1R4CA

N-truncated human cystatin c; dimeric form with 3d domain swapping
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
b'GGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin C
molecule tags Hydrolase inhibitor
source organism Homo sapiens
publication title Domain swapping in N-truncated human cystatin C.
pubmed doi rcsb
total genus 19
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1r4cA00
1RN7A 2KXGA 5LC6A 3SVAA 3LH4A 1NB5I 1IV9A 2OCTA 3QRDA 1CYUA 1LXEA 4N6LA 1N5PA 3PS8A 1G96A 3PYJA 4IT7A 1A90A 3S67A 3PXMA 4N6TA 1A67A 2BO9B 1DVDA 1IV7A 4N6MA 1STFI 3NX0A 4TX4A 1GD3A 3Q2PA 1NB3I 4N6OB 3KSED 2O9UX 1M9GA 2W9QA 1TIJA 1EQKA 4LZIA 4EYCA 3L0RA 3UL5A 1FA3A 3K9MC 1CEWI 1FUWA 4ZM8A 5ELJA 1MOLA 1ROAA 3MWZA 1YVBI 4N6V0 1PFPA 1CYVA 1N5HA 5LC7A 5EQLA 1GD4A 3UL6A 4N6UA 5A0OB 1KWIA 2CH9A 4CCVA 1MNLA 2W9PA 5ELUA 4N6NB 1N9JA 3IMAB 3KFQC 1R4CA 1DVCA 3GAXA 1WNHA
chains in the Genus database with same CATH superfamily
2OTL3 2KF3A 2OOVC 3NM2A 1W7CA 1DMQA 4HM1B 2CK3H 4L8OA 3NBBA 5G2GA 4HKVB 1B2XA 3FH1A 2ML6A 3D5GA 4FMDA 4R9KA 1YJW3 3GZYB 3EBYA 3ALAA 3NX0A 2KAAA 3X41A 1GD3A 1TJDA 1LQGC 4H61A 1RNBA 2LQVA 3BNDA 2A15A 1D6UA 2BMOB 3MYTA 3DXOA 4H3UA 4HYZA 4OUQA 5AIHA 3EHCA 3EQQB 3V99A 4EYCA 4R80A 1YJN3 2OQEA 1A67A 1YI23 1RTUA 1BSAA 2CC3A 3BIRA 1RLSA 1GMQA 4HM5B 1IK3A 2W03A 1A2PA 3KKGA 1BSEA 5IG3A 1IVVA 2BT3A 4NHFA 4EV5A 1YNVX 3IMAB 1GY5A 1DE3A 3N54B 3WHOA 3X42A 4RZMA 4KZ1A 4BIRA 1G02A 3NBJA 3NV0A 2IUKA 4EW5A 1RDSA 5IF6A 1B21A 3STDA 4WHAA 1YGEA 1VQK3 1LRAA 3CC23 5IEPA 1G96A 1W6GA 2CFKA 1BRNL 2QGUA 5I97A 1PU4A 1WMNA 1DMNA 3DGLA 1N8QA 2YFJB 3BB9A 3GZRA 3KZTA 4J8TA 5IEOA 1IT8A 1BNGA 5KP1A 1EUIC 1G0TA 3MWZA 1BRHA 1UUWB 3NHXA 4HM0B 2GU1A 1WQLB 1JB5A 1AY7A 3CCU3 1JB2A 1VQQA 5TGNA 3PCSA 2L1SA 1T5YA 3Q1CA 3F8XA 1BIRA 3BNCA 4QWTA 5BXQA 1JBRA 4CJNA 1HU9A 5CF2A 3ZFZA 4N6TA 1X1UA 2UUGC 1BNRA 4MEIA 3SEDA 3EJVA 1M9GA 2W9QA 4STDA 2IY2A 1JKGB 1IVUA 3NQZA 3OWUA 1IU7A 3CME3 3K9MC 4NREA 2FXTA 3EB8A 1NU3A 5AYSC 3G16A 3URPA 3J7Yd 2D42A 3I0YA 1ASKA 3NBRA 1CYVA 3UL6A 2AADA 4IIAA 1GY6A 1SIHA 4PEJA 2CG1A 1JBSA 1Q814 3S28A 1AV4A 5DRVA 1W02A 1B2ZA 1UCIA 1NDOB 1O7HB 3DUKA 1V57A 4KFDA 3CXC2 1CYUA 3MG2A 3EF8A 1JJ22 1YVSA 5STDA 3RDEA 3DZLA 1WTHA 2CFDA 4O2HA 4NPBA 1ZO2A 8RNTA 4R9LA 4WYKB 3Q2PA 1NB3I 1O7WB 3D3LA 1BANA 2CG0A 4I5QA 1EKMA 1M1XB 1GYBA 4X2HA 2OOVA 1Z1SA 2CWVA 3JUOA 1RGAA 6GSPA 2B24B 3HOHA 3JUMA 1QMAA 1Q9EA 3JUNA 1N9EA 1OPYA 4HOHA 1RN4A 3KFQC 3CD63 2WGQA 3AHWA 3OX9A 2P05A 1GMRA 4N6OB 2ZA4A 1GY7A 5M18A 1NB5I 3T8NA 1O7MB 2P38A 3F40A 3DM8A 2HMKB 4FCJA 5IENA 2INXA 2CIUA 1A2KA 1OACA 1TRQA 2CWTA 2R4IA 2XFTA 3CU3A 3FLJA 3K63A 3KE7A 3V98A 1RNTA 3CCM3 3FZWA 2PZVA 4N6MA 4BL3A 2P09A 1M1K4 1QVF2 2IYJA 3NV0B 4HM7B 4U13A 3CCL3 3CMA3 3GZXB 1EEJA 5AIFA 1J2BA 2D1WA 3M8CA 4FMBA 3HX8A 1W01A 2IA7A 4MMZB 4N6UA 5AEUB 3CCE3 4KVHA 1HYFA 1EG9B 2WO0A 3LZAA 4LEHA 4LMIA 4XBYA 3IJEB 4WP5A 3WA2X 4N6LA 3OV4A 2GEXA 1IDPA 3NXJA 1VQ93 1U5OA 4K1UA 2XGLA 4EBGA 3PXMA 1ULIB 2XF3A 3E99A 2MF7A 3D5IA 2CKFB 4WYKA 3DGOA 1D6ZA 1RGCA 1JBTA 2Z7AA 1LNIA 2ZL8A 4K61A 4L7KA 4BTYA 4L8PA 3DMCA 2E2UA 1LOVA 1B2SA 1FGMA 3FF0A 1GOYA 1W4NA 1N5HA 4RNZA 3CCS3 3K0ZA 3SOAA 3GRDA 1KC84 2XSOB 4HM2B 1OHPA 3LYGA 1Q7Y4 3I563 2XEPA 4LYLB 1MWUA 3PYJA 1F8NA 5G1LA 3WODG 3SXXA 1WMOA 3EBTA 1I0VA 4CDLA 1S5AA 1BSDA 1RGFA 2BMQB 1QVG2 1IQYA 1FGOA 2BO9B 2CFLA 1BOXA 2H0GA 5EEOA 3EN1B 5JBSA 5GSPA 3Q90A 1VQ83 1FZUA 1T3BA 1BRIA 2GSPA 4EXRA 1RGLA 3CPOA 3FGYA 3OWSA 1BGSA 1MOLA 2H0HA 1W00A 1YVBI 4MMXB 1UGHI 3AMOB 3LT9A 4X2OA 4O8SA 1A90A 4O02B 4J5GA 5IG5A 2F86B 3DGMA 3F7SA 1STDA 2K54A 2WOHA 3DY5A 4HBRA 4Q53A 2HMLB 5CF1A 3NUVA 1VQM3 3AGOA 1Q40B 2XR8B 1DVCA 3MKIA 2J8XB 1OH0A 2W56B 3VF1A 2KXGA 5LC6A 1BAOA 2OTJ3 1WMPA 1DYUA 1AVLA 1ZX2A 3A76A 3KN4A 7STDA 2W6JH 5HGRA 3DGNA 1US1A 1X1WA 3RGRA 2P0XA 3HIGA 1NWWA 2GEYA 1T2HA 2W56A 2XSHB 3FG3A 1TFKA 3F14A 3L0RA 2XRXB 1SJWA 4FMCA 4AKYA 2GBWB 3BU4A 1RGEA 1ROAA 4N6V0 1C54A 3HI7A 2QA43 1AR0A 3MG3A 2Y73A 2ZHXB 1O7PB 3HIIA 4RBNA 1YJ93 2M7OA 2W0QA 1LOYA 1MWSA 3A5EA 2Q07A 4GL6A 3X40A 4AKZA 1R4CA 4BL2A 4G1MB 1BNJA 1JB4A 1UCJA 2UGIA 1MWRA 1V58A 4WWUC 1B27A 1KD14 3PCRA 3CPW2 2BU4A 3MPHA 1HKXA 5IG4A 1TU5A 1DVDA 1IV7A 6STDA 1LQMB 1BUQA 1IQXA 3BNBA 1UUGB 5D83A 2L4VA 1JZDA 3CCR3 1SIIA 1TRPA 1UW1A 1GS3A 1BNFA 3Q3FA 4JF8A 4K1VA 1FYSA 2W2CA 5G1KA 1K734 3F7XA 2B1XB 3JUPA 3OXAA 3RNTA 4EV2A 2HMNB 3EE1A 1BVIA 1MNLA 4N6NB 4IPBA 4KT3B 2Z6BA 3ROBA 2RFRA 1LOXA 1RCKA 3B4PA 3IPTA 2ML5A 2P0MA 2V1LA 2BIRA 8CHOA 2RGQA 3O8YA 5FGOA 2OQEC 3SVAA 1IV9A 2OCTA 1AQZA 4K90B 4XDVA 1LXEA 1TFOA 1IVWA 1I2FA 2KCDA 3N8BA 1C7HA 4IT7A 5M19A 2CX1A 4HJLB 1B2MA 3AMOA 3G0KA 1RCLA 2MC8A 3ZG5A 1I0XA 1RGHA 4DKIA 4LGQA 2HMJB 1O7GB 2RCDA 1DETA 2JQ5A 1IYYA 1IQ8A 5IERA 3UL5A 1UCKA 1CEWI 1W6CA 3K7CA 3JVCA 4FMAA 3TDGA 1YHQ3 3MG1A 2QEX3 1B2UA 4MMYB 3I553 1OHSA 5RNTA 3D79A 4OVMA 2GBXB 1BNSA 1I3IA 1V74A 1QAKA 2CFGA 2F5WA 1OGXA 2SARA 3N9HA 5AI1A 3G713 1JZOA 1BRGA 1HZ1A 4J9AA 3NQYA 1Q7HA 3KSPA 3X3XA 2Z77A 1TP6A 3QK9A 1DMMA 1RGKA 1Y4KA 1FW7A 1BRKA 3CCQ3 3G4S3 1BRJA 2C4BA 2FGTA 2K0MA 2E2VA 2YFIB 4HAAA 1SQWA 1SPUA 3FG4A 3PGBA 4LZIA 3X3ZA 4KFEA 1K41A 4GHOA 2R41A 5M1AA 1VQN3 2CWUA 2AAEA 5ELJA 3S27A 3CC43 1BRSA 3LT8A 1I2GA 3X3YA 4GB5A 1K28A 3CCJ3 1N8R4 1OUNA 1KWIA 1VQ63 2BMRB 1FUTA 1LNHA 1I70A 4XBTA 4HM8B 3SYUA 3U97A 5HOHA 3ZG0A 2FNQA 3K5TA 3LH4A 1Q824 2SBLA 2Z76A 1RSNA 4ILFA 3AHSA 1EA2A 3S5CA 3QRDA 4BTXA 3PS8A 3H3HA 1B20A 4WFOA 3S67A 3B8LA 2W04A 5CXOA 5CLKA 3DGYA 2UX0A 5FW5A 1R4YA 1VQO3 1FGQA 3NM7A 2Y74A 2GXFA 1BSBA 1CQSA 5BIRA 2LYXA 1EQKA 4ORLA 4HZBB 1YIT3 3WMDA 2RBIA 2XH9A 3FCSB 2I9WA 3FG1A 1Q42A 4FCZA 3F8HA 1NNVA 4R1KA 1GD4A 3G6E3 3SLUA 4XDWA 2F98A 1RGGA 4CCVA 2BNGA 2WOFA 3GZBA 1PY3A 4ZM8A 3OWYA 4BTWA 1GOUA 3HZPA 2ZDJA 2BHMA 1OCVA 1NJI4 3D9RA 1OF5A 1I3FA 3FKAA 2CX0A 3LMLA 4BU4A 1N5PA 1LOWA 1QALA 3EC9A 3CNXA 4GSPA 4LSOA 4N3VA 1GMPA 2YFLB 1STFI 3WOFB 3S29A 4TX4A 2WGOA 3CCV3 1B3SA 1RN1A 2HMOB 1OF5B 1BU4A 1FA3A 1JNQA 7GSPA 4XBXA 3WR2A 1VZZA 1PYLA 2YX9A 1PFPA 1TUHA 5LC7A 2PNCA 3CNMA 1OHOA 1E3RA 5A0OB 1W6YA 3T0UA 3KIIA 1BNEA 3U1WA 1K8A4 3DH2A 1BUJA 1JN5B 2CW9A 2STDA 3VSYA 3BLZA 1WNHA 1ISKA 1BNIA 1RN7A 2HMMB 6RNTA 3GWRA 2K3DA 5EVHA 1ULJB 1IVXA 1A2VA 2CHCA 3LOYA 2RNTA 1D6YA 5KP3A 2GU3A 7RNTA 1UGIA 2E2TA 1JN5A 2QIYA 5KP4A 3LTAA 3KSED 1UI7A 1FUSA 2XGNA 4RNTA 4XB5A 5AIIA 3GSPA 3CC73 9RNTA 4HVNA 3B7CA 1M904 1FUWA 1TTOA 3OW22 4XM4A 1O7NB 1E3VA 4CPKA 5JPPA 1KQS2 1RMSA 1SARA 5JPUA 1QAFA 2W9PA 5ELUA 4JRFA 1QJGA 4KFFA 3SX1A 2OWPA 5BU4A 1Q864 2IUJA 3GAXA 5AIGA 3FF2A 1Q40A 1UI8A 3ER7A 3FSDA 4HM3B 1S723 3F9SA 2KRTA 3V92A 4HM6B 3UNLA 1VQ53 5DREA 1IT7A 4AEQA 1K9M4 2HOHA 2RSXA 1GOVA 1ZS7A 2CFWA 2O3OA 1U8CB 3PZWA 3VGNA 3T8UA 5BVBA 5AEWB 3JUQA 1NO3A 1MGWA 1VQ43 1UUVB 5D82A 3LTBA 3WOEB 4FCMA 1OGZA 2JDIH 1JRQA 5CK6A 1UDII 3EX9A 1MGRA 3LXUX 1KSIA 1W2B2 2KF6A 4OK0A 3ECFA 3WDGB 1N9JA 3MSOA 2F4YA 1L5GB 1RKYA 1I2EA 1YGWA 4R4KA 3G8ZA 1GSPA 3SOYA 1CH0A 4RNYA 1JV2B 2XFSA 1ZGXA 2KF4A 1VQP3 3BNEA 1UCLA 1RJOA 5D81A 1AVKA 4I4KA 1W5ZA 2H0IA 3HK4A 1RRLA 2C10A 4FR9A 3WA3A 3B4OA 1LVNA 3MHEA 4J5KA 1MWTA 3D4AA 4O3VA 1RHLA 2F56A 4HZ9B 5IW9A 2C11A 2O9UX 1TIJA 3AGNA 3LTCA 4HM4B 3RGAA 3EN8A 3KCHA 2F5MA 2F99A 5IG0A 1ROVA 1W2ZA 2IMJA 1X1XA 1VQ73 2KF5A 4EC6A 1RRHA 1E97A 3H51A 5EQLA 3UB1A 3UJMA 5AYRB 1FGTA 2CH9A 1BSCA 3LTDA 1T2IA 1FGRA 1YIJ3 4MJDA 1VQL3 1JKGA 1I8VA 1X1YA
chains in the Genus database with same CATH topology
2OTL3 2OOVC 3NM2A 1W7CA 1DMQA 4HM1B 2CK3H 4L8OA 3NBBA 5G2GA 4HKVB 3FH1A 2ML6A 4R9KA 4FMDA 3GZYB 3EBYA 3ALAA 3NX0A 3X41A 1GD3A 4H61A 2LQVA 3BNDA 2A15A 1D6UA 2BMOB 3MYTA 3DXOA 4H3UA 4HYZA 4OUQA 5AIHA 3EHCA 3EQQB 3V99A 4EYCA 4R80A 1YJN3 2OQEA 1YI23 2CC3A 4HM5B 1IK3A 2W03A 3KKGA 5IG3A 1IVVA 2BT3A 4NHFA 4EV5A 3IMAB 1GY5A 3N54B 3X42A 4RZMA 4KZ1A 5IF6A 3NBJA 3NV0A 1VQK3 2IUKA 3STDA 4WHAA 1YGEA 3CC23 5IEPA 1G96A 1W6GA 2CFKA 2QGUA 5I97A 1PU4A 1WMNA 1DMNA 3DGLA 1N8QA 2YFJB 3BB9A 3GZRA 3KZTA 4J8TA 5IEOA 1IT8A 5KP1A 3MWZA 1UUWB 3NHXA 4HM0B 2GU1A 1WQLB 1JB5A 3CCU3 1JB2A 5TGNA 3PCSA 3Q1CA 1T5YA 5BXQA 3F8XA 3BNCA 4QWTA 1HU9A 5CF2A 4N6TA 4MEIA 3SEDA 3EJVA 1M9GA 2W9QA 4STDA 1JKGB 1IVUA 3NQZA 3OWUA 1IU7A 3CME3 3K9MC 4NREA 2FXTA 3EB8A 1NU3A 5AYSC 3G16A 3J7Yd 2D42A 3I0YA 1ASKA 3NBRA 1CYVA 3UL6A 4IIAA 4PEJA 1GY6A 1SIHA 2CG1A 1Q814 3S28A 1AV4A 5DRVA 1W02A 1NDOB 1O7HB 3DUKA 4KFDA 3CXC2 1CYUA 3MG2A 3EF8A 1JJ22 5STDA 3RDEA 3DZLA 1WTHA 2CFDA 4O2HA 1ZO2A 4R9LA 4WYKB 3Q2PA 1NB3I 1O7WB 3D3LA 2CG0A 1EKMA 1M1XB 1GYBA 4X2HA 2OOVA 1Z1SA 2CWVA 3JUOA 2B24B 3JUMA 1QMAA 3JUNA 1N9EA 1OPYA 3KFQC 3CD63 2WGQA 4N6OB 3OX9A 2P05A 1NB5I 1GY7A 3T8NA 1O7MB 2P38A 3F40A 3DM8A 2HMKB 4FCJA 5IENA 2INXA 2CIUA 1A2KA 1OACA 2CWTA 2R4IA 2XFTA 3CU3A 3FLJA 3K63A 3KE7A 3V98A 1A90A 3CCM3 3FZWA 2PZVA 4N6MA 2P09A 1M1K4 1QVF2 3NV0B 4HM7B 4U13A 3CCL3 3CMA3 3GZXB 5AIFA 1J2BA 2D1WA 3M8CA 4FMBA 3HX8A 1W01A 2IA7A 4MMZB 4N6UA 5AEUB 3CCE3 4KVHA 1EG9B 2WO0A 3LZAA 4LEHA 4LMIA 4XBYA 3IJEB 4WP5A 3WA2X 4N6LA 3OV4A 2GEXA 1IDPA 3NXJA 1VQ93 1U5OA 4K1UA 2XGLA 4EBGA 3PXMA 1ULIB 2XF3A 3E99A 2MF7A 4WYKA 2CKFB 3DGOA 1D6ZA 2Z7AA 2ZL8A 4K61A 4L7KA 4BTYA 4L8PA 3DMCA 2E2UA 1FGMA 3FF0A 4RNZA 1W4NA 1N5HA 3CCS3 3K0ZA 3SOAA 3GRDA 1KC84 2XSOB 4HM2B 1OHPA 3LYGA 1Q7Y4 3I563 2XEPA 3PYJA 1F8NA 3WODG 3SXXA 1WMOA 3EBTA 4CDLA 1QVG2 1S5AA 2BMQB 1A67A 1IQYA 1FGOA 2BO9B 2CFLA 5EEOA 3EN1B 5JBSA 3Q90A 1VQ83 4EXRA 3CPOA 3FGYA 3OWSA 1MOLA 1W00A 1YVBI 4MMXB 4X2OA 3AMOB 3LT9A 4O8SA 4O02B 5IG5A 2F86B 3DGMA 3F7SA 1STDA 2K54A 2WOHA 3DY5A 4HBRA 4Q53A 2HMLB 5CF1A 3NUVA 1VQM3 1Q40B 2XR8B 1DVCA 3MKIA 1OH0A 2W56B 3VF1A 2KXGA 5LC6A 2OTJ3 1WMPA 1DYUA 1AVLA 1ZX2A 3A76A 3KN4A 7STDA 2W6JH 5HGRA 3DGNA 1US1A 3RGRA 2P0XA 3HIGA 1NWWA 2GEYA 2W56A 2XSHB 3FG3A 1TFKA 3F14A 3L0RA 2XRXB 1SJWA 4FMCA 4AKYA 2GBWB 1ROAA 4N6V0 3HI7A 2QA43 1AR0A 3MG3A 2Y73A 4RBNA 1O7PB 3HIIA 1YJ93 2M7OA 2W0QA 3X40A 4AKZA 2Q07A 4GL6A 1R4CA 4G1MB 1JB4A 4WWUC 1KD14 3PCRA 3CPW2 3MPHA 1HKXA 5IG4A 1TU5A 1DVDA 1IV7A 6STDA 1BUQA 1IQXA 3BNBA 5D83A 2L4VA 3CCR3 1SIIA 1UW1A 1GS3A 4JF8A 4K1VA 2W2CA 1K734 3F7XA 2B1XB 3JUPA 3OXAA 4EV2A 2HMNB 3EE1A 1MNLA 4N6NB 4IPBA 3ROBA 2Z6BA 2RFRA 1LOXA 3B4PA 3IPTA 2ML5A 2P0MA 2V1LA 8CHOA 2RGQA 3O8YA 5FGOA 2OQEC 3SVAA 1IV9A 2OCTA 4K90B 4XDVA 1LXEA 1TFOA 1IVWA 2KCDA 3N8BA 1C7HA 4IT7A 4HJLB 3AMOA 3G0KA 2MC8A 4LGQA 2HMJB 1O7GB 2RCDA 2JQ5A 1IQ8A 5IERA 3UL5A 1W6CA 1CEWI 3K7CA 3TDGA 3JVCA 4FMAA 1YHQ3 3MG1A 2QEX3 4MMYB 3I553 1OHSA 4OVMA 2GBXB 1V74A 1QAKA 2CFGA 1OGXA 3N9HA 5AI1A 3G713 4J9AA 3NQYA 3KSPA 3X3XA 2Z77A 1TP6A 3QK9A 1DMMA 1Y4KA 3CCQ3 3G4S3 2FGTA 2K0MA 2E2VA 2YFIB 1SQWA 1SPUA 3FG4A 3PGBA 4LZIA 3X3ZA 4KFEA 1K41A 1VQN3 2CWUA 5ELJA 3S27A 3CC43 3LT8A 3X3YA 4GB5A 1K28A 3CCJ3 1N8R4 1OUNA 1KWIA 1VQ63 2BMRB 3U97A 1LNHA 4XBTA 4HM8B 1Q824 2FNQA 3K5TA 3LH4A 2SBLA 2Z76A 3S5CA 1EA2A 4BTXA 3QRDA 3PS8A 3H3HA 4WFOA 3S67A 3B8LA 2W04A 5CXOA 5CLKA 2UX0A 5FW5A 1VQO3 1FGQA 3NM7A 2Y74A 2GXFA 1CQSA 2LYXA 1EQKA 4ORLA 4HZBB 1YIT3 3WMDA 2XH9A 3FCSB 2I9WA 3FG1A 1Q42A 4FCZA 3F8HA 4R1KA 1GD4A 3G6E3 3SLUA 4XDWA 2F98A 4CCVA 2BNGA 2WOFA 3GZBA 4ZM8A 3OWYA 4BTWA 3HZPA 2ZDJA 2BHMA 1OCVA 1NJI4 3D9RA 1OF5A 3FKAA 3LMLA 1N5PA 1QALA 3EC9A 3CNXA 4LSOA 4N3VA 2YFLB 1STFI 3WOFB 3S29A 4TX4A 2WGOA 3CCV3 2HMOB 1OF5B 1FA3A 1JNQA 4XBXA 1VZZA 2YX9A 1PFPA 1TUHA 5LC7A 2PNCA 3CNMA 1OHOA 1E3RA 5A0OB 1W6YA 3T0UA 3KIIA 1K8A4 3U1WA 1JN5B 2CW9A 2STDA 3VSYA 3BLZA 1WNHA 1ISKA 1RN7A 2HMMB 3GWRA 5EVHA 1ULJB 1IVXA 1A2VA 2CHCA 3LOYA 1D6YA 5KP3A 2GU3A 2E2TA 1JN5A 2QIYA 5KP4A 3LTAA 3KSED 1UI7A 2XGNA 4XB5A 5AIIA 3CC73 1M904 4HVNA 3B7CA 1FUWA 3OW22 4XM4A 1O7NB 1E3VA 5JPPA 1KQS2 5JPUA 1QAFA 2W9PA 5ELUA 4JRFA 1QJGA 4KFFA 3SX1A 2OWPA 1Q864 2IUJA 3GAXA 5AIGA 3FF2A 1Q40A 1UI8A 3ER7A 3FSDA 4HM3B 1S723 3F9SA 2KRTA 3V92A 4HM6B 3UNLA 1VQ53 5DREA 1IT7A 4AEQA 1K9M4 2RSXA 2CFWA 2O3OA 1U8CB 3PZWA 3VGNA 3T8UA 5BVBA 5AEWB 3JUQA 1NO3A 1VQ43 1UUVB 5D82A 3LTBA 3WOEB 4FCMA 1OGZA 2JDIH 1JRQA 5CK6A 3EX9A 3LXUX 1KSIA 1W2B2 4OK0A 3ECFA 3WDGB 1N9JA 3MSOA 1L5GB 1RKYA 4R4KA 3G8ZA 3SOYA 4RNYA 1JV2B 2XFSA 1VQP3 3BNEA 1RJOA 5D81A 1AVKA 4I4KA 1W5ZA 3HK4A 1RRLA 2C10A 4FR9A 3WA3A 3B4OA 1LVNA 3MHEA 4O3VA 4HZ9B 5IW9A 2C11A 2O9UX 1TIJA 3RGAA 3LTCA 4HM4B 3EN8A 2F99A 5IG0A 1ROVA 1W2ZA 2IMJA 1VQ73 4EC6A 1RRHA 1E97A 3H51A 5EQLA 3UB1A 3UJMA 5AYRB 1FGTA 2CH9A 3LTDA 1FGRA 1YIJ3 4MJDA 1VQL3 1JKGA 1YJW3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RN7 A;  2KXG A;  5LC6 A;  3SVA A;  3LH4 A;  1NB5 I;  1IV9 A;  2OCT A;  3QRD A;  1CYU A;  1LXE A;  4N6L A;  1N5P A;  3PS8 A;  1G96 A;  3PYJ A;  4IT7 A;  1A90 A;  3S67 A;  3PXM A;  4N6T A;  1A67 A;  2BO9 B;  1DVD A;  1IV7 A;  4N6M A;  1STF I;  3NX0 A;  4TX4 A;  1GD3 A;  3Q2P A;  1NB3 I;  4N6O B;  3KSE D;  2O9U X;  1M9G A;  2W9Q A;  1TIJ A;  1EQK A;  4LZI A;  4EYC A;  3L0R A;  3UL5 A;  1FA3 A;  3K9M C;  1CEW I;  1FUW A;  4ZM8 A;  5ELJ A;  1MOL A;  1ROA A;  3MWZ A;  1YVB I;  4N6V 0;  1PFP A;  1CYV A;  1N5H A;  5LC7 A;  5EQL A;  1GD4 A;  3UL6 A;  4N6U A;  5A0O B;  1KWI A;  2CH9 A;  4CCV A;  1MNL A;  2W9P A;  5ELU A;  4N6N B;  1N9J A;  3IMA B;  3KFQ C;  1R4C A;  1DVC A;  3GAX A;  1WNH A; 
#chains in the Genus database with same CATH topology
 2OTL 3;  2KF3 A;  2OOV C;  3NM2 A;  1W7C A;  1DMQ A;  4HM1 B;  2CK3 H;  4L8O A;  3NBB A;  5G2G A;  4HKV B;  1B2X A;  3FH1 A;  2ML6 A;  3D5G A;  4FMD A;  4R9K A;  1YJW 3;  3GZY B;  3EBY A;  3ALA A;  3NX0 A;  2KAA A;  3X41 A;  1GD3 A;  1TJD A;  1LQG C;  4H61 A;  1RNB A;  2LQV A;  3BND A;  2A15 A;  1D6U A;  2BMO B;  3MYT A;  3DXO A;  4H3U A;  4HYZ A;  4OUQ A;  5AIH A;  3EHC A;  3EQQ B;  3V99 A;  4EYC A;  4R80 A;  1YJN 3;  2OQE A;  1A67 A;  1YI2 3;  1RTU A;  1BSA A;  2CC3 A;  3BIR A;  1RLS A;  1GMQ A;  4HM5 B;  1IK3 A;  2W03 A;  1A2P A;  3KKG A;  1BSE A;  5IG3 A;  1IVV A;  2BT3 A;  4NHF A;  4EV5 A;  1YNV X;  3IMA B;  1GY5 A;  1DE3 A;  3N54 B;  3WHO A;  3X42 A;  4RZM A;  4KZ1 A;  4BIR A;  1G02 A;  3NBJ A;  3NV0 A;  2IUK A;  4EW5 A;  1RDS A;  5IF6 A;  1B21 A;  3STD A;  4WHA A;  1YGE A;  1VQK 3;  1LRA A;  3CC2 3;  5IEP A;  1G96 A;  1W6G A;  2CFK A;  1BRN L;  2QGU A;  5I97 A;  1PU4 A;  1WMN A;  1DMN A;  3DGL A;  1N8Q A;  2YFJ B;  3BB9 A;  3GZR A;  3KZT A;  4J8T A;  5IEO A;  1IT8 A;  1BNG A;  5KP1 A;  1EUI C;  1G0T A;  3MWZ A;  1BRH A;  1UUW B;  3NHX A;  4HM0 B;  2GU1 A;  1WQL B;  1JB5 A;  1AY7 A;  3CCU 3;  1JB2 A;  1VQQ A;  5TGN A;  3PCS A;  2L1S A;  1T5Y A;  3Q1C A;  3F8X A;  1BIR A;  3BNC A;  4QWT A;  5BXQ A;  1JBR A;  4CJN A;  1HU9 A;  5CF2 A;  3ZFZ A;  4N6T A;  1X1U A;  2UUG C;  1BNR A;  4MEI A;  3SED A;  3EJV A;  1M9G A;  2W9Q A;  4STD A;  2IY2 A;  1JKG B;  1IVU A;  3NQZ A;  3OWU A;  1IU7 A;  3CME 3;  3K9M C;  4NRE A;  2FXT A;  3EB8 A;  1NU3 A;  5AYS C;  3G16 A;  3URP A;  3J7Y d;  2D42 A;  3I0Y A;  1ASK A;  3NBR A;  1CYV A;  3UL6 A;  2AAD A;  4IIA A;  1GY6 A;  1SIH A;  4PEJ A;  2CG1 A;  1JBS A;  1Q81 4;  3S28 A;  1AV4 A;  5DRV A;  1W02 A;  1B2Z A;  1UCI A;  1NDO B;  1O7H B;  3DUK A;  1V57 A;  4KFD A;  3CXC 2;  1CYU A;  3MG2 A;  3EF8 A;  1JJ2 2;  1YVS A;  5STD A;  3RDE A;  3DZL A;  1WTH A;  2CFD A;  4O2H A;  4NPB A;  1ZO2 A;  8RNT A;  4R9L A;  4WYK B;  3Q2P A;  1NB3 I;  1O7W B;  3D3L A;  1BAN A;  2CG0 A;  4I5Q A;  1EKM A;  1M1X B;  1GYB A;  4X2H A;  2OOV A;  1Z1S A;  2CWV A;  3JUO A;  1RGA A;  6GSP A;  2B24 B;  3HOH A;  3JUM A;  1QMA A;  1Q9E A;  3JUN A;  1N9E A;  1OPY A;  4HOH A;  1RN4 A;  3KFQ C;  3CD6 3;  2WGQ A;  3AHW A;  3OX9 A;  2P05 A;  1GMR A;  4N6O B;  2ZA4 A;  1GY7 A;  5M18 A;  1NB5 I;  3T8N A;  1O7M B;  2P38 A;  3F40 A;  3DM8 A;  2HMK B;  4FCJ A;  5IEN A;  2INX A;  2CIU A;  1A2K A;  1OAC A;  1TRQ A;  2CWT A;  2R4I A;  2XFT A;  3CU3 A;  3FLJ A;  3K63 A;  3KE7 A;  3V98 A;  1RNT A;  3CCM 3;  3FZW A;  2PZV A;  4N6M A;  4BL3 A;  2P09 A;  1M1K 4;  1QVF 2;  2IYJ A;  3NV0 B;  4HM7 B;  4U13 A;  3CCL 3;  3CMA 3;  3GZX B;  1EEJ A;  5AIF A;  1J2B A;  2D1W A;  3M8C A;  4FMB A;  3HX8 A;  1W01 A;  2IA7 A;  4MMZ B;  4N6U A;  5AEU B;  3CCE 3;  4KVH A;  1HYF A;  1EG9 B;  2WO0 A;  3LZA A;  4LEH A;  4LMI A;  4XBY A;  3IJE B;  4WP5 A;  3WA2 X;  4N6L A;  3OV4 A;  2GEX A;  1IDP A;  3NXJ A;  1VQ9 3;  1U5O A;  4K1U A;  2XGL A;  4EBG A;  3PXM A;  1ULI B;  2XF3 A;  3E99 A;  2MF7 A;  3D5I A;  2CKF B;  4WYK A;  3DGO A;  1D6Z A;  1RGC A;  1JBT A;  2Z7A A;  1LNI A;  2ZL8 A;  4K61 A;  4L7K A;  4BTY A;  4L8P A;  3DMC A;  2E2U A;  1LOV A;  1B2S A;  1FGM A;  3FF0 A;  1GOY A;  1W4N A;  1N5H A;  4RNZ A;  3CCS 3;  3K0Z A;  3SOA A;  3GRD A;  1KC8 4;  2XSO B;  4HM2 B;  1OHP A;  3LYG A;  1Q7Y 4;  3I56 3;  2XEP A;  4LYL B;  1MWU A;  3PYJ A;  1F8N A;  5G1L A;  3WOD G;  3SXX A;  1WMO A;  3EBT A;  1I0V A;  4CDL A;  1S5A A;  1BSD A;  1RGF A;  2BMQ B;  1QVG 2;  1IQY A;  1FGO A;  2BO9 B;  2CFL A;  1BOX A;  2H0G A;  5EEO A;  3EN1 B;  5JBS A;  5GSP A;  3Q90 A;  1VQ8 3;  1FZU A;  1T3B A;  1BRI A;  2GSP A;  4EXR A;  1RGL A;  3CPO A;  3FGY A;  3OWS A;  1BGS A;  1MOL A;  2H0H A;  1W00 A;  1YVB I;  4MMX B;  1UGH I;  3AMO B;  3LT9 A;  4X2O A;  4O8S A;  1A90 A;  4O02 B;  4J5G A;  5IG5 A;  2F86 B;  3DGM A;  3F7S A;  1STD A;  2K54 A;  2WOH A;  3DY5 A;  4HBR A;  4Q53 A;  2HML B;  5CF1 A;  3NUV A;  1VQM 3;  3AGO A;  1Q40 B;  2XR8 B;  1DVC A;  3MKI A;  2J8X B;  1OH0 A;  2W56 B;  3VF1 A;  2KXG A;  5LC6 A;  1BAO A;  2OTJ 3;  1WMP A;  1DYU A;  1AVL A;  1ZX2 A;  3A76 A;  3KN4 A;  7STD A;  2W6J H;  5HGR A;  3DGN A;  1US1 A;  1X1W A;  3RGR A;  2P0X A;  3HIG A;  1NWW A;  2GEY A;  1T2H A;  2W56 A;  2XSH B;  3FG3 A;  1TFK A;  3F14 A;  3L0R A;  2XRX B;  1SJW A;  4FMC A;  4AKY A;  2GBW B;  3BU4 A;  1RGE A;  1ROA A;  4N6V 0;  1C54 A;  3HI7 A;  2QA4 3;  1AR0 A;  3MG3 A;  2Y73 A;  2ZHX B;  1O7P B;  3HII A;  4RBN A;  1YJ9 3;  2M7O A;  2W0Q A;  1LOY A;  1MWS A;  3A5E A;  2Q07 A;  4GL6 A;  3X40 A;  4AKZ A;  1R4C A;  4BL2 A;  4G1M B;  1BNJ A;  1JB4 A;  1UCJ A;  2UGI A;  1MWR A;  1V58 A;  4WWU C;  1B27 A;  1KD1 4;  3PCR A;  3CPW 2;  2BU4 A;  3MPH A;  1HKX A;  5IG4 A;  1TU5 A;  1DVD A;  1IV7 A;  6STD A;  1LQM B;  1BUQ A;  1IQX A;  3BNB A;  1UUG B;  5D83 A;  2L4V A;  1JZD A;  3CCR 3;  1SII A;  1TRP A;  1UW1 A;  1GS3 A;  1BNF A;  3Q3F A;  4JF8 A;  4K1V A;  1FYS A;  2W2C A;  5G1K A;  1K73 4;  3F7X A;  2B1X B;  3JUP A;  3OXA A;  3RNT A;  4EV2 A;  2HMN B;  3EE1 A;  1BVI A;  1MNL A;  4N6N B;  4IPB A;  4KT3 B;  2Z6B A;  3ROB A;  2RFR A;  1LOX A;  1RCK A;  3B4P A;  3IPT A;  2ML5 A;  2P0M A;  2V1L A;  2BIR A;  8CHO A;  2RGQ A;  3O8Y A;  5FGO A;  2OQE C;  3SVA A;  1IV9 A;  2OCT A;  1AQZ A;  4K90 B;  4XDV A;  1LXE A;  1TFO A;  1IVW A;  1I2F A;  2KCD A;  3N8B A;  1C7H A;  4IT7 A;  5M19 A;  2CX1 A;  4HJL B;  1B2M A;  3AMO A;  3G0K A;  1RCL A;  2MC8 A;  3ZG5 A;  1I0X A;  1RGH A;  4DKI A;  4LGQ A;  2HMJ B;  1O7G B;  2RCD A;  1DET A;  2JQ5 A;  1IYY A;  1IQ8 A;  5IER A;  3UL5 A;  1UCK A;  1CEW I;  1W6C A;  3K7C A;  3JVC A;  4FMA A;  3TDG A;  1YHQ 3;  3MG1 A;  2QEX 3;  1B2U A;  4MMY B;  3I55 3;  1OHS A;  5RNT A;  3D79 A;  4OVM A;  2GBX B;  1BNS A;  1I3I A;  1V74 A;  1QAK A;  2CFG A;  2F5W A;  1OGX A;  2SAR A;  3N9H A;  5AI1 A;  3G71 3;  1JZO A;  1BRG A;  1HZ1 A;  4J9A A;  3NQY A;  1Q7H A;  3KSP A;  3X3X A;  2Z77 A;  1TP6 A;  3QK9 A;  1DMM A;  1RGK A;  1Y4K A;  1FW7 A;  1BRK A;  3CCQ 3;  3G4S 3;  1BRJ A;  2C4B A;  2FGT A;  2K0M A;  2E2V A;  2YFI B;  4HAA A;  1SQW A;  1SPU A;  3FG4 A;  3PGB A;  4LZI A;  3X3Z A;  4KFE A;  1K41 A;  4GHO A;  2R41 A;  5M1A A;  1VQN 3;  2CWU A;  2AAE A;  5ELJ A;  3S27 A;  3CC4 3;  1BRS A;  3LT8 A;  1I2G A;  3X3Y A;  4GB5 A;  1K28 A;  3CCJ 3;  1N8R 4;  1OUN A;  1KWI A;  1VQ6 3;  2BMR B;  1FUT A;  1LNH A;  1I70 A;  4XBT A;  4HM8 B;  3SYU A;  3U97 A;  5HOH A;  3ZG0 A;  2FNQ A;  3K5T A;  3LH4 A;  1Q82 4;  2SBL A;  2Z76 A;  1RSN A;  4ILF A;  3AHS A;  1EA2 A;  3S5C A;  3QRD A;  4BTX A;  3PS8 A;  3H3H A;  1B20 A;  4WFO A;  3S67 A;  3B8L A;  2W04 A;  5CXO A;  5CLK A;  3DGY A;  2UX0 A;  5FW5 A;  1R4Y A;  1VQO 3;  1FGQ A;  3NM7 A;  2Y74 A;  2GXF A;  1BSB A;  1CQS A;  5BIR A;  2LYX A;  1EQK A;  4ORL A;  4HZB B;  1YIT 3;  3WMD A;  2RBI A;  2XH9 A;  3FCS B;  2I9W A;  3FG1 A;  1Q42 A;  4FCZ A;  3F8H A;  1NNV A;  4R1K A;  1GD4 A;  3G6E 3;  3SLU A;  4XDW A;  2F98 A;  1RGG A;  4CCV A;  2BNG A;  2WOF A;  3GZB A;  1PY3 A;  4ZM8 A;  3OWY A;  4BTW A;  1GOU A;  3HZP A;  2ZDJ A;  2BHM A;  1OCV A;  1NJI 4;  3D9R A;  1OF5 A;  1I3F A;  3FKA A;  2CX0 A;  3LML A;  4BU4 A;  1N5P A;  1LOW A;  1QAL A;  3EC9 A;  3CNX A;  4GSP A;  4LSO A;  4N3V A;  1GMP A;  2YFL B;  1STF I;  3WOF B;  3S29 A;  4TX4 A;  2WGO A;  3CCV 3;  1B3S A;  1RN1 A;  2HMO B;  1OF5 B;  1BU4 A;  1FA3 A;  1JNQ A;  7GSP A;  4XBX A;  3WR2 A;  1VZZ A;  1PYL A;  2YX9 A;  1PFP A;  1TUH A;  5LC7 A;  2PNC A;  3CNM A;  1OHO A;  1E3R A;  5A0O B;  1W6Y A;  3T0U A;  3KII A;  1BNE A;  3U1W A;  1K8A 4;  3DH2 A;  1BUJ A;  1JN5 B;  2CW9 A;  2STD A;  3VSY A;  3BLZ A;  1WNH A;  1ISK A;  1BNI A;  1RN7 A;  2HMM B;  6RNT A;  3GWR A;  2K3D A;  5EVH A;  1ULJ B;  1IVX A;  1A2V A;  2CHC A;  3LOY A;  2RNT A;  1D6Y A;  5KP3 A;  2GU3 A;  7RNT A;  1UGI A;  2E2T A;  1JN5 A;  2QIY A;  5KP4 A;  3LTA A;  3KSE D;  1UI7 A;  1FUS A;  2XGN A;  4RNT A;  4XB5 A;  5AII A;  3GSP A;  3CC7 3;  9RNT A;  4HVN A;  3B7C A;  1M90 4;  1FUW A;  1TTO A;  3OW2 2;  4XM4 A;  1O7N B;  1E3V A;  4CPK A;  5JPP A;  1KQS 2;  1RMS A;  1SAR A;  5JPU A;  1QAF A;  2W9P A;  5ELU A;  4JRF A;  1QJG A;  4KFF A;  3SX1 A;  2OWP A;  5BU4 A;  1Q86 4;  2IUJ A;  3GAX A;  5AIG A;  3FF2 A;  1Q40 A;  1UI8 A;  3ER7 A;  3FSD A;  4HM3 B;  1S72 3;  3F9S A;  2KRT A;  3V92 A;  4HM6 B;  3UNL A;  1VQ5 3;  5DRE A;  1IT7 A;  4AEQ A;  1K9M 4;  2HOH A;  2RSX A;  1GOV A;  1ZS7 A;  2CFW A;  2O3O A;  1U8C B;  3PZW A;  3VGN A;  3T8U A;  5BVB A;  5AEW B;  3JUQ A;  1NO3 A;  1MGW A;  1VQ4 3;  1UUV B;  5D82 A;  3LTB A;  3WOE B;  4FCM A;  1OGZ A;  2JDI H;  1JRQ A;  5CK6 A;  1UDI I;  3EX9 A;  1MGR A;  3LXU X;  1KSI A;  1W2B 2;  2KF6 A;  4OK0 A;  3ECF A;  3WDG B;  1N9J A;  3MSO A;  2F4Y A;  1L5G B;  1RKY A;  1I2E A;  1YGW A;  4R4K A;  3G8Z A;  1GSP A;  3SOY A;  1CH0 A;  4RNY A;  1JV2 B;  2XFS A;  1ZGX A;  2KF4 A;  1VQP 3;  3BNE A;  1UCL A;  1RJO A;  5D81 A;  1AVK A;  4I4K A;  1W5Z A;  2H0I A;  3HK4 A;  1RRL A;  2C10 A;  4FR9 A;  3WA3 A;  3B4O A;  1LVN A;  3MHE A;  4J5K A;  1MWT A;  3D4A A;  4O3V A;  1RHL A;  2F56 A;  4HZ9 B;  5IW9 A;  2C11 A;  2O9U X;  1TIJ A;  3AGN A;  3LTC A;  4HM4 B;  3RGA A;  3EN8 A;  3KCH A;  2F5M A;  2F99 A;  5IG0 A;  1ROV A;  1W2Z A;  2IMJ A;  1X1X A;  1VQ7 3;  2KF5 A;  4EC6 A;  1RRH A;  1E97 A;  3H51 A;  5EQL A;  3UB1 A;  3UJM A;  5AYR B;  1FGT A;  2CH9 A;  1BSC A;  3LTD A;  1T2I A;  1FGR A;  1YIJ 3;  4MJD A;  1VQL 3;  1JKG A;  1I8V A;  1X1Y A; 
#chains in the Genus database with same CATH homology
 2OTL 3;  2OOV C;  3NM2 A;  1W7C A;  1DMQ A;  4HM1 B;  2CK3 H;  4L8O A;  3NBB A;  5G2G A;  4HKV B;  3FH1 A;  2ML6 A;  4R9K A;  4FMD A;  3GZY B;  3EBY A;  3ALA A;  3NX0 A;  3X41 A;  1GD3 A;  4H61 A;  2LQV A;  3BND A;  2A15 A;  1D6U A;  2BMO B;  3MYT A;  3DXO A;  4H3U A;  4HYZ A;  4OUQ A;  5AIH A;  3EHC A;  3EQQ B;  3V99 A;  4EYC A;  4R80 A;  1YJN 3;  2OQE A;  1YI2 3;  2CC3 A;  4HM5 B;  1IK3 A;  2W03 A;  3KKG A;  5IG3 A;  1IVV A;  2BT3 A;  4NHF A;  4EV5 A;  3IMA B;  1GY5 A;  3N54 B;  3X42 A;  4RZM A;  4KZ1 A;  5IF6 A;  3NBJ A;  3NV0 A;  1VQK 3;  2IUK A;  3STD A;  4WHA A;  1YGE A;  3CC2 3;  5IEP A;  1G96 A;  1W6G A;  2CFK A;  2QGU A;  5I97 A;  1PU4 A;  1WMN A;  1DMN A;  3DGL A;  1N8Q A;  2YFJ B;  3BB9 A;  3GZR A;  3KZT A;  4J8T A;  5IEO A;  1IT8 A;  5KP1 A;  3MWZ A;  1UUW B;  3NHX A;  4HM0 B;  2GU1 A;  1WQL B;  1JB5 A;  3CCU 3;  1JB2 A;  5TGN A;  3PCS A;  3Q1C A;  1T5Y A;  5BXQ A;  3F8X A;  3BNC A;  4QWT A;  1HU9 A;  5CF2 A;  4N6T A;  4MEI A;  3SED A;  3EJV A;  1M9G A;  2W9Q A;  4STD A;  1JKG B;  1IVU A;  3NQZ A;  3OWU A;  1IU7 A;  3CME 3;  3K9M C;  4NRE A;  2FXT A;  3EB8 A;  1NU3 A;  5AYS C;  3G16 A;  3J7Y d;  2D42 A;  3I0Y A;  1ASK A;  3NBR A;  1CYV A;  3UL6 A;  4IIA A;  4PEJ A;  1GY6 A;  1SIH A;  2CG1 A;  1Q81 4;  3S28 A;  1AV4 A;  5DRV A;  1W02 A;  1NDO B;  1O7H B;  3DUK A;  4KFD A;  3CXC 2;  1CYU A;  3MG2 A;  3EF8 A;  1JJ2 2;  5STD A;  3RDE A;  3DZL A;  1WTH A;  2CFD A;  4O2H A;  1ZO2 A;  4R9L A;  4WYK B;  3Q2P A;  1NB3 I;  1O7W B;  3D3L A;  2CG0 A;  1EKM A;  1M1X B;  1GYB A;  4X2H A;  2OOV A;  1Z1S A;  2CWV A;  3JUO A;  2B24 B;  3JUM A;  1QMA A;  3JUN A;  1N9E A;  1OPY A;  3KFQ C;  3CD6 3;  2WGQ A;  4N6O B;  3OX9 A;  2P05 A;  1NB5 I;  1GY7 A;  3T8N A;  1O7M B;  2P38 A;  3F40 A;  3DM8 A;  2HMK B;  4FCJ A;  5IEN A;  2INX A;  2CIU A;  1A2K A;  1OAC A;  2CWT A;  2R4I A;  2XFT A;  3CU3 A;  3FLJ A;  3K63 A;  3KE7 A;  3V98 A;  1A90 A;  3CCM 3;  3FZW A;  2PZV A;  4N6M A;  2P09 A;  1M1K 4;  1QVF 2;  3NV0 B;  4HM7 B;  4U13 A;  3CCL 3;  3CMA 3;  3GZX B;  5AIF A;  1J2B A;  2D1W A;  3M8C A;  4FMB A;  3HX8 A;  1W01 A;  2IA7 A;  4MMZ B;  4N6U A;  5AEU B;  3CCE 3;  4KVH A;  1EG9 B;  2WO0 A;  3LZA A;  4LEH A;  4LMI A;  4XBY A;  3IJE B;  4WP5 A;  3WA2 X;  4N6L A;  3OV4 A;  2GEX A;  1IDP A;  3NXJ A;  1VQ9 3;  1U5O A;  4K1U A;  2XGL A;  4EBG A;  3PXM A;  1ULI B;  2XF3 A;  3E99 A;  2MF7 A;  4WYK A;  2CKF B;  3DGO A;  1D6Z A;  2Z7A A;  2ZL8 A;  4K61 A;  4L7K A;  4BTY A;  4L8P A;  3DMC A;  2E2U A;  1FGM A;  3FF0 A;  4RNZ A;  1W4N A;  1N5H A;  3CCS 3;  3K0Z A;  3SOA A;  3GRD A;  1KC8 4;  2XSO B;  4HM2 B;  1OHP A;  3LYG A;  1Q7Y 4;  3I56 3;  2XEP A;  3PYJ A;  1F8N A;  3WOD G;  3SXX A;  1WMO A;  3EBT A;  4CDL A;  1QVG 2;  1S5A A;  2BMQ B;  1A67 A;  1IQY A;  1FGO A;  2BO9 B;  2CFL A;  5EEO A;  3EN1 B;  5JBS A;  3Q90 A;  1VQ8 3;  4EXR A;  3CPO A;  3FGY A;  3OWS A;  1MOL A;  1W00 A;  1YVB I;  4MMX B;  4X2O A;  3AMO B;  3LT9 A;  4O8S A;  4O02 B;  5IG5 A;  2F86 B;  3DGM A;  3F7S A;  1STD A;  2K54 A;  2WOH A;  3DY5 A;  4HBR A;  4Q53 A;  2HML B;  5CF1 A;  3NUV A;  1VQM 3;  1Q40 B;  2XR8 B;  1DVC A;  3MKI A;  1OH0 A;  2W56 B;  3VF1 A;  2KXG A;  5LC6 A;  2OTJ 3;  1WMP A;  1DYU A;  1AVL A;  1ZX2 A;  3A76 A;  3KN4 A;  7STD A;  2W6J H;  5HGR A;  3DGN A;  1US1 A;  3RGR A;  2P0X A;  3HIG A;  1NWW A;  2GEY A;  2W56 A;  2XSH B;  3FG3 A;  1TFK A;  3F14 A;  3L0R A;  2XRX B;  1SJW A;  4FMC A;  4AKY A;  2GBW B;  1ROA A;  4N6V 0;  3HI7 A;  2QA4 3;  1AR0 A;  3MG3 A;  2Y73 A;  4RBN A;  1O7P B;  3HII A;  1YJ9 3;  2M7O A;  2W0Q A;  3X40 A;  4AKZ A;  2Q07 A;  4GL6 A;  1R4C A;  4G1M B;  1JB4 A;  4WWU C;  1KD1 4;  3PCR A;  3CPW 2;  3MPH A;  1HKX A;  5IG4 A;  1TU5 A;  1DVD A;  1IV7 A;  6STD A;  1BUQ A;  1IQX A;  3BNB A;  5D83 A;  2L4V A;  3CCR 3;  1SII A;  1UW1 A;  1GS3 A;  4JF8 A;  4K1V A;  2W2C A;  1K73 4;  3F7X A;  2B1X B;  3JUP A;  3OXA A;  4EV2 A;  2HMN B;  3EE1 A;  1MNL A;  4N6N B;  4IPB A;  3ROB A;  2Z6B A;  2RFR A;  1LOX A;  3B4P A;  3IPT A;  2ML5 A;  2P0M A;  2V1L A;  8CHO A;  2RGQ A;  3O8Y A;  5FGO A;  2OQE C;  3SVA A;  1IV9 A;  2OCT A;  4K90 B;  4XDV A;  1LXE A;  1TFO A;  1IVW A;  2KCD A;  3N8B A;  1C7H A;  4IT7 A;  4HJL B;  3AMO A;  3G0K A;  2MC8 A;  4LGQ A;  2HMJ B;  1O7G B;  2RCD A;  2JQ5 A;  1IQ8 A;  5IER A;  3UL5 A;  1W6C A;  1CEW I;  3K7C A;  3TDG A;  3JVC A;  4FMA A;  1YHQ 3;  3MG1 A;  2QEX 3;  4MMY B;  3I55 3;  1OHS A;  4OVM A;  2GBX B;  1V74 A;  1QAK A;  2CFG A;  1OGX A;  3N9H A;  5AI1 A;  3G71 3;  4J9A A;  3NQY A;  3KSP A;  3X3X A;  2Z77 A;  1TP6 A;  3QK9 A;  1DMM A;  1Y4K A;  3CCQ 3;  3G4S 3;  2FGT A;  2K0M A;  2E2V A;  2YFI B;  1SQW A;  1SPU A;  3FG4 A;  3PGB A;  4LZI A;  3X3Z A;  4KFE A;  1K41 A;  1VQN 3;  2CWU A;  5ELJ A;  3S27 A;  3CC4 3;  3LT8 A;  3X3Y A;  4GB5 A;  1K28 A;  3CCJ 3;  1N8R 4;  1OUN A;  1KWI A;  1VQ6 3;  2BMR B;  3U97 A;  1LNH A;  4XBT A;  4HM8 B;  1Q82 4;  2FNQ A;  3K5T A;  3LH4 A;  2SBL A;  2Z76 A;  3S5C A;  1EA2 A;  4BTX A;  3QRD A;  3PS8 A;  3H3H A;  4WFO A;  3S67 A;  3B8L A;  2W04 A;  5CXO A;  5CLK A;  2UX0 A;  5FW5 A;  1VQO 3;  1FGQ A;  3NM7 A;  2Y74 A;  2GXF A;  1CQS A;  2LYX A;  1EQK A;  4ORL A;  4HZB B;  1YIT 3;  3WMD A;  2XH9 A;  3FCS B;  2I9W A;  3FG1 A;  1Q42 A;  4FCZ A;  3F8H A;  4R1K A;  1GD4 A;  3G6E 3;  3SLU A;  4XDW A;  2F98 A;  4CCV A;  2BNG A;  2WOF A;  3GZB A;  4ZM8 A;  3OWY A;  4BTW A;  3HZP A;  2ZDJ A;  2BHM A;  1OCV A;  1NJI 4;  3D9R A;  1OF5 A;  3FKA A;  3LML A;  1N5P A;  1QAL A;  3EC9 A;  3CNX A;  4LSO A;  4N3V A;  2YFL B;  1STF I;  3WOF B;  3S29 A;  4TX4 A;  2WGO A;  3CCV 3;  2HMO B;  1OF5 B;  1FA3 A;  1JNQ A;  4XBX A;  1VZZ A;  2YX9 A;  1PFP A;  1TUH A;  5LC7 A;  2PNC A;  3CNM A;  1OHO A;  1E3R A;  5A0O B;  1W6Y A;  3T0U A;  3KII A;  1K8A 4;  3U1W A;  1JN5 B;  2CW9 A;  2STD A;  3VSY A;  3BLZ A;  1WNH A;  1ISK A;  1RN7 A;  2HMM B;  3GWR A;  5EVH A;  1ULJ B;  1IVX A;  1A2V A;  2CHC A;  3LOY A;  1D6Y A;  5KP3 A;  2GU3 A;  2E2T A;  1JN5 A;  2QIY A;  5KP4 A;  3LTA A;  3KSE D;  1UI7 A;  2XGN A;  4XB5 A;  5AII A;  3CC7 3;  1M90 4;  4HVN A;  3B7C A;  1FUW A;  3OW2 2;  4XM4 A;  1O7N B;  1E3V A;  5JPP A;  1KQS 2;  5JPU A;  1QAF A;  2W9P A;  5ELU A;  4JRF A;  1QJG A;  4KFF A;  3SX1 A;  2OWP A;  1Q86 4;  2IUJ A;  3GAX A;  5AIG A;  3FF2 A;  1Q40 A;  1UI8 A;  3ER7 A;  3FSD A;  4HM3 B;  1S72 3;  3F9S A;  2KRT A;  3V92 A;  4HM6 B;  3UNL A;  1VQ5 3;  5DRE A;  1IT7 A;  4AEQ A;  1K9M 4;  2RSX A;  2CFW A;  2O3O A;  1U8C B;  3PZW A;  3VGN A;  3T8U A;  5BVB A;  5AEW B;  3JUQ A;  1NO3 A;  1VQ4 3;  1UUV B;  5D82 A;  3LTB A;  3WOE B;  4FCM A;  1OGZ A;  2JDI H;  1JRQ A;  5CK6 A;  3EX9 A;  3LXU X;  1KSI A;  1W2B 2;  4OK0 A;  3ECF A;  3WDG B;  1N9J A;  3MSO A;  1L5G B;  1RKY A;  4R4K A;  3G8Z A;  3SOY A;  4RNY A;  1JV2 B;  2XFS A;  1VQP 3;  3BNE A;  1RJO A;  5D81 A;  1AVK A;  4I4K A;  1W5Z A;  3HK4 A;  1RRL A;  2C10 A;  4FR9 A;  3WA3 A;  3B4O A;  1LVN A;  3MHE A;  4O3V A;  4HZ9 B;  5IW9 A;  2C11 A;  2O9U X;  1TIJ A;  3RGA A;  3LTC A;  4HM4 B;  3EN8 A;  2F99 A;  5IG0 A;  1ROV A;  1W2Z A;  2IMJ A;  1VQ7 3;  4EC6 A;  1RRH A;  1E97 A;  3H51 A;  5EQL A;  3UB1 A;  3UJM A;  5AYR B;  1FGT A;  2CH9 A;  3LTD A;  1FGR A;  1YIJ 3;  4MJD A;  1VQL 3;  1JKG A;  1YJW 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...