1R4CA

N-truncated human cystatin c; dimeric form with 3d domain swapping
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
GGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain swapping in N-truncated human cystatin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords Cystatin C
total genus 19
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1r4cA00
1DVDA 1MNLA 4TX4A 3KFQC 1PFPA 1N5PA 1R4CA 3PXMA 4LZIA 3S67A 3MWZA 1RN7A 1N5HA 3Q2PA 1N9JA 1IV9A 1ROAA 1WNHA 4IT7A 2OCTA 5LC6A 3SVAA 1GD4A 2BO9B 3L0RA 3QRDA 3UL6A 4CCVA 1NB5I 2O9UX 4EYCA 1YVBI 1M9GA 4N6V0 1LXEA 3UL5A 5ELJA 1STFI 3IMAB 2CH9A 4ZM8A 2KXGA 5EQLA 1EQKA 3PS8A 5ELUA 1A67A 3PYJA 1CEWI 3LH4A 4N6MA 4N6TA 1FUWA 4N6LA 4N6NB 1CYUA 1CYVA 4N6UA 1A90A 3NX0A 5LC7A 1MOLA 2W9QA 1NB3I 3KSED 5A0OB 1GD3A 4N6OB 3K9MC 1TIJA 3GAXA 1FA3A 1IV7A 2W9PA 1G96A 1KWIA 1DVCA
chains in the Genus database with same CATH superfamily
1TP6A 2W56A 1IVXA 1SIIA 3FKAA 2GU1A 2HMNB 1JNQA 1C54A 1DETA 1IQYA 2RBIA 2UGIA 2F56A 7RNTA 2W03A 2CG0A 2ML5A 3MHEA 4RBNA 4AKYA 8CHOA 1Q7HA 4FCJA 1FGMA 1JB4A 1W6YA 2YFIB 2YFJB 1Q824 1N8R4 3HOHA 5DRVA 2IA7A 1S723 3DM8A 1IDPA 2ML6A 1JJ22 1FUWA 1NNVA 1TFOA 1E3VA 4N6UA 3F9SA 2CX0A 2C11A 4XB5A 3X3YA 1JBSA 3DGOA 2IUJA 1OACA 1W01A 2INXA 4WP5A 1YNVX 3K9MC 3LTDA 1AR0A 3RGAA 1KWIA 4HM5B 2YFLB 1IVWA 2XSHB 1LOVA 3JVCA 4KFDA 1FGTA 1Q42A 3S67A 2GBWB 2M7OA 3HX8A 3ZG5A 1MWUA 2BNGA 2ZHXB 3CNMA 1U5OA 1FW7A 5FW5A 1IV9A 4NPBA 1ISKA 3CPOA 2XFTA 3PZWA 4J9AA 2E2VA 1JV2B 1OF5A 2SARA 3BNCA 1A2PA 4N6V0 1G02A 1LXEA 1STFI 1QJGA 3D4AA 2MC8A 1BNRA 2XFSA 1CEWI 3DGMA 3N8BA 1B20A 2BU4A 3KIIA 3OX9A 3LYGA 3DXOA 1VQO3 1MWSA 5IG4A 3ALAA 1RMSA 2OOVC 1FUSA 1AY7A 2OWPA 3X41A 2B24B 3NM7A 1BNEA 5IG0A 4HZ9B 3EBTA 5FGOA 1U8CB 1C7HA 1IV7A 1O7NB 3V99A 1FYSA 3KZTA 3G0KA 1Q9EA 3WR2A 1SQWA 4LYLB 2RNTA 4WYKA 1PFPA 1JZOA 1D6YA 1IQ8A 3CCR3 4FR9A 1YIT3 3CCS3 2IYJA 1JB5A 2HMOB 1B21A 2FNQA 2P38A 3E99A 3MYTA 2CWUA 4MMXB 1RLSA 3EJVA 5STDA 1BUQA 1UCIA 1JKGB 4HJLB 2F5WA 3HK4A 3CD63 1A2VA 3IMAB 1DE3A 3EX9A 3CMA3 2KAAA 3NBRA 3D5GA 4QWTA 4JF8A 4N6TA 2P09A 5M18A 3PCRA 5CK6A 3GZXB 3NHXA 9RNTA 1BRIA 2B1XB 3KSPA 3U1WA 1DMMA 1NO3A 3KN4A 1BNGA 2K3DA 1BNIA 4CCVA 4K90B 3T8NA 2RCDA 2CFLA 4RNZA 3CME3 2QA43 2WGQA 1GY7A 1TRPA 4O8SA 2GXFA 3NM2A 1QMAA 3WODG 1VQ73 2Q07A 2GU3A 3OW22 2CIUA 3Q2PA 1VQ53 1WMOA 5DREA 1W6CA 1N9EA 3HI7A 3NV0B 1ASKA 3EC9A 3TDGA 1OPYA 1JBRA 1RGGA 3MSOA 1IVVA 3X42A 1B27A 2GSPA 2BMOB 4GSPA 4RNTA 1IT8A 1BSEA 2D1WA 3HIGA 4K1UA 2ZA4A 4BTWA 1Q814 3AGOA 4HM3B 4GHOA 3S28A 1O7WB 1Y4KA 1CYVA 4O2HA 5EVHA 1BOXA 3ECFA 5IEOA 4O3VA 1W00A 3NBBA 3OXAA 3VF1A 1KQS2 1QVF2 3EB8A 3OWUA 3EE1A 3QK9A 4STDA 2XH9A 5IEPA 2OTJ3 1B2XA 1VQQA 1X1UA 2XF3A 1RN4A 4HAAA 2R4IA 3NXJA 1OGXA 1GOUA 2KCDA 3CNXA 1LVNA 2IUKA 3UB1A 1RN7A 1ZS7A 2HOHA 2K0MA 2W04A 1WNHA 2Z77A 4OVMA 1Q40A 2GBXB 1B2UA 2HMMB 5AIGA 3SOAA 5JPUA 3ZFZA 1JZDA 1GS3A 1BRHA 1ROVA 4GB5A 1UDII 4BTXA 1RGLA 3WA3A 1W4NA 2FXTA 5G1KA 3FH1A 2AADA 2R41A 3K63A 3Q90A 4CPKA 1SARA 6GSPA 3I563 3LZAA 1RJOA 2CW9A 1RKYA 1RCLA 2UUGC 1VQK3 1VQ43 4XM4A 1YJW3 3F7SA 1GY5A 1VQN3 5D83A 5JBSA 3UNLA 7GSPA 4BL3A 1BRGA 1I0XA 4TX4A 5IF6A 1YHQ3 1UUVB 4J5KA 3RGRA 5AYRB 1W02A 4H3UA 3PXMA 3WOEB 3FG4A 1K8A4 1KSIA 1GOVA 2GEYA 1N8QA 3BU4A 1S5AA 5GSPA 1VQ93 2PNCA 2W0QA 2A15A 1T2IA 4HYZA 1TJDA 1YIJ3 2YX9A 3F40A 1D6UA 5CLKA 1BU4A 3AHWA 2UX0A 4R9LA 5ELUA 1UW1A 1UCJA 1ZX2A 3AMOB 4N6MA 4N6NB 4HM2B 4XDWA 1T5YA 4HM8B 2CC3A 5HGRA 1GD3A 2C4BA 4GL6A 3KE7A 4EC6A 3ZG0A 5I97A 1OHSA 3EF8A 3BIRA 4RZMA 4JRFA 4NHFA 2K54A 2XSOB 2CG1A 1IU7A 1N5PA 3T0UA 1WMPA 2F98A 5CXOA 2CK3H 4HZBB 4Q53A 1N9JA 1I3FA 1I2GA 1OCVA 4HOHA 3T8UA 4CDLA 5KP1A 1OF5B 1LNIA 3NBJA 4R1KA 4EV2A 2XGNA 4XBTA 5M1AA 1BSCA 2E2TA 2LQVA 3BNEA 1RNBA 2P0XA 1E97A 1LRAA 2CX1A 1BSAA 4IPBA 3SXXA 5CF1A 2W6JH 1ZO2A 3PCSA 3ROBA 3G713 1NB3I 1RGHA 1V57A 1B2MA 3GZYB 2F99A 5IG3A 2ZL8A 1GY6A 1Q40B 2O3OA 2CWVA 4ILFA 1Z1SA 1PU4A 3DUKA 3CCM3 3G16A 2XRXB 3WMDA 3GRDA 4ORLA 1I70A 2P0MA 4HBRA 2XEPA 5TGNA 3S27A 2AAEA 4FCMA 1O7GB 4XDVA 2Z7AA 1PYLA 1K9M4 2KRTA 4MEIA 1FUTA 3FSDA 1D6ZA 5AI1A 4EYCA 3CCL3 1VQL3 4BIRA 2HMJB 2Z76A 1L5GB 2KXGA 2BMRB 1I3IA 1O7MB 1UI8A 4OK0A 1Q7Y4 1BRJA 1AQZA 1YGEA 4XBYA 4KT3B 1JRQA 2OQEA 3BB9A 4EXRA 1BRNL 3JUOA 3BLZA 3VGNA 1MWTA 1LOWA 3WA2X 4G1MB 4HKVB 4HVNA 5D81A 1OUNA 2KF3A 5HOHA 4X2OA 1R4CA 1RTUA 3FG3A 1RGCA 5EEOA 3MWZA 1UGHI 1I8VA 3NV0A 3S5CA 6RNTA 3SOYA 1TUHA 3SVAA 1K734 3A5EA 1GD4A 1STDA 5AYSC 3I0YA 3X3XA 3Q1CA 4WHAA 3CCE3 1PY3A 2W2CA 3JUQA 1YVBI 3UL5A 1EG9B 4LEHA 5AEUB 2WOHA 3EN8A 3CCU3 1IK3A 3RNTA 1UUGB 2H0GA 1VQ63 5IW9A 2F5MA 3BNBA 1NU3A 3M8CA 5BIRA 3HZPA 1IQXA 2Z6BA 4XBXA 5A0OB 3CCQ3 2CFDA 1G0TA 5KP4A 5BVBA 3EHCA 3FGYA 3ER7A 1X1WA 1OGZA 1F8NA 1RNTA 5BU4A 4HM1B 4KVHA 3H3HA 3GZBA 3LMLA 1IYYA 3FG1A 1US1A 3A76A 4LSOA 3IJEB 2IY2A 3HIIA 5LC6A 1EUIC 2CWTA 4J8TA 1QALA 3OWYA 3MG3A 1DMQA 2CFWA 1W2ZA 2HMLB 4OUQA 3CPW2 4ZM8A 1E3RA 8RNTA 2GEXA 3F14A 5AIFA 3WDGB 3PGBA 2KF4A 1K28A 4HM4B 3K7CA 5RNTA 1M904 3NQZA 3B4OA 4CJNA 1RGFA 5LC7A 4KFEA 1OHOA 2ZDJA 3FF0A 5IERA 1RN1A 1MWRA 4FMCA 1TFKA 1NDOB 1RRLA 4WFOA 4LMIA 1SPUA 2BT3A 1BANA 5M19A 4KFFA 3OV4A 1J2BA 3EN1B 5IG5A 2PZVA 1VZZA 1BRKA 2BO9B 3B7CA 3F8XA 3QRDA 5IENA 1BGSA 5ELJA 2CH9A 3F8HA 1FZUA 4L7KA 1UCKA 4HM0B 5D82A 3V98A 1CQSA 4R80A 3OWSA 2QIYA 1TTOA 2H0IA 3DGNA 3FZWA 3KSED 1KD14 1IT7A 1TIJA 3GAXA 5AIIA 1FA3A 4L8OA 1UI7A 1HYFA 2W9PA 3MG2A 4IIAA 3LTAA 3SLUA 1RGKA 3K0ZA 1JBTA 2CFKA 1I2FA 2STDA 4J5GA 1LQGC 1AVLA 4FMDA 1JN5A 3DMCA 3F7XA 3STDA 1RGEA 3D9RA 1WQLB 3K5TA 1BSDA 2H0HA 3MG1A 1EA2A 4U13A 4N3VA 3UL6A 1VQ83 2Y74A 5G1LA 1QVG2 4FMBA 2O9UX 1M9GA 4I4KA 1OHPA 1LOYA 1IVUA 3URPA 1RDSA 4LGQA 7STDA 3PYJA 2WO0A 3U97A 2JDIH 4AEQA 1YJN3 1MGRA 1RSNA 1ULIB 2CHCA 2W9QA 2WOFA 3CCV3 3LT9A 2SBLA 4HM6B 4L8PA 3X3ZA 3NQYA 3WOFB 2Y73A 2C10A 2I9WA 3JUPA 4MMZB 1DMNA 1LOXA 3JUMA 1QAFA 3JUNA 1K41A 4LZIA 3IPTA 3N9HA 4BU4A 4EV5A 3H51A 1CH0A 1W2B2 2OTL3 1W6GA 3GWRA 1NJI4 1RRHA 1X1YA 1W7CA 1T2HA 3FF2A 4FMAA 1ULJB 4O02B 1MGWA 2OOVA 2BMQB 1YVSA 2WGOA 1EQKA 1X1XA 3FCSB 1FGQA 1HZ1A 3NUVA 4N6LA 3LTBA 3Q3FA 1CYUA 1AVKA 3MPHA 2LYXA 1GMRA 3AHSA 3VSYA 1FGOA 1YJ93 3MKIA 1UGIA 3SEDA 5G2GA 1KC84 1BUJA 3KKGA 4IT7A 3D5IA 3V92A 4AKZA 1HU9A 1LNHA 3B4PA 3CXC2 1GMPA 1ZGXA 3LXUX 1BVIA 4WYKB 2BHMA 3AGNA 3LT8A 4I5QA 3AMOA 3EBYA 3DH2A 2OCTA 2F4YA 1JB2A 3WHOA 2QEX3 4X2HA 3O8YA 2QGUA 3B8LA 2E2UA 1V58A 4R4KA 5EQLA 3DZLA 2JQ5A 1GOYA 2KF6A 3LH4A 3N54B 1W5ZA 4BL2A 5JPPA 2CKFB 4K61A 2W56B 3SX1A 1M1K4 1M1XB 1YI23 3CC43 3FLJA 4BTYA 4H61A 1T3BA 1LQMB 1TRQA 1BAOA 1UUWB 1VQP3 1B2SA 1DVCA 1DVDA 3G6E3 1EKMA 1MNLA 3DY5A 5AIHA 3UJMA 1B2ZA 3DGYA 4R9KA 4RNYA 3GSPA 3RDEA 2FGTA 1N5HA 1A2KA 1BNFA 1ROAA 3GZRA 1NWWA 3L0RA 4K1VA 4MMYB 2XGLA 5BXQA 3D79A 3G4S3 1BIRA 1UCLA 2P05A 3EQQB 1RGAA 4FCZA 1AV4A 4KZ1A 3X40A 3CCJ3 5CF2A 1SJWA 4WWUC 1I2EA 4MJDA 3CU3A 1O7PB 2F86B 1RHLA 2D42A 3CC73 1DYUA 2MF7A 2RFRA 3DGLA 1WTHA 1BNJA 1I0VA 1QAKA 5AEWB 2L4VA 1G96A 1JKGA 1RCKA 1BNSA 1OH0A 1JN5B 2V1LA 2OQEC 2XR8B 3G8ZA 1TU5A 3KFQC 1SIHA 3S29A 1Q864 1O7HB 1BRSA 1WMNA 2BIRA 1R4YA 3LOYA 1BSBA 4EBGA 6STDA 2L1SA 1GMQA 1NB5I 4DKIA 2CFGA 2RSXA 2RGQA 4EW5A 3PS8A 4NREA 1B3SA 3J7Yd 1A67A 2KF5A 1YGWA 2IMJA 1FGRA 1VQM3 5KP3A 3I553 1A90A 3NX0A 1GYBA 3LTCA 1MOLA 3D3LA 1GSPA 1EEJA 3KCHA 4N6OB 3SYUA 2HMKB 3CC23 4PEJA 3BNDA 2J8XB 4HM7B 1HKXA 1V74A
chains in the Genus database with same CATH topology
1TP6A 2W56A 1IVXA 1SIIA 3FKAA 2GU1A 2HMNB 1JNQA 1IQYA 2W03A 2CG0A 2ML5A 3MHEA 4RBNA 4AKYA 8CHOA 4FCJA 1FGMA 1JB4A 1W6YA 2YFIB 2YFJB 1Q824 1N8R4 5DRVA 2IA7A 1S723 3DM8A 1IDPA 2ML6A 1JJ22 1FUWA 1TFOA 1E3VA 4N6UA 3F9SA 4XB5A 2C11A 3X3YA 3DGOA 2IUJA 1OACA 1W01A 2INXA 4WP5A 3K9MC 3LTDA 1AR0A 3RGAA 1KWIA 4HM5B 2YFLB 1IVWA 2XSHB 3JVCA 4KFDA 1FGTA 1Q42A 3S67A 2GBWB 2M7OA 3HX8A 2BNGA 3CNMA 1U5OA 5FW5A 1IV9A 1ISKA 3CPOA 2XFTA 3PZWA 4J9AA 2E2VA 1JV2B 1OF5A 3BNCA 4N6V0 1LXEA 1STFI 1QJGA 2MC8A 2XFSA 1CEWI 3DGMA 3N8BA 1VQO3 3KIIA 3OX9A 3LYGA 3DXOA 5IG4A 3ALAA 2OOVC 2OWPA 3X41A 2B24B 3NM7A 5IG0A 4HZ9B 3EBTA 5FGOA 1U8CB 1C7HA 1IV7A 1O7NB 3V99A 3KZTA 3G0KA 1SQWA 4WYKA 1PFPA 1D6YA 1IQ8A 3CCR3 4FR9A 1YIT3 3CCS3 3E99A 1JB5A 2HMOB 2FNQA 2P38A 3MYTA 4MMXB 2CWUA 3EJVA 5STDA 1BUQA 1JKGB 4HJLB 3HK4A 3CD63 1A2VA 3IMAB 3EX9A 3CMA3 3NBRA 4QWTA 4JF8A 4N6TA 2P09A 3PCRA 5CK6A 3GZXB 3NHXA 2B1XB 3KSPA 3U1WA 1DMMA 1NO3A 3KN4A 4CCVA 4K90B 3T8NA 2RCDA 2CFLA 4RNZA 3CME3 2QA43 2WGQA 1GY7A 4O8SA 2GXFA 3NM2A 1QMAA 3WODG 1VQ73 2Q07A 2GU3A 3OW22 2CIUA 3Q2PA 1VQ53 1WMOA 5DREA 1W6CA 1N9EA 3HI7A 3NV0B 1ASKA 3EC9A 3TDGA 1OPYA 3MSOA 3X42A 1IVVA 2BMOB 4BTWA 1Q814 1IT8A 2D1WA 3HIGA 4K1UA 4HM3B 3S28A 1O7WB 1Y4KA 1CYVA 4O2HA 5EVHA 5IEOA 3ECFA 4O3VA 1W00A 3NBBA 3OXAA 3VF1A 1KQS2 1QVF2 3EB8A 3OWUA 3EE1A 3QK9A 4STDA 2XH9A 5IEPA 2OTJ3 2XF3A 2R4IA 3NXJA 1OGXA 2KCDA 3CNXA 1LVNA 2IUKA 3UB1A 1RN7A 2K0MA 2W04A 1WNHA 2Z77A 4OVMA 1Q40A 2GBXB 5JPUA 2HMMB 5AIGA 3SOAA 1GS3A 1ROVA 4GB5A 4BTXA 3WA3A 1W4NA 2FXTA 3FH1A 3K63A 3Q90A 3I563 3LZAA 1RJOA 2CW9A 1RKYA 1VQK3 1VQ43 4XM4A 1YJW3 3F7SA 1GY5A 1VQN3 5D83A 5JBSA 3UNLA 5IF6A 4TX4A 1YHQ3 1UUVB 3RGRA 5AYRB 1W02A 4H3UA 3PXMA 3WOEB 3FG4A 1K8A4 1KSIA 2GEYA 1N8QA 1S5AA 1VQ93 2PNCA 2W0QA 2A15A 4HYZA 1YIJ3 2YX9A 3F40A 1D6UA 5CLKA 2UX0A 4R9LA 5ELUA 1UW1A 1ZX2A 3AMOB 4N6MA 4N6NB 4HM2B 4XDWA 1T5YA 4HM8B 2CC3A 5HGRA 1GD3A 4EC6A 4GL6A 3KE7A 5I97A 1OHSA 3EF8A 4RZMA 4JRFA 4NHFA 2K54A 2XSOB 2CG1A 1IU7A 1N5PA 3T0UA 1WMPA 2F98A 5CXOA 2CK3H 4HZBB 4Q53A 1N9JA 1OCVA 1YJ93 3T8UA 4CDLA 5KP1A 1OF5B 3NBJA 4R1KA 4EV2A 2XGNA 4XBTA 2E2TA 3BNEA 2LQVA 2P0XA 1E97A 4IPBA 3SXXA 3G713 5CF1A 2W6JH 1ZO2A 3PCSA 3ROBA 1NB3I 3GZYB 2F99A 5IG3A 2ZL8A 1GY6A 1Q40B 2O3OA 2CWVA 1Z1SA 1PU4A 3DUKA 3CCM3 3G16A 2XRXB 3WMDA 3GRDA 4ORLA 2P0MA 4HBRA 2XEPA 5TGNA 3S27A 4FCMA 1O7GB 4XDVA 2Z7AA 1K9M4 2KRTA 4MEIA 3FSDA 5AI1A 1D6ZA 4EYCA 3CCL3 1VQL3 2HMJB 2Z76A 1L5GB 2KXGA 2BMRB 4OK0A 1O7MB 1UI8A 1Q7Y4 1J2BA 1YGEA 4XBYA 1JRQA 2OQEA 3BB9A 4EXRA 3JUOA 3BLZA 3VGNA 3WA2X 4G1MB 4HKVB 4HVNA 5D81A 1OUNA 4X2OA 1R4CA 3FG3A 5EEOA 3MWZA 3NV0A 3S5CA 3SOYA 1TUHA 3SVAA 1K734 1GD4A 1STDA 5AYSC 3I0YA 3X3XA 3Q1CA 4WHAA 3CCE3 3JUQA 2W2CA 5AEUB 1YVBI 3UL5A 1EG9B 4LEHA 3CCU3 2WOHA 3EN8A 1IK3A 1VQ63 5IW9A 3BNBA 1NU3A 3M8CA 3HZPA 1IQXA 2Z6BA 4XBXA 5A0OB 3CCQ3 2CFDA 5KP4A 5BVBA 3EHCA 3FGYA 3ER7A 1OGZA 1F8NA 4HM1B 4KVHA 3H3HA 3GZBA 3LMLA 3FG1A 1US1A 3A76A 4LSOA 3IJEB 3HIIA 5LC6A 2CWTA 4J8TA 1QALA 3OWYA 3MG3A 1DMQA 2CFWA 1W2ZA 2HMLB 4OUQA 3CPW2 4ZM8A 1E3RA 2GEXA 3F14A 5AIFA 3WDGB 3PGBA 1K28A 4HM4B 3K7CA 1M904 3NQZA 3B4OA 5LC7A 4KFEA 1OHOA 2ZDJA 3FF0A 5IERA 4FMCA 1TFKA 1NDOB 1RRLA 4WFOA 4LMIA 1SPUA 2BT3A 4KFFA 3OV4A 3EN1B 5IG5A 2PZVA 1VZZA 2BO9B 3F8XA 3B7CA 3QRDA 5IENA 5ELJA 2CH9A 3F8HA 4L7KA 4HM0B 3V98A 5D82A 1CQSA 4R80A 3OWSA 2QIYA 3FZWA 3DGNA 3KSED 1KD14 1IT7A 1TIJA 3GAXA 5AIIA 1FA3A 4L8OA 1UI7A 2W9PA 3MG2A 4IIAA 3LTAA 3SLUA 3K0ZA 2CFKA 2STDA 1AVLA 4FMDA 1JN5A 3DMCA 3F7XA 3STDA 3D9RA 1WQLB 3K5TA 3MG1A 1EA2A 4U13A 4N3VA 3UL6A 1VQ83 2Y74A 1QVG2 4FMBA 2O9UX 1M9GA 4I4KA 1OHPA 1IVUA 4LGQA 7STDA 3PYJA 2WO0A 3U97A 2JDIH 4AEQA 1YJN3 1ULIB 2CHCA 2WOFA 2W9QA 3CCV3 3LT9A 2SBLA 4HM6B 4L8PA 3NQYA 3WOFB 2Y73A 2C10A 2I9WA 3JUPA 4MMZB 1DMNA 1LOXA 3JUMA 1QAFA 3JUNA 1K41A 4LZIA 3IPTA 3N9HA 4EV5A 3H51A 1W2B2 2OTL3 1W6GA 3GWRA 1NJI4 1RRHA 1W7CA 3FF2A 4FMAA 4O02B 1ULJB 2OOVA 3X3ZA 2BMQB 2WGOA 1EQKA 3FCSB 1FGQA 3NUVA 4N6LA 3LTBA 1CYUA 1AVKA 3MPHA 2LYXA 3VSYA 1FGOA 3MKIA 3SEDA 5G2GA 1KC84 3KKGA 4IT7A 3V92A 4AKZA 1HU9A 1LNHA 3B4PA 3CXC2 3LXUX 4WYKB 2BHMA 3LT8A 3AMOA 3EBYA 2OCTA 1JB2A 2QEX3 4X2HA 3O8YA 2QGUA 3B8LA 2E2UA 4R4KA 5EQLA 3DZLA 2JQ5A 3LH4A 3N54B 1W5ZA 5JPPA 2CKFB 4K61A 2W56B 3SX1A 1M1K4 1M1XB 1YI23 3CC43 3FLJA 4BTYA 4H61A 1UUWB 1VQP3 1DVCA 1DVDA 3G6E3 1EKMA 1MNLA 3DY5A 5AIHA 3UJMA 4R9KA 4RNYA 3RDEA 2FGTA 1N5HA 1A2KA 1ROAA 3GZRA 1NWWA 3L0RA 4K1VA 4MMYB 2XGLA 5BXQA 3G4S3 2P05A 3EQQB 4FCZA 1AV4A 4KZ1A 3X40A 3CCJ3 5CF2A 1SJWA 4WWUC 4MJDA 3CU3A 1O7PB 2F86B 2D42A 3CC73 1DYUA 2MF7A 2RFRA 3DGLA 1QAKA 1WTHA 5AEWB 2L4VA 1JKGA 1G96A 1OH0A 1JN5B 2V1LA 2OQEC 2XR8B 3G8ZA 1TU5A 3KFQC 1SIHA 3S29A 1Q864 1O7HB 1WMNA 3LOYA 4EBGA 6STDA 1NB5I 2CFGA 2RSXA 2RGQA 3PS8A 4NREA 3J7Yd 1A67A 2IMJA 1FGRA 1VQM3 5KP3A 3I553 1A90A 3NX0A 1GYBA 3LTCA 1MOLA 3D3LA 4N6OB 3CC23 2HMKB 4PEJA 3BNDA 4HM7B 1HKXA 1V74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVD A;  1MNL A;  4TX4 A;  3KFQ C;  1PFP A;  1N5P A;  1R4C A;  3PXM A;  4LZI A;  3S67 A;  3MWZ A;  1RN7 A;  1N5H A;  3Q2P A;  1N9J A;  1IV9 A;  1ROA A;  1WNH A;  4IT7 A;  2OCT A;  5LC6 A;  3SVA A;  1GD4 A;  2BO9 B;  3L0R A;  3QRD A;  3UL6 A;  4CCV A;  1NB5 I;  2O9U X;  4EYC A;  1YVB I;  1M9G A;  4N6V 0;  1LXE A;  3UL5 A;  5ELJ A;  1STF I;  3IMA B;  2CH9 A;  4ZM8 A;  2KXG A;  5EQL A;  1EQK A;  3PS8 A;  5ELU A;  1A67 A;  3PYJ A;  1CEW I;  3LH4 A;  4N6M A;  4N6T A;  1FUW A;  4N6L A;  4N6N B;  1CYU A;  1CYV A;  4N6U A;  1A90 A;  3NX0 A;  5LC7 A;  1MOL A;  2W9Q A;  1NB3 I;  3KSE D;  5A0O B;  1GD3 A;  4N6O B;  3K9M C;  1TIJ A;  3GAX A;  1FA3 A;  1IV7 A;  2W9P A;  1G96 A;  1KWI A;  1DVC A; 
#chains in the Genus database with same CATH topology
 1TP6 A;  2W56 A;  1IVX A;  1SII A;  3FKA A;  2GU1 A;  2HMN B;  1JNQ A;  1C54 A;  1DET A;  1IQY A;  2RBI A;  2UGI A;  2F56 A;  7RNT A;  2W03 A;  2CG0 A;  2ML5 A;  3MHE A;  4RBN A;  4AKY A;  8CHO A;  1Q7H A;  4FCJ A;  1FGM A;  1JB4 A;  1W6Y A;  2YFI B;  2YFJ B;  1Q82 4;  1N8R 4;  3HOH A;  5DRV A;  2IA7 A;  1S72 3;  3DM8 A;  1IDP A;  2ML6 A;  1JJ2 2;  1FUW A;  1NNV A;  1TFO A;  1E3V A;  4N6U A;  3F9S A;  2CX0 A;  2C11 A;  4XB5 A;  3X3Y A;  1JBS A;  3DGO A;  2IUJ A;  1OAC A;  1W01 A;  2INX A;  4WP5 A;  1YNV X;  3K9M C;  3LTD A;  1AR0 A;  3RGA A;  1KWI A;  4HM5 B;  2YFL B;  1IVW A;  2XSH B;  1LOV A;  3JVC A;  4KFD A;  1FGT A;  1Q42 A;  3S67 A;  2GBW B;  2M7O A;  3HX8 A;  3ZG5 A;  1MWU A;  2BNG A;  2ZHX B;  3CNM A;  1U5O A;  1FW7 A;  5FW5 A;  1IV9 A;  4NPB A;  1ISK A;  3CPO A;  2XFT A;  3PZW A;  4J9A A;  2E2V A;  1JV2 B;  1OF5 A;  2SAR A;  3BNC A;  1A2P A;  4N6V 0;  1G02 A;  1LXE A;  1STF I;  1QJG A;  3D4A A;  2MC8 A;  1BNR A;  2XFS A;  1CEW I;  3DGM A;  3N8B A;  1B20 A;  2BU4 A;  3KII A;  3OX9 A;  3LYG A;  3DXO A;  1VQO 3;  1MWS A;  5IG4 A;  3ALA A;  1RMS A;  2OOV C;  1FUS A;  1AY7 A;  2OWP A;  3X41 A;  2B24 B;  3NM7 A;  1BNE A;  5IG0 A;  4HZ9 B;  3EBT A;  5FGO A;  1U8C B;  1C7H A;  1IV7 A;  1O7N B;  3V99 A;  1FYS A;  3KZT A;  3G0K A;  1Q9E A;  3WR2 A;  1SQW A;  4LYL B;  2RNT A;  4WYK A;  1PFP A;  1JZO A;  1D6Y A;  1IQ8 A;  3CCR 3;  4FR9 A;  1YIT 3;  3CCS 3;  2IYJ A;  1JB5 A;  2HMO B;  1B21 A;  2FNQ A;  2P38 A;  3E99 A;  3MYT A;  2CWU A;  4MMX B;  1RLS A;  3EJV A;  5STD A;  1BUQ A;  1UCI A;  1JKG B;  4HJL B;  2F5W A;  3HK4 A;  3CD6 3;  1A2V A;  3IMA B;  1DE3 A;  3EX9 A;  3CMA 3;  2KAA A;  3NBR A;  3D5G A;  4QWT A;  4JF8 A;  4N6T A;  2P09 A;  5M18 A;  3PCR A;  5CK6 A;  3GZX B;  3NHX A;  9RNT A;  1BRI A;  2B1X B;  3KSP A;  3U1W A;  1DMM A;  1NO3 A;  3KN4 A;  1BNG A;  2K3D A;  1BNI A;  4CCV A;  4K90 B;  3T8N A;  2RCD A;  2CFL A;  4RNZ A;  3CME 3;  2QA4 3;  2WGQ A;  1GY7 A;  1TRP A;  4O8S A;  2GXF A;  3NM2 A;  1QMA A;  3WOD G;  1VQ7 3;  2Q07 A;  2GU3 A;  3OW2 2;  2CIU A;  3Q2P A;  1VQ5 3;  1WMO A;  5DRE A;  1W6C A;  1N9E A;  3HI7 A;  3NV0 B;  1ASK A;  3EC9 A;  3TDG A;  1OPY A;  1JBR A;  1RGG A;  3MSO A;  1IVV A;  3X42 A;  1B27 A;  2GSP A;  2BMO B;  4GSP A;  4RNT A;  1IT8 A;  1BSE A;  2D1W A;  3HIG A;  4K1U A;  2ZA4 A;  4BTW A;  1Q81 4;  3AGO A;  4HM3 B;  4GHO A;  3S28 A;  1O7W B;  1Y4K A;  1CYV A;  4O2H A;  5EVH A;  1BOX A;  3ECF A;  5IEO A;  4O3V A;  1W00 A;  3NBB A;  3OXA A;  3VF1 A;  1KQS 2;  1QVF 2;  3EB8 A;  3OWU A;  3EE1 A;  3QK9 A;  4STD A;  2XH9 A;  5IEP A;  2OTJ 3;  1B2X A;  1VQQ A;  1X1U A;  2XF3 A;  1RN4 A;  4HAA A;  2R4I A;  3NXJ A;  1OGX A;  1GOU A;  2KCD A;  3CNX A;  1LVN A;  2IUK A;  3UB1 A;  1RN7 A;  1ZS7 A;  2HOH A;  2K0M A;  2W04 A;  1WNH A;  2Z77 A;  4OVM A;  1Q40 A;  2GBX B;  1B2U A;  2HMM B;  5AIG A;  3SOA A;  5JPU A;  3ZFZ A;  1JZD A;  1GS3 A;  1BRH A;  1ROV A;  4GB5 A;  1UDI I;  4BTX A;  1RGL A;  3WA3 A;  1W4N A;  2FXT A;  5G1K A;  3FH1 A;  2AAD A;  2R41 A;  3K63 A;  3Q90 A;  4CPK A;  1SAR A;  6GSP A;  3I56 3;  3LZA A;  1RJO A;  2CW9 A;  1RKY A;  1RCL A;  2UUG C;  1VQK 3;  1VQ4 3;  4XM4 A;  1YJW 3;  3F7S A;  1GY5 A;  1VQN 3;  5D83 A;  5JBS A;  3UNL A;  7GSP A;  4BL3 A;  1BRG A;  1I0X A;  4TX4 A;  5IF6 A;  1YHQ 3;  1UUV B;  4J5K A;  3RGR A;  5AYR B;  1W02 A;  4H3U A;  3PXM A;  3WOE B;  3FG4 A;  1K8A 4;  1KSI A;  1GOV A;  2GEY A;  1N8Q A;  3BU4 A;  1S5A A;  5GSP A;  1VQ9 3;  2PNC A;  2W0Q A;  2A15 A;  1T2I A;  4HYZ A;  1TJD A;  1YIJ 3;  2YX9 A;  3F40 A;  1D6U A;  5CLK A;  1BU4 A;  3AHW A;  2UX0 A;  4R9L A;  5ELU A;  1UW1 A;  1UCJ A;  1ZX2 A;  3AMO B;  4N6M A;  4N6N B;  4HM2 B;  4XDW A;  1T5Y A;  4HM8 B;  2CC3 A;  5HGR A;  1GD3 A;  2C4B A;  4GL6 A;  3KE7 A;  4EC6 A;  3ZG0 A;  5I97 A;  1OHS A;  3EF8 A;  3BIR A;  4RZM A;  4JRF A;  4NHF A;  2K54 A;  2XSO B;  2CG1 A;  1IU7 A;  1N5P A;  3T0U A;  1WMP A;  2F98 A;  5CXO A;  2CK3 H;  4HZB B;  4Q53 A;  1N9J A;  1I3F A;  1I2G A;  1OCV A;  4HOH A;  3T8U A;  4CDL A;  5KP1 A;  1OF5 B;  1LNI A;  3NBJ A;  4R1K A;  4EV2 A;  2XGN A;  4XBT A;  5M1A A;  1BSC A;  2E2T A;  2LQV A;  3BNE A;  1RNB A;  2P0X A;  1E97 A;  1LRA A;  2CX1 A;  1BSA A;  4IPB A;  3SXX A;  5CF1 A;  2W6J H;  1ZO2 A;  3PCS A;  3ROB A;  3G71 3;  1NB3 I;  1RGH A;  1V57 A;  1B2M A;  3GZY B;  2F99 A;  5IG3 A;  2ZL8 A;  1GY6 A;  1Q40 B;  2O3O A;  2CWV A;  4ILF A;  1Z1S A;  1PU4 A;  3DUK A;  3CCM 3;  3G16 A;  2XRX B;  3WMD A;  3GRD A;  4ORL A;  1I70 A;  2P0M A;  4HBR A;  2XEP A;  5TGN A;  3S27 A;  2AAE A;  4FCM A;  1O7G B;  4XDV A;  2Z7A A;  1PYL A;  1K9M 4;  2KRT A;  4MEI A;  1FUT A;  3FSD A;  1D6Z A;  5AI1 A;  4EYC A;  3CCL 3;  1VQL 3;  4BIR A;  2HMJ B;  2Z76 A;  1L5G B;  2KXG A;  2BMR B;  1I3I A;  1O7M B;  1UI8 A;  4OK0 A;  1Q7Y 4;  1BRJ A;  1AQZ A;  1YGE A;  4XBY A;  4KT3 B;  1JRQ A;  2OQE A;  3BB9 A;  4EXR A;  1BRN L;  3JUO A;  3BLZ A;  3VGN A;  1MWT A;  1LOW A;  3WA2 X;  4G1M B;  4HKV B;  4HVN A;  5D81 A;  1OUN A;  2KF3 A;  5HOH A;  4X2O A;  1R4C A;  1RTU A;  3FG3 A;  1RGC A;  5EEO A;  3MWZ A;  1UGH I;  1I8V A;  3NV0 A;  3S5C A;  6RNT A;  3SOY A;  1TUH A;  3SVA A;  1K73 4;  3A5E A;  1GD4 A;  1STD A;  5AYS C;  3I0Y A;  3X3X A;  3Q1C A;  4WHA A;  3CCE 3;  1PY3 A;  2W2C A;  3JUQ A;  1YVB I;  3UL5 A;  1EG9 B;  4LEH A;  5AEU B;  2WOH A;  3EN8 A;  3CCU 3;  1IK3 A;  3RNT A;  1UUG B;  2H0G A;  1VQ6 3;  5IW9 A;  2F5M A;  3BNB A;  1NU3 A;  3M8C A;  5BIR A;  3HZP A;  1IQX A;  2Z6B A;  4XBX A;  5A0O B;  3CCQ 3;  2CFD A;  1G0T A;  5KP4 A;  5BVB A;  3EHC A;  3FGY A;  3ER7 A;  1X1W A;  1OGZ A;  1F8N A;  1RNT A;  5BU4 A;  4HM1 B;  4KVH A;  3H3H A;  3GZB A;  3LML A;  1IYY A;  3FG1 A;  1US1 A;  3A76 A;  4LSO A;  3IJE B;  2IY2 A;  3HII A;  5LC6 A;  1EUI C;  2CWT A;  4J8T A;  1QAL A;  3OWY A;  3MG3 A;  1DMQ A;  2CFW A;  1W2Z A;  2HML B;  4OUQ A;  3CPW 2;  4ZM8 A;  1E3R A;  8RNT A;  2GEX A;  3F14 A;  5AIF A;  3WDG B;  3PGB A;  2KF4 A;  1K28 A;  4HM4 B;  3K7C A;  5RNT A;  1M90 4;  3NQZ A;  3B4O A;  4CJN A;  1RGF A;  5LC7 A;  4KFE A;  1OHO A;  2ZDJ A;  3FF0 A;  5IER A;  1RN1 A;  1MWR A;  4FMC A;  1TFK A;  1NDO B;  1RRL A;  4WFO A;  4LMI A;  1SPU A;  2BT3 A;  1BAN A;  5M19 A;  4KFF A;  3OV4 A;  1J2B A;  3EN1 B;  5IG5 A;  2PZV A;  1VZZ A;  1BRK A;  2BO9 B;  3B7C A;  3F8X A;  3QRD A;  5IEN A;  1BGS A;  5ELJ A;  2CH9 A;  3F8H A;  1FZU A;  4L7K A;  1UCK A;  4HM0 B;  5D82 A;  3V98 A;  1CQS A;  4R80 A;  3OWS A;  2QIY A;  1TTO A;  2H0I A;  3DGN A;  3FZW A;  3KSE D;  1KD1 4;  1IT7 A;  1TIJ A;  3GAX A;  5AII A;  1FA3 A;  4L8O A;  1UI7 A;  1HYF A;  2W9P A;  3MG2 A;  4IIA A;  3LTA A;  3SLU A;  1RGK A;  3K0Z A;  1JBT A;  2CFK A;  1I2F A;  2STD A;  4J5G A;  1LQG C;  1AVL A;  4FMD A;  1JN5 A;  3DMC A;  3F7X A;  3STD A;  1RGE A;  3D9R A;  1WQL B;  3K5T A;  1BSD A;  2H0H A;  3MG1 A;  1EA2 A;  4U13 A;  4N3V A;  3UL6 A;  1VQ8 3;  2Y74 A;  5G1L A;  1QVG 2;  4FMB A;  2O9U X;  1M9G A;  4I4K A;  1OHP A;  1LOY A;  1IVU A;  3URP A;  1RDS A;  4LGQ A;  7STD A;  3PYJ A;  2WO0 A;  3U97 A;  2JDI H;  4AEQ A;  1YJN 3;  1MGR A;  1RSN A;  1ULI B;  2CHC A;  2W9Q A;  2WOF A;  3CCV 3;  3LT9 A;  2SBL A;  4HM6 B;  4L8P A;  3X3Z A;  3NQY A;  3WOF B;  2Y73 A;  2C10 A;  2I9W A;  3JUP A;  4MMZ B;  1DMN A;  1LOX A;  3JUM A;  1QAF A;  3JUN A;  1K41 A;  4LZI A;  3IPT A;  3N9H A;  4BU4 A;  4EV5 A;  3H51 A;  1CH0 A;  1W2B 2;  2OTL 3;  1W6G A;  3GWR A;  1NJI 4;  1RRH A;  1X1Y A;  1W7C A;  1T2H A;  3FF2 A;  4FMA A;  1ULJ B;  4O02 B;  1MGW A;  2OOV A;  2BMQ B;  1YVS A;  2WGO A;  1EQK A;  1X1X A;  3FCS B;  1FGQ A;  1HZ1 A;  3NUV A;  4N6L A;  3LTB A;  3Q3F A;  1CYU A;  1AVK A;  3MPH A;  2LYX A;  1GMR A;  3AHS A;  3VSY A;  1FGO A;  1YJ9 3;  3MKI A;  1UGI A;  3SED A;  5G2G A;  1KC8 4;  1BUJ A;  3KKG A;  4IT7 A;  3D5I A;  3V92 A;  4AKZ A;  1HU9 A;  1LNH A;  3B4P A;  3CXC 2;  1GMP A;  1ZGX A;  3LXU X;  1BVI A;  4WYK B;  2BHM A;  3AGN A;  3LT8 A;  4I5Q A;  3AMO A;  3EBY A;  3DH2 A;  2OCT A;  2F4Y A;  1JB2 A;  3WHO A;  2QEX 3;  4X2H A;  3O8Y A;  2QGU A;  3B8L A;  2E2U A;  1V58 A;  4R4K A;  5EQL A;  3DZL A;  2JQ5 A;  1GOY A;  2KF6 A;  3LH4 A;  3N54 B;  1W5Z A;  4BL2 A;  5JPP A;  2CKF B;  4K61 A;  2W56 B;  3SX1 A;  1M1K 4;  1M1X B;  1YI2 3;  3CC4 3;  3FLJ A;  4BTY A;  4H61 A;  1T3B A;  1LQM B;  1TRQ A;  1BAO A;  1UUW B;  1VQP 3;  1B2S A;  1DVC A;  1DVD A;  3G6E 3;  1EKM A;  1MNL A;  3DY5 A;  5AIH A;  3UJM A;  1B2Z A;  3DGY A;  4R9K A;  4RNY A;  3GSP A;  3RDE A;  2FGT A;  1N5H A;  1A2K A;  1BNF A;  1ROA A;  3GZR A;  1NWW A;  3L0R A;  4K1V A;  4MMY B;  2XGL A;  5BXQ A;  3D79 A;  3G4S 3;  1BIR A;  1UCL A;  2P05 A;  3EQQ B;  1RGA A;  4FCZ A;  1AV4 A;  4KZ1 A;  3X40 A;  3CCJ 3;  5CF2 A;  1SJW A;  4WWU C;  1I2E A;  4MJD A;  3CU3 A;  1O7P B;  2F86 B;  1RHL A;  2D42 A;  3CC7 3;  1DYU A;  2MF7 A;  2RFR A;  3DGL A;  1WTH A;  1BNJ A;  1I0V A;  1QAK A;  5AEW B;  2L4V A;  1G96 A;  1JKG A;  1RCK A;  1BNS A;  1OH0 A;  1JN5 B;  2V1L A;  2OQE C;  2XR8 B;  3G8Z A;  1TU5 A;  3KFQ C;  1SIH A;  3S29 A;  1Q86 4;  1O7H B;  1BRS A;  1WMN A;  2BIR A;  1R4Y A;  3LOY A;  1BSB A;  4EBG A;  6STD A;  2L1S A;  1GMQ A;  1NB5 I;  4DKI A;  2CFG A;  2RSX A;  2RGQ A;  4EW5 A;  3PS8 A;  4NRE A;  1B3S A;  3J7Y d;  1A67 A;  2KF5 A;  1YGW A;  2IMJ A;  1FGR A;  1VQM 3;  5KP3 A;  3I55 3;  1A90 A;  3NX0 A;  1GYB A;  3LTC A;  1MOL A;  3D3L A;  1GSP A;  1EEJ A;  3KCH A;  4N6O B;  3SYU A;  2HMK B;  3CC2 3;  4PEJ A;  3BND A;  2J8X B;  4HM7 B;  1HKX A;  1V74 A; 
#chains in the Genus database with same CATH homology
 1TP6 A;  2W56 A;  1IVX A;  1SII A;  3FKA A;  2GU1 A;  2HMN B;  1JNQ A;  1IQY A;  2W03 A;  2CG0 A;  2ML5 A;  3MHE A;  4RBN A;  4AKY A;  8CHO A;  4FCJ A;  1FGM A;  1JB4 A;  1W6Y A;  2YFI B;  2YFJ B;  1Q82 4;  1N8R 4;  5DRV A;  2IA7 A;  1S72 3;  3DM8 A;  1IDP A;  2ML6 A;  1JJ2 2;  1FUW A;  1TFO A;  1E3V A;  4N6U A;  3F9S A;  4XB5 A;  2C11 A;  3X3Y A;  3DGO A;  2IUJ A;  1OAC A;  1W01 A;  2INX A;  4WP5 A;  3K9M C;  3LTD A;  1AR0 A;  3RGA A;  1KWI A;  4HM5 B;  2YFL B;  1IVW A;  2XSH B;  3JVC A;  4KFD A;  1FGT A;  1Q42 A;  3S67 A;  2GBW B;  2M7O A;  3HX8 A;  2BNG A;  3CNM A;  1U5O A;  5FW5 A;  1IV9 A;  1ISK A;  3CPO A;  2XFT A;  3PZW A;  4J9A A;  2E2V A;  1JV2 B;  1OF5 A;  3BNC A;  4N6V 0;  1LXE A;  1STF I;  1QJG A;  2MC8 A;  2XFS A;  1CEW I;  3DGM A;  3N8B A;  1VQO 3;  3KII A;  3OX9 A;  3LYG A;  3DXO A;  5IG4 A;  3ALA A;  2OOV C;  2OWP A;  3X41 A;  2B24 B;  3NM7 A;  5IG0 A;  4HZ9 B;  3EBT A;  5FGO A;  1U8C B;  1C7H A;  1IV7 A;  1O7N B;  3V99 A;  3KZT A;  3G0K A;  1SQW A;  4WYK A;  1PFP A;  1D6Y A;  1IQ8 A;  3CCR 3;  4FR9 A;  1YIT 3;  3CCS 3;  3E99 A;  1JB5 A;  2HMO B;  2FNQ A;  2P38 A;  3MYT A;  4MMX B;  2CWU A;  3EJV A;  5STD A;  1BUQ A;  1JKG B;  4HJL B;  3HK4 A;  3CD6 3;  1A2V A;  3IMA B;  3EX9 A;  3CMA 3;  3NBR A;  4QWT A;  4JF8 A;  4N6T A;  2P09 A;  3PCR A;  5CK6 A;  3GZX B;  3NHX A;  2B1X B;  3KSP A;  3U1W A;  1DMM A;  1NO3 A;  3KN4 A;  4CCV A;  4K90 B;  3T8N A;  2RCD A;  2CFL A;  4RNZ A;  3CME 3;  2QA4 3;  2WGQ A;  1GY7 A;  4O8S A;  2GXF A;  3NM2 A;  1QMA A;  3WOD G;  1VQ7 3;  2Q07 A;  2GU3 A;  3OW2 2;  2CIU A;  3Q2P A;  1VQ5 3;  1WMO A;  5DRE A;  1W6C A;  1N9E A;  3HI7 A;  3NV0 B;  1ASK A;  3EC9 A;  3TDG A;  1OPY A;  3MSO A;  3X42 A;  1IVV A;  2BMO B;  4BTW A;  1Q81 4;  1IT8 A;  2D1W A;  3HIG A;  4K1U A;  4HM3 B;  3S28 A;  1O7W B;  1Y4K A;  1CYV A;  4O2H A;  5EVH A;  5IEO A;  3ECF A;  4O3V A;  1W00 A;  3NBB A;  3OXA A;  3VF1 A;  1KQS 2;  1QVF 2;  3EB8 A;  3OWU A;  3EE1 A;  3QK9 A;  4STD A;  2XH9 A;  5IEP A;  2OTJ 3;  2XF3 A;  2R4I A;  3NXJ A;  1OGX A;  2KCD A;  3CNX A;  1LVN A;  2IUK A;  3UB1 A;  1RN7 A;  2K0M A;  2W04 A;  1WNH A;  2Z77 A;  4OVM A;  1Q40 A;  2GBX B;  5JPU A;  2HMM B;  5AIG A;  3SOA A;  1GS3 A;  1ROV A;  4GB5 A;  4BTX A;  3WA3 A;  1W4N A;  2FXT A;  3FH1 A;  3K63 A;  3Q90 A;  3I56 3;  3LZA A;  1RJO A;  2CW9 A;  1RKY A;  1VQK 3;  1VQ4 3;  4XM4 A;  1YJW 3;  3F7S A;  1GY5 A;  1VQN 3;  5D83 A;  5JBS A;  3UNL A;  5IF6 A;  4TX4 A;  1YHQ 3;  1UUV B;  3RGR A;  5AYR B;  1W02 A;  4H3U A;  3PXM A;  3WOE B;  3FG4 A;  1K8A 4;  1KSI A;  2GEY A;  1N8Q A;  1S5A A;  1VQ9 3;  2PNC A;  2W0Q A;  2A15 A;  4HYZ A;  1YIJ 3;  2YX9 A;  3F40 A;  1D6U A;  5CLK A;  2UX0 A;  4R9L A;  5ELU A;  1UW1 A;  1ZX2 A;  3AMO B;  4N6M A;  4N6N B;  4HM2 B;  4XDW A;  1T5Y A;  4HM8 B;  2CC3 A;  5HGR A;  1GD3 A;  4EC6 A;  4GL6 A;  3KE7 A;  5I97 A;  1OHS A;  3EF8 A;  4RZM A;  4JRF A;  4NHF A;  2K54 A;  2XSO B;  2CG1 A;  1IU7 A;  1N5P A;  3T0U A;  1WMP A;  2F98 A;  5CXO A;  2CK3 H;  4HZB B;  4Q53 A;  1N9J A;  1OCV A;  1YJ9 3;  3T8U A;  4CDL A;  5KP1 A;  1OF5 B;  3NBJ A;  4R1K A;  4EV2 A;  2XGN A;  4XBT A;  2E2T A;  3BNE A;  2LQV A;  2P0X A;  1E97 A;  4IPB A;  3SXX A;  3G71 3;  5CF1 A;  2W6J H;  1ZO2 A;  3PCS A;  3ROB A;  1NB3 I;  3GZY B;  2F99 A;  5IG3 A;  2ZL8 A;  1GY6 A;  1Q40 B;  2O3O A;  2CWV A;  1Z1S A;  1PU4 A;  3DUK A;  3CCM 3;  3G16 A;  2XRX B;  3WMD A;  3GRD A;  4ORL A;  2P0M A;  4HBR A;  2XEP A;  5TGN A;  3S27 A;  4FCM A;  1O7G B;  4XDV A;  2Z7A A;  1K9M 4;  2KRT A;  4MEI A;  3FSD A;  5AI1 A;  1D6Z A;  4EYC A;  3CCL 3;  1VQL 3;  2HMJ B;  2Z76 A;  1L5G B;  2KXG A;  2BMR B;  4OK0 A;  1O7M B;  1UI8 A;  1Q7Y 4;  1J2B A;  1YGE A;  4XBY A;  1JRQ A;  2OQE A;  3BB9 A;  4EXR A;  3JUO A;  3BLZ A;  3VGN A;  3WA2 X;  4G1M B;  4HKV B;  4HVN A;  5D81 A;  1OUN A;  4X2O A;  1R4C A;  3FG3 A;  5EEO A;  3MWZ A;  3NV0 A;  3S5C A;  3SOY A;  1TUH A;  3SVA A;  1K73 4;  1GD4 A;  1STD A;  5AYS C;  3I0Y A;  3X3X A;  3Q1C A;  4WHA A;  3CCE 3;  3JUQ A;  2W2C A;  5AEU B;  1YVB I;  3UL5 A;  1EG9 B;  4LEH A;  3CCU 3;  2WOH A;  3EN8 A;  1IK3 A;  1VQ6 3;  5IW9 A;  3BNB A;  1NU3 A;  3M8C A;  3HZP A;  1IQX A;  2Z6B A;  4XBX A;  5A0O B;  3CCQ 3;  2CFD A;  5KP4 A;  5BVB A;  3EHC A;  3FGY A;  3ER7 A;  1OGZ A;  1F8N A;  4HM1 B;  4KVH A;  3H3H A;  3GZB A;  3LML A;  3FG1 A;  1US1 A;  3A76 A;  4LSO A;  3IJE B;  3HII A;  5LC6 A;  2CWT A;  4J8T A;  1QAL A;  3OWY A;  3MG3 A;  1DMQ A;  2CFW A;  1W2Z A;  2HML B;  4OUQ A;  3CPW 2;  4ZM8 A;  1E3R A;  2GEX A;  3F14 A;  5AIF A;  3WDG B;  3PGB A;  1K28 A;  4HM4 B;  3K7C A;  1M90 4;  3NQZ A;  3B4O A;  5LC7 A;  4KFE A;  1OHO A;  2ZDJ A;  3FF0 A;  5IER A;  4FMC A;  1TFK A;  1NDO B;  1RRL A;  4WFO A;  4LMI A;  1SPU A;  2BT3 A;  4KFF A;  3OV4 A;  3EN1 B;  5IG5 A;  2PZV A;  1VZZ A;  2BO9 B;  3F8X A;  3B7C A;  3QRD A;  5IEN A;  5ELJ A;  2CH9 A;  3F8H A;  4L7K A;  4HM0 B;  3V98 A;  5D82 A;  1CQS A;  4R80 A;  3OWS A;  2QIY A;  3FZW A;  3DGN A;  3KSE D;  1KD1 4;  1IT7 A;  1TIJ A;  3GAX A;  5AII A;  1FA3 A;  4L8O A;  1UI7 A;  2W9P A;  3MG2 A;  4IIA A;  3LTA A;  3SLU A;  3K0Z A;  2CFK A;  2STD A;  1AVL A;  4FMD A;  1JN5 A;  3DMC A;  3F7X A;  3STD A;  3D9R A;  1WQL B;  3K5T A;  3MG1 A;  1EA2 A;  4U13 A;  4N3V A;  3UL6 A;  1VQ8 3;  2Y74 A;  1QVG 2;  4FMB A;  2O9U X;  1M9G A;  4I4K A;  1OHP A;  1IVU A;  4LGQ A;  7STD A;  3PYJ A;  2WO0 A;  3U97 A;  2JDI H;  4AEQ A;  1YJN 3;  1ULI B;  2CHC A;  2WOF A;  2W9Q A;  3CCV 3;  3LT9 A;  2SBL A;  4HM6 B;  4L8P A;  3NQY A;  3WOF B;  2Y73 A;  2C10 A;  2I9W A;  3JUP A;  4MMZ B;  1DMN A;  1LOX A;  3JUM A;  1QAF A;  3JUN A;  1K41 A;  4LZI A;  3IPT A;  3N9H A;  4EV5 A;  3H51 A;  1W2B 2;  2OTL 3;  1W6G A;  3GWR A;  1NJI 4;  1RRH A;  1W7C A;  3FF2 A;  4FMA A;  4O02 B;  1ULJ B;  2OOV A;  3X3Z A;  2BMQ B;  2WGO A;  1EQK A;  3FCS B;  1FGQ A;  3NUV A;  4N6L A;  3LTB A;  1CYU A;  1AVK A;  3MPH A;  2LYX A;  3VSY A;  1FGO A;  3MKI A;  3SED A;  5G2G A;  1KC8 4;  3KKG A;  4IT7 A;  3V92 A;  4AKZ A;  1HU9 A;  1LNH A;  3B4P A;  3CXC 2;  3LXU X;  4WYK B;  2BHM A;  3LT8 A;  3AMO A;  3EBY A;  2OCT A;  1JB2 A;  2QEX 3;  4X2H A;  3O8Y A;  2QGU A;  3B8L A;  2E2U A;  4R4K A;  5EQL A;  3DZL A;  2JQ5 A;  3LH4 A;  3N54 B;  1W5Z A;  5JPP A;  2CKF B;  4K61 A;  2W56 B;  3SX1 A;  1M1K 4;  1M1X B;  1YI2 3;  3CC4 3;  3FLJ A;  4BTY A;  4H61 A;  1UUW B;  1VQP 3;  1DVC A;  1DVD A;  3G6E 3;  1EKM A;  1MNL A;  3DY5 A;  5AIH A;  3UJM A;  4R9K A;  4RNY A;  3RDE A;  2FGT A;  1N5H A;  1A2K A;  1ROA A;  3GZR A;  1NWW A;  3L0R A;  4K1V A;  4MMY B;  2XGL A;  5BXQ A;  3G4S 3;  2P05 A;  3EQQ B;  4FCZ A;  1AV4 A;  4KZ1 A;  3X40 A;  3CCJ 3;  5CF2 A;  1SJW A;  4WWU C;  4MJD A;  3CU3 A;  1O7P B;  2F86 B;  2D42 A;  3CC7 3;  1DYU A;  2MF7 A;  2RFR A;  3DGL A;  1QAK A;  1WTH A;  5AEW B;  2L4V A;  1JKG A;  1G96 A;  1OH0 A;  1JN5 B;  2V1L A;  2OQE C;  2XR8 B;  3G8Z A;  1TU5 A;  3KFQ C;  1SIH A;  3S29 A;  1Q86 4;  1O7H B;  1WMN A;  3LOY A;  4EBG A;  6STD A;  1NB5 I;  2CFG A;  2RSX A;  2RGQ A;  3PS8 A;  4NRE A;  3J7Y d;  1A67 A;  2IMJ A;  1FGR A;  1VQM 3;  5KP3 A;  3I55 3;  1A90 A;  3NX0 A;  1GYB A;  3LTC A;  1MOL A;  3D3L A;  4N6O B;  3CC2 3;  2HMK B;  4PEJ A;  3BND A;  4HM7 B;  1HKX A;  1V74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...