA 5EVHA 3S27A 4HM7B 4MEIA 4FCZA 1BRHA 1RLSA 4PEJA 1FGTA 3EE1A 1BRGA 1C7HA 2E2UA 5GSPA 3L0RA 4HBRA 1YGWA 1JB2A 2OOVA 2C4BA 4EXRA 1RRHA 1WQLB 3NV0A 2P0XA 3HK4A 1MOLA 1RGLA 1NWWA 3CCE3
chains in the Genus database with same CATH topology
4LEHA 1IQYA 3EX9A 2LQVA 4FMCA 2E2TA 1OF5A 4IT7A 1W6GA 1VQ93 2HMMB 3CNXA 3Q1CA 2BO9B 4KZ1A 2CFDA 1STFI 4CCVA 4OUQA 2OOVC 3SOAA 2P09A 1SQWA 1YHQ3 3EC9A 4RNYA 4XB5A 2YFJB 2WOHA 3EN8A 1M1K4 3X40A 3G713 1DVDA 1A2KA 3Q90A 5KP3A 5IG4A 2C10A 5FGOA 2WOFA 3IJEB 4GL6A 3HI7A 1Q864 2IUKA 2Z77A 4N6TA 1ULIB 4N6NB 1E97A 5JPUA 4KVHA 1O7GB 3EHCA 3KFQC 1IVWA 2CG0A 5AI1A 1SJWA 3B8LA 1Q40B 1YJ93 3NX0A 2KXGA 2YFIB 3FF0A 5AIFA 4FMDA 1KD14 2F98A 3MKIA 4FCJA 1AVLA 4O02B 1SIIA 2CIUA 4XBYA 3F40A 3FZWA 4HZ9B 1YJW3 1KWIA 3RGAA 1IVVA 3CPW2 3HX8A 2W04A 1M9GA 2L4VA 4L8OA 3DZLA 4R4KA 5AYRB 2QGUA 2R4IA 3VSYA 3NBRA 1GY7A 1M1XB 1W4NA 3OXAA 1O7WB 3GZBA 1O7NB 4IIAA 5IG5A 1D6ZA 4NHFA 1UUVB 3JUPA 1QAFA 1LXEA 3S67A 1STDA 3BNCA 1VQ83 3FG1A 1QVG2 2OTL3 4EV2A 2CFWA 1OUNA 4MMYB 3J7Yd 1SPUA 1QAKA 3SOYA 1W00A 5ELJA 2RGQA 4U13A 2XH9A 1OGXA 3BNBA 2CHCA 3HIGA 3MG1A 5AYSC 4L7KA 3LMLA 3PCSA 1YI23 5CF2A 1JB4A 2FGTA 4H3UA 2OQEA 1IU7A 3UB1A 1L5GB 4J8TA 1NU3A 3WA3A 3HIIA 4J9AA 1ZX2A 3VF1A 4K61A 3U97A 4HJLB 5IG3A 1N8QA 3G6E3 4WFOA 1OH0A 3MSOA 3SVAA 1YIJ3 3SX1A 4O3VA 1TIJA 4X2OA 3FF2A 2CWUA 2OQEC 3S5CA 3V98A 1ISKA 1RJOA 2MF7A 1UUWB 3U1WA 3JUOA 1IV7A 2Q07A 3ECFA 2W9PA 4ZM8A 4O2HA 1OHOA 2Y74A 3KSED 3FG3A 1CYUA 1ROAA 1W2ZA 3FGYA 3KZTA 2GU3A 3Q2PA 1TFOA 5HGRA 1OACA 2W0QA 3VGNA 4NREA 1EA2A 1K41A 3IMAB 3G0KA 4MMZB 3UL6A 3LOYA 3F14A 3EN1B 3CCV3 5KP1A 3T8NA 1VQP3 3E99A 3ER7A 3NM7A 4XDVA 1A90A 1JB5A 1CQSA 1QJGA 3I0YA 2BMOB 3NHXA 1K8A4 4HM6B 3X42A 4CDLA 2Z7AA 4STDA 2RFRA 2O9UX 1NJI4 1SIHA 1N9EA 2YFLB 1GD3A 3CCQ3 4L8PA 1K9M4 3DUKA 4EYCA 1VZZA 2KCDA 5A0OB 3SEDA 1ULJB 1WMPA 3H51A 3JVCA 3CPOA 1YGEA 2XGNA 3JUNA 2IUJA 3K9MC 3FSDA 1FGOA 2GU1A 3OWUA 2F99A 3B7CA 3PGBA 4K1UA 1ZO2A 3LT9A 1E3VA 1US1A 1Q40A 2GEYA 3STDA 4N3VA 5CF1A 2BHMA 2CFLA 3WOFB 2CWTA 3EJVA 3JUQA 3F8XA 1GYBA 3WOEB 5AEWB 1V74A 1YIT3 1VQL3 3G8ZA 1WNHA 4R9KA 3GAXA 2INXA 3CCL3 1QVF2 1ASKA 2XFSA 3D9RA 3EBTA 2Y73A 1VQN3 4HM4B 2C11A 2BNGA 3UL5A 1JNQA 4N6LA 3FCSB 4AKYA 3NBBA 3OW22 5CK6A 2JDIH 3T8UA 1VQM3 1KC84 3LTDA 2MC8A 2Z6BA 2OTJ3 2WGQA 3DGLA 2HMOB 4K90B 2RSXA 5D82A 2B1XB 3OV4A 4H61A 2QA43 2P05A 1Q7Y4 2IMJA 1DMNA 1W6YA 4QWTA 2WGOA 4GB5A 3TDGA 5KP4A 3CC73 1YJN3 1NO3A 5D83A 4AEQA 2XGLA 2PNCA 3NBJA 4R9LA 3RGRA 4LSOA 1NDOB 1QMAA 2E2VA 4OK0A 5IG0A 3EBYA 4N6MA 1M904 3KE7A 3MG2A 4N6UA 5CLKA 2B24B 3EB8A 2IA7A 5IENA 1IQXA 2LYXA 1FA3A 1W01A 3F8HA 3GZRA 5IW9A 1K28A 4KFDA 5D81A 1N8R4 1A2VA 3BNEA 1JRQA 4I4KA 3X3ZA 1LNHA 1IV9A 3LYGA 4HM2B 1O7HB 1CEWI 2RCDA 3CC43 1VQ43 4R80A 3LT8A 1GY5A 1EG9B 3K7CA 1N5PA 3DM8A 1S723 3LTCA 2WO0A 4G1MB 2XSOB 2I9WA 2CFKA 4BTXA 4R1KA 3PCRA 2OWPA 3PYJA 2P0MA 8CHOA 1F8NA 3CU3A 4N6OB 1VQ63 2M7OA 3K5TA 3LH4A 1W2B2 4HM1B 4HM8B 4RNZA 2CH9A 5AIHA 1OCVA 1GD4A 3G16A 2HMLB 3O8YA 2K0MA 5IERA 3UNLA 2D42A 3G4S3 5BVBA 3A76A 4BTYA 5LC7A 1LOXA 3V99A 3NQZA 4ORLA 5LC6A 3N54B 2ZDJA 3NM2A 1UI8A 1CYVA 4HZBB 1R4CA 5I97A 3CXC2 1W02A 3CCR3 1BUQA 1FGRA 1E3RA 3FLJA 4TX4A 3S29A 2BT3A 3CME3 1A67A 1TFKA 3DMCA 3I553 3KN4A 4XBXA 5CXOA 5JBSA 1TUHA 2CW9A 4WYKA 7STDA 5IEPA 1DYUA 3QK9A 5ELUA 5IF6A 3PXMA 1S5AA 3UJMA 3EF8A 3DGNA 4AKZA 1JKGA 5G2GA 1KSIA 2W2CA 3MHEA 5AIGA 2ML5A 1PFPA 1WMOA 1IT8A 1TP6A 4O8SA 3CMA3 4WYKB 3X41A 1IT7A 2XSHB 3IPTA 2QEX3 1EKMA 3SXXA 1AR0A 3SLUA 3GZXB 6STDA 1JKGB 3PZWA 1PU4A 3LTBA 3PS8A 2OCTA 2CG1A 1O7MB 1OPYA 3FKAA 4EC6A 2FNQA 4WWUC 1HU9A 5DRVA 1WMNA 1DMMA 2SBLA 4EBGA 1VQ53 3JUMA 3WODG 4HYZA 1JV2B 3S28A 2K54A 3K63A 3NXJA 5TGNA 3CCS3 1Q824 1J2BA 2V1LA 2XEPA 2W6JH 4HM5B 3CCJ3 3NV0B 4MMXB 3AMOA 3F7XA 1UI7A 3MYTA 2ZL8A 2Z76A 3HZPA 5BXQA 1EQKA 3WA2X 3MPHA 4RBNA 1K734 1OF5B 2PZVA 5JPPA 1VQO3 1DMQA 1Z1SA 4BTWA 2CC3A 1WTHA 4Q53A 3RDEA 4FMAA 3AMOB 2HMKB 4JRFA 3LXUX 1Q42A 3DY5A 1N5HA 5STDA 3FH1A 1D6UA 1NB5I 3M8CA 4KFFA 1LVNA 1GS3A 1Q814 2BMQB 3BNDA 2GEXA 1YVBI 1W7CA 3F9SA 1IQ8A 2KRTA 1QALA 2FXTA 1RKYA 4KFEA 1AVKA 3X3YA 1OHSA 1D6YA 4XBTA 3KKGA 4XM4A 2D1WA 1RRLA 2A15A 1RN7A 3NQYA 4HM3B 2STDA 2XF3A 1HKXA 1VQ73 4IPBA 3OWSA 1UW1A 3LZAA 4LGQA 1IVUA 3H3HA 4WP5A 3OWYA 4RZMA 1DVCA 1OHPA 2GXFA 1VQK3 4OVMA 3DGOA 4FMBA 5AEUB 3DXOA 1T5YA 1ROVA 3ROBA 3GWRA 2GBXB 1G96A 1FGMA 3KSPA 3KIIA 4EV5A 1AV4A 5EQLA 3DGMA 5IEOA 3CCU3 3ALAA 3N8BA 3FG4A 1GY6A 3BB9A 3F7SA 3GZYB 3GRDA 2ML6A 3V92A 2XFTA 5AIIA 2CKFB 5DREA 1FUWA 1O7PB 3MG3A 2W9QA 3B4PA 1N9JA 1W5ZA 3CD63 1JN5A 4X2HA 3MWZA 3X3XA 1Y4KA 1NB3I 4JF8A 4XDWA 2XRXB 4K1VA 2UX0A 4MJDA 3WDGB 2F86B 1KQS2 3I563 1W6CA 2CK3H 1MNLA 4WHAA 3OX9A 2GBWB 2W03A 2JQ5A 4HM0B 3D3LA 3EQQB 1JN5B 3BLZA 3LTAA 4FCMA 1IDPA 5FW5A 2W56A 3WMDA 2CFGA 4HKVB 1IK3A 5EEOA 4FR9A 3B4OA 2O3OA 4N6V0 3NUVA 2QIYA 1FGQA 3CCM3 3T0UA 3CNMA 2BMRB 2XR8B 1TU5A 3K0ZA 1OGZA 4LMIA 3N9HA 1U5OA 2HMJB 2HMNB 2W56B 2P38A 4HVNA 3CC23 1U8CB 1JJ22 3QRDA 2CWVA 1IVXA 2YX9A 4LZIA 5EVHA 3S27A 4HM7B 4MEIA 4FCZA 4PEJA 1FGTA 3EE1A 1C7HA 2E2UA 3L0RA 4HBRA 1JB2A 2OOVA 4EXRA 1RRHA 1WQLB 3NV0A 2P0XA 3HK4A 1MOLA 1NWWA 3CCE3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV9 A;  1CEW I;  3Q2P A;  4IT7 A;  1YVB I;  2BO9 B;  1N5P A;  3IMA B;  3UL6 A;  1STF I;  4CCV A;  3PYJ A;  4N6O B;  1A90 A;  3LH4 A;  1DVD A;  1RN7 A;  2CH9 A;  1GD4 A;  4N6T A;  4N6N B;  2O9U X;  1DVC A;  5LC7 A;  3KFQ C;  1GD3 A;  5LC6 A;  1CYV A;  1R4C A;  3NX0 A;  2KXG A;  4EYC A;  5A0O B;  4TX4 A;  1A67 A;  1G96 A;  3K9M C;  1KWI A;  5EQL A;  1M9G A;  5ELU A;  3PXM A;  1PFP A;  1FUW A;  1WNH A;  1LXE A;  2W9Q A;  3S67 A;  1N9J A;  3GAX A;  3MWZ A;  1NB3 I;  3PS8 A;  2OCT A;  4N6L A;  3UL5 A;  5ELJ A;  1MNL A;  4N6V 0;  3SVA A;  1EQK A;  3QRD A;  1TIJ A;  4N6M A;  4LZI A;  4N6U A;  1IV7 A;  3L0R A;  2W9P A;  1FA3 A;  4ZM8 A;  3KSE D;  1MOL A;  1CYU A;  1N5H A;  1ROA A;  1NB5 I; 
#chains in the Genus database with same CATH topology
 4LEH A;  1IQY A;  3EX9 A;  2LQV A;  4FMC A;  2E2T A;  1C54 A;  1OF5 A;  4IT7 A;  1W6G A;  1VQ9 3;  2HMM B;  3CNX A;  3Q1C A;  2BO9 B;  4KZ1 A;  4GSP A;  2CFD A;  1STF I;  4CCV A;  4OUQ A;  3AGO A;  1LNI A;  2OOV C;  3SOA A;  1A2P A;  1MWR A;  2P09 A;  1SQW A;  3ZFZ A;  3EC9 A;  1YHQ 3;  1X1U A;  4RNY A;  4XB5 A;  2YFJ B;  2WOH A;  3EN8 A;  1M1K 4;  3X40 A;  3G71 3;  1DVD A;  1A2K A;  3Q90 A;  5KP3 A;  1RCL A;  5IG4 A;  2C10 A;  5FGO A;  2WOF A;  3IJE B;  1I70 A;  4GL6 A;  1EUI C;  2KF3 A;  3HI7 A;  1ISK A;  1Q86 4;  2IUK A;  2Z77 A;  4N6T A;  1BUJ A;  1TJD A;  1ULI B;  1BIR A;  4N6N B;  1E97 A;  5JPU A;  4GHO A;  4KVH A;  1BNS A;  1O7G B;  3EHC A;  3KFQ C;  1IVW A;  2CG0 A;  5AI1 A;  1SJW A;  3B8L A;  1Q40 B;  1YJ9 3;  3NX0 A;  2KXG A;  2YFI B;  3FF0 A;  5BU4 A;  7GSP A;  9RNT A;  5AIF A;  4FMD A;  1KD1 4;  2F98 A;  3URP A;  3MKI A;  4FCJ A;  1AVL A;  1YVS A;  1SII A;  2CIU A;  4O02 B;  4XBY A;  3F40 A;  3FZW A;  4HZ9 B;  1B21 A;  1YJW 3;  1DET A;  1HZ1 A;  1KWI A;  1IVV A;  2KAA A;  2KF6 A;  2K3D A;  1T2H A;  2W04 A;  1M9G A;  3HX8 A;  2L4V A;  3CPW 2;  4L8O A;  3DZL A;  4R4K A;  2IY2 A;  2KF4 A;  2SAR A;  2QGU A;  5AYR B;  2R4I A;  3AGN A;  2ZA4 A;  3NBR A;  1GY7 A;  1M1X B;  3VSY A;  1Q9E A;  1W4N A;  3OXA A;  1O7W B;  3GZB A;  1G02 A;  1O7N B;  4IIA A;  5IG5 A;  1D6Z A;  4NHF A;  1AY7 A;  1UUV B;  3JUP A;  1QAF A;  3DH2 A;  1GOY A;  1LXE A;  3S67 A;  1STD A;  1BNF A;  3BNC A;  3FG1 A;  1VQ8 3;  1RGE A;  1QVG 2;  2OTL 3;  4EV2 A;  2CFW A;  1OUN A;  1JBS A;  4MMY B;  3J7Y d;  1SPU A;  1QAK A;  3SOY A;  1B27 A;  1RCK A;  1W00 A;  5ELJ A;  2RGQ A;  1FZU A;  4U13 A;  2XH9 A;  1OGX A;  3BNB A;  2CHC A;  1LOW A;  3HIG A;  1GSP A;  2L1S A;  3MG1 A;  1RMS A;  5AYS C;  4L7K A;  4BU4 A;  3LML A;  3PCS A;  1DE3 A;  1YI2 3;  5CF2 A;  1JB4 A;  2FGT A;  4H3U A;  2OQE A;  1IU7 A;  1I2E A;  3UB1 A;  4LYL B;  1L5G B;  4J8T A;  1NU3 A;  3WA3 A;  3HII A;  4J9A A;  1ZX2 A;  3AHS A;  3VF1 A;  4K61 A;  3U97 A;  4HJL B;  5IG3 A;  1N8Q A;  3G6E 3;  1I0X A;  4WFO A;  1OH0 A;  3MSO A;  1B2Z A;  3SVA A;  1GMQ A;  1YIJ 3;  3SX1 A;  2H0G A;  4O3V A;  1TIJ A;  4X2O A;  1BGS A;  2CWU A;  2OQE C;  3FF2 A;  2H0H A;  5G1L A;  1YNV X;  3S5C A;  4HOH A;  1RJO A;  2MF7 A;  1UUW B;  3U1W A;  1JBR A;  3JUO A;  1IV7 A;  1MGR A;  1BSD A;  2Q07 A;  3ECF A;  4HAA A;  2F56 A;  1BSE A;  2W9P A;  2CX1 A;  4ZM8 A;  4O2H A;  1OHO A;  2J8X B;  2Y74 A;  3KSE D;  1UDI I;  3FG3 A;  1CYU A;  1ROA A;  1W2Z A;  3FGY A;  2R41 A;  3KZT A;  2AAD A;  2IYJ A;  2GU3 A;  3Q2P A;  1TFO A;  5HGR A;  1OAC A;  2W0Q A;  3VGN A;  4NRE A;  1BNE A;  1EA2 A;  1K41 A;  3G0K A;  3IMA B;  4MMZ B;  3UL6 A;  3LOY A;  3F14 A;  3EN1 B;  3CCV 3;  5KP1 A;  1SAR A;  3T8N A;  1VQP 3;  3E99 A;  3ER7 A;  3NM7 A;  1BOX A;  4XDV A;  1A90 A;  2F5W A;  1JB5 A;  2CX0 A;  1CQS A;  5RNT A;  1QJG A;  1R4Y A;  3I0Y A;  2BMO B;  1RHL A;  3NHX A;  1K8A 4;  4HM6 B;  3X42 A;  4CDL A;  2Z7A A;  1RN1 A;  4STD A;  1B2U A;  2RFR A;  2O9U X;  1NJI 4;  1FUT A;  1N9E A;  1SIH A;  2YFL B;  5M1A A;  1GD3 A;  1UGH I;  3CCQ 3;  3ZG5 A;  4L8P A;  1K9M 4;  1ZGX A;  1B2S A;  3DUK A;  4EYC A;  1VZZ A;  2KCD A;  5A0O B;  3SED A;  1ULJ B;  1WMP A;  3H51 A;  3JVC A;  3CPO A;  1CH0 A;  1YGE A;  2XGN A;  3JUN A;  2IUJ A;  3K9M C;  3FSD A;  1FGO A;  2GU1 A;  5M19 A;  3OWU A;  2F99 A;  3B7C A;  3PGB A;  4K1U A;  1ZO2 A;  3LT9 A;  1E3V A;  1US1 A;  1Q40 A;  1I0V A;  6RNT A;  2GEY A;  3STD A;  4N3V A;  1TRP A;  1X1X A;  3RGA A;  5CF1 A;  2BHM A;  2CFL A;  4RNT A;  3WOF B;  2CWT A;  3EJV A;  1BSC A;  3JUQ A;  4J5G A;  3F8X A;  1GYB A;  2UUG C;  3WOE B;  5AEW B;  1V74 A;  1BRJ A;  1YIT 3;  1VQL 3;  3G8Z A;  1WNH A;  4R9K A;  3GAX A;  2INX A;  4CPK A;  3CCL 3;  1QVF 2;  1ASK A;  1UCJ A;  2XFS A;  1PYL A;  3D9R A;  2Y73 A;  3EBT A;  1VQN 3;  4HM4 B;  2C11 A;  2BNG A;  1AQZ A;  3UL5 A;  1JNQ A;  4N6L A;  3FCS B;  5HOH A;  1V57 A;  3NBB A;  4AKY A;  3OW2 2;  1LOY A;  2JDI H;  5CK6 A;  3T8U A;  1VQM 3;  1FYS A;  1KC8 4;  3LTD A;  2MC8 A;  2Z6B A;  1B2M A;  2OTJ 3;  2WGQ A;  3WR2 A;  1BAO A;  7RNT A;  3DGL A;  2HMO B;  4K90 B;  2RSX A;  5D82 A;  2B1X B;  3OV4 A;  4H61 A;  1UGI A;  2QA4 3;  2P05 A;  1Q7Y 4;  2IMJ A;  1DMN A;  1W6Y A;  4QWT A;  2WGO A;  1I3F A;  4GB5 A;  3TDG A;  5KP4 A;  3CC7 3;  2HOH A;  1YJN 3;  1NO3 A;  5D83 A;  4AEQ A;  2XGL A;  2PNC A;  3NBJ A;  4R9L A;  3RGR A;  4LSO A;  1BNG A;  1NDO B;  1QMA A;  2E2V A;  4OK0 A;  5IG0 A;  3EBY A;  4N6M A;  1M90 4;  1NNV A;  3KE7 A;  1BRS A;  8RNT A;  3MG2 A;  4N6U A;  5CLK A;  2B24 B;  3EB8 A;  2IA7 A;  5IEN A;  1LQM B;  1IQX A;  2LYX A;  1FA3 A;  1W01 A;  3F8H A;  3GZR A;  5IW9 A;  1K28 A;  2RNT A;  4KFD A;  5D81 A;  1N8R 4;  1A2V A;  3BNE A;  1JRQ A;  1HYF A;  4I4K A;  3X3Z A;  1LNH A;  1IV9 A;  1VQQ A;  3LYG A;  4HM2 B;  4CJN A;  1O7H B;  1CEW I;  1UCL A;  2RCD A;  3CC4 3;  1VQ4 3;  4R80 A;  1Q7H A;  1GY5 A;  3LT8 A;  1EG9 B;  1ZS7 A;  3HOH A;  3K7C A;  1BNR A;  1N5P A;  3DM8 A;  1S72 3;  3LTC A;  2WO0 A;  4G1M B;  2XSO B;  2I9W A;  3Q3F A;  2CFK A;  4BTX A;  4R1K A;  3PCR A;  1RDS A;  2OWP A;  3PYJ A;  2P0M A;  1MGW A;  8CHO A;  1F8N A;  3CU3 A;  4N6O B;  1VQ6 3;  2AAE A;  2M7O A;  3K5T A;  3LH4 A;  1W2B 2;  4HM1 B;  4HM8 B;  4RNZ A;  1LRA A;  2ZHX B;  1BNI A;  2CH9 A;  5AIH A;  1OCV A;  1GD4 A;  3G16 A;  2HML B;  3O8Y A;  2K0M A;  5IER A;  3UNL A;  2D42 A;  1BRN L;  3G4S 3;  5BVB A;  3A76 A;  4BTY A;  5LC7 A;  1LOX A;  3V99 A;  3NQZ A;  4ORL A;  5LC6 A;  3N54 B;  2ZDJ A;  3NM2 A;  1UI8 A;  1CYV A;  4HZB B;  1R4C A;  5I97 A;  3CXC 2;  1V58 A;  1TTO A;  1W02 A;  3CCR 3;  1BUQ A;  1BNJ A;  1FGR A;  1E3R A;  3FLJ A;  1RGF A;  4TX4 A;  3S29 A;  2BT3 A;  1GOU A;  3CME 3;  1TFK A;  4BL2 A;  1A67 A;  3DMC A;  3I55 3;  1B3S A;  3KN4 A;  4XBX A;  5CXO A;  5JBS A;  1TUH A;  2CW9 A;  1RGG A;  4WYK A;  7STD A;  1RGA A;  5IEP A;  1BU4 A;  1DYU A;  3QK9 A;  1X1Y A;  2RBI A;  3AHW A;  5ELU A;  3PXM A;  3WHO A;  1S5A A;  5IF6 A;  3UJM A;  3EF8 A;  3DGN A;  4AKZ A;  1JKG A;  5G2G A;  1KSI A;  2BU4 A;  2W2C A;  3MHE A;  5AIG A;  2ML5 A;  1PFP A;  1WMO A;  1IT8 A;  1TP6 A;  4O8S A;  3CMA 3;  4WYK B;  3X41 A;  1IT7 A;  2XSH B;  3IPT A;  2QEX 3;  1EKM A;  3SXX A;  1AR0 A;  3SLU A;  3GZX B;  6STD A;  1JKG B;  1I3I A;  3PZW A;  1PU4 A;  3LTB A;  3PS8 A;  2OCT A;  2CG1 A;  1BVI A;  1O7M B;  1OPY A;  4DKI A;  1B2X A;  3FKA A;  1BRI A;  4EC6 A;  2FNQ A;  4WWU C;  1HU9 A;  1X1W A;  1LQG C;  5DRV A;  1WMN A;  1DMM A;  2SBL A;  1UUG B;  4EBG A;  3JUM A;  1VQ5 3;  3WOD G;  4HYZ A;  1JV2 B;  3S28 A;  2F4Y A;  1MWT A;  2K54 A;  3K63 A;  3NXJ A;  5TGN A;  3CCS 3;  1RGC A;  1Q82 4;  1J2B A;  2V1L A;  2XEP A;  2W6J H;  4HM5 B;  4J5K A;  5M18 A;  3CCJ 3;  1MWU A;  1BSA A;  3NV0 B;  4MMX B;  3AMO A;  3F7X A;  1UI7 A;  3MYT A;  2ZL8 A;  2Z76 A;  3HZP A;  5BXQ A;  1EQK A;  3WA2 X;  3MPH A;  4RBN A;  1K73 4;  1LOV A;  1OF5 B;  2PZV A;  5JPP A;  1VQO 3;  1DMQ A;  3KCH A;  1Z1S A;  4BTW A;  2CC3 A;  1WTH A;  4Q53 A;  3RDE A;  1I8V A;  1B20 A;  4FMA A;  3AMO B;  2HMK B;  4JRF A;  3LXU X;  1Q42 A;  3DY5 A;  1N5H A;  5STD A;  4EW5 A;  3FH1 A;  1D6U A;  1NB5 I;  3M8C A;  4KFF A;  1LVN A;  1GS3 A;  1Q81 4;  2BMQ B;  1TRQ A;  3BND A;  3DGY A;  2GEX A;  1YVB I;  1W7C A;  3F9S A;  1IQ8 A;  4ILF A;  2KRT A;  1QAL A;  3SYU A;  2FXT A;  1RKY A;  1GMP A;  1JZD A;  4KFE A;  1RGK A;  1AVK A;  3X3Y A;  3BIR A;  1OHS A;  1D6Y A;  4XBT A;  1MWS A;  1T3B A;  3KKG A;  4XM4 A;  1JBT A;  2D1W A;  1RRL A;  2A15 A;  1RN7 A;  3NQY A;  4HM3 B;  1EEJ A;  1FUS A;  2STD A;  1HKX A;  1RNT A;  2XF3 A;  4IPB A;  1VQ7 3;  3OWS A;  1FW7 A;  1UW1 A;  3LZA A;  4LGQ A;  1IVU A;  3H3H A;  4WP5 A;  1UCI A;  3OWY A;  4RZM A;  1DVC A;  1OHP A;  2GXF A;  1G0T A;  1I2F A;  4KT3 B;  1VQK 3;  4OVM A;  3DGO A;  4FMB A;  4I5Q A;  3D5I A;  5AEU B;  3DXO A;  1UCK A;  1T5Y A;  1ROV A;  3D4A A;  1BAN A;  3ROB A;  3GWR A;  2H0I A;  2GBX B;  5BIR A;  1G96 A;  1FGM A;  3KSP A;  4BIR A;  3KII A;  4EV5 A;  1AV4 A;  2GSP A;  1BSB A;  5EQL A;  3DGM A;  5IEO A;  3CCU 3;  1BRK A;  3ALA A;  3GSP A;  3N8B A;  4BL3 A;  3FG4 A;  1GOV A;  4NPB A;  1GY6 A;  3D79 A;  5G1K A;  3BB9 A;  2UGI A;  3F7S A;  6GSP A;  3GZY B;  3A5E A;  2ML6 A;  3GRD A;  2XFT A;  5AII A;  3V92 A;  1RNB A;  2CKF B;  5DRE A;  2F5M A;  1O7P B;  1FUW A;  3MG3 A;  1T2I A;  2W9Q A;  3B4P A;  1N9J A;  1W5Z A;  3ZG0 A;  3CD6 3;  1JN5 A;  1RSN A;  4X2H A;  3MWZ A;  1RTU A;  1RN4 A;  3X3X A;  1Y4K A;  1NB3 I;  1PY3 A;  4JF8 A;  4XDW A;  2XRX B;  4K1V A;  2UX0 A;  4MJD A;  3WDG B;  3BU4 A;  2F86 B;  1KQS 2;  3I56 3;  1W6C A;  2CK3 H;  3V98 A;  1MNL A;  4WHA A;  2KF5 A;  3OX9 A;  2GBW B;  2W03 A;  2JQ5 A;  4HM0 B;  3D3L A;  3EQQ B;  1JN5 B;  1I2G A;  1JZO A;  3BLZ A;  3LTA A;  1IDP A;  4FCM A;  5FW5 A;  2W56 A;  3WMD A;  2CFG A;  4HKV B;  1IK3 A;  5EEO A;  4FR9 A;  3B4O A;  2O3O A;  4N6V 0;  3NUV A;  2QIY A;  1FGQ A;  3RNT A;  3CCM 3;  3T0U A;  3CNM A;  2BMR B;  2XR8 B;  1TU5 A;  3K0Z A;  1OGZ A;  4LMI A;  1IYY A;  2BIR A;  3N9H A;  1U5O A;  2HMJ B;  2HMN B;  2W56 B;  2P38 A;  3D5G A;  4HVN A;  1U8C B;  3CC2 3;  1JJ2 2;  3QRD A;  1GMR A;  1IVX A;  1RGH A;  2CWV A;  2YX9 A;  4LZI A;  5EVH A;  3S27 A;  4HM7 B;  4MEI A;  4FCZ A;  1BRH A;  1RLS A;  4PEJ A;  1FGT A;  3EE1 A;  1BRG A;  1C7H A;  2E2U A;  5GSP A;  3L0R A;  4HBR A;  1YGW A;  1JB2 A;  2OOV A;  2C4B A;  4EXR A;  1RRH A;  1WQL B;  3NV0 A;  2P0X A;  3HK4 A;  1MOL A;  1RGL A;  1NWW A;  3CCE 3; 
#chains in the Genus database with same CATH homology
 4LEH A;  1IQY A;  3EX9 A;  2LQV A;  4FMC A;  2E2T A;  1OF5 A;  4IT7 A;  1W6G A;  1VQ9 3;  2HMM B;  3CNX A;  3Q1C A;  2BO9 B;  4KZ1 A;  2CFD A;  1STF I;  4CCV A;  4OUQ A;  2OOV C;  3SOA A;  2P09 A;  1SQW A;  1YHQ 3;  3EC9 A;  4RNY A;  4XB5 A;  2YFJ B;  2WOH A;  3EN8 A;  1M1K 4;  3X40 A;  3G71 3;  1DVD A;  1A2K A;  3Q90 A;  5KP3 A;  5IG4 A;  2C10 A;  5FGO A;  2WOF A;  3IJE B;  4GL6 A;  3HI7 A;  1Q86 4;  2IUK A;  2Z77 A;  4N6T A;  1ULI B;  4N6N B;  1E97 A;  5JPU A;  4KVH A;  1O7G B;  3EHC A;  3KFQ C;  1IVW A;  2CG0 A;  5AI1 A;  1SJW A;  3B8L A;  1Q40 B;  1YJ9 3;  3NX0 A;  2KXG A;  2YFI B;  3FF0 A;  5AIF A;  4FMD A;  1KD1 4;  2F98 A;  3MKI A;  4FCJ A;  1AVL A;  4O02 B;  1SII A;  2CIU A;  4XBY A;  3F40 A;  3FZW A;  4HZ9 B;  1YJW 3;  1KWI A;  3RGA A;  1IVV A;  3CPW 2;  3HX8 A;  2W04 A;  1M9G A;  2L4V A;  4L8O A;  3DZL A;  4R4K A;  5AYR B;  2QGU A;  2R4I A;  3VSY A;  3NBR A;  1GY7 A;  1M1X B;  1W4N A;  3OXA A;  1O7W B;  3GZB A;  1O7N B;  4IIA A;  5IG5 A;  1D6Z A;  4NHF A;  1UUV B;  3JUP A;  1QAF A;  1LXE A;  3S67 A;  1STD A;  3BNC A;  1VQ8 3;  3FG1 A;  1QVG 2;  2OTL 3;  4EV2 A;  2CFW A;  1OUN A;  4MMY B;  3J7Y d;  1SPU A;  1QAK A;  3SOY A;  1W00 A;  5ELJ A;  2RGQ A;  4U13 A;  2XH9 A;  1OGX A;  3BNB A;  2CHC A;  3HIG A;  3MG1 A;  5AYS C;  4L7K A;  3LML A;  3PCS A;  1YI2 3;  5CF2 A;  1JB4 A;  2FGT A;  4H3U A;  2OQE A;  1IU7 A;  3UB1 A;  1L5G B;  4J8T A;  1NU3 A;  3WA3 A;  3HII A;  4J9A A;  1ZX2 A;  3VF1 A;  4K61 A;  3U97 A;  4HJL B;  5IG3 A;  1N8Q A;  3G6E 3;  4WFO A;  1OH0 A;  3MSO A;  3SVA A;  1YIJ 3;  3SX1 A;  4O3V A;  1TIJ A;  4X2O A;  3FF2 A;  2CWU A;  2OQE C;  3S5C A;  3V98 A;  1ISK A;  1RJO A;  2MF7 A;  1UUW B;  3U1W A;  3JUO A;  1IV7 A;  2Q07 A;  3ECF A;  2W9P A;  4ZM8 A;  4O2H A;  1OHO A;  2Y74 A;  3KSE D;  3FG3 A;  1CYU A;  1ROA A;  1W2Z A;  3FGY A;  3KZT A;  2GU3 A;  3Q2P A;  1TFO A;  5HGR A;  1OAC A;  2W0Q A;  3VGN A;  4NRE A;  1EA2 A;  1K41 A;  3IMA B;  3G0K A;  4MMZ B;  3UL6 A;  3LOY A;  3F14 A;  3EN1 B;  3CCV 3;  5KP1 A;  3T8N A;  1VQP 3;  3E99 A;  3ER7 A;  3NM7 A;  4XDV A;  1A90 A;  1JB5 A;  1CQS A;  1QJG A;  3I0Y A;  2BMO B;  3NHX A;  1K8A 4;  4HM6 B;  3X42 A;  4CDL A;  2Z7A A;  4STD A;  2RFR A;  2O9U X;  1NJI 4;  1SIH A;  1N9E A;  2YFL B;  1GD3 A;  3CCQ 3;  4L8P A;  1K9M 4;  3DUK A;  4EYC A;  1VZZ A;  2KCD A;  5A0O B;  3SED A;  1ULJ B;  1WMP A;  3H51 A;  3JVC A;  3CPO A;  1YGE A;  2XGN A;  3JUN A;  2IUJ A;  3K9M C;  3FSD A;  1FGO A;  2GU1 A;  3OWU A;  2F99 A;  3B7C A;  3PGB A;  4K1U A;  1ZO2 A;  3LT9 A;  1E3V A;  1US1 A;  1Q40 A;  2GEY A;  3STD A;  4N3V A;  5CF1 A;  2BHM A;  2CFL A;  3WOF B;  2CWT A;  3EJV A;  3JUQ A;  3F8X A;  1GYB A;  3WOE B;  5AEW B;  1V74 A;  1YIT 3;  1VQL 3;  3G8Z A;  1WNH A;  4R9K A;  3GAX A;  2INX A;  3CCL 3;  1QVF 2;  1ASK A;  2XFS A;  3D9R A;  3EBT A;  2Y73 A;  1VQN 3;  4HM4 B;  2C11 A;  2BNG A;  3UL5 A;  1JNQ A;  4N6L A;  3FCS B;  4AKY A;  3NBB A;  3OW2 2;  5CK6 A;  2JDI H;  3T8U A;  1VQM 3;  1KC8 4;  3LTD A;  2MC8 A;  2Z6B A;  2OTJ 3;  2WGQ A;  3DGL A;  2HMO B;  4K90 B;  2RSX A;  5D82 A;  2B1X B;  3OV4 A;  4H61 A;  2QA4 3;  2P05 A;  1Q7Y 4;  2IMJ A;  1DMN A;  1W6Y A;  4QWT A;  2WGO A;  4GB5 A;  3TDG A;  5KP4 A;  3CC7 3;  1YJN 3;  1NO3 A;  5D83 A;  4AEQ A;  2XGL A;  2PNC A;  3NBJ A;  4R9L A;  3RGR A;  4LSO A;  1NDO B;  1QMA A;  2E2V A;  4OK0 A;  5IG0 A;  3EBY A;  4N6M A;  1M90 4;  3KE7 A;  3MG2 A;  4N6U A;  5CLK A;  2B24 B;  3EB8 A;  2IA7 A;  5IEN A;  1IQX A;  2LYX A;  1FA3 A;  1W01 A;  3F8H A;  3GZR A;  5IW9 A;  1K28 A;  4KFD A;  5D81 A;  1N8R 4;  1A2V A;  3BNE A;  1JRQ A;  4I4K A;  3X3Z A;  1LNH A;  1IV9 A;  3LYG A;  4HM2 B;  1O7H B;  1CEW I;  2RCD A;  3CC4 3;  1VQ4 3;  4R80 A;  3LT8 A;  1GY5 A;  1EG9 B;  3K7C A;  1N5P A;  3DM8 A;  1S72 3;  3LTC A;  2WO0 A;  4G1M B;  2XSO B;  2I9W A;  2CFK A;  4BTX A;  4R1K A;  3PCR A;  2OWP A;  3PYJ A;  2P0M A;  8CHO A;  1F8N A;  3CU3 A;  4N6O B;  1VQ6 3;  2M7O A;  3K5T A;  3LH4 A;  1W2B 2;  4HM1 B;  4HM8 B;  4RNZ A;  2CH9 A;  5AIH A;  1OCV A;  1GD4 A;  3G16 A;  2HML B;  3O8Y A;  2K0M A;  5IER A;  3UNL A;  2D42 A;  3G4S 3;  5BVB A;  3A76 A;  4BTY A;  5LC7 A;  1LOX A;  3V99 A;  3NQZ A;  4ORL A;  5LC6 A;  3N54 B;  2ZDJ A;  3NM2 A;  1UI8 A;  1CYV A;  4HZB B;  1R4C A;  5I97 A;  3CXC 2;  1W02 A;  3CCR 3;  1BUQ A;  1FGR A;  1E3R A;  3FLJ A;  4TX4 A;  3S29 A;  2BT3 A;  3CME 3;  1A67 A;  1TFK A;  3DMC A;  3I55 3;  3KN4 A;  4XBX A;  5CXO A;  5JBS A;  1TUH A;  2CW9 A;  4WYK A;  7STD A;  5IEP A;  1DYU A;  3QK9 A;  5ELU A;  5IF6 A;  3PXM A;  1S5A A;  3UJM A;  3EF8 A;  3DGN A;  4AKZ A;  1JKG A;  5G2G A;  1KSI A;  2W2C A;  3MHE A;  5AIG A;  2ML5 A;  1PFP A;  1WMO A;  1IT8 A;  1TP6 A;  4O8S A;  3CMA 3;  4WYK B;  3X41 A;  1IT7 A;  2XSH B;  3IPT A;  2QEX 3;  1EKM A;  3SXX A;  1AR0 A;  3SLU A;  3GZX B;  6STD A;  1JKG B;  3PZW A;  1PU4 A;  3LTB A;  3PS8 A;  2OCT A;  2CG1 A;  1O7M B;  1OPY A;  3FKA A;  4EC6 A;  2FNQ A;  4WWU C;  1HU9 A;  5DRV A;  1WMN A;  1DMM A;  2SBL A;  4EBG A;  1VQ5 3;  3JUM A;  3WOD G;  4HYZ A;  1JV2 B;  3S28 A;  2K54 A;  3K63 A;  3NXJ A;  5TGN A;  3CCS 3;  1Q82 4;  1J2B A;  2V1L A;  2XEP A;  2W6J H;  4HM5 B;  3CCJ 3;  3NV0 B;  4MMX B;  3AMO A;  3F7X A;  1UI7 A;  3MYT A;  2ZL8 A;  2Z76 A;  3HZP A;  5BXQ A;  1EQK A;  3WA2 X;  3MPH A;  4RBN A;  1K73 4;  1OF5 B;  2PZV A;  5JPP A;  1VQO 3;  1DMQ A;  1Z1S A;  4BTW A;  2CC3 A;  1WTH A;  4Q53 A;  3RDE A;  4FMA A;  3AMO B;  2HMK B;  4JRF A;  3LXU X;  1Q42 A;  3DY5 A;  1N5H A;  5STD A;  3FH1 A;  1D6U A;  1NB5 I;  3M8C A;  4KFF A;  1LVN A;  1GS3 A;  1Q81 4;  2BMQ B;  3BND A;  2GEX A;  1YVB I;  1W7C A;  3F9S A;  1IQ8 A;  2KRT A;  1QAL A;  2FXT A;  1RKY A;  4KFE A;  1AVK A;  3X3Y A;  1OHS A;  1D6Y A;  4XBT A;  3KKG A;  4XM4 A;  2D1W A;  1RRL A;  2A15 A;  1RN7 A;  3NQY A;  4HM3 B;  2STD A;  2XF3 A;  1HKX A;  1VQ7 3;  4IPB A;  3OWS A;  1UW1 A;  3LZA A;  4LGQ A;  1IVU A;  3H3H A;  4WP5 A;  3OWY A;  4RZM A;  1DVC A;  1OHP A;  2GXF A;  1VQK 3;  4OVM A;  3DGO A;  4FMB A;  5AEU B;  3DXO A;  1T5Y A;  1ROV A;  3ROB A;  3GWR A;  2GBX B;  1G96 A;  1FGM A;  3KSP A;  3KII A;  4EV5 A;  1AV4 A;  5EQL A;  3DGM A;  5IEO A;  3CCU 3;  3ALA A;  3N8B A;  3FG4 A;  1GY6 A;  3BB9 A;  3F7S A;  3GZY B;  3GRD A;  2ML6 A;  3V92 A;  2XFT A;  5AII A;  2CKF B;  5DRE A;  1FUW A;  1O7P B;  3MG3 A;  2W9Q A;  3B4P A;  1N9J A;  1W5Z A;  3CD6 3;  1JN5 A;  4X2H A;  3MWZ A;  3X3X A;  1Y4K A;  1NB3 I;  4JF8 A;  4XDW A;  2XRX B;  4K1V A;  2UX0 A;  4MJD A;  3WDG B;  2F86 B;  1KQS 2;  3I56 3;  1W6C A;  2CK3 H;  1MNL A;  4WHA A;  3OX9 A;  2GBW B;  2W03 A;  2JQ5 A;  4HM0 B;  3D3L A;  3EQQ B;  1JN5 B;  3BLZ A;  3LTA A;  4FCM A;  1IDP A;  5FW5 A;  2W56 A;  3WMD A;  2CFG A;  4HKV B;  1IK3 A;  5EEO A;  4FR9 A;  3B4O A;  2O3O A;  4N6V 0;  3NUV A;  2QIY A;  1FGQ A;  3CCM 3;  3T0U A;  3CNM A;  2BMR B;  2XR8 B;  1TU5 A;  3K0Z A;  1OGZ A;  4LMI A;  3N9H A;  1U5O A;  2HMJ B;  2HMN B;  2W56 B;  2P38 A;  4HVN A;  3CC2 3;  1U8C B;  1JJ2 2;  3QRD A;  2CWV A;  1IVX A;  2YX9 A;  4LZI A;  5EVH A;  3S27 A;  4HM7 B;  4MEI A;  4FCZ A;  4PEJ A;  1FGT A;  3EE1 A;  1C7H A;  2E2U A;  3L0R A;  4HBR A;  1JB2 A;  2OOV A;  4EXR A;  1RRH A;  1WQL B;  3NV0 A;  2P0X A;  3HK4 A;  1MOL A;  1NWW A;  3CCE 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...