1NB5I

Crystal structure of stefin a in complex with cathepsin h
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin H
total genus 18
structure length 98
sequence length 98
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nb5I00
1EQKA 5A0OB 1N5HA 3PYJA 4N6MA 3S67A 3NX0A 1N5PA 1CYUA 4EYCA 2KXGA 3Q2PA 4CCVA 1ROAA 5ELJA 1A90A 1R4CA 4ZM8A 2CH9A 1FA3A 4IT7A 1GD3A 1MNLA 1NB5I 5ELUA 1WNHA 3IMAB 3LH4A 3MWZA 1KWIA 2W9QA 4N6LA 1IV9A 5LC6A 1A67A 4TX4A 1STFI 3KSED 1LXEA 4N6V0 5LC7A 1CEWI 1MOLA 1CYVA 2W9PA 1GD4A 2O9UX 1TIJA 4N6NB 1M9GA 4N6TA 1DVDA 1G96A 3UL6A 4N6UA 4LZIA 3PS8A 3QRDA 2BO9B 1IV7A 2OCTA 1N9JA 3KFQC 1YVBI 4N6OB 5EQLA 1RN7A 3UL5A 1FUWA 1DVCA 1PFPA 3L0RA 3K9MC 1NB3I 3GAXA 3SVAA 3PXMA
chains in the Genus database with same CATH superfamily
2CK3H 3MHEA 1I2FA 1FGRA 3FCSB 3S67A 3NX0A 2P0XA 1C54A 1TUHA 1TTOA 1FGTA 3HIIA 3WDGB 2F98A 3DY5A 4AKZA 4EYCA 1W4NA 1OGXA 5BIRA 3NBRA 3OWYA 4IIAA 4XBTA 2RGQA 3B4OA 1GMQA 1WNHA 1GY7A 1YNVX 1US1A 2K54A 2KAAA 3DGYA 5IG0A 3U1WA 1OHOA 4N6V0 3LTCA 1IVWA 2CIUA 4FCZA 3CCV3 2GXFA 1NNVA 6GSPA 1TP6A 3ALAA 4ORLA 4PEJA 2IUJA 1JBTA 3I0YA 4LZIA 5BVBA 3HK4A 8RNTA 1NDOB 1RRHA 4N6OB 1OH0A 1UDII 4EV5A 1HYFA 5KP1A 1JBRA 2XH9A 2K0MA 4XM4A 3FG1A 3HOHA 1A2PA 1QALA 1RGGA 3PYJA 3NM7A 4O02B 3BIRA 2XFSA 3WA2X 4R80A 4HM3B 3OXAA 1BRGA 1BANA 1BUQA 4FR9A 1IT7A 3SX1A 3D4AA 1BSCA 1KSIA 4GL6A 4O2HA 4WYKB 1BIRA 1R4YA 2W6JH 1LOVA 2H0HA 3KSED 4J9AA 2Y73A 3KCHA 1QVF2 2O9UX 1K734 2R4IA 1NJI4 3PZWA 5AIIA 5EEOA 1Q864 1UCKA 3EBTA 8CHOA 1K28A 3QRDA 2K3DA 1UUWB 2RSXA 5CF2A 1TFOA 1VQ63 3HZPA 3JUMA 3GZYB 1UCIA 4LMIA 5EQLA 1VQP3 1B2MA 1OF5B 1PFPA 2HMMB 3KSPA 2IMJA 1BRSA 3JVCA 3ROBA 1VQN3 4STDA 1EQKA 4RBNA 3D3LA 1Y4KA 4KFFA 1YIT3 2H0IA 4HM7B 3H3HA 5AEUB 2AADA 4R4KA 2IY2A 1QJGA 1OACA 4HZBB 1WMOA 3WMDA 1WMPA 1SQWA 2KRTA 5BU4A 3CME3 3OX9A 1YIJ3 3NQZA 1A90A 1OPYA 3N54B 1MNLA 1Q824 3DXOA 3OWUA 4N6LA 2RNTA 1IV9A 4HYZA 2E2UA 2Z6BA 3BNBA 1BRNL 3EB8A 2PNCA 3V99A 1GY6A 3ZFZA 3SOYA 3DGOA 3I563 1O7WB 1T2IA 2XSOB 4MMYB 4BTYA 1SIHA 3NXJA 4R9LA 4QWTA 2F4YA 3DGMA 3EX9A 3KFQC 3SLUA 5AIGA 2D42A 1I2EA 2XF3A 1HKXA 5D81A 4XBXA 1JZDA 1W6YA 4I5QA 3JUNA 5BXQA 1FGMA 2BT3A 1RGEA 4FMAA 2QEX3 1EEJA 1W7CA 2ZL8A 1W6CA 3CC23 2BU4A 3BU4A 1B3SA 3QK9A 3LOYA 1QMAA 3DMCA 1ROAA 2P05A 4LGQA 1Q814 1VQL3 1VQ83 3CNMA 1VQQA 3D5GA 3MG1A 1LRAA 1BRIA 5ELUA 3LH4A 3AHWA 1JKGB 3DZLA 3Q90A 1MWRA 3AHSA 1N9EA 1RGAA 4EW5A 2OQEC 1UW1A 1G96A 3AMOA 1W00A 2ML6A 3NHXA 1O7HB 1JNQA 5M1AA 1BNSA 1RN7A 1J2BA 4JF8A 3DGNA 1IU7A 1X1WA 3KKGA 4BU4A 4OUQA 3B7CA 2RBIA 4AEQA 2W2CA 4ILFA 1RMSA 2CFLA 5EVHA 1W2B2 3CD63 2QGUA 4O3VA 2SARA 2W56B 3LTAA 1I0VA 1M904 1DMNA 2W04A 4KFDA 1RGHA 1BSDA 2BIRA 4ZM8A 5KP4A 2CHCA 4G1MB 5D83A 3B8LA 3CXC2 2E2VA 3AMOB 4AKYA 2WOHA 1G0TA 4EXRA 1LOXA 4MMZB 5IW9A 3ZG0A 1FW7A 3WOEB 1B2XA 2CX0A 3WA3A 4NREA 3VSYA 2F86B 4NPBA 3GZBA 4FMCA 3K0ZA 1WTHA 3NBJA 4BTXA 4KT3B 3GZXB 3LMLA 1MGWA 2C4BA 2OTJ3 2WOFA 3LXUX 1Q40A 1JN5A 4WYKA 1MWSA 2KXGA 3A76A 5CK6A 5STDA 3NQYA 1BNRA 6STDA 4HM4B 3EBYA 3K7CA 3RNTA 1QAFA 4HM8B 1SJWA 3I553 5FGOA 2W9QA 2WO0A 3WR2A 5LC7A 1V58A 2SBLA 1QAKA 1TRPA 1ZX2A 3UNLA 4N6TA 2W03A 1DVDA 1I2GA 1DETA 2UX0A 2HMLB 1GY5A 1TFKA 3S27A 3FKAA 5IERA 1IK3A 1YGWA 4R1KA 4KVHA 1DMMA 3DUKA 2L4VA 1Q40B 3FG4A 2MC8A 3WHOA 3CCQ3 4HM2B 3UJMA 2FNQA 5IG4A 3MG3A 3SYUA 1DE3A 4HAAA 1JRQA 1OF5A 1FUTA 4HVNA 3G4S3 1K41A 1N8QA 1T2HA 2CFGA 3BNDA 3X41A 1A67A 4HM0B 1RN1A 2JQ5A 3FF0A 5IEPA 1MWTA 4MEIA 4CDLA 1JBSA 2CFWA 1MOLA 2IA7A 1CYVA 4WWUC 1JN5B 1MGRA 2HMJB 5GSPA 3EN1B 1SARA 5HOHA 1Q9EA 1YVSA 1JKGA 3FH1A 2F5MA 2CFKA 1RGCA 1YVBI 1E3VA 5I97A 1EKMA 1I0XA 2JDIH 1RRLA 3GWRA 1VQ73 2W56A 4BIRA 4K90B 2GBWB 5G1KA 3V98A 2W0QA 1IVVA 3CCE3 1Z1SA 1RGKA 1RLSA 3EJVA 5FW5A 1W6GA 1ZS7A 4Q53A 3HX8A 1RKYA 1YJN3 2QIYA 4IT7A 1NB5I 1JJ22 1SIIA 1ISKA 3D5IA 3FGYA 3BNCA 4LSOA 3E99A 5AYSC 2CW9A 1S723 3WOFB 2Z77A 1HZ1A 1OCVA 1STDA 2HMOB 2KF5A 2BO9B 3F8XA 5CXOA 4WHAA 1ROVA 5G1LA 5IG5A 3HIGA 4L8OA 3LT9A 7GSPA 3CC73 2E2TA 3ER7A 3PXMA 2F99A 3BLZA 2RCDA 3RGAA 2B24B 3PCSA 2XGLA 3S28A 4RNZA 4L7KA 3VGNA 1KQS2 4BL2A 1QVG2 3BB9A 1EUIC 4GSPA 1GS3A 3HI7A 3G713 1B21A 2J8XB 1GSPA 1PU4A 2Z7AA 3AGOA 2BHMA 1E97A 4DKIA 1F8NA 5M18A 2INXA 3TDGA 1D6UA 2R41A 2V1LA 4GHOA 1VQ43 1OHPA 2P38A 4HM5B 3SOAA 3CMA3 4X2OA 3ECFA 1BGSA 4EBGA 2BMOB 1O7NB 2BNGA 1BNJA 1GYBA 1UCLA 3S29A 1IVXA 4NHFA 3ZG5A 5CF1A 1LVNA 1GMRA 3EQQB 1JB5A 3PCRA 2RFRA 2Z76A 1TU5A 1IQYA 4N3VA 2WGQA 4HM6B 4GB5A 1S5AA 4R9KA 3CCM3 1JB2A 1VZZA 1BRJA 1RNTA 1ULJB 2CG1A 3CCU3 2XGNA 1B27A 1C7HA 3JUOA 1AVKA 2CH9A 3EHCA 4LEHA 1BVIA 1GD3A 1DMQA 4FCJA 4K61A 5CLKA 3J7Yd 4L8PA 4LYLB 1K9M4 1BSBA 3IPTA 1STFI 2YFJB 3VF1A 1BNFA 1TIJA 2GSPA 2XEPA 1W2ZA 2GEXA 4XB5A 1X1UA 4N6UA 1RSNA 3LZAA 2CX1A 2CG0A 1K8A4 1UUVB 1W02A 3LTDA 3FSDA 1Q7HA 3RGRA 1BUJA 1OUNA 3Q1CA 1RGLA 3MSOA 1BSAA 2BMQB 2F5WA 1W01A 1W5ZA 1IVUA 4OVMA 4MMXB 2XFTA 4J8TA 4JRFA 4FCMA 1FGOA 3G0KA 2WGOA 3T8NA 3CCJ3 2CWUA 1N5PA 2FXTA 3OW22 3DM8A 2GU3A 2QA43 9RNTA 4OK0A 1VQO3 1BSEA 1AR0A 1VQM3 1RCLA 2P09A 3F8HA 5IF6A 1Q42A 3IMAB 3FG3A 4MJDA 4RNTA 5LC6A 4HBRA 1Q7Y4 4U13A 1T5YA 1LXEA 3T0UA 1VQ53 2A15A 1ZGXA 1I3FA 3NUVA 1JZOA 1V57A 4BTWA 4HOHA 1D6ZA 1I3IA 1YI23 1FUWA 3X3ZA 3MYTA 3O8YA 1RGFA 1A2KA 1DVCA 3FF2A 1RTUA 2YFLB 1AQZA 1UUGB 3L0RA 1LOYA 2I9WA 5TGNA 3K63A 3STDA 2P0MA 1VQ93 4FMBA 3BNEA 3F7XA 4FMDA 2OTL3 1PY3A 1UGIA 4RZMA 1GOVA 5AEWB 3UB1A 1SPUA 3PGBA 5ELJA 2HOHA 1RHLA 2HMKB 6RNTA 3LT8A 3G16A 1YHQ3 1ZO2A 3LTBA 3K5TA 2STDA 1IQXA 3EC9A 1AV4A 4I4KA 4TX4A 3G6E3 1AVLA 4HKVB 1GD4A 4HM1B 2MF7A 1O7PB 3LYGA 5IG3A 1BNIA 1NU3A 3NV0A 3U97A 4XBYA 3PS8A 1ASKA 1BAOA 2L1SA 3FLJA 1JV2B 3CPOA 3F9SA 1U8CB 2ZA4A 1ULIB 1LQGC 1E3RA 1U5OA 3GAXA 5D82A 1IYYA 1V74A 4WP5A 1OGZA 1BRKA 4H3UA 4K1VA 5AI1A 1LNIA 5KP3A 5JPPA 3CCR3 3MKIA 1G02A 1CYUA 3SXXA 1B2ZA 3A5EA 1NO3A 3WODG 2F56A 2KF3A 1UCJA 1RDSA 3JUQA 1KWIA 3NV0B 3X3XA 3X40A 1B2UA 1KC84 1O7MB 3KZTA 4IPBA 5IEOA 1CEWI 3DGLA 3F40A 3RDEA 4RNYA 1TRQA 3UL6A 1IQ8A 1BU4A 5AYRB 2KCDA 1IV7A 2OCTA 1I70A 1N9JA 1FGQA 3UL5A 4CJNA 1FYSA 2OOVA 3EE1A 4J5KA 1N5HA 2Y74A 3S5CA 4O8SA 3CPW2 2UUGC 3CCS3 3Q2PA 1O7GB 1WMNA 1PYLA 1BNGA 3OV4A 3GSPA 5DRVA 2C11A 1B20A 1BOXA 2CKFB 1NWWA 4X2HA 2HMNB 4CPKA 1CQSA 2KF4A 5AIFA 3AGNA 3M8CA 1L5GB 3CC43 3T8UA 1RNBA 4BL3A 1YJW3 2GBXB 3F7SA 3JUPA 3CCL3 2UGIA 1X1XA 2ZHXB 3IJEB 4WFOA 3MG2A 1UGHI 1N8R4 1GMPA 1WQLB 7STDA 1D6YA 3SVAA 3Q3FA 1FZUA 3CNXA 5A0OB 1FUSA 3X42A 2D1WA 5M19A 1M1K4 1JB4A 2LYXA 2XRXB 3F14A 3KIIA 3DH2A 5HGRA 4J5GA 2XR8B 3N9HA 1HU9A 3FZWA 3D79A 5JPUA 1R4CA 2ZDJA 2XSHB 1GOUA 5JBSA 5G2GA 3OWSA 1B2SA 2OOVC 2CWVA 1KD14 1FA3A 3V92A 1EA2A 2YX9A 2W9PA 1MWUA 1AY7A 3URPA 4H61A 5AIHA 5RNTA 4N6NB 2CFDA 1M9GA 1VQK3 1CH0A 3D9RA 3EF8A 5IENA 2GEYA 4K1UA 1UI8A 2IYJA 1M1XB 1RJOA 1YGEA 2KF6A 3KE7A 1X1YA 5DREA 1EG9B 3EN8A 1LQMB 2FGTA 3GZRA 2O3OA 1TJDA 4XDWA 3X3YA 1I8VA 1NB3I 4HJLB 1YJ93 2PZVA 2AAEA 2BMRB 2M7OA 1GOYA 4KFEA 4N6MA 2OQEA 1BNEA 3MPHA 4EC6A 4CCVA 4EV2A 2LQVA 3KN4A 2ML5A 2IUKA 2YFIB 4HZ9B 4KZ1A 1IDPA 2GU1A 2Q07A 3SEDA 3MWZA 2CWTA 1LNHA 2OWPA 2C10A 2B1XB 1BRHA 2H0GA 3N8BA 1T3BA 1RN4A 3G8ZA 3NBBA 1DYUA 3H51A 3B4PA 1A2VA 1LOWA 1UI7A 4XDVA 1RCKA 3CU3A 7RNTA 3K9MC 3GRDA 1OHSA 3NM2A 1IT8A 2CC3A
chains in the Genus database with same CATH topology
2CK3H 3MHEA 1FGRA 3FCSB 3S67A 3NX0A 2P0XA 1TUHA 1FGTA 3HIIA 3WDGB 2F98A 3DY5A 4AKZA 4EYCA 1W4NA 1OGXA 3NBRA 3OWYA 4IIAA 4XBTA 2RGQA 3B4OA 1WNHA 1GY7A 1US1A 2K54A 5IG0A 3U1WA 1OHOA 4N6V0 3LTCA 1IVWA 2CIUA 4FCZA 3CCV3 2GXFA 1TP6A 3ALAA 4ORLA 4PEJA 2IUJA 3I0YA 4LZIA 5BVBA 3HK4A 1NDOB 1RRHA 4N6OB 1OH0A 4EV5A 5KP1A 2XH9A 2K0MA 4XM4A 3FG1A 1QALA 3PYJA 3NM7A 4O02B 2XFSA 3WA2X 4R80A 4HM3B 3OXAA 1BUQA 4FR9A 1IT7A 3SX1A 1KSIA 4GL6A 4O2HA 4WYKB 2W6JH 3KSED 4J9AA 2Y73A 1QVF2 2O9UX 1K734 2R4IA 1NJI4 3PZWA 5AIIA 5EEOA 1Q864 3EBTA 8CHOA 1K28A 3QRDA 1VQ63 1UUWB 2RSXA 5CF2A 1TFOA 3HZPA 3JUMA 3GZYB 4LMIA 5EQLA 1VQP3 1OF5B 1PFPA 2HMMB 3KSPA 2IMJA 3JVCA 3ROBA 1VQN3 4STDA 1EQKA 4RBNA 3D3LA 1Y4KA 4KFFA 1YIT3 4HM7B 3H3HA 5AEUB 4R4KA 1QJGA 1OACA 4HZBB 1WMOA 3WMDA 1WMPA 1SQWA 2KRTA 1YIJ3 3CME3 3OX9A 1A90A 3NQZA 1OPYA 3N54B 1MNLA 1Q824 3DXOA 3OWUA 4N6LA 1IV9A 4HYZA 2E2UA 2Z6BA 3BNBA 3EB8A 2PNCA 3V99A 1GY6A 3I563 3SOYA 3DGOA 1O7WB 2XSOB 4MMYB 4BTYA 1SIHA 3NXJA 4R9LA 4QWTA 3DGMA 3EX9A 3KFQC 3SLUA 5AIGA 2D42A 2XF3A 1HKXA 5D81A 4XBXA 1W6YA 5BXQA 3JUNA 1FGMA 2BT3A 4FMAA 2QEX3 1W7CA 2ZL8A 1W6CA 3CC23 3QK9A 3LOYA 1QMAA 3DMCA 1ROAA 2P05A 4LGQA 1Q814 1VQL3 1VQ83 3CNMA 3MG1A 5ELUA 3LH4A 1JKGB 3DZLA 3Q90A 1N9EA 2OQEC 1UW1A 1G96A 3AMOA 1W00A 2ML6A 3NHXA 1O7HB 1JNQA 1RN7A 1J2BA 4JF8A 3DGNA 1IU7A 3KKGA 4OUQA 3B7CA 4AEQA 2W2CA 2CFLA 5EVHA 1W2B2 3CD63 2QGUA 4O3VA 2W56B 3LTAA 1M904 1DMNA 2W04A 4KFDA 4ZM8A 5KP4A 2CHCA 4G1MB 5D83A 3B8LA 3CXC2 2E2VA 3AMOB 4AKYA 2WOHA 4EXRA 1LOXA 4MMZB 5IW9A 3WOEB 3WA3A 4NREA 3VSYA 2F86B 3GZBA 4FMCA 3K0ZA 1WTHA 3NBJA 4BTXA 3GZXB 3LMLA 2OTJ3 2WOFA 3LXUX 1Q40A 1JN5A 4WYKA 5CK6A 2KXGA 3A76A 5STDA 3NQYA 6STDA 4HM4B 3EBYA 3K7CA 1QAFA 4HM8B 1SJWA 3I553 5FGOA 2W9QA 2WO0A 5LC7A 2SBLA 1QAKA 1ZX2A 3UNLA 4N6TA 2W03A 1DVDA 2UX0A 2HMLB 1GY5A 1TFKA 3S27A 3FKAA 5IERA 1IK3A 4R1KA 4KVHA 1DMMA 3DUKA 2L4VA 1Q40B 3FG4A 2MC8A 3CCQ3 4HM2B 3UJMA 2FNQA 5IG4A 3MG3A 1JRQA 1OF5A 4HVNA 3G4S3 1K41A 1N8QA 2CFGA 3BNDA 3X41A 1A67A 4HM0B 2JQ5A 3FF0A 5IEPA 4CDLA 4MEIA 2CFWA 1MOLA 2IA7A 1CYVA 4WWUC 1JN5B 2HMJB 3EN1B 1JKGA 3FH1A 2CFKA 1YVBI 1E3VA 5I97A 1EKMA 2JDIH 1VQ73 1RRLA 3GWRA 2W56A 4K90B 2GBWB 3V98A 2W0QA 1IVVA 3CCE3 1Z1SA 3EJVA 5FW5A 1W6GA 4Q53A 3HX8A 1RKYA 1YJN3 2QIYA 4IT7A 1NB5I 1JJ22 1SIIA 1ISKA 3FGYA 3BNCA 4LSOA 3E99A 5AYSC 2CW9A 1S723 3WOFB 2Z77A 1OCVA 1STDA 2HMOB 3F8XA 2BO9B 5CXOA 4WHAA 1ROVA 5IG5A 3HIGA 4L8OA 3LT9A 3CC73 2E2TA 3ER7A 3PXMA 2F99A 3BLZA 2RCDA 3RGAA 2B24B 3PCSA 2XGLA 3S28A 4RNZA 4L7KA 3VGNA 1KQS2 1QVG2 3BB9A 1GS3A 3HI7A 3G713 1PU4A 2Z7AA 2BHMA 1E97A 1F8NA 2INXA 3TDGA 1D6UA 2V1LA 1VQ43 1OHPA 2P38A 4HM5B 3SOAA 3CMA3 4X2OA 3ECFA 4EBGA 2BMOB 1O7NB 2BNGA 1GYBA 3S29A 1IVXA 4NHFA 5CF1A 1LVNA 3EQQB 1JB5A 3PCRA 2RFRA 2Z76A 1TU5A 1IQYA 4N3VA 2WGQA 4HM6B 4GB5A 1S5AA 4R9KA 3CCM3 1JB2A 1VZZA 1ULJB 2CG1A 3CCU3 2XGNA 1C7HA 3JUOA 1AVKA 2CH9A 3EHCA 4LEHA 1FA3A 1GD3A 1DMQA 4FCJA 4K61A 5CLKA 3J7Yd 4L8PA 1K9M4 3IPTA 1STFI 2YFJB 3VF1A 1TIJA 2XEPA 1W2ZA 2GEXA 4XB5A 4N6UA 3LZAA 2CG0A 1K8A4 1UUVB 1W02A 3LTDA 3FSDA 3RGRA 1OUNA 3Q1CA 3MSOA 2BMQB 1W01A 1W5ZA 1IVUA 4OVMA 4MMXB 2XFTA 4J8TA 4JRFA 4FCMA 1FGOA 3G0KA 2WGOA 3T8NA 3CCJ3 2CWUA 1N5PA 2FXTA 3OW22 3DM8A 2GU3A 2QA43 4OK0A 1VQO3 1AR0A 1VQM3 2P09A 3F8HA 5IF6A 1Q42A 3IMAB 3FG3A 4MJDA 5LC6A 1Q7Y4 4HBRA 4U13A 1T5YA 1LXEA 3T0UA 1VQ53 2A15A 3NUVA 4BTWA 1D6ZA 1YI23 1FUWA 3X3ZA 3MYTA 3O8YA 1A2KA 1DVCA 3FF2A 3STDA 3L0RA 5TGNA 2I9WA 3K63A 2P0MA 1VQ93 4FMBA 3BNEA 3F7XA 4FMDA 2OTL3 4RZMA 5AEWB 3UB1A 1SPUA 3PGBA 5ELJA 2HMKB 3LT8A 3G16A 1YHQ3 1ZO2A 3LTBA 3K5TA 2STDA 3EC9A 1IQXA 1AV4A 4I4KA 4TX4A 3G6E3 1AVLA 4HKVB 1GD4A 4HM1B 2MF7A 1O7PB 3LYGA 5IG3A 1NU3A 3NV0A 3U97A 4XBYA 3PS8A 1ASKA 3FLJA 1JV2B 3CPOA 3F9SA 1U8CB 1ULIB 1E3RA 1U5OA 3GAXA 5D82A 1V74A 4WP5A 1OGZA 4H3UA 4K1VA 5AI1A 5KP3A 5JPPA 3CCR3 3MKIA 1CYUA 3SXXA 1NO3A 3WODG 3X3XA 3X40A 3JUQA 1KWIA 3NV0B 1KC84 1O7MB 3KZTA 4IPBA 5IEOA 1CEWI 3DGLA 3F40A 3RDEA 4RNYA 3UL6A 1IQ8A 5AYRB 2KCDA 1IV7A 2OCTA 1N9JA 1FGQA 3UL5A 2OOVA 3EE1A 1N5HA 2Y74A 3S5CA 4O8SA 3CPW2 3CCS3 3Q2PA 1O7GB 1WMNA 3OV4A 5DRVA 2C11A 2CKFB 1NWWA 4X2HA 2HMNB 1CQSA 5AIFA 3M8CA 1L5GB 3CC43 3T8UA 1YJW3 2GBXB 3F7SA 3JUPA 3CCL3 3IJEB 4WFOA 3MG2A 1N8R4 1WQLB 7STDA 1D6YA 3SVAA 5A0OB 3CNXA 3X42A 2D1WA 1M1K4 1JB4A 2LYXA 2XRXB 3F14A 3KIIA 5HGRA 2XR8B 3N9HA 1HU9A 3FZWA 5JPUA 1R4CA 2ZDJA 2XSHB 5JBSA 5G2GA 3OWSA 2OOVC 2CWVA 1IT8A 1KD14 3V92A 2YX9A 1EA2A 2W9PA 4H61A 5AIHA 1VQK3 4N6NB 2CFDA 1M9GA 3D9RA 3EF8A 5IENA 2GEYA 4K1UA 1UI8A 1M1XB 1RJOA 1YGEA 3KE7A 5DREA 1EG9B 3EN8A 2FGTA 3GZRA 2O3OA 4XDWA 3X3YA 1NB3I 4HJLB 1YJ93 2PZVA 2BMRB 2M7OA 4KFEA 2OQEA 4N6MA 3MPHA 4EC6A 4CCVA 4EV2A 2LQVA 3KN4A 2ML5A 2IUKA 2YFIB 4HZ9B 4KZ1A 1IDPA 2GU1A 2Q07A 3SEDA 3MWZA 2CWTA 1LNHA 2OWPA 2C10A 2B1XB 3N8BA 3G8ZA 3NBBA 1DYUA 3H51A 3B4PA 1A2VA 1UI7A 4XDVA 3CU3A 3K9MC 3GRDA 1OHSA 3NM2A 2YFLB 2CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQK A;  5A0O B;  1N5H A;  3PYJ A;  4N6M A;  3S67 A;  3NX0 A;  1N5P A;  1CYU A;  4EYC A;  2KXG A;  3Q2P A;  4CCV A;  1ROA A;  5ELJ A;  1A90 A;  1R4C A;  4ZM8 A;  2CH9 A;  1FA3 A;  4IT7 A;  1GD3 A;  1MNL A;  1NB5 I;  5ELU A;  1WNH A;  3IMA B;  3LH4 A;  3MWZ A;  1KWI A;  2W9Q A;  4N6L A;  1IV9 A;  5LC6 A;  1A67 A;  4TX4 A;  1STF I;  3KSE D;  1LXE A;  4N6V 0;  5LC7 A;  1CEW I;  1MOL A;  1CYV A;  2W9P A;  1GD4 A;  2O9U X;  1TIJ A;  4N6N B;  1M9G A;  4N6T A;  1DVD A;  1G96 A;  3UL6 A;  4N6U A;  4LZI A;  3PS8 A;  3QRD A;  2BO9 B;  1IV7 A;  2OCT A;  1N9J A;  3KFQ C;  1YVB I;  4N6O B;  5EQL A;  1RN7 A;  3UL5 A;  1FUW A;  1DVC A;  1PFP A;  3L0R A;  3K9M C;  1NB3 I;  3GAX A;  3SVA A;  3PXM A; 
#chains in the Genus database with same CATH topology
 2CK3 H;  3MHE A;  1I2F A;  1FGR A;  3FCS B;  3S67 A;  3NX0 A;  2P0X A;  1C54 A;  1TUH A;  1TTO A;  1FGT A;  3HII A;  3WDG B;  2F98 A;  3DY5 A;  4AKZ A;  4EYC A;  1W4N A;  1OGX A;  5BIR A;  3NBR A;  3OWY A;  4IIA A;  4XBT A;  2RGQ A;  3B4O A;  1GMQ A;  1WNH A;  1GY7 A;  1YNV X;  1US1 A;  2K54 A;  2KAA A;  3DGY A;  5IG0 A;  3U1W A;  1OHO A;  4N6V 0;  3LTC A;  1IVW A;  2CIU A;  4FCZ A;  3CCV 3;  2GXF A;  1NNV A;  6GSP A;  1TP6 A;  3ALA A;  4ORL A;  4PEJ A;  2IUJ A;  1JBT A;  3I0Y A;  4LZI A;  5BVB A;  3HK4 A;  8RNT A;  1NDO B;  1RRH A;  4N6O B;  1OH0 A;  1UDI I;  4EV5 A;  1HYF A;  5KP1 A;  1JBR A;  2XH9 A;  2K0M A;  4XM4 A;  3FG1 A;  3HOH A;  1A2P A;  1QAL A;  1RGG A;  3PYJ A;  3NM7 A;  4O02 B;  3BIR A;  2XFS A;  3WA2 X;  4R80 A;  4HM3 B;  3OXA A;  1BRG A;  1BAN A;  1BUQ A;  4FR9 A;  1IT7 A;  3SX1 A;  3D4A A;  1BSC A;  1KSI A;  4GL6 A;  4O2H A;  4WYK B;  1BIR A;  1R4Y A;  2W6J H;  1LOV A;  2H0H A;  3KSE D;  4J9A A;  2Y73 A;  3KCH A;  1QVF 2;  2O9U X;  1K73 4;  2R4I A;  1NJI 4;  3PZW A;  5AII A;  5EEO A;  1Q86 4;  1UCK A;  3EBT A;  8CHO A;  1K28 A;  3QRD A;  2K3D A;  1UUW B;  2RSX A;  5CF2 A;  1TFO A;  1VQ6 3;  3HZP A;  3JUM A;  3GZY B;  1UCI A;  4LMI A;  5EQL A;  1VQP 3;  1B2M A;  1OF5 B;  1PFP A;  2HMM B;  3KSP A;  2IMJ A;  1BRS A;  3JVC A;  3ROB A;  1VQN 3;  4STD A;  1EQK A;  4RBN A;  3D3L A;  1Y4K A;  4KFF A;  1YIT 3;  2H0I A;  4HM7 B;  3H3H A;  5AEU B;  2AAD A;  4R4K A;  2IY2 A;  1QJG A;  1OAC A;  4HZB B;  1WMO A;  3WMD A;  1WMP A;  1SQW A;  2KRT A;  5BU4 A;  3CME 3;  3OX9 A;  1YIJ 3;  3NQZ A;  1A90 A;  1OPY A;  3N54 B;  1MNL A;  1Q82 4;  3DXO A;  3OWU A;  4N6L A;  2RNT A;  1IV9 A;  4HYZ A;  2E2U A;  2Z6B A;  3BNB A;  1BRN L;  3EB8 A;  2PNC A;  3V99 A;  1GY6 A;  3ZFZ A;  3SOY A;  3DGO A;  3I56 3;  1O7W B;  1T2I A;  2XSO B;  4MMY B;  4BTY A;  1SIH A;  3NXJ A;  4R9L A;  4QWT A;  2F4Y A;  3DGM A;  3EX9 A;  3KFQ C;  3SLU A;  5AIG A;  2D42 A;  1I2E A;  2XF3 A;  1HKX A;  5D81 A;  4XBX A;  1JZD A;  1W6Y A;  4I5Q A;  3JUN A;  5BXQ A;  1FGM A;  2BT3 A;  1RGE A;  4FMA A;  2QEX 3;  1EEJ A;  1W7C A;  2ZL8 A;  1W6C A;  3CC2 3;  2BU4 A;  3BU4 A;  1B3S A;  3QK9 A;  3LOY A;  1QMA A;  3DMC A;  1ROA A;  2P05 A;  4LGQ A;  1Q81 4;  1VQL 3;  1VQ8 3;  3CNM A;  1VQQ A;  3D5G A;  3MG1 A;  1LRA A;  1BRI A;  5ELU A;  3LH4 A;  3AHW A;  1JKG B;  3DZL A;  3Q90 A;  1MWR A;  3AHS A;  1N9E A;  1RGA A;  4EW5 A;  2OQE C;  1UW1 A;  1G96 A;  3AMO A;  1W00 A;  2ML6 A;  3NHX A;  1O7H B;  1JNQ A;  5M1A A;  1BNS A;  1RN7 A;  1J2B A;  4JF8 A;  3DGN A;  1IU7 A;  1X1W A;  3KKG A;  4BU4 A;  4OUQ A;  3B7C A;  2RBI A;  4AEQ A;  2W2C A;  4ILF A;  1RMS A;  2CFL A;  5EVH A;  1W2B 2;  3CD6 3;  2QGU A;  4O3V A;  2SAR A;  2W56 B;  3LTA A;  1I0V A;  1M90 4;  1DMN A;  2W04 A;  4KFD A;  1RGH A;  1BSD A;  2BIR A;  4ZM8 A;  5KP4 A;  2CHC A;  4G1M B;  5D83 A;  3B8L A;  3CXC 2;  2E2V A;  3AMO B;  4AKY A;  2WOH A;  1G0T A;  4EXR A;  1LOX A;  4MMZ B;  5IW9 A;  3ZG0 A;  1FW7 A;  3WOE B;  1B2X A;  2CX0 A;  3WA3 A;  4NRE A;  3VSY A;  2F86 B;  4NPB A;  3GZB A;  4FMC A;  3K0Z A;  1WTH A;  3NBJ A;  4BTX A;  4KT3 B;  3GZX B;  3LML A;  1MGW A;  2C4B A;  2OTJ 3;  2WOF A;  3LXU X;  1Q40 A;  1JN5 A;  4WYK A;  1MWS A;  2KXG A;  3A76 A;  5CK6 A;  5STD A;  3NQY A;  1BNR A;  6STD A;  4HM4 B;  3EBY A;  3K7C A;  3RNT A;  1QAF A;  4HM8 B;  1SJW A;  3I55 3;  5FGO A;  2W9Q A;  2WO0 A;  3WR2 A;  5LC7 A;  1V58 A;  2SBL A;  1QAK A;  1TRP A;  1ZX2 A;  3UNL A;  4N6T A;  2W03 A;  1DVD A;  1I2G A;  1DET A;  2UX0 A;  2HML B;  1GY5 A;  1TFK A;  3S27 A;  3FKA A;  5IER A;  1IK3 A;  1YGW A;  4R1K A;  4KVH A;  1DMM A;  3DUK A;  2L4V A;  1Q40 B;  3FG4 A;  2MC8 A;  3WHO A;  3CCQ 3;  4HM2 B;  3UJM A;  2FNQ A;  5IG4 A;  3MG3 A;  3SYU A;  1DE3 A;  4HAA A;  1JRQ A;  1OF5 A;  1FUT A;  4HVN A;  3G4S 3;  1K41 A;  1N8Q A;  1T2H A;  2CFG A;  3BND A;  3X41 A;  1A67 A;  4HM0 B;  1RN1 A;  2JQ5 A;  3FF0 A;  5IEP A;  1MWT A;  4MEI A;  4CDL A;  1JBS A;  2CFW A;  1MOL A;  2IA7 A;  1CYV A;  4WWU C;  1JN5 B;  1MGR A;  2HMJ B;  5GSP A;  3EN1 B;  1SAR A;  5HOH A;  1Q9E A;  1YVS A;  1JKG A;  3FH1 A;  2F5M A;  2CFK A;  1RGC A;  1YVB I;  1E3V A;  5I97 A;  1EKM A;  1I0X A;  2JDI H;  1RRL A;  3GWR A;  1VQ7 3;  2W56 A;  4BIR A;  4K90 B;  2GBW B;  5G1K A;  3V98 A;  2W0Q A;  1IVV A;  3CCE 3;  1Z1S A;  1RGK A;  1RLS A;  3EJV A;  5FW5 A;  1W6G A;  1ZS7 A;  4Q53 A;  3HX8 A;  1RKY A;  1YJN 3;  2QIY A;  4IT7 A;  1NB5 I;  1JJ2 2;  1SII A;  1ISK A;  3D5I A;  3FGY A;  3BNC A;  4LSO A;  3E99 A;  5AYS C;  2CW9 A;  1S72 3;  3WOF B;  2Z77 A;  1HZ1 A;  1OCV A;  1STD A;  2HMO B;  2KF5 A;  2BO9 B;  3F8X A;  5CXO A;  4WHA A;  1ROV A;  5G1L A;  5IG5 A;  3HIG A;  4L8O A;  3LT9 A;  7GSP A;  3CC7 3;  2E2T A;  3ER7 A;  3PXM A;  2F99 A;  3BLZ A;  2RCD A;  3RGA A;  2B24 B;  3PCS A;  2XGL A;  3S28 A;  4RNZ A;  4L7K A;  3VGN A;  1KQS 2;  4BL2 A;  1QVG 2;  3BB9 A;  1EUI C;  4GSP A;  1GS3 A;  3HI7 A;  3G71 3;  1B21 A;  2J8X B;  1GSP A;  1PU4 A;  2Z7A A;  3AGO A;  2BHM A;  1E97 A;  4DKI A;  1F8N A;  5M18 A;  2INX A;  3TDG A;  1D6U A;  2R41 A;  2V1L A;  4GHO A;  1VQ4 3;  1OHP A;  2P38 A;  4HM5 B;  3SOA A;  3CMA 3;  4X2O A;  3ECF A;  1BGS A;  4EBG A;  2BMO B;  1O7N B;  2BNG A;  1BNJ A;  1GYB A;  1UCL A;  3S29 A;  1IVX A;  4NHF A;  3ZG5 A;  5CF1 A;  1LVN A;  1GMR A;  3EQQ B;  1JB5 A;  3PCR A;  2RFR A;  2Z76 A;  1TU5 A;  1IQY A;  4N3V A;  2WGQ A;  4HM6 B;  4GB5 A;  1S5A A;  4R9K A;  3CCM 3;  1JB2 A;  1VZZ A;  1BRJ A;  1RNT A;  1ULJ B;  2CG1 A;  3CCU 3;  2XGN A;  1B27 A;  1C7H A;  3JUO A;  1AVK A;  2CH9 A;  3EHC A;  4LEH A;  1BVI A;  1GD3 A;  1DMQ A;  4FCJ A;  4K61 A;  5CLK A;  3J7Y d;  4L8P A;  4LYL B;  1K9M 4;  1BSB A;  3IPT A;  1STF I;  2YFJ B;  3VF1 A;  1BNF A;  1TIJ A;  2GSP A;  2XEP A;  1W2Z A;  2GEX A;  4XB5 A;  1X1U A;  4N6U A;  1RSN A;  3LZA A;  2CX1 A;  2CG0 A;  1K8A 4;  1UUV B;  1W02 A;  3LTD A;  3FSD A;  1Q7H A;  3RGR A;  1BUJ A;  1OUN A;  3Q1C A;  1RGL A;  3MSO A;  1BSA A;  2BMQ B;  2F5W A;  1W01 A;  1W5Z A;  1IVU A;  4OVM A;  4MMX B;  2XFT A;  4J8T A;  4JRF A;  4FCM A;  1FGO A;  3G0K A;  2WGO A;  3T8N A;  3CCJ 3;  2CWU A;  1N5P A;  2FXT A;  3OW2 2;  3DM8 A;  2GU3 A;  2QA4 3;  9RNT A;  4OK0 A;  1VQO 3;  1BSE A;  1AR0 A;  1VQM 3;  1RCL A;  2P09 A;  3F8H A;  5IF6 A;  1Q42 A;  3IMA B;  3FG3 A;  4MJD A;  4RNT A;  5LC6 A;  4HBR A;  1Q7Y 4;  4U13 A;  1T5Y A;  1LXE A;  3T0U A;  1VQ5 3;  2A15 A;  1ZGX A;  1I3F A;  3NUV A;  1JZO A;  1V57 A;  4BTW A;  4HOH A;  1D6Z A;  1I3I A;  1YI2 3;  1FUW A;  3X3Z A;  3MYT A;  3O8Y A;  1RGF A;  1A2K A;  1DVC A;  3FF2 A;  1RTU A;  2YFL B;  1AQZ A;  1UUG B;  3L0R A;  1LOY A;  2I9W A;  5TGN A;  3K63 A;  3STD A;  2P0M A;  1VQ9 3;  4FMB A;  3BNE A;  3F7X A;  4FMD A;  2OTL 3;  1PY3 A;  1UGI A;  4RZM A;  1GOV A;  5AEW B;  3UB1 A;  1SPU A;  3PGB A;  5ELJ A;  2HOH A;  1RHL A;  2HMK B;  6RNT A;  3LT8 A;  3G16 A;  1YHQ 3;  1ZO2 A;  3LTB A;  3K5T A;  2STD A;  1IQX A;  3EC9 A;  1AV4 A;  4I4K A;  4TX4 A;  3G6E 3;  1AVL A;  4HKV B;  1GD4 A;  4HM1 B;  2MF7 A;  1O7P B;  3LYG A;  5IG3 A;  1BNI A;  1NU3 A;  3NV0 A;  3U97 A;  4XBY A;  3PS8 A;  1ASK A;  1BAO A;  2L1S A;  3FLJ A;  1JV2 B;  3CPO A;  3F9S A;  1U8C B;  2ZA4 A;  1ULI B;  1LQG C;  1E3R A;  1U5O A;  3GAX A;  5D82 A;  1IYY A;  1V74 A;  4WP5 A;  1OGZ A;  1BRK A;  4H3U A;  4K1V A;  5AI1 A;  1LNI A;  5KP3 A;  5JPP A;  3CCR 3;  3MKI A;  1G02 A;  1CYU A;  3SXX A;  1B2Z A;  3A5E A;  1NO3 A;  3WOD G;  2F56 A;  2KF3 A;  1UCJ A;  1RDS A;  3JUQ A;  1KWI A;  3NV0 B;  3X3X A;  3X40 A;  1B2U A;  1KC8 4;  1O7M B;  3KZT A;  4IPB A;  5IEO A;  1CEW I;  3DGL A;  3F40 A;  3RDE A;  4RNY A;  1TRQ A;  3UL6 A;  1IQ8 A;  1BU4 A;  5AYR B;  2KCD A;  1IV7 A;  2OCT A;  1I70 A;  1N9J A;  1FGQ A;  3UL5 A;  4CJN A;  1FYS A;  2OOV A;  3EE1 A;  4J5K A;  1N5H A;  2Y74 A;  3S5C A;  4O8S A;  3CPW 2;  2UUG C;  3CCS 3;  3Q2P A;  1O7G B;  1WMN A;  1PYL A;  1BNG A;  3OV4 A;  3GSP A;  5DRV A;  2C11 A;  1B20 A;  1BOX A;  2CKF B;  1NWW A;  4X2H A;  2HMN B;  4CPK A;  1CQS A;  2KF4 A;  5AIF A;  3AGN A;  3M8C A;  1L5G B;  3CC4 3;  3T8U A;  1RNB A;  4BL3 A;  1YJW 3;  2GBX B;  3F7S A;  3JUP A;  3CCL 3;  2UGI A;  1X1X A;  2ZHX B;  3IJE B;  4WFO A;  3MG2 A;  1UGH I;  1N8R 4;  1GMP A;  1WQL B;  7STD A;  1D6Y A;  3SVA A;  3Q3F A;  1FZU A;  3CNX A;  5A0O B;  1FUS A;  3X42 A;  2D1W A;  5M19 A;  1M1K 4;  1JB4 A;  2LYX A;  2XRX B;  3F14 A;  3KII A;  3DH2 A;  5HGR A;  4J5G A;  2XR8 B;  3N9H A;  1HU9 A;  3FZW A;  3D79 A;  5JPU A;  1R4C A;  2ZDJ A;  2XSH B;  1GOU A;  5JBS A;  5G2G A;  3OWS A;  1B2S A;  2OOV C;  2CWV A;  1KD1 4;  1FA3 A;  3V92 A;  1EA2 A;  2YX9 A;  2W9P A;  1MWU A;  1AY7 A;  3URP A;  4H61 A;  5AIH A;  5RNT A;  4N6N B;  2CFD A;  1M9G A;  1VQK 3;  1CH0 A;  3D9R A;  3EF8 A;  5IEN A;  2GEY A;  4K1U A;  1UI8 A;  2IYJ A;  1M1X B;  1RJO A;  1YGE A;  2KF6 A;  3KE7 A;  1X1Y A;  5DRE A;  1EG9 B;  3EN8 A;  1LQM B;  2FGT A;  3GZR A;  2O3O A;  1TJD A;  4XDW A;  3X3Y A;  1I8V A;  1NB3 I;  4HJL B;  1YJ9 3;  2PZV A;  2AAE A;  2BMR B;  2M7O A;  1GOY A;  4KFE A;  4N6M A;  2OQE A;  1BNE A;  3MPH A;  4EC6 A;  4CCV A;  4EV2 A;  2LQV A;  3KN4 A;  2ML5 A;  2IUK A;  2YFI B;  4HZ9 B;  4KZ1 A;  1IDP A;  2GU1 A;  2Q07 A;  3SED A;  3MWZ A;  2CWT A;  1LNH A;  2OWP A;  2C10 A;  2B1X B;  1BRH A;  2H0G A;  3N8B A;  1T3B A;  1RN4 A;  3G8Z A;  3NBB A;  1DYU A;  3H51 A;  3B4P A;  1A2V A;  1LOW A;  1UI7 A;  4XDV A;  1RCK A;  3CU3 A;  7RNT A;  3K9M C;  3GRD A;  1OHS A;  3NM2 A;  1IT8 A;  2CC3 A; 
#chains in the Genus database with same CATH homology
 2CK3 H;  3MHE A;  1FGR A;  3FCS B;  3S67 A;  3NX0 A;  2P0X A;  1TUH A;  1FGT A;  3HII A;  3WDG B;  2F98 A;  3DY5 A;  4AKZ A;  4EYC A;  1W4N A;  1OGX A;  3NBR A;  3OWY A;  4IIA A;  4XBT A;  2RGQ A;  3B4O A;  1WNH A;  1GY7 A;  1US1 A;  2K54 A;  5IG0 A;  3U1W A;  1OHO A;  4N6V 0;  3LTC A;  1IVW A;  2CIU A;  4FCZ A;  3CCV 3;  2GXF A;  1TP6 A;  3ALA A;  4ORL A;  4PEJ A;  2IUJ A;  3I0Y A;  4LZI A;  5BVB A;  3HK4 A;  1NDO B;  1RRH A;  4N6O B;  1OH0 A;  4EV5 A;  5KP1 A;  2XH9 A;  2K0M A;  4XM4 A;  3FG1 A;  1QAL A;  3PYJ A;  3NM7 A;  4O02 B;  2XFS A;  3WA2 X;  4R80 A;  4HM3 B;  3OXA A;  1BUQ A;  4FR9 A;  1IT7 A;  3SX1 A;  1KSI A;  4GL6 A;  4O2H A;  4WYK B;  2W6J H;  3KSE D;  4J9A A;  2Y73 A;  1QVF 2;  2O9U X;  1K73 4;  2R4I A;  1NJI 4;  3PZW A;  5AII A;  5EEO A;  1Q86 4;  3EBT A;  8CHO A;  1K28 A;  3QRD A;  1VQ6 3;  1UUW B;  2RSX A;  5CF2 A;  1TFO A;  3HZP A;  3JUM A;  3GZY B;  4LMI A;  5EQL A;  1VQP 3;  1OF5 B;  1PFP A;  2HMM B;  3KSP A;  2IMJ A;  3JVC A;  3ROB A;  1VQN 3;  4STD A;  1EQK A;  4RBN A;  3D3L A;  1Y4K A;  4KFF A;  1YIT 3;  4HM7 B;  3H3H A;  5AEU B;  4R4K A;  1QJG A;  1OAC A;  4HZB B;  1WMO A;  3WMD A;  1WMP A;  1SQW A;  2KRT A;  1YIJ 3;  3CME 3;  3OX9 A;  1A90 A;  3NQZ A;  1OPY A;  3N54 B;  1MNL A;  1Q82 4;  3DXO A;  3OWU A;  4N6L A;  1IV9 A;  4HYZ A;  2E2U A;  2Z6B A;  3BNB A;  3EB8 A;  2PNC A;  3V99 A;  1GY6 A;  3I56 3;  3SOY A;  3DGO A;  1O7W B;  2XSO B;  4MMY B;  4BTY A;  1SIH A;  3NXJ A;  4R9L A;  4QWT A;  3DGM A;  3EX9 A;  3KFQ C;  3SLU A;  5AIG A;  2D42 A;  2XF3 A;  1HKX A;  5D81 A;  4XBX A;  1W6Y A;  5BXQ A;  3JUN A;  1FGM A;  2BT3 A;  4FMA A;  2QEX 3;  1W7C A;  2ZL8 A;  1W6C A;  3CC2 3;  3QK9 A;  3LOY A;  1QMA A;  3DMC A;  1ROA A;  2P05 A;  4LGQ A;  1Q81 4;  1VQL 3;  1VQ8 3;  3CNM A;  3MG1 A;  5ELU A;  3LH4 A;  1JKG B;  3DZL A;  3Q90 A;  1N9E A;  2OQE C;  1UW1 A;  1G96 A;  3AMO A;  1W00 A;  2ML6 A;  3NHX A;  1O7H B;  1JNQ A;  1RN7 A;  1J2B A;  4JF8 A;  3DGN A;  1IU7 A;  3KKG A;  4OUQ A;  3B7C A;  4AEQ A;  2W2C A;  2CFL A;  5EVH A;  1W2B 2;  3CD6 3;  2QGU A;  4O3V A;  2W56 B;  3LTA A;  1M90 4;  1DMN A;  2W04 A;  4KFD A;  4ZM8 A;  5KP4 A;  2CHC A;  4G1M B;  5D83 A;  3B8L A;  3CXC 2;  2E2V A;  3AMO B;  4AKY A;  2WOH A;  4EXR A;  1LOX A;  4MMZ B;  5IW9 A;  3WOE B;  3WA3 A;  4NRE A;  3VSY A;  2F86 B;  3GZB A;  4FMC A;  3K0Z A;  1WTH A;  3NBJ A;  4BTX A;  3GZX B;  3LML A;  2OTJ 3;  2WOF A;  3LXU X;  1Q40 A;  1JN5 A;  4WYK A;  5CK6 A;  2KXG A;  3A76 A;  5STD A;  3NQY A;  6STD A;  4HM4 B;  3EBY A;  3K7C A;  1QAF A;  4HM8 B;  1SJW A;  3I55 3;  5FGO A;  2W9Q A;  2WO0 A;  5LC7 A;  2SBL A;  1QAK A;  1ZX2 A;  3UNL A;  4N6T A;  2W03 A;  1DVD A;  2UX0 A;  2HML B;  1GY5 A;  1TFK A;  3S27 A;  3FKA A;  5IER A;  1IK3 A;  4R1K A;  4KVH A;  1DMM A;  3DUK A;  2L4V A;  1Q40 B;  3FG4 A;  2MC8 A;  3CCQ 3;  4HM2 B;  3UJM A;  2FNQ A;  5IG4 A;  3MG3 A;  1JRQ A;  1OF5 A;  4HVN A;  3G4S 3;  1K41 A;  1N8Q A;  2CFG A;  3BND A;  3X41 A;  1A67 A;  4HM0 B;  2JQ5 A;  3FF0 A;  5IEP A;  4CDL A;  4MEI A;  2CFW A;  1MOL A;  2IA7 A;  1CYV A;  4WWU C;  1JN5 B;  2HMJ B;  3EN1 B;  1JKG A;  3FH1 A;  2CFK A;  1YVB I;  1E3V A;  5I97 A;  1EKM A;  2JDI H;  1VQ7 3;  1RRL A;  3GWR A;  2W56 A;  4K90 B;  2GBW B;  3V98 A;  2W0Q A;  1IVV A;  3CCE 3;  1Z1S A;  3EJV A;  5FW5 A;  1W6G A;  4Q53 A;  3HX8 A;  1RKY A;  1YJN 3;  2QIY A;  4IT7 A;  1NB5 I;  1JJ2 2;  1SII A;  1ISK A;  3FGY A;  3BNC A;  4LSO A;  3E99 A;  5AYS C;  2CW9 A;  1S72 3;  3WOF B;  2Z77 A;  1OCV A;  1STD A;  2HMO B;  3F8X A;  2BO9 B;  5CXO A;  4WHA A;  1ROV A;  5IG5 A;  3HIG A;  4L8O A;  3LT9 A;  3CC7 3;  2E2T A;  3ER7 A;  3PXM A;  2F99 A;  3BLZ A;  2RCD A;  3RGA A;  2B24 B;  3PCS A;  2XGL A;  3S28 A;  4RNZ A;  4L7K A;  3VGN A;  1KQS 2;  1QVG 2;  3BB9 A;  1GS3 A;  3HI7 A;  3G71 3;  1PU4 A;  2Z7A A;  2BHM A;  1E97 A;  1F8N A;  2INX A;  3TDG A;  1D6U A;  2V1L A;  1VQ4 3;  1OHP A;  2P38 A;  4HM5 B;  3SOA A;  3CMA 3;  4X2O A;  3ECF A;  4EBG A;  2BMO B;  1O7N B;  2BNG A;  1GYB A;  3S29 A;  1IVX A;  4NHF A;  5CF1 A;  1LVN A;  3EQQ B;  1JB5 A;  3PCR A;  2RFR A;  2Z76 A;  1TU5 A;  1IQY A;  4N3V A;  2WGQ A;  4HM6 B;  4GB5 A;  1S5A A;  4R9K A;  3CCM 3;  1JB2 A;  1VZZ A;  1ULJ B;  2CG1 A;  3CCU 3;  2XGN A;  1C7H A;  3JUO A;  1AVK A;  2CH9 A;  3EHC A;  4LEH A;  1FA3 A;  1GD3 A;  1DMQ A;  4FCJ A;  4K61 A;  5CLK A;  3J7Y d;  4L8P A;  1K9M 4;  3IPT A;  1STF I;  2YFJ B;  3VF1 A;  1TIJ A;  2XEP A;  1W2Z A;  2GEX A;  4XB5 A;  4N6U A;  3LZA A;  2CG0 A;  1K8A 4;  1UUV B;  1W02 A;  3LTD A;  3FSD A;  3RGR A;  1OUN A;  3Q1C A;  3MSO A;  2BMQ B;  1W01 A;  1W5Z A;  1IVU A;  4OVM A;  4MMX B;  2XFT A;  4J8T A;  4JRF A;  4FCM A;  1FGO A;  3G0K A;  2WGO A;  3T8N A;  3CCJ 3;  2CWU A;  1N5P A;  2FXT A;  3OW2 2;  3DM8 A;  2GU3 A;  2QA4 3;  4OK0 A;  1VQO 3;  1AR0 A;  1VQM 3;  2P09 A;  3F8H A;  5IF6 A;  1Q42 A;  3IMA B;  3FG3 A;  4MJD A;  5LC6 A;  1Q7Y 4;  4HBR A;  4U13 A;  1T5Y A;  1LXE A;  3T0U A;  1VQ5 3;  2A15 A;  3NUV A;  4BTW A;  1D6Z A;  1YI2 3;  1FUW A;  3X3Z A;  3MYT A;  3O8Y A;  1A2K A;  1DVC A;  3FF2 A;  3STD A;  3L0R A;  5TGN A;  2I9W A;  3K63 A;  2P0M A;  1VQ9 3;  4FMB A;  3BNE A;  3F7X A;  4FMD A;  2OTL 3;  4RZM A;  5AEW B;  3UB1 A;  1SPU A;  3PGB A;  5ELJ A;  2HMK B;  3LT8 A;  3G16 A;  1YHQ 3;  1ZO2 A;  3LTB A;  3K5T A;  2STD A;  3EC9 A;  1IQX A;  1AV4 A;  4I4K A;  4TX4 A;  3G6E 3;  1AVL A;  4HKV B;  1GD4 A;  4HM1 B;  2MF7 A;  1O7P B;  3LYG A;  5IG3 A;  1NU3 A;  3NV0 A;  3U97 A;  4XBY A;  3PS8 A;  1ASK A;  3FLJ A;  1JV2 B;  3CPO A;  3F9S A;  1U8C B;  1ULI B;  1E3R A;  1U5O A;  3GAX A;  5D82 A;  1V74 A;  4WP5 A;  1OGZ A;  4H3U A;  4K1V A;  5AI1 A;  5KP3 A;  5JPP A;  3CCR 3;  3MKI A;  1CYU A;  3SXX A;  1NO3 A;  3WOD G;  3X3X A;  3X40 A;  3JUQ A;  1KWI A;  3NV0 B;  1KC8 4;  1O7M B;  3KZT A;  4IPB A;  5IEO A;  1CEW I;  3DGL A;  3F40 A;  3RDE A;  4RNY A;  3UL6 A;  1IQ8 A;  5AYR B;  2KCD A;  1IV7 A;  2OCT A;  1N9J A;  1FGQ A;  3UL5 A;  2OOV A;  3EE1 A;  1N5H A;  2Y74 A;  3S5C A;  4O8S A;  3CPW 2;  3CCS 3;  3Q2P A;  1O7G B;  1WMN A;  3OV4 A;  5DRV A;  2C11 A;  2CKF B;  1NWW A;  4X2H A;  2HMN B;  1CQS A;  5AIF A;  3M8C A;  1L5G B;  3CC4 3;  3T8U A;  1YJW 3;  2GBX B;  3F7S A;  3JUP A;  3CCL 3;  3IJE B;  4WFO A;  3MG2 A;  1N8R 4;  1WQL B;  7STD A;  1D6Y A;  3SVA A;  5A0O B;  3CNX A;  3X42 A;  2D1W A;  1M1K 4;  1JB4 A;  2LYX A;  2XRX B;  3F14 A;  3KII A;  5HGR A;  2XR8 B;  3N9H A;  1HU9 A;  3FZW A;  5JPU A;  1R4C A;  2ZDJ A;  2XSH B;  5JBS A;  5G2G A;  3OWS A;  2OOV C;  2CWV A;  1IT8 A;  1KD1 4;  3V92 A;  2YX9 A;  1EA2 A;  2W9P A;  4H61 A;  5AIH A;  1VQK 3;  4N6N B;  2CFD A;  1M9G A;  3D9R A;  3EF8 A;  5IEN A;  2GEY A;  4K1U A;  1UI8 A;  1M1X B;  1RJO A;  1YGE A;  3KE7 A;  5DRE A;  1EG9 B;  3EN8 A;  2FGT A;  3GZR A;  2O3O A;  4XDW A;  3X3Y A;  1NB3 I;  4HJL B;  1YJ9 3;  2PZV A;  2BMR B;  2M7O A;  4KFE A;  2OQE A;  4N6M A;  3MPH A;  4EC6 A;  4CCV A;  4EV2 A;  2LQV A;  3KN4 A;  2ML5 A;  2IUK A;  2YFI B;  4HZ9 B;  4KZ1 A;  1IDP A;  2GU1 A;  2Q07 A;  3SED A;  3MWZ A;  2CWT A;  1LNH A;  2OWP A;  2C10 A;  2B1X B;  3N8B A;  3G8Z A;  3NBB A;  1DYU A;  3H51 A;  3B4P A;  1A2V A;  1UI7 A;  4XDV A;  3CU3 A;  3K9M C;  3GRD A;  1OHS A;  3NM2 A;  2YFL B;  2CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...