1R4CA

N-truncated human cystatin c; dimeric form with 3d domain swapping
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
GGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin C
publication title Domain swapping in N-truncated human cystatin C.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1r4cA00
1A67A 3MWZA 3S67A 1CYVA 3NX0A 1DVDA 1MNLA 4N6MA 5ELJA 2BO9B 3UL6A 1ROAA 4ZM8A 3PS8A 2W9PA 1G96A 4N6OB 4N6NB 1R4CA 2O9UX 1IV9A 5A0OB 3UL5A 1NB3I 3Q2PA 1CYUA 4N6V0 3QRDA 3PXMA 2KXGA 3GAXA 4N6LA 1MOLA 1YVBI 1WNHA 1LXEA 3K9MC 3IMAB 3KSED 1TIJA 5LC7A 4LZIA 1PFPA 4N6TA 1FUWA 1DVCA 1N5PA 1STFI 1GD4A 3PYJA 2CH9A 5ELUA 4CCVA 4N6UA 1N9JA 3SVAA 5LC6A 1GD3A 4EYCA 1A90A 1KWIA 5EQLA 3L0RA 1N5HA 3KFQC 4IT7A 1EQKA 2W9QA 1M9GA 1CEWI 1RN7A 1IV7A 1FA3A 3LH4A 4TX4A 2OCTA 1NB5I
chains in the Genus database with same CATH superfamily
3FCSB 2WOFA 1B2UA 2CWTA 1A67A 3I0YA 4KFEA 1OGZA 2Q07A 1HU9A 2Y74A 4X2HA 2XGNA 2W6JH 1W5ZA 1CYVA 4LYLB 2KAAA 1GOYA 1DVDA 1W2B2 2INXA 3DUKA 4GB5A 4L8PA 5G1LA 2HMNB 1YJ93 3LXUX 1BUJA 2BNGA 1UI8A 2CKFB 1ROAA 3OXAA 1JBSA 1VQ63 3H51A 3EX9A 3WA2X 1TP6A 1G96A 2W9PA 2RGQA 2O9UX 4HM1B 5AI1A 3MKIA 4PEJA 3UNLA 5EEOA 3G713 3LTCA 2F99A 1JZOA 2KCDA 5HGRA 4HM5B 2E2VA 1BRNL 3K7CA 1NB3I 2PNCA 3DXOA 1N8QA 2OWPA 5RNTA 4OVMA 1O7MB 5AIGA 5FW5A 4HZ9B 2W56B 2XF3A 2SBLA 2XRXB 4STDA 2AAEA 5D81A 2KXGA 2KRTA 1UUGB 3WOFB 1W01A 1BGSA 1GY5A 3MG2A 1BUQA 4CJNA 1YI23 4N6LA 1LVNA 1IDPA 1MOLA 3G0KA 4KT3B 3EB8A 1MWSA 1RJOA 2GEYA 4NREA 1LXEA 1OHOA 4ILFA 3O8YA 3BNDA 1BSBA 1PFPA 2IUJA 1V58A 1Q824 1OUNA 1W7CA 3DY5A 2RCDA 4KFDA 3GRDA 1BNFA 3IPTA 3F9SA 1OHPA 1N5PA 1STFI 2KF4A 1GSPA 1VQ83 3HOHA 2BU4A 3FLJA 4GSPA 2RBIA 2Y73A 1FGOA 3G6E3 1G02A 5IG3A 1EKMA 1B2XA 4QWTA 1PY3A 3KE7A 4K1VA 4N6UA 5BU4A 3GZYB 2KF6A 1D6UA 1TUHA 1K9M4 1ROVA 2LQVA 2V1LA 4MMYB 2YFLB 3GSPA 4XBYA 3B4PA 4XB5A 1GD3A 3RNTA 1A90A 2H0IA 3LTAA 1BSEA 1JKGA 1SQWA 2WO0A 3RGAA 1VQN3 3LZAA 4WYKB 1V57A 3T8UA 3MHEA 1DMQA 5BIRA 4HVNA 3SOYA 3CCR3 3F8HA 4LGQA 1O7GB 2FXTA 1JBTA 1WMNA 1JB5A 2FGTA 1B2ZA 3K63A 2BHMA 2YX9A 1QJGA 3IJEB 1RN1A 3FG1A 3L0RA 5DREA 1N5HA 1WTHA 2ML6A 2D1WA 1WMOA 2BMOB 1X1WA 1SJWA 5AYSC 1E3RA 3KZTA 2I9WA 1LRAA 2GU3A 2XSHB 4IIAA 1OF5B 1E97A 3AMOA 1I3FA 1I2EA 1JZDA 2CIUA 2W9QA 1O7HB 3KKGA 4L8OA 5AIFA 1CEWI 4OUQA 4ORLA 3UB1A 3SOAA 1QVF2 5BVBA 1TTOA 3AGNA 3FF2A 1FA3A 1SIHA 1RSNA 2F5MA 1Q814 3OX9A 3EN1B 1TFKA 1EUIC 3FG3A 3X40A 2OCTA 5AEWB 1BNSA 1D6ZA 1RRLA 4HM4B 3SX1A 1IQXA 2OOVA 1YIT3 3S67A 4BTWA 4R80A 2L4VA 3MG3A 4FR9A 3NX0A 5AIHA 1YIJ3 4EW5A 3GWRA 3UJMA 1TRPA 1BNEA 1NO3A 4HM7B 1VZZA 3FZWA 2KF5A 3GZXB 3KN4A 4J5GA 1VQQA 2JQ5A 1SARA 3DGLA 2XH9A 1BRKA 4N3VA 4FCJA 3FG4A 3UL6A 4HBRA 1VQ73 3CD63 4BTXA 1LOWA 3MYTA 2P05A 3PS8A 3CNXA 3CC73 1DMMA 2XFTA 1QMAA 1RNBA 3V99A 1IV9A 5JPUA 1NU3A 4GHOA 5KP4A 3D79A 1YVSA 4NPBA 3Q2PA 4MEIA 5IEOA 1CYUA 1B3SA 4R9LA 3A76A 1IT8A 4RBNA 3Q3FA 2BMQB 3K5TA 1BNJA 3PXMA 5JBSA 3F40A 1I2FA 2XFSA 3E99A 2ZA4A 4K1UA 4BTYA 1FUTA 3LTDA 5AIIA 1UCIA 1LQMB 1S5AA 1EG9B 1HZ1A 1RN4A 4RNYA 4RNTA 5AEUB 1JBRA 1ULJB 1STDA 3CCJ3 2GEXA 1FYSA 4XDVA 3AHWA 3DM8A 1UGIA 3H3HA 1YVBI 3LT8A 4HM8B 2F98A 4MJDA 2CG1A 3K9MC 3HX8A 3M8CA 2OQEC 3CCU3 3EQQB 3NQZA 4LZIA 5LC7A 2RSXA 2QA43 1I8VA 1IVWA 4OK0A 1GY6A 1Y4KA 3AGOA 2SARA 3G8ZA 1DMNA 1Z1SA 4EV2A 1GD4A 3VSYA 1AY7A 1GYBA 2CC3A 5G1KA 2C11A 5G2GA 8RNTA 2Z6BA 1GMQA 3U97A 2CX1A 1BU4A 1MGWA 2P09A 1MWTA 2CX0A 1N9JA 2Z76A 3ALAA 3BB9A 1MGRA 1VQO3 1CQSA 3B8LA 1W6YA 1IQYA 3HIIA 1O7NB 3SLUA 3EBYA 2J8XB 4EYCA 1ISKA 2M7OA 2HMMB 3S27A 1R4YA 1GOUA 6RNTA 1VQ93 1QAKA 1KWIA 4R4KA 3EHCA 4DKIA 4IPBA 1B27A 3S5CA 2KF3A 1W00A 1FZUA 2A15A 1M1K4 3LYGA 3RDEA 2RFRA 3HZPA 5IERA 4MMZB 2UGIA 4L7KA 1IT7A 4BU4A 4EC6A 1UCJA 2IUKA 3F14A 3URPA 5CLKA 5TGNA 2W2CA 3S28A 3DZLA 1IVVA 1ZGXA 3CPW2 4O2HA 4FMCA 2YFJB 3WMDA 5M18A 3F8XA 1N8R4 1YJW3 4U13A 1ASKA 3U1WA 2STDA 4EV5A 3DGNA 3DH2A 3NXJA 3CC23 1G0TA 3BNBA 4BL2A 2W56A 1X1YA 2IMJA 3NV0B 3X41A 1BSCA 3I553 1QAFA 3CCQ3 2UUGC 4CPKA 3I563 3FH1A 3EF8A 1BVIA 1O7PB 3BIRA 3CME3 1IK3A 1RLSA 4X2OA 1L5GB 2CWUA 1JRQA 1GMPA 3JUOA 1A2PA 1B20A 1UGHI 2LYXA 4EXRA 1W6GA 4HM2B 2GSPA 2D42A 1MNLA 3JUNA 3PCRA 2PZVA 4FCZA 3ROBA 2W0QA 1DE3A 3CCM3 4R9KA 2BO9B 2YFIB 2E2UA 2P38A 3JVCA 3AHSA 1W2ZA 4EBGA 2BT3A 1O7WB 2ZHXB 4H3UA 5IEPA 1YJN3 4N6OB 4N6NB 1RCKA 5CXOA 3DGOA 1TU5A 5A0OB 2HOHA 3EBTA 3NM2A 1M904 3HI7A 2IYJA 1TRQA 4N6V0 6GSPA 3CXC2 4J8TA 3X3YA 2IY2A 4FMDA 5IG0A 1I0VA 5HOHA 2HMOB 1B2MA 5IG5A 3EN8A 3DGYA 1I2GA 1Q40B 2JDIH 5DRVA 3GAXA 3NUVA 3D5IA 5GSPA 1ZS7A 3OV4A 1LNIA 1UI7A 3PGBA 1T5YA 1W4NA 4WYKA 4J9AA 2UX0A 2QIYA 2CHCA 3BNEA 1NJI4 2AADA 1WNHA 2E2TA 1T2IA 1JN5A 1RDSA 4K90B 3NM7A 4HM3B 1E3VA 1Q9EA 1TIJA 1JB2A 1VQM3 1LQGC 3LT9A 4N6TA 3OW22 3ER7A 1HYFA 1AR0A 3B4OA 1Q7HA 3B7CA 1BRHA 2XEPA 4R1KA 1RGLA 3T8NA 3PYJA 1OF5A 1K28A 2F5WA 4HYZA 5ELUA 3KSPA 1WMPA 3MSOA 1TFOA 1UUVB 3OWUA 3N8BA 1RKYA 1I3IA 2FNQA 3F7XA 1VQP3 3K0ZA 1DETA 1Q7Y4 4LSOA 3WODG 3CMA3 2R4IA 3SVAA 1BNGA 5LC6A 1FGRA 1MWUA 1RHLA 2MF7A 1N9EA 5D82A 1RGHA 1AVKA 1YGWA 3A5EA 1FW7A 8CHOA 3DGMA 7RNTA 2K0MA 4HAAA 1AVLA 1GS3A 1IVXA 2H0HA 3D5GA 5EQLA 5FGOA 5KP3A 4H61A 2W03A 1K41A 3LOYA 3ZFZA 1PYLA 3QK9A 2XSOB 3EC9A 3X42A 2P0MA 2CFLA 3D3LA 1AQZA 3EJVA 5CF1A 2ZDJA 5AYRB 1DYUA 3DMCA 4HJLB 4WFOA 1RGAA 2L1SA 3VF1A 2K54A 5IF6A 7STDA 1YGEA 3KFQC 2CFDA 1T3BA 1OHSA 1A2VA 4XBTA 1U8CB 1C54A 2O3OA 2XGLA 4KZ1A 3ECFA 3WR2A 1IU7A 1VQ53 2WOHA 3STDA 4WWUC 3WHOA 1BSAA 2GBWB 2OOVC 3LH4A 3Q1CA 4G1MB 3CCL3 1QVG2 3NQYA 1US1A 3CCS3 1VQL3 3FGYA 5CF2A 3SXXA 1I70A 1FGMA 1KD14 2QGUA 1NB5I 1LOYA 1RMSA 4XM4A 1ZO2A 1K734 1JKGB 4HM0B 2CFKA 3G16A 3MWZA 3SEDA 1YNVX 1EEJA 3PCSA 1UCKA 1RGCA 2ZL8A 4AKZA 3CPOA 3T0UA 5BXQA 3MPHA 5I97A 3LTBA 3JUMA 1NWWA 3TDGA 3BU4A 1RGKA 4N6MA 1GMRA 3NBJA 1BAOA 3D4AA 5ELJA 3HK4A 2CK3H 3CU3A 4K61A 1OACA 4O3VA 4ZM8A 1J2BA 1FUSA 3ZG5A 1BSDA 2HMLB 1I0XA 1BRGA 2B1XB 3AMOB 4RZMA 3NBRA 1R4CA 1UCLA 3N54B 3CC43 3CNMA 1LNHA 4XBXA 1F8NA 3UL5A 2CFGA 3OWSA 3PZWA 1GOVA 4FMAA 1BOXA 3V98A 1B2SA 9RNTA 2GBXB 1Q864 3KCHA 4HM6B 4CDLA 1VQ43 1JV2B 1BNIA 4JRFA 3EE1A 2IA7A 3GZRA 3QRDA 5STDA 1YHQ3 2HMJB 7GSPA 2GU1A 6STDA 4XDWA 3JUPA 1OH0A 3S29A 3N9HA 1RCLA 3V92A 4FMBA 5IENA 1LOXA 2C10A 1BRSA 1LOVA 5M19A 1QALA 1GY7A 4GL6A 1BRIA 4I4KA 1V74A 3BLZA 5D83A 4MMXB 1RRHA 1FGTA 3FKAA 1AV4A 4LEHA 1KSIA 3F7SA 4KFFA 1PU4A 3IMAB 3X3ZA 3NHXA 2CFWA 1IVUA 3KSED 1KQS2 1RNTA 4RNZA 2F4YA 1JJ22 2H0GA 1FUWA 1FGQA 1ZX2A 1TJDA 1VQK3 1DVCA 1JN5B 2XR8B 3CCE3 3WDGB 3Q90A 3FSDA 1WQLB 2BMRB 3D9RA 2OQEA 5KP1A 2GXFA 2CH9A 1JNQA 2K3DA 3LMLA 3OWYA 2B24B 4CCVA 1HKXA 4AKYA 2OTL3 4AEQA 1B21A 3NBBA 1M1XB 2CG0A 3FF0A 1BANA 3BNCA 5JPPA 3NV0A 5IG4A 1RGEA 3WA3A 1OCVA 4HKVB 4KVHA 4O8SA 2HMKB 2P0XA 1W6CA 3MG1A 4BIRA 4HOHA 4I5QA 5EVHA 2CWVA 2Z7AA 4LMIA 5CK6A 2W04A 5IW9A 4WHAA 4BL3A 1W02A 1C7HA 1OPYA 3VGNA 1K8A4 4FCMA 1SIIA 4J5KA 1SPUA 3SYUA 4NHFA 2CW9A 1UDII 4Q53A 1D6YA 1MWRA 1BNRA 1KC84 1RTUA 1ULIB 1BIRA 2F56A 4HZBB 1CH0A 4O02B 3GZBA 1NDOB 1X1XA 1UW1A 3HIGA 1IQ8A 1NNVA 1Q42A 2WGOA 3RGRA 4IT7A 1EQKA 1JB4A 2WGQA 4WP5A 3G4S3 3ZG0A 1S723 1X1UA 1M9GA 3KIIA 1U5OA 2OTJ3 2R41A 1OGXA 2MC8A 1RN7A 1IV7A 1RGGA 1UUWB 2RNTA 3CCV3 2Z77A 2C4BA 3J7Yd 1RGFA 3JUQA 2QEX3 2ML5A 4JF8A 3X3XA 5M1AA 4TX4A 1EA2A 1BRJA 1T2HA 1Q40A 3WOEB 1IYYA 2BIRA 1A2KA 2F86B
chains in the Genus database with same CATH topology
3FCSB 2WOFA 2CWTA 1A67A 3I0YA 4KFEA 1OGZA 2Q07A 1HU9A 2Y74A 4X2HA 2XGNA 2W6JH 1W5ZA 1CYVA 1DVDA 1W2B2 2INXA 3DUKA 4GB5A 4L8PA 2HMNB 1YJ93 3LXUX 2BNGA 1UI8A 2CKFB 1ROAA 3OXAA 1VQ63 3H51A 3EX9A 3WA2X 1TP6A 1G96A 2W9PA 2RGQA 2O9UX 4HM1B 5AI1A 3MKIA 4PEJA 3UNLA 5EEOA 3G713 3LTCA 2F99A 2KCDA 5HGRA 4HM5B 2E2VA 3K7CA 1NB3I 2PNCA 3DXOA 1N8QA 2OWPA 4OVMA 1O7MB 5AIGA 5FW5A 4HZ9B 2W56B 2XF3A 2SBLA 2XRXB 4STDA 5D81A 2KXGA 2KRTA 3WOFB 1W01A 1GY5A 3MG2A 1BUQA 1YI23 4N6LA 1LVNA 1IDPA 1MOLA 3G0KA 3EB8A 2GEYA 1RJOA 4NREA 1LXEA 1OHOA 3O8YA 3BNDA 1PFPA 2IUJA 1Q824 1OUNA 1W7CA 3DY5A 2RCDA 4KFDA 3GRDA 3IPTA 3F9SA 1OHPA 1N5PA 1STFI 1VQ83 3FLJA 3G6E3 2Y73A 1FGOA 5IG3A 1EKMA 4QWTA 3KE7A 4K1VA 4N6UA 3GZYB 1D6UA 1TUHA 1K9M4 1ROVA 2LQVA 2V1LA 4MMYB 2YFLB 4XBYA 3B4PA 4XB5A 1GD3A 1A90A 3LTAA 1JKGA 1SQWA 2WO0A 3RGAA 1VQN3 3LZAA 4WYKB 3T8UA 3MHEA 1DMQA 4HVNA 3SOYA 3CCR3 3F8HA 4LGQA 1O7GB 2FXTA 1WMNA 1JB5A 2FGTA 3K63A 2BHMA 2YX9A 1QJGA 3IJEB 3L0RA 3FG1A 5DREA 1N5HA 1WTHA 2ML6A 2D1WA 1WMOA 2BMOB 1SJWA 5AYSC 1E3RA 3KZTA 2I9WA 2XSHB 2GU3A 4IIAA 1OF5B 1E97A 3AMOA 2CIUA 2W9QA 1O7HB 3KKGA 4L8OA 5AIFA 1CEWI 4OUQA 4ORLA 3UB1A 3SOAA 1QVF2 5BVBA 3FF2A 1FA3A 1SIHA 1Q814 3OX9A 3EN1B 1TFKA 3FG3A 3X40A 2OCTA 5AEWB 1D6ZA 1RRLA 4HM4B 3SX1A 1IQXA 2OOVA 1YIT3 3S67A 4BTWA 4R80A 2L4VA 3MG3A 4FR9A 3NX0A 5AIHA 1YIJ3 3GWRA 3UJMA 1NO3A 4HM7B 1VZZA 3FZWA 3GZXB 3KN4A 2JQ5A 3DGLA 2XH9A 4N3VA 4FCJA 3FG4A 3UL6A 4HBRA 1VQ73 3CD63 4BTXA 3MYTA 2P05A 3PS8A 3CNXA 3CC73 1DMMA 2XFTA 1QMAA 3V99A 1IV9A 5JPUA 1NU3A 5KP4A 3Q2PA 4MEIA 5IEOA 1CYUA 4R9LA 3A76A 1IT8A 4RBNA 2BMQB 3K5TA 3PXMA 5JBSA 3F40A 2XFSA 3E99A 4K1UA 4BTYA 3LTDA 5AIIA 1S5AA 1EG9B 5AEUB 4RNYA 1ULJB 1STDA 3CCJ3 2GEXA 4XDVA 3DM8A 3LT8A 3H3HA 1YVBI 4HM8B 2F98A 4MJDA 2CG1A 3K9MC 3HX8A 3M8CA 2OQEC 3CCU3 3EQQB 3NQZA 4LZIA 5LC7A 2RSXA 2QA43 1IVWA 4OK0A 1GY6A 1Y4KA 3G8ZA 1DMNA 1Z1SA 4EV2A 1GD4A 3VSYA 1GYBA 2CC3A 2C11A 5G2GA 2Z6BA 3U97A 2P09A 1N9JA 2Z76A 3ALAA 3BB9A 1VQO3 1CQSA 3B8LA 1W6YA 1IQYA 3HIIA 1O7NB 3SLUA 3EBYA 4EYCA 1ISKA 2M7OA 2HMMB 3S27A 1VQ93 1QAKA 1KWIA 4R4KA 3EHCA 4IPBA 3S5CA 1W00A 2A15A 1M1K4 3LYGA 3RDEA 2RFRA 3HZPA 5IERA 4MMZB 4L7KA 1IT7A 4EC6A 2IUKA 3F14A 5CLKA 5TGNA 2W2CA 3S28A 3DZLA 1IVVA 3CPW2 4O2HA 4FMCA 2YFJB 3WMDA 3F8XA 1N8R4 1YJW3 4U13A 1ASKA 3U1WA 2STDA 4EV5A 3DGNA 3NXJA 3CC23 3BNBA 2W56A 2IMJA 3NV0B 3X41A 3I553 1QAFA 3I563 3FH1A 3EF8A 1O7PB 3CME3 1IK3A 4X2OA 1L5GB 2CWUA 1JRQA 3JUOA 2LYXA 4EXRA 1W6GA 4HM2B 2D42A 1MNLA 3JUNA 3PCRA 2PZVA 4FCZA 3ROBA 2W0QA 3CCM3 4R9KA 2BO9B 2YFIB 2E2UA 2P38A 3JVCA 1W2ZA 4EBGA 2BT3A 1O7WB 1YJN3 4H3UA 5IEPA 4N6OB 4N6NB 5CXOA 3DGOA 1TU5A 5A0OB 3EBTA 3NM2A 1M904 3HI7A 4N6V0 3CXC2 4J8TA 3X3YA 4FMDA 5IG0A 2HMOB 5IG5A 3EN8A 1Q40B 2JDIH 5DRVA 3GAXA 3NUVA 3OV4A 1UI7A 3PGBA 1T5YA 1W4NA 4WYKA 4J9AA 2UX0A 2QIYA 2CHCA 3BNEA 1NJI4 1WNHA 2E2TA 1JN5A 4K90B 3NM7A 4HM3B 1E3VA 1TIJA 1JB2A 1VQM3 3LT9A 4N6TA 3OW22 3ER7A 1AR0A 3B4OA 3B7CA 2XEPA 4R1KA 3T8NA 3PYJA 1OF5A 1K28A 4HYZA 5ELUA 3KSPA 1WMPA 3MSOA 1TFOA 1UUVB 3OWUA 3N8BA 1RKYA 2FNQA 3F7XA 1VQP3 3K0ZA 1Q7Y4 4LSOA 3WODG 3CMA3 2R4IA 3SVAA 5LC6A 1FGRA 2MF7A 1N9EA 5D82A 1AVKA 8CHOA 3DGMA 2K0MA 1AVLA 1GS3A 1IVXA 5EQLA 5FGOA 5KP3A 4H61A 2W03A 1K41A 3LOYA 3QK9A 2XSOB 3EC9A 3X42A 2P0MA 2CFLA 3D3LA 3EJVA 5CF1A 3CCQ3 2ZDJA 5AYRB 1DYUA 3DMCA 4HJLB 4WFOA 3VF1A 2K54A 5IF6A 7STDA 1YGEA 3KFQC 2CFDA 1OHSA 1A2VA 4XBTA 1U8CB 2O3OA 2XGLA 4KZ1A 3ECFA 1IU7A 1VQ53 2WOHA 3STDA 4WWUC 2GBWB 2OOVC 3LH4A 3Q1CA 4G1MB 3CCL3 1QVG2 3NQYA 1US1A 3CCS3 1VQL3 3FGYA 5CF2A 3SXXA 1FGMA 1KD14 2QGUA 1NB5I 4XM4A 1ZO2A 1K734 1JKGB 4HM0B 2CFKA 3G16A 3MWZA 3SEDA 3PCSA 2ZL8A 4AKZA 3CPOA 3T0UA 5BXQA 3MPHA 5I97A 3LTBA 3JUMA 1NWWA 3TDGA 4N6MA 3NBJA 5ELJA 3HK4A 2CK3H 3CU3A 4K61A 1OACA 4O3VA 4ZM8A 1J2BA 2HMLB 2B1XB 4RZMA 3AMOB 3NBRA 1R4CA 3N54B 3CC43 3CNMA 1LNHA 4XBXA 1F8NA 3UL5A 2CFGA 3OWSA 3PZWA 3V98A 4FMAA 2GBXB 1Q864 4HM6B 4CDLA 1VQ43 1JV2B 4JRFA 3EE1A 2IA7A 3GZRA 3QRDA 5STDA 1YHQ3 2HMJB 2GU1A 6STDA 4XDWA 3JUPA 1OH0A 3S29A 3N9HA 5IENA 3V92A 4FMBA 1LOXA 2C10A 1QALA 1GY7A 4GL6A 4I4KA 1V74A 3BLZA 5D83A 4MMXB 1RRHA 1FGTA 3FKAA 1AV4A 4LEHA 1KSIA 3F7SA 4KFFA 1PU4A 3IMAB 3X3ZA 3NHXA 2CFWA 1IVUA 3KSED 1KQS2 4RNZA 1JJ22 1FUWA 1FGQA 1ZX2A 1VQK3 1DVCA 1JN5B 2XR8B 3CCE3 3WDGB 3Q90A 3FSDA 1WQLB 2BMRB 3D9RA 2OQEA 5KP1A 2GXFA 2CH9A 1JNQA 3LMLA 3OWYA 2B24B 4CCVA 1HKXA 4AKYA 2OTL3 4AEQA 3NBBA 1M1XB 2CG0A 3FF0A 3BNCA 5JPPA 3NV0A 5IG4A 3WA3A 1OCVA 4HKVB 4KVHA 4O8SA 2HMKB 2P0XA 1W6CA 3MG1A 5EVHA 3J7Yd 2CWVA 2Z7AA 4LMIA 5CK6A 2W04A 5IW9A 4WHAA 1W02A 1C7HA 1OPYA 3VGNA 1K8A4 4FCMA 1SIIA 1SPUA 4NHFA 2CW9A 4Q53A 1D6YA 1KC84 1ULIB 4HZBB 4O02B 3GZBA 1NDOB 1UW1A 3HIGA 1IQ8A 2WGOA 1Q42A 3RGRA 4IT7A 1EQKA 1JB4A 2WGQA 4WP5A 3G4S3 1S723 1M9GA 3KIIA 1U5OA 2OTJ3 1OGXA 2MC8A 1RN7A 1IV7A 1UUWB 3CCV3 2Z77A 3JUQA 2QEX3 2ML5A 4JF8A 3X3XA 4TX4A 1EA2A 1Q40A 3WOEB 1A2KA 2F86B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A67 A;  3MWZ A;  3S67 A;  1CYV A;  3NX0 A;  1DVD A;  1MNL A;  4N6M A;  5ELJ A;  2BO9 B;  3UL6 A;  1ROA A;  4ZM8 A;  3PS8 A;  2W9P A;  1G96 A;  4N6O B;  4N6N B;  1R4C A;  2O9U X;  1IV9 A;  5A0O B;  3UL5 A;  1NB3 I;  3Q2P A;  1CYU A;  4N6V 0;  3QRD A;  3PXM A;  2KXG A;  3GAX A;  4N6L A;  1MOL A;  1YVB I;  1WNH A;  1LXE A;  3K9M C;  3IMA B;  3KSE D;  1TIJ A;  5LC7 A;  4LZI A;  1PFP A;  4N6T A;  1FUW A;  1DVC A;  1N5P A;  1STF I;  1GD4 A;  3PYJ A;  2CH9 A;  5ELU A;  4CCV A;  4N6U A;  1N9J A;  3SVA A;  5LC6 A;  1GD3 A;  4EYC A;  1A90 A;  1KWI A;  5EQL A;  3L0R A;  1N5H A;  3KFQ C;  4IT7 A;  1EQK A;  2W9Q A;  1M9G A;  1CEW I;  1RN7 A;  1IV7 A;  1FA3 A;  3LH4 A;  4TX4 A;  2OCT A;  1NB5 I; 
#chains in the Genus database with same CATH topology
 3FCS B;  2WOF A;  1B2U A;  2CWT A;  1A67 A;  3I0Y A;  4KFE A;  1OGZ A;  2Q07 A;  1HU9 A;  2Y74 A;  4X2H A;  2XGN A;  2W6J H;  1W5Z A;  1CYV A;  4LYL B;  2KAA A;  1GOY A;  1DVD A;  1W2B 2;  2INX A;  3DUK A;  4GB5 A;  4L8P A;  5G1L A;  2HMN B;  1YJ9 3;  3LXU X;  1BUJ A;  2BNG A;  1UI8 A;  2CKF B;  1ROA A;  3OXA A;  1JBS A;  1VQ6 3;  3H51 A;  3EX9 A;  3WA2 X;  1TP6 A;  1G96 A;  2W9P A;  2RGQ A;  2O9U X;  4HM1 B;  5AI1 A;  3MKI A;  4PEJ A;  3UNL A;  5EEO A;  3G71 3;  3LTC A;  2F99 A;  1JZO A;  2KCD A;  5HGR A;  4HM5 B;  2E2V A;  1BRN L;  3K7C A;  1NB3 I;  2PNC A;  3DXO A;  1N8Q A;  2OWP A;  5RNT A;  4OVM A;  1O7M B;  5AIG A;  5FW5 A;  4HZ9 B;  2W56 B;  2XF3 A;  2SBL A;  2XRX B;  4STD A;  2AAE A;  5D81 A;  2KXG A;  2KRT A;  1UUG B;  3WOF B;  1W01 A;  1BGS A;  1GY5 A;  3MG2 A;  1BUQ A;  4CJN A;  1YI2 3;  4N6L A;  1LVN A;  1IDP A;  1MOL A;  3G0K A;  4KT3 B;  3EB8 A;  1MWS A;  1RJO A;  2GEY A;  4NRE A;  1LXE A;  1OHO A;  4ILF A;  3O8Y A;  3BND A;  1BSB A;  1PFP A;  2IUJ A;  1V58 A;  1Q82 4;  1OUN A;  1W7C A;  3DY5 A;  2RCD A;  4KFD A;  3GRD A;  1BNF A;  3IPT A;  3F9S A;  1OHP A;  1N5P A;  1STF I;  2KF4 A;  1GSP A;  1VQ8 3;  3HOH A;  2BU4 A;  3FLJ A;  4GSP A;  2RBI A;  2Y73 A;  1FGO A;  3G6E 3;  1G02 A;  5IG3 A;  1EKM A;  1B2X A;  4QWT A;  1PY3 A;  3KE7 A;  4K1V A;  4N6U A;  5BU4 A;  3GZY B;  2KF6 A;  1D6U A;  1TUH A;  1K9M 4;  1ROV A;  2LQV A;  2V1L A;  4MMY B;  2YFL B;  3GSP A;  4XBY A;  3B4P A;  4XB5 A;  1GD3 A;  3RNT A;  1A90 A;  2H0I A;  3LTA A;  1BSE A;  1JKG A;  1SQW A;  2WO0 A;  3RGA A;  1VQN 3;  3LZA A;  4WYK B;  1V57 A;  3T8U A;  3MHE A;  1DMQ A;  5BIR A;  4HVN A;  3SOY A;  3CCR 3;  3F8H A;  4LGQ A;  1O7G B;  2FXT A;  1JBT A;  1WMN A;  1JB5 A;  2FGT A;  1B2Z A;  3K63 A;  2BHM A;  2YX9 A;  1QJG A;  3IJE B;  1RN1 A;  3FG1 A;  3L0R A;  5DRE A;  1N5H A;  1WTH A;  2ML6 A;  2D1W A;  1WMO A;  2BMO B;  1X1W A;  1SJW A;  5AYS C;  1E3R A;  3KZT A;  2I9W A;  1LRA A;  2GU3 A;  2XSH B;  4IIA A;  1OF5 B;  1E97 A;  3AMO A;  1I3F A;  1I2E A;  1JZD A;  2CIU A;  2W9Q A;  1O7H B;  3KKG A;  4L8O A;  5AIF A;  1CEW I;  4OUQ A;  4ORL A;  3UB1 A;  3SOA A;  1QVF 2;  5BVB A;  1TTO A;  3AGN A;  3FF2 A;  1FA3 A;  1SIH A;  1RSN A;  2F5M A;  1Q81 4;  3OX9 A;  3EN1 B;  1TFK A;  1EUI C;  3FG3 A;  3X40 A;  2OCT A;  5AEW B;  1BNS A;  1D6Z A;  1RRL A;  4HM4 B;  3SX1 A;  1IQX A;  2OOV A;  1YIT 3;  3S67 A;  4BTW A;  4R80 A;  2L4V A;  3MG3 A;  4FR9 A;  3NX0 A;  5AIH A;  1YIJ 3;  4EW5 A;  3GWR A;  3UJM A;  1TRP A;  1BNE A;  1NO3 A;  4HM7 B;  1VZZ A;  3FZW A;  2KF5 A;  3GZX B;  3KN4 A;  4J5G A;  1VQQ A;  2JQ5 A;  1SAR A;  3DGL A;  2XH9 A;  1BRK A;  4N3V A;  4FCJ A;  3FG4 A;  3UL6 A;  4HBR A;  1VQ7 3;  3CD6 3;  4BTX A;  1LOW A;  3MYT A;  2P05 A;  3PS8 A;  3CNX A;  3CC7 3;  1DMM A;  2XFT A;  1QMA A;  1RNB A;  3V99 A;  1IV9 A;  5JPU A;  1NU3 A;  4GHO A;  5KP4 A;  3D79 A;  1YVS A;  4NPB A;  3Q2P A;  4MEI A;  5IEO A;  1CYU A;  1B3S A;  4R9L A;  3A76 A;  1IT8 A;  4RBN A;  3Q3F A;  2BMQ B;  3K5T A;  1BNJ A;  3PXM A;  5JBS A;  3F40 A;  1I2F A;  2XFS A;  3E99 A;  2ZA4 A;  4K1U A;  4BTY A;  1FUT A;  3LTD A;  5AII A;  1UCI A;  1LQM B;  1S5A A;  1EG9 B;  1HZ1 A;  1RN4 A;  4RNY A;  4RNT A;  5AEU B;  1JBR A;  1ULJ B;  1STD A;  3CCJ 3;  2GEX A;  1FYS A;  4XDV A;  3AHW A;  3DM8 A;  1UGI A;  3H3H A;  1YVB I;  3LT8 A;  4HM8 B;  2F98 A;  4MJD A;  2CG1 A;  3K9M C;  3HX8 A;  3M8C A;  2OQE C;  3CCU 3;  3EQQ B;  3NQZ A;  4LZI A;  5LC7 A;  2RSX A;  2QA4 3;  1I8V A;  1IVW A;  4OK0 A;  1GY6 A;  1Y4K A;  3AGO A;  2SAR A;  3G8Z A;  1DMN A;  1Z1S A;  4EV2 A;  1GD4 A;  3VSY A;  1AY7 A;  1GYB A;  2CC3 A;  5G1K A;  2C11 A;  5G2G A;  8RNT A;  2Z6B A;  1GMQ A;  3U97 A;  2CX1 A;  1BU4 A;  1MGW A;  2P09 A;  1MWT A;  2CX0 A;  1N9J A;  2Z76 A;  3ALA A;  3BB9 A;  1MGR A;  1VQO 3;  1CQS A;  3B8L A;  1W6Y A;  1IQY A;  3HII A;  1O7N B;  3SLU A;  3EBY A;  2J8X B;  4EYC A;  1ISK A;  2M7O A;  2HMM B;  3S27 A;  1R4Y A;  1GOU A;  6RNT A;  1VQ9 3;  1QAK A;  1KWI A;  4R4K A;  3EHC A;  4DKI A;  4IPB A;  1B27 A;  3S5C A;  2KF3 A;  1W00 A;  1FZU A;  2A15 A;  1M1K 4;  3LYG A;  3RDE A;  2RFR A;  3HZP A;  5IER A;  4MMZ B;  2UGI A;  4L7K A;  1IT7 A;  4BU4 A;  4EC6 A;  1UCJ A;  2IUK A;  3F14 A;  3URP A;  5CLK A;  5TGN A;  2W2C A;  3S28 A;  3DZL A;  1IVV A;  1ZGX A;  3CPW 2;  4O2H A;  4FMC A;  2YFJ B;  3WMD A;  5M18 A;  3F8X A;  1N8R 4;  1YJW 3;  4U13 A;  1ASK A;  3U1W A;  2STD A;  4EV5 A;  3DGN A;  3DH2 A;  3NXJ A;  3CC2 3;  1G0T A;  3BNB A;  4BL2 A;  2W56 A;  1X1Y A;  2IMJ A;  3NV0 B;  3X41 A;  1BSC A;  3I55 3;  1QAF A;  3CCQ 3;  2UUG C;  4CPK A;  3I56 3;  3FH1 A;  3EF8 A;  1BVI A;  1O7P B;  3BIR A;  3CME 3;  1IK3 A;  1RLS A;  4X2O A;  1L5G B;  2CWU A;  1JRQ A;  1GMP A;  3JUO A;  1A2P A;  1B20 A;  1UGH I;  2LYX A;  4EXR A;  1W6G A;  4HM2 B;  2GSP A;  2D42 A;  1MNL A;  3JUN A;  3PCR A;  2PZV A;  4FCZ A;  3ROB A;  2W0Q A;  1DE3 A;  3CCM 3;  4R9K A;  2BO9 B;  2YFI B;  2E2U A;  2P38 A;  3JVC A;  3AHS A;  1W2Z A;  4EBG A;  2BT3 A;  1O7W B;  2ZHX B;  4H3U A;  5IEP A;  1YJN 3;  4N6O B;  4N6N B;  1RCK A;  5CXO A;  3DGO A;  1TU5 A;  5A0O B;  2HOH A;  3EBT A;  3NM2 A;  1M90 4;  3HI7 A;  2IYJ A;  1TRQ A;  4N6V 0;  6GSP A;  3CXC 2;  4J8T A;  3X3Y A;  2IY2 A;  4FMD A;  5IG0 A;  1I0V A;  5HOH A;  2HMO B;  1B2M A;  5IG5 A;  3EN8 A;  3DGY A;  1I2G A;  1Q40 B;  2JDI H;  5DRV A;  3GAX A;  3NUV A;  3D5I A;  5GSP A;  1ZS7 A;  3OV4 A;  1LNI A;  1UI7 A;  3PGB A;  1T5Y A;  1W4N A;  4WYK A;  4J9A A;  2UX0 A;  2QIY A;  2CHC A;  3BNE A;  1NJI 4;  2AAD A;  1WNH A;  2E2T A;  1T2I A;  1JN5 A;  1RDS A;  4K90 B;  3NM7 A;  4HM3 B;  1E3V A;  1Q9E A;  1TIJ A;  1JB2 A;  1VQM 3;  1LQG C;  3LT9 A;  4N6T A;  3OW2 2;  3ER7 A;  1HYF A;  1AR0 A;  3B4O A;  1Q7H A;  3B7C A;  1BRH A;  2XEP A;  4R1K A;  1RGL A;  3T8N A;  3PYJ A;  1OF5 A;  1K28 A;  2F5W A;  4HYZ A;  5ELU A;  3KSP A;  1WMP A;  3MSO A;  1TFO A;  1UUV B;  3OWU A;  3N8B A;  1RKY A;  1I3I A;  2FNQ A;  3F7X A;  1VQP 3;  3K0Z A;  1DET A;  1Q7Y 4;  4LSO A;  3WOD G;  3CMA 3;  2R4I A;  3SVA A;  1BNG A;  5LC6 A;  1FGR A;  1MWU A;  1RHL A;  2MF7 A;  1N9E A;  5D82 A;  1RGH A;  1AVK A;  1YGW A;  3A5E A;  1FW7 A;  8CHO A;  3DGM A;  7RNT A;  2K0M A;  4HAA A;  1AVL A;  1GS3 A;  1IVX A;  2H0H A;  3D5G A;  5EQL A;  5FGO A;  5KP3 A;  4H61 A;  2W03 A;  1K41 A;  3LOY A;  3ZFZ A;  1PYL A;  3QK9 A;  2XSO B;  3EC9 A;  3X42 A;  2P0M A;  2CFL A;  3D3L A;  1AQZ A;  3EJV A;  5CF1 A;  2ZDJ A;  5AYR B;  1DYU A;  3DMC A;  4HJL B;  4WFO A;  1RGA A;  2L1S A;  3VF1 A;  2K54 A;  5IF6 A;  7STD A;  1YGE A;  3KFQ C;  2CFD A;  1T3B A;  1OHS A;  1A2V A;  4XBT A;  1U8C B;  1C54 A;  2O3O A;  2XGL A;  4KZ1 A;  3ECF A;  3WR2 A;  1IU7 A;  1VQ5 3;  2WOH A;  3STD A;  4WWU C;  3WHO A;  1BSA A;  2GBW B;  2OOV C;  3LH4 A;  3Q1C A;  4G1M B;  3CCL 3;  1QVG 2;  3NQY A;  1US1 A;  3CCS 3;  1VQL 3;  3FGY A;  5CF2 A;  3SXX A;  1I70 A;  1FGM A;  1KD1 4;  2QGU A;  1NB5 I;  1LOY A;  1RMS A;  4XM4 A;  1ZO2 A;  1K73 4;  1JKG B;  4HM0 B;  2CFK A;  3G16 A;  3MWZ A;  3SED A;  1YNV X;  1EEJ A;  3PCS A;  1UCK A;  1RGC A;  2ZL8 A;  4AKZ A;  3CPO A;  3T0U A;  5BXQ A;  3MPH A;  5I97 A;  3LTB A;  3JUM A;  1NWW A;  3TDG A;  3BU4 A;  1RGK A;  4N6M A;  1GMR A;  3NBJ A;  1BAO A;  3D4A A;  5ELJ A;  3HK4 A;  2CK3 H;  3CU3 A;  4K61 A;  1OAC A;  4O3V A;  4ZM8 A;  1J2B A;  1FUS A;  3ZG5 A;  1BSD A;  2HML B;  1I0X A;  1BRG A;  2B1X B;  3AMO B;  4RZM A;  3NBR A;  1R4C A;  1UCL A;  3N54 B;  3CC4 3;  3CNM A;  1LNH A;  4XBX A;  1F8N A;  3UL5 A;  2CFG A;  3OWS A;  3PZW A;  1GOV A;  4FMA A;  1BOX A;  3V98 A;  1B2S A;  9RNT A;  2GBX B;  1Q86 4;  3KCH A;  4HM6 B;  4CDL A;  1VQ4 3;  1JV2 B;  1BNI A;  4JRF A;  3EE1 A;  2IA7 A;  3GZR A;  3QRD A;  5STD A;  1YHQ 3;  2HMJ B;  7GSP A;  2GU1 A;  6STD A;  4XDW A;  3JUP A;  1OH0 A;  3S29 A;  3N9H A;  1RCL A;  3V92 A;  4FMB A;  5IEN A;  1LOX A;  2C10 A;  1BRS A;  1LOV A;  5M19 A;  1QAL A;  1GY7 A;  4GL6 A;  1BRI A;  4I4K A;  1V74 A;  3BLZ A;  5D83 A;  4MMX B;  1RRH A;  1FGT A;  3FKA A;  1AV4 A;  4LEH A;  1KSI A;  3F7S A;  4KFF A;  1PU4 A;  3IMA B;  3X3Z A;  3NHX A;  2CFW A;  1IVU A;  3KSE D;  1KQS 2;  1RNT A;  4RNZ A;  2F4Y A;  1JJ2 2;  2H0G A;  1FUW A;  1FGQ A;  1ZX2 A;  1TJD A;  1VQK 3;  1DVC A;  1JN5 B;  2XR8 B;  3CCE 3;  3WDG B;  3Q90 A;  3FSD A;  1WQL B;  2BMR B;  3D9R A;  2OQE A;  5KP1 A;  2GXF A;  2CH9 A;  1JNQ A;  2K3D A;  3LML A;  3OWY A;  2B24 B;  4CCV A;  1HKX A;  4AKY A;  2OTL 3;  4AEQ A;  1B21 A;  3NBB A;  1M1X B;  2CG0 A;  3FF0 A;  1BAN A;  3BNC A;  5JPP A;  3NV0 A;  5IG4 A;  1RGE A;  3WA3 A;  1OCV A;  4HKV B;  4KVH A;  4O8S A;  2HMK B;  2P0X A;  1W6C A;  3MG1 A;  4BIR A;  4HOH A;  4I5Q A;  5EVH A;  2CWV A;  2Z7A A;  4LMI A;  5CK6 A;  2W04 A;  5IW9 A;  4WHA A;  4BL3 A;  1W02 A;  1C7H A;  1OPY A;  3VGN A;  1K8A 4;  4FCM A;  1SII A;  4J5K A;  1SPU A;  3SYU A;  4NHF A;  2CW9 A;  1UDI I;  4Q53 A;  1D6Y A;  1MWR A;  1BNR A;  1KC8 4;  1RTU A;  1ULI B;  1BIR A;  2F56 A;  4HZB B;  1CH0 A;  4O02 B;  3GZB A;  1NDO B;  1X1X A;  1UW1 A;  3HIG A;  1IQ8 A;  1NNV A;  1Q42 A;  2WGO A;  3RGR A;  4IT7 A;  1EQK A;  1JB4 A;  2WGQ A;  4WP5 A;  3G4S 3;  3ZG0 A;  1S72 3;  1X1U A;  1M9G A;  3KII A;  1U5O A;  2OTJ 3;  2R41 A;  1OGX A;  2MC8 A;  1RN7 A;  1IV7 A;  1RGG A;  1UUW B;  2RNT A;  3CCV 3;  2Z77 A;  2C4B A;  3J7Y d;  1RGF A;  3JUQ A;  2QEX 3;  2ML5 A;  4JF8 A;  3X3X A;  5M1A A;  4TX4 A;  1EA2 A;  1BRJ A;  1T2H A;  1Q40 A;  3WOE B;  1IYY A;  2BIR A;  1A2K A;  2F86 B; 
#chains in the Genus database with same CATH homology
 3FCS B;  2WOF A;  2CWT A;  1A67 A;  3I0Y A;  4KFE A;  1OGZ A;  2Q07 A;  1HU9 A;  2Y74 A;  4X2H A;  2XGN A;  2W6J H;  1W5Z A;  1CYV A;  1DVD A;  1W2B 2;  2INX A;  3DUK A;  4GB5 A;  4L8P A;  2HMN B;  1YJ9 3;  3LXU X;  2BNG A;  1UI8 A;  2CKF B;  1ROA A;  3OXA A;  1VQ6 3;  3H51 A;  3EX9 A;  3WA2 X;  1TP6 A;  1G96 A;  2W9P A;  2RGQ A;  2O9U X;  4HM1 B;  5AI1 A;  3MKI A;  4PEJ A;  3UNL A;  5EEO A;  3G71 3;  3LTC A;  2F99 A;  2KCD A;  5HGR A;  4HM5 B;  2E2V A;  3K7C A;  1NB3 I;  2PNC A;  3DXO A;  1N8Q A;  2OWP A;  4OVM A;  1O7M B;  5AIG A;  5FW5 A;  4HZ9 B;  2W56 B;  2XF3 A;  2SBL A;  2XRX B;  4STD A;  5D81 A;  2KXG A;  2KRT A;  3WOF B;  1W01 A;  1GY5 A;  3MG2 A;  1BUQ A;  1YI2 3;  4N6L A;  1LVN A;  1IDP A;  1MOL A;  3G0K A;  3EB8 A;  2GEY A;  1RJO A;  4NRE A;  1LXE A;  1OHO A;  3O8Y A;  3BND A;  1PFP A;  2IUJ A;  1Q82 4;  1OUN A;  1W7C A;  3DY5 A;  2RCD A;  4KFD A;  3GRD A;  3IPT A;  3F9S A;  1OHP A;  1N5P A;  1STF I;  1VQ8 3;  3FLJ A;  3G6E 3;  2Y73 A;  1FGO A;  5IG3 A;  1EKM A;  4QWT A;  3KE7 A;  4K1V A;  4N6U A;  3GZY B;  1D6U A;  1TUH A;  1K9M 4;  1ROV A;  2LQV A;  2V1L A;  4MMY B;  2YFL B;  4XBY A;  3B4P A;  4XB5 A;  1GD3 A;  1A90 A;  3LTA A;  1JKG A;  1SQW A;  2WO0 A;  3RGA A;  1VQN 3;  3LZA A;  4WYK B;  3T8U A;  3MHE A;  1DMQ A;  4HVN A;  3SOY A;  3CCR 3;  3F8H A;  4LGQ A;  1O7G B;  2FXT A;  1WMN A;  1JB5 A;  2FGT A;  3K63 A;  2BHM A;  2YX9 A;  1QJG A;  3IJE B;  3L0R A;  3FG1 A;  5DRE A;  1N5H A;  1WTH A;  2ML6 A;  2D1W A;  1WMO A;  2BMO B;  1SJW A;  5AYS C;  1E3R A;  3KZT A;  2I9W A;  2XSH B;  2GU3 A;  4IIA A;  1OF5 B;  1E97 A;  3AMO A;  2CIU A;  2W9Q A;  1O7H B;  3KKG A;  4L8O A;  5AIF A;  1CEW I;  4OUQ A;  4ORL A;  3UB1 A;  3SOA A;  1QVF 2;  5BVB A;  3FF2 A;  1FA3 A;  1SIH A;  1Q81 4;  3OX9 A;  3EN1 B;  1TFK A;  3FG3 A;  3X40 A;  2OCT A;  5AEW B;  1D6Z A;  1RRL A;  4HM4 B;  3SX1 A;  1IQX A;  2OOV A;  1YIT 3;  3S67 A;  4BTW A;  4R80 A;  2L4V A;  3MG3 A;  4FR9 A;  3NX0 A;  5AIH A;  1YIJ 3;  3GWR A;  3UJM A;  1NO3 A;  4HM7 B;  1VZZ A;  3FZW A;  3GZX B;  3KN4 A;  2JQ5 A;  3DGL A;  2XH9 A;  4N3V A;  4FCJ A;  3FG4 A;  3UL6 A;  4HBR A;  1VQ7 3;  3CD6 3;  4BTX A;  3MYT A;  2P05 A;  3PS8 A;  3CNX A;  3CC7 3;  1DMM A;  2XFT A;  1QMA A;  3V99 A;  1IV9 A;  5JPU A;  1NU3 A;  5KP4 A;  3Q2P A;  4MEI A;  5IEO A;  1CYU A;  4R9L A;  3A76 A;  1IT8 A;  4RBN A;  2BMQ B;  3K5T A;  3PXM A;  5JBS A;  3F40 A;  2XFS A;  3E99 A;  4K1U A;  4BTY A;  3LTD A;  5AII A;  1S5A A;  1EG9 B;  5AEU B;  4RNY A;  1ULJ B;  1STD A;  3CCJ 3;  2GEX A;  4XDV A;  3DM8 A;  3LT8 A;  3H3H A;  1YVB I;  4HM8 B;  2F98 A;  4MJD A;  2CG1 A;  3K9M C;  3HX8 A;  3M8C A;  2OQE C;  3CCU 3;  3EQQ B;  3NQZ A;  4LZI A;  5LC7 A;  2RSX A;  2QA4 3;  1IVW A;  4OK0 A;  1GY6 A;  1Y4K A;  3G8Z A;  1DMN A;  1Z1S A;  4EV2 A;  1GD4 A;  3VSY A;  1GYB A;  2CC3 A;  2C11 A;  5G2G A;  2Z6B A;  3U97 A;  2P09 A;  1N9J A;  2Z76 A;  3ALA A;  3BB9 A;  1VQO 3;  1CQS A;  3B8L A;  1W6Y A;  1IQY A;  3HII A;  1O7N B;  3SLU A;  3EBY A;  4EYC A;  1ISK A;  2M7O A;  2HMM B;  3S27 A;  1VQ9 3;  1QAK A;  1KWI A;  4R4K A;  3EHC A;  4IPB A;  3S5C A;  1W00 A;  2A15 A;  1M1K 4;  3LYG A;  3RDE A;  2RFR A;  3HZP A;  5IER A;  4MMZ B;  4L7K A;  1IT7 A;  4EC6 A;  2IUK A;  3F14 A;  5CLK A;  5TGN A;  2W2C A;  3S28 A;  3DZL A;  1IVV A;  3CPW 2;  4O2H A;  4FMC A;  2YFJ B;  3WMD A;  3F8X A;  1N8R 4;  1YJW 3;  4U13 A;  1ASK A;  3U1W A;  2STD A;  4EV5 A;  3DGN A;  3NXJ A;  3CC2 3;  3BNB A;  2W56 A;  2IMJ A;  3NV0 B;  3X41 A;  3I55 3;  1QAF A;  3I56 3;  3FH1 A;  3EF8 A;  1O7P B;  3CME 3;  1IK3 A;  4X2O A;  1L5G B;  2CWU A;  1JRQ A;  3JUO A;  2LYX A;  4EXR A;  1W6G A;  4HM2 B;  2D42 A;  1MNL A;  3JUN A;  3PCR A;  2PZV A;  4FCZ A;  3ROB A;  2W0Q A;  3CCM 3;  4R9K A;  2BO9 B;  2YFI B;  2E2U A;  2P38 A;  3JVC A;  1W2Z A;  4EBG A;  2BT3 A;  1O7W B;  1YJN 3;  4H3U A;  5IEP A;  4N6O B;  4N6N B;  5CXO A;  3DGO A;  1TU5 A;  5A0O B;  3EBT A;  3NM2 A;  1M90 4;  3HI7 A;  4N6V 0;  3CXC 2;  4J8T A;  3X3Y A;  4FMD A;  5IG0 A;  2HMO B;  5IG5 A;  3EN8 A;  1Q40 B;  2JDI H;  5DRV A;  3GAX A;  3NUV A;  3OV4 A;  1UI7 A;  3PGB A;  1T5Y A;  1W4N A;  4WYK A;  4J9A A;  2UX0 A;  2QIY A;  2CHC A;  3BNE A;  1NJI 4;  1WNH A;  2E2T A;  1JN5 A;  4K90 B;  3NM7 A;  4HM3 B;  1E3V A;  1TIJ A;  1JB2 A;  1VQM 3;  3LT9 A;  4N6T A;  3OW2 2;  3ER7 A;  1AR0 A;  3B4O A;  3B7C A;  2XEP A;  4R1K A;  3T8N A;  3PYJ A;  1OF5 A;  1K28 A;  4HYZ A;  5ELU A;  3KSP A;  1WMP A;  3MSO A;  1TFO A;  1UUV B;  3OWU A;  3N8B A;  1RKY A;  2FNQ A;  3F7X A;  1VQP 3;  3K0Z A;  1Q7Y 4;  4LSO A;  3WOD G;  3CMA 3;  2R4I A;  3SVA A;  5LC6 A;  1FGR A;  2MF7 A;  1N9E A;  5D82 A;  1AVK A;  8CHO A;  3DGM A;  2K0M A;  1AVL A;  1GS3 A;  1IVX A;  5EQL A;  5FGO A;  5KP3 A;  4H61 A;  2W03 A;  1K41 A;  3LOY A;  3QK9 A;  2XSO B;  3EC9 A;  3X42 A;  2P0M A;  2CFL A;  3D3L A;  3EJV A;  5CF1 A;  3CCQ 3;  2ZDJ A;  5AYR B;  1DYU A;  3DMC A;  4HJL B;  4WFO A;  3VF1 A;  2K54 A;  5IF6 A;  7STD A;  1YGE A;  3KFQ C;  2CFD A;  1OHS A;  1A2V A;  4XBT A;  1U8C B;  2O3O A;  2XGL A;  4KZ1 A;  3ECF A;  1IU7 A;  1VQ5 3;  2WOH A;  3STD A;  4WWU C;  2GBW B;  2OOV C;  3LH4 A;  3Q1C A;  4G1M B;  3CCL 3;  1QVG 2;  3NQY A;  1US1 A;  3CCS 3;  1VQL 3;  3FGY A;  5CF2 A;  3SXX A;  1FGM A;  1KD1 4;  2QGU A;  1NB5 I;  4XM4 A;  1ZO2 A;  1K73 4;  1JKG B;  4HM0 B;  2CFK A;  3G16 A;  3MWZ A;  3SED A;  3PCS A;  2ZL8 A;  4AKZ A;  3CPO A;  3T0U A;  5BXQ A;  3MPH A;  5I97 A;  3LTB A;  3JUM A;  1NWW A;  3TDG A;  4N6M A;  3NBJ A;  5ELJ A;  3HK4 A;  2CK3 H;  3CU3 A;  4K61 A;  1OAC A;  4O3V A;  4ZM8 A;  1J2B A;  2HML B;  2B1X B;  4RZM A;  3AMO B;  3NBR A;  1R4C A;  3N54 B;  3CC4 3;  3CNM A;  1LNH A;  4XBX A;  1F8N A;  3UL5 A;  2CFG A;  3OWS A;  3PZW A;  3V98 A;  4FMA A;  2GBX B;  1Q86 4;  4HM6 B;  4CDL A;  1VQ4 3;  1JV2 B;  4JRF A;  3EE1 A;  2IA7 A;  3GZR A;  3QRD A;  5STD A;  1YHQ 3;  2HMJ B;  2GU1 A;  6STD A;  4XDW A;  3JUP A;  1OH0 A;  3S29 A;  3N9H A;  5IEN A;  3V92 A;  4FMB A;  1LOX A;  2C10 A;  1QAL A;  1GY7 A;  4GL6 A;  4I4K A;  1V74 A;  3BLZ A;  5D83 A;  4MMX B;  1RRH A;  1FGT A;  3FKA A;  1AV4 A;  4LEH A;  1KSI A;  3F7S A;  4KFF A;  1PU4 A;  3IMA B;  3X3Z A;  3NHX A;  2CFW A;  1IVU A;  3KSE D;  1KQS 2;  4RNZ A;  1JJ2 2;  1FUW A;  1FGQ A;  1ZX2 A;  1VQK 3;  1DVC A;  1JN5 B;  2XR8 B;  3CCE 3;  3WDG B;  3Q90 A;  3FSD A;  1WQL B;  2BMR B;  3D9R A;  2OQE A;  5KP1 A;  2GXF A;  2CH9 A;  1JNQ A;  3LML A;  3OWY A;  2B24 B;  4CCV A;  1HKX A;  4AKY A;  2OTL 3;  4AEQ A;  3NBB A;  1M1X B;  2CG0 A;  3FF0 A;  3BNC A;  5JPP A;  3NV0 A;  5IG4 A;  3WA3 A;  1OCV A;  4HKV B;  4KVH A;  4O8S A;  2HMK B;  2P0X A;  1W6C A;  3MG1 A;  5EVH A;  3J7Y d;  2CWV A;  2Z7A A;  4LMI A;  5CK6 A;  2W04 A;  5IW9 A;  4WHA A;  1W02 A;  1C7H A;  1OPY A;  3VGN A;  1K8A 4;  4FCM A;  1SII A;  1SPU A;  4NHF A;  2CW9 A;  4Q53 A;  1D6Y A;  1KC8 4;  1ULI B;  4HZB B;  4O02 B;  3GZB A;  1NDO B;  1UW1 A;  3HIG A;  1IQ8 A;  2WGO A;  1Q42 A;  3RGR A;  4IT7 A;  1EQK A;  1JB4 A;  2WGQ A;  4WP5 A;  3G4S 3;  1S72 3;  1M9G A;  3KII A;  1U5O A;  2OTJ 3;  1OGX A;  2MC8 A;  1RN7 A;  1IV7 A;  1UUW B;  3CCV 3;  2Z77 A;  3JUQ A;  2QEX 3;  2ML5 A;  4JF8 A;  3X3X A;  4TX4 A;  1EA2 A;  1Q40 A;  3WOE B;  1A2K A;  2F86 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...