1R4CA

N-truncated human cystatin c; dimeric form with 3d domain swapping
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
GGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin C
publication title Domain swapping in N-truncated human cystatin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 19
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1r4cA00
1STFI 2BO9B 3KSED 2W9QA 1RN7A 4TX4A 3UL6A 2O9UX 1N9JA 3GAXA 1IV9A 3MWZA 4N6UA 3PYJA 1EQKA 4EYCA 3IMAB 1GD3A 1NB5I 1ROAA 2W9PA 5A0OB 1FA3A 1MNLA 5ELJA 1CYVA 1TIJA 3QRDA 1M9GA 1A90A 1IV7A 1LXEA 4N6MA 3S67A 3LH4A 2CH9A 4LZIA 2KXGA 4N6V0 1GD4A 1A67A 1NB3I 3NX0A 5EQLA 3PXMA 1FUWA 3L0RA 1CEWI 4N6LA 1KWIA 4ZM8A 1MOLA 2OCTA 1N5PA 1DVDA 1PFPA 1DVCA 4N6NB 4CCVA 3K9MC 3KFQC 3PS8A 4IT7A 1G96A 1R4CA 1YVBI 3Q2PA 1CYUA 1N5HA 5ELUA 4N6OB 3UL5A 3SVAA 5LC6A 1WNHA 5LC7A 4N6TA
chains in the Genus database with same CATH superfamily
1R4YA 1STFI 1WQLB 2BO9B 1V74A 2KF5A 1ROVA 1EKMA 3BU4A 3EBTA 2W9QA 3D5GA 3F9SA 3WODG 1ZGXA 3EX9A 5AIFA 4HAAA 1RN7A 1VQ93 1NNVA 1B2UA 4KT3B 1W2ZA 1N8R4 1W5ZA 5DRVA 1B3SA 1N8QA 1GMRA 3X42A 1GD3A 1K8A4 1NB5I 1YIJ3 3DGNA 1VQ73 2PZVA 1AY7A 1WTHA 2XSHB 4WFOA 2OQEA 4LGQA 1FA3A 4KVHA 3KZTA 1OF5A 3IPTA 4BL3A 1O7GB 5AYRB 1WMPA 3WA3A 2D42A 4K1UA 3RDEA 3OW22 1MNLA 2CK3H 1I0XA 2W2CA 1UW1A 4XM4A 1VQN3 3OWYA 1IYYA 3G8ZA 3NBRA 3QRDA 1IV7A 1LXEA 1RGGA 1UCKA 3U1WA 2XR8B 3GZRA 3CME3 3NHXA 3N8BA 5AEUB 3LMLA 3EJVA 3GRDA 5I97A 1HKXA 1SARA 2F98A 1SIHA 3CCL3 1MGWA 4OUQA 5KP1A 1ISKA 1UCIA 3UB1A 1E3VA 1IVWA 2KXGA 3CMA3 1BNRA 3FG1A 3Q3FA 3G0KA 2LQVA 1X1WA 4HM3B 4XBXA 2YFIB 2ZDJA 1JKGA 3CNXA 1VQK3 4HBRA 5DREA 3JUOA 1RCLA 4KFEA 4HM8B 1QALA 2MF7A 3MG2A 1LVNA 4HJLB 5BVBA 8CHOA 4O02B 3G4S3 2HMLB 1MWRA 2C11A 3JUPA 5JBSA 1X1XA 3DGOA 1BRSA 2GBWB 2F86B 1M1K4 3SLUA 1FGTA 2WGOA 1IQ8A 4N6LA 1JN5B 1I2GA 3DGLA 4X2HA 1KWIA 3A5EA 4L8PA 1F8NA 1BAOA 1CQSA 1GOVA 1B2SA 3DUKA 1AQZA 1UGHI 3PGBA 3D9RA 4MMYB 4O8SA 3CCE3 1E97A 2BU4A 2P0MA 2XSOB 1EG9B 2O3OA 2A15A 4HOHA 3ER7A 3KE7A 4FCMA 3RGAA 5STDA 2HMMB 1NWWA 3K9MC 1S5AA 1HYFA 3CCJ3 1NO3A 2Z77A 3DXOA 3KFQC 4ILFA 4N3VA 2FXTA 4HM2B 3FSDA 1O7MB 3NUVA 1ZO2A 3FH1A 1Q814 2R41A 4FMCA 4MMXB 4DKIA 3FG4A 1JNQA 1G96A 1V58A 1Q9EA 1YVBI 4HZBB 3RGRA 3X41A 3FG3A 3G6E3 1GSPA 2ML5A 1RTUA 4I4KA 1GMPA 4MEIA 5AIGA 1OPYA 3Q2PA 5IEOA 1N9EA 1CYUA 1QVG2 1Q42A 2J8XB 3ZFZA 3CCM3 1ZX2A 5IW9A 3UL5A 3J7Yd 1AVKA 2WGQA 3MYTA 1YNVX 1BVIA 2XEPA 2INXA 4JF8A 3AHSA 2BIRA 2UGIA 1A2KA 1US1A 3UJMA 1YGEA 3MG3A 1B20A 4FMDA 3PCRA 1GY5A 2CFWA 2SBLA 5AIHA 2HMOB 2IUKA 5D82A 1BRHA 2H0HA 2XGNA 3CC73 4TX4A 5RNTA 1BNFA 3OV4A 3DGMA 2W0QA 4CPKA 1JN5A 2YFJB 4N6UA 3DZLA 1EQKA 4FCZA 1RN1A 5BIRA 4IIAA 4EYCA 4HVNA 3VGNA 3NV0B 1D6UA 1UI8A 2BMRB 2W56B 3WOFB 1ROAA 2W9PA 4O2HA 1B21A 3EHCA 1B27A 1CH0A 3T8UA 4BTWA 1BOXA 1MWTA 2UUGC 2Y73A 4EXRA 1BSBA 1E3RA 3F8HA 1UI7A 2MC8A 1LOWA 1YVSA 1JZDA 2E2VA 3FGYA 1W6YA 4HM5B 4R1KA 3S27A 1O7HB 4HZ9B 2CX1A 4LSOA 4BTXA 1PY3A 1D6YA 2CIUA 3GSPA 3S67A 2E2TA 2K54A 3LOYA 4GB5A 5M1AA 3UNLA 5CF2A 1BUQA 4LEHA 4LZIA 1RMSA 2HMJB 4BTYA 4J5GA 1NU3A 2KCDA 3B4PA 1QAFA 1VQO3 1K41A 1RGEA 4HM7B 1KC84 1AR0A 3STDA 1NDOB 5HGRA 1IVUA 5D81A 1OUNA 1GD4A 1B2XA 1I3FA 1V57A 2XGLA 2V1LA 3EBYA 1BRJA 1DMMA 1NB3I 4FMBA 4STDA 1O7WB 1RNBA 3PXMA 1VQP3 1K9M4 1YGWA 3F7SA 3V92A 2P0XA 3NBBA 1ZS7A 4CJNA 2BMQB 3LTAA 1TJDA 3NXJA 1IQXA 3B4OA 1CEWI 1BSCA 2F99A 1Y4KA 3LYGA 3DMCA 2YX9A 3EQQB 3S28A 1QMAA 3QK9A 2OTL3 3H51A 1EA2A 4ZM8A 1BNGA 3MKIA 3CNMA 3EN1B 3RNTA 1TUHA 1BU4A 1DYUA 1OGZA 1W4NA 5KP3A 2RGQA 3WR2A 1N5PA 2W6JH 1U8CB 1T2HA 3NV0A 4RZMA 2CWTA 1EUIC 2H0GA 2W56A 3HIIA 3IJEB 4HM0B 3CCR3 1M1XB 1W2B2 5M18A 1DVCA 1FYSA 4CCVA 2JQ5A 2CG1A 1VZZA 3CCU3 2QA43 1W02A 2GU1A 2XFTA 3BNDA 1BNSA 1JB5A 4XB5A 1UUVB 7GSPA 2IYJA 1LQMB 1VQ53 5JPUA 3OWSA 4GHOA 5IF6A 3NQZA 2GBXB 1T5YA 1RJOA 5KP4A 4FCJA 1TRQA 1IDPA 2XF3A 5G1KA 1IT7A 3LT8A 1BRKA 4WWUC 3TDGA 2SARA 2BNGA 2OOVC 3CCQ3 4K90B 1TTOA 2AAEA 1K28A 3BNBA 1N5HA 1TFOA 3ALAA 2CFKA 4N6OB 2K3DA 1IVXA 1UCJA 4RBNA 3Q90A 3T0UA 1OHSA 1Q824 2Z76A 7STDA 2F5MA 5IG5A 3OXAA 3X3ZA 1Q40B 1MWUA 1LOYA 4N6TA 4EW5A 5TGNA 1JZOA 4LMIA 2W03A 2P05A 2BHMA 5CK6A 3D5IA 1L5GB 1IK3A 2XRXB 3K0ZA 2HMNB 2Z7AA 4MJDA 3URPA 1ULIB 1RRLA 2CX0A 2GEXA 3BIRA 4BU4A 3JUQA 2IY2A 1D6ZA 3MWZA 1FGRA 2GXFA 3EC9A 3PYJA 1KSIA 1X1UA 1SJWA 4WYKB 4AKYA 1VQQA 1LNIA 3AGOA 3JUMA 4U13A 4NREA 1YIT3 3CU3A 3WOEB 2ML6A 2CFLA 2E2UA 1BIRA 1BUJA 1G0TA 4EV5A 1FW7A 1VQ83 3MG1A 5IG0A 1I8VA 1RNTA 2D1WA 3NQYA 1O7NB 1PU4A 5ELJA 3HOHA 3JVCA 4J8TA 5IERA 1YHQ3 3PZWA 1M9GA 3K5TA 3OWUA 3X3YA 5FGOA 3V98A 4IPBA 2KF4A 1RHLA 1IQYA 1RGAA 3LH4A 2CH9A 5BU4A 1VQM3 1JV2B 1FUSA 1DMQA 1SPUA 4EC6A 4JRFA 5CXOA 4LYLB 2CW9A 6RNTA 8RNTA 1UCLA 2RCDA 3BNEA 4H61A 5HOHA 1BSEA 1GY6A 3CXC2 2ZA4A 3BNCA 3SXXA 1M904 3WHOA 4AEQA 5IEPA 1Q7HA 4N6V0 1Q864 6STDA 2B24B 3FF0A 3GZYB 3KCHA 3LT9A 3OX9A 1A67A 1W00A 4NHFA 1HZ1A 1HU9A 3NX0A 3F14A 2BT3A 4RNYA 2OOVA 5M19A 1FGMA 1LRAA 4BL2A 1Q40A 3D4AA 5CLKA 4EV2A 2F4YA 2Y74A 1OGXA 3KIIA 4WHAA 1AV4A 3HK4A 3B7CA 3S5CA 2M7OA 4R80A 3FLJA 3FZWA 1A2PA 1UDII 1JRQA 1BSDA 4R9LA 2OTJ3 2Z6BA 1MOLA 2OCTA 4WYKA 2HMKB 1FUWA 1RGCA 4AKZA 3SX1A 1DVDA 1GYBA 1PFPA 4J5KA 3ROBA 4KZ1A 5FW5A 3MHEA 5D83A 3CPW2 4XDVA 1LOXA 3F8XA 3AHWA 3MSOA 1OACA 2CKFB 3NM7A 1RGHA 2CFGA 1WMNA 2IA7A 4O3VA 2QGUA 3GWRA 3CD63 4GSPA 2CC3A 2ZL8A 2K0MA 3H3HA 3CCS3 1YI23 3NM2A 1WMOA 1S723 4IT7A 2CWUA 1AVLA 3I0YA 1UUWB 1GMQA 4OVMA 1I0VA 4I5QA 2IMJA 2W04A 3AMOB 3FKAA 3VF1A 1RKYA 4ORLA 1T2IA 1RRHA 1W6GA 2FGTA 2I9WA 4KFFA 4L7KA 1LNHA 3K7CA 1IU7A 4HM4B 5AI1A 1U5OA 3U97A 1VQ63 3VSYA 3SEDA 1G02A 1QAKA 1JJ22 4XBYA 1KQS2 3N9HA 2C10A 3CC23 1OHPA 5LC6A 6GSPA 4Q53A 1WNHA 2PNCA 1BANA 5IENA 4CDLA 2CWVA 4K61A 1DE3A 3T8NA 2AADA 3KKGA 1JB2A 2RFRA 3GZXB 3K63A 3EE1A 1NJI4 3KSED 1FGQA 2QIYA 3V99A 3A76A 3I563 2GEYA 2CHCA 2WOFA 1J2BA 4QWTA 1FZUA 3WMDA 3KN4A 3UL6A 2GU3A 1N9JA 1RSNA 2O9UX 3HZPA 2STDA 1EEJA 3N54B 1K734 3GAXA 1BRNL 1C54A 1IV9A 1RDSA 1W01A 1Z1SA 3WA2X 1MGRA 1OHOA 1RLSA 1LQGC 4NPBA 5CF1A 3DH2A 3IMAB 3CPOA 3CCV3 5A0OB 3HX8A 4RNZA 1TFKA 1SQWA 4OK0A 2F5WA 4L8OA 5AYSC 2LYXA 4J9AA 1W7CA 2P09A 2RBIA 3D3LA 1OH0A 1W6CA 1I70A 2F56A 2WO0A 2XH9A 4R4KA 1BNIA 1FGOA 2HOHA 1RGKA 1X1YA 1CYVA 1TIJA 3X40A 3CC43 1A90A 1TU5A 2KRTA 1STDA 3PCSA 1ASKA 1I2FA 2UX0A 3DM8A 4N6MA 4HM1B 4WP5A 1I2EA 2CFDA 1VQ43 3SYUA 3LTBA 1OCVA 3G16A 2JDIH 1C7HA 3AMOA 1ULJB 1YJ93 1B2ZA 1GOUA 2YFLB 3FF2A 1JBRA 2P38A 3SOYA 1IT8A 1UGIA 2CG0A 2FNQA 1QJGA 3ECFA 5AIIA 4MMZB 1DETA 1JBTA 5EQLA 5GSPA 2KF3A 1I3IA 4FR9A 4X2OA 3I553 4XBTA 1SIIA 3DGYA 1RCKA 4R9KA 5EEOA 1JBSA 3G713 1A2VA 1BNEA 3F7XA 3LTCA 4RNTA 3S29A 9RNTA 2GSPA 4K1VA 2C4BA 5IG4A 3L0RA 1O7PB 1KD14 5AEWB 4FMAA 3HIGA 5BXQA 2OQEC 2BMOB 1DMNA 2H0IA 2KF6A 3EN8A 2RSXA 1TP6A 3O8YA 1FUTA 3X3XA 1GS3A 1OF5B 3AGNA 3HI7A 4PEJA 1VQL3 1IVVA 3BLZA 5IG3A 2B1XB 1GOYA 3E99A 2Q07A 4N6NB 1QVF2 2QEX3 2OWPA 2L4VA 3LTDA 4XDWA 1UUGB 1B2MA 3F40A 3Q1CA 4HYZA 3PS8A 3DY5A 3ZG0A 4KFDA 3MPHA 1BSAA 1TRPA 3D79A 3EF8A 3NBJA 3SOAA 1BRGA 1RGFA 5G1LA 3ZG5A 1R4CA 1BGSA 1YJN3 2R4IA 3FCSB 7RNTA 1RGLA 5EVHA 3KSPA 1BNJA 2RNTA 4G1MB 2ZHXB 1JB4A 1LOVA 5JPPA 4EBGA 1Q7Y4 1T3BA 3JUNA 3B8LA 3LXUX 4HKVB 5ELUA 2KAAA 2L1SA 1JKGB 5G2GA 3GZBA 3BB9A 1BRIA 3SVAA 2XFSA 3M8CA 4HM6B 3EB8A 4BIRA 1RN4A 4H3UA 1YJW3 1GY7A 3LZAA 4GL6A 5LC7A 3WDGB 1PYLA 1MWSA 2WOHA 2IUJA
chains in the Genus database with same CATH topology
1STFI 1WQLB 2BO9B 1V74A 1ROVA 1EKMA 3EBTA 3WODG 2W9QA 3F9SA 3EX9A 5AIFA 1RN7A 1VQ93 1W2ZA 1N8R4 1W5ZA 5DRVA 1N8QA 3X42A 1GD3A 1K8A4 1NB5I 1YIJ3 3DGNA 1VQ73 2PZVA 1WTHA 4WFOA 2XSHB 2OQEA 4LGQA 1FA3A 4KVHA 3KZTA 1OF5A 3IPTA 1O7GB 5AYRB 1WMPA 3WA3A 2D42A 4K1UA 3RDEA 3OW22 1MNLA 2CK3H 2W2CA 1UW1A 4XM4A 1VQN3 3OWYA 3G8ZA 3NBRA 3QRDA 1IV7A 1LXEA 3U1WA 2XR8B 3GZRA 3CME3 3NHXA 3N8BA 5AEUB 3LMLA 3EJVA 3GRDA 5I97A 1HKXA 2F98A 1SIHA 3CCL3 4OUQA 5KP1A 1ISKA 3UB1A 1E3VA 1IVWA 2KXGA 3CMA3 3FG1A 2LQVA 4XBXA 4HM3B 2YFIB 2ZDJA 1JKGA 3CNXA 1VQK3 4HBRA 5DREA 3JUOA 4KFEA 4HM8B 1QALA 2MF7A 3MG2A 1LVNA 4HJLB 5BVBA 8CHOA 4O02B 3G4S3 2HMLB 2C11A 3JUPA 5JBSA 3DGOA 2GBWB 2F86B 1M1K4 3SLUA 1FGTA 2WGOA 1IQ8A 4N6LA 1JN5B 3DGLA 4X2HA 1KWIA 4L8PA 1F8NA 1CQSA 3DUKA 3PGBA 3D9RA 4MMYB 4O8SA 3CCE3 1E97A 2P0MA 2XSOB 1EG9B 2O3OA 2A15A 3ER7A 3KE7A 4FCMA 3RGAA 5STDA 2HMMB 1NWWA 3K9MC 1S5AA 3CCJ3 1NO3A 2Z77A 3DXOA 3KFQC 4N3VA 2FXTA 4HM2B 3FSDA 1O7MB 3NUVA 1ZO2A 3FH1A 1Q814 4FMCA 4MMXB 1JNQA 1G96A 4HZBB 1YVBI 3RGRA 3X41A 3FG3A 3G6E3 2ML5A 4I4KA 4MEIA 5AIGA 1OPYA 3Q2PA 5IEOA 1N9EA 1CYUA 1QVG2 1Q42A 3CCM3 1ZX2A 5IW9A 3UL5A 3J7Yd 1AVKA 2WGQA 3MYTA 2XEPA 2INXA 4JF8A 1A2KA 1US1A 3UJMA 1YGEA 3MG3A 4FMDA 3PCRA 1GY5A 2CFWA 2SBLA 5AIHA 2HMOB 2IUKA 5D82A 2XGNA 3CC73 4TX4A 3OV4A 3DGMA 2W0QA 1JN5A 2YFJB 4N6UA 3DZLA 1EQKA 4FCZA 4IIAA 4EYCA 4HVNA 3VGNA 3NV0B 1D6UA 1UI8A 2BMRB 2W56B 3WOFB 1ROAA 2W9PA 4O2HA 3T8UA 3EHCA 4BTWA 2Y73A 4EXRA 1E3RA 3F8HA 1UI7A 2MC8A 2E2VA 4HM5B 3FGYA 1W6YA 4R1KA 3S27A 1O7HB 4HZ9B 4LSOA 4BTXA 2CIUA 1D6YA 3S67A 2E2TA 2K54A 3LOYA 4GB5A 3UNLA 5CF2A 1BUQA 4LEHA 4LZIA 2HMJB 4BTYA 1NU3A 2KCDA 3B4PA 1QAFA 1VQO3 1K41A 4HM7B 1KC84 1AR0A 3STDA 1NDOB 5HGRA 1IVUA 5D81A 1OUNA 1GD4A 2XGLA 3EBYA 2V1LA 4STDA 1NB3I 1DMMA 4FMBA 1O7WB 3PXMA 1VQP3 1K9M4 3F7SA 3V92A 2P0XA 3NBBA 2BMQB 3LTAA 3NXJA 1IQXA 3B4OA 1CEWI 2F99A 1Y4KA 3LYGA 3DMCA 2YX9A 3EQQB 3S28A 1QMAA 3QK9A 2OTL3 3H51A 1EA2A 4ZM8A 3MKIA 3CNMA 3EN1B 1TUHA 1DYUA 1OGZA 1W4NA 5KP3A 2RGQA 1N5PA 2W6JH 1U8CB 3NV0A 4RZMA 2CWTA 4HM0B 2W56A 3HIIA 3IJEB 3CCR3 1W2B2 1M1XB 1DVCA 4CCVA 2JQ5A 2CG1A 1VZZA 3CCU3 2QA43 1W02A 2GU1A 2XFTA 3BNDA 1JB5A 4XB5A 1UUVB 1VQ53 5JPUA 3OWSA 5IF6A 3NQZA 2GBXB 1T5YA 1RJOA 5KP4A 4FCJA 1IDPA 2XF3A 1IT7A 3LT8A 4WWUC 3TDGA 2BNGA 2OOVC 3CCQ3 4K90B 1K28A 3BNBA 1N5HA 1TFOA 3ALAA 2CFKA 4N6OB 1IVXA 4RBNA 3Q90A 3T0UA 1OHSA 1Q824 2Z76A 7STDA 5IG5A 3OXAA 3X3ZA 1Q40B 4N6TA 5TGNA 4LMIA 2W03A 2P05A 2BHMA 5CK6A 1L5GB 1IK3A 2XRXB 3K0ZA 2HMNB 2Z7AA 4MJDA 1ULIB 1RRLA 2GEXA 3JUQA 1D6ZA 3MWZA 1FGRA 2GXFA 3EC9A 3PYJA 1KSIA 1SJWA 4WYKB 4AKYA 3JUMA 4U13A 4NREA 1YIT3 3CU3A 3WOEB 2ML6A 2CFLA 2E2UA 4EV5A 1VQ83 3MG1A 5IG0A 2D1WA 3NQYA 1O7NB 1PU4A 5ELJA 3JVCA 4J8TA 5IERA 1YHQ3 3PZWA 1M9GA 3K5TA 3OWUA 3X3YA 5FGOA 3V98A 4IPBA 1VQM3 1IQYA 3LH4A 2CH9A 1JV2B 1SPUA 1DMQA 4EC6A 4JRFA 5CXOA 2CW9A 2RCDA 3BNEA 4H61A 3CXC2 1GY6A 3BNCA 3SXXA 1M904 5IEPA 4AEQA 4N6V0 1Q864 6STDA 2B24B 3FF0A 3GZYB 3LT9A 3OX9A 1A67A 1W00A 4NHFA 1HU9A 3NX0A 3F14A 2BT3A 4RNYA 2OOVA 1FGMA 1Q40A 5CLKA 4EV2A 2Y74A 1OGXA 3KIIA 4WHAA 1AV4A 3HK4A 3B7CA 3S5CA 2M7OA 4R80A 3FLJA 3FZWA 1JRQA 4R9LA 2OTJ3 2Z6BA 1MOLA 2OCTA 4WYKA 2HMKB 1FUWA 4AKZA 1DVDA 3SX1A 1GYBA 1PFPA 3ROBA 4KZ1A 5FW5A 3MHEA 5D83A 3CPW2 4XDVA 1LOXA 3F8XA 3MSOA 1OACA 2CKFB 3NM7A 2CFGA 1WMNA 2IA7A 4O3VA 2QGUA 3GWRA 3CD63 2CC3A 2ZL8A 2K0MA 3H3HA 3CCS3 1YI23 3NM2A 1WMOA 1S723 4IT7A 2CWUA 1AVLA 3I0YA 1UUWB 4OVMA 2IMJA 2W04A 3AMOB 3FKAA 3VF1A 1RKYA 4ORLA 1RRHA 1W6GA 2FGTA 2I9WA 4KFFA 4L7KA 1LNHA 3K7CA 1IU7A 4HM4B 5AI1A 1U5OA 3U97A 1VQ63 3VSYA 3SEDA 1QAKA 1JJ22 4XBYA 1KQS2 3N9HA 2C10A 3CC23 1OHPA 5LC6A 4Q53A 1WNHA 2PNCA 5IENA 4CDLA 2CWVA 4K61A 3T8NA 3KKGA 2RFRA 1JB2A 3GZXB 3K63A 3EE1A 1NJI4 3KSED 1FGQA 2QIYA 3V99A 3A76A 3I563 2GEYA 2CHCA 2WOFA 1J2BA 4QWTA 3WMDA 3KN4A 3UL6A 2GU3A 1N9JA 2O9UX 3HZPA 2STDA 3N54B 1K734 3GAXA 1IV9A 1Z1SA 1W01A 3WA2X 1OHOA 5CF1A 3IMAB 3CPOA 3CCV3 5A0OB 3HX8A 4RNZA 1TFKA 1SQWA 4OK0A 4L8OA 5AYSC 2LYXA 4J9AA 1W7CA 2P09A 3D3LA 1OH0A 1W6CA 2WO0A 2XH9A 4R4KA 1FGOA 1CYVA 1TIJA 3X40A 3CC43 1A90A 1TU5A 2KRTA 1STDA 3PCSA 1ASKA 2UX0A 3DM8A 4N6MA 4HM1B 4WP5A 2CFDA 1VQ43 3LTBA 1OCVA 3G16A 2JDIH 1C7HA 3AMOA 1ULJB 1YJ93 2YFLB 3FF2A 2P38A 3SOYA 1IT8A 2CG0A 2FNQA 1QJGA 3ECFA 5AIIA 4MMZB 5EQLA 4X2OA 4FR9A 3I553 4XBTA 1SIIA 5EEOA 4R9KA 3G713 1A2VA 3F7XA 3LTCA 3S29A 4K1VA 5IG4A 3L0RA 1O7PB 1KD14 5AEWB 4FMAA 3HIGA 5BXQA 2OQEC 2BMOB 1DMNA 3EN8A 2RSXA 1TP6A 3O8YA 3X3XA 1GS3A 1OF5B 3HI7A 4PEJA 1VQL3 1IVVA 3BLZA 5IG3A 2B1XB 3E99A 4N6NB 2Q07A 1QVF2 2QEX3 2OWPA 2L4VA 3LTDA 4XDWA 3F40A 3Q1CA 4HYZA 3PS8A 3DY5A 4KFDA 3MPHA 3EF8A 3NBJA 3SOAA 1R4CA 1YJN3 2R4IA 3FCSB 5EVHA 3KSPA 4G1MB 1JB4A 5JPPA 4EBGA 1Q7Y4 3JUNA 3B8LA 3LXUX 4HKVB 5ELUA 1JKGB 5G2GA 3GZBA 3BB9A 3SVAA 2XFSA 3M8CA 4HM6B 3EB8A 4H3UA 1YJW3 1GY7A 3LZAA 4GL6A 5LC7A 3WDGB 2WOHA 3G0KA 3FG4A 2IUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF I;  2BO9 B;  3KSE D;  2W9Q A;  1RN7 A;  4TX4 A;  3UL6 A;  2O9U X;  1N9J A;  3GAX A;  1IV9 A;  3MWZ A;  4N6U A;  3PYJ A;  1EQK A;  4EYC A;  3IMA B;  1GD3 A;  1NB5 I;  1ROA A;  2W9P A;  5A0O B;  1FA3 A;  1MNL A;  5ELJ A;  1CYV A;  1TIJ A;  3QRD A;  1M9G A;  1A90 A;  1IV7 A;  1LXE A;  4N6M A;  3S67 A;  3LH4 A;  2CH9 A;  4LZI A;  2KXG A;  4N6V 0;  1GD4 A;  1A67 A;  1NB3 I;  3NX0 A;  5EQL A;  3PXM A;  1FUW A;  3L0R A;  1CEW I;  4N6L A;  1KWI A;  4ZM8 A;  1MOL A;  2OCT A;  1N5P A;  1DVD A;  1PFP A;  1DVC A;  4N6N B;  4CCV A;  3K9M C;  3KFQ C;  3PS8 A;  4IT7 A;  1G96 A;  1R4C A;  1YVB I;  3Q2P A;  1CYU A;  1N5H A;  5ELU A;  4N6O B;  3UL5 A;  3SVA A;  5LC6 A;  1WNH A;  5LC7 A;  4N6T A; 
#chains in the Genus database with same CATH topology
 1R4Y A;  1STF I;  1WQL B;  2BO9 B;  1V74 A;  2KF5 A;  1ROV A;  1EKM A;  3BU4 A;  3EBT A;  2W9Q A;  3D5G A;  3F9S A;  3WOD G;  1ZGX A;  3EX9 A;  5AIF A;  4HAA A;  1RN7 A;  1VQ9 3;  1NNV A;  1B2U A;  4KT3 B;  1W2Z A;  1N8R 4;  1W5Z A;  5DRV A;  1B3S A;  1N8Q A;  1GMR A;  3X42 A;  1GD3 A;  1K8A 4;  1NB5 I;  1YIJ 3;  3DGN A;  1VQ7 3;  2PZV A;  1AY7 A;  1WTH A;  2XSH B;  4WFO A;  2OQE A;  4LGQ A;  1FA3 A;  4KVH A;  3KZT A;  1OF5 A;  3IPT A;  4BL3 A;  1O7G B;  5AYR B;  1WMP A;  3WA3 A;  2D42 A;  4K1U A;  3RDE A;  3OW2 2;  1MNL A;  2CK3 H;  1I0X A;  2W2C A;  1UW1 A;  4XM4 A;  1VQN 3;  3OWY A;  1IYY A;  3G8Z A;  3NBR A;  3QRD A;  1IV7 A;  1LXE A;  1RGG A;  1UCK A;  3U1W A;  2XR8 B;  3GZR A;  3CME 3;  3NHX A;  3N8B A;  5AEU B;  3LML A;  3EJV A;  3GRD A;  5I97 A;  1HKX A;  1SAR A;  2F98 A;  1SIH A;  3CCL 3;  1MGW A;  4OUQ A;  5KP1 A;  1ISK A;  1UCI A;  3UB1 A;  1E3V A;  1IVW A;  2KXG A;  3CMA 3;  1BNR A;  3FG1 A;  3Q3F A;  3G0K A;  2LQV A;  1X1W A;  4HM3 B;  4XBX A;  2YFI B;  2ZDJ A;  1JKG A;  3CNX A;  1VQK 3;  4HBR A;  5DRE A;  3JUO A;  1RCL A;  4KFE A;  4HM8 B;  1QAL A;  2MF7 A;  3MG2 A;  1LVN A;  4HJL B;  5BVB A;  8CHO A;  4O02 B;  3G4S 3;  2HML B;  1MWR A;  2C11 A;  3JUP A;  5JBS A;  1X1X A;  3DGO A;  1BRS A;  2GBW B;  2F86 B;  1M1K 4;  3SLU A;  1FGT A;  2WGO A;  1IQ8 A;  4N6L A;  1JN5 B;  1I2G A;  3DGL A;  4X2H A;  1KWI A;  3A5E A;  4L8P A;  1F8N A;  1BAO A;  1CQS A;  1GOV A;  1B2S A;  3DUK A;  1AQZ A;  1UGH I;  3PGB A;  3D9R A;  4MMY B;  4O8S A;  3CCE 3;  1E97 A;  2BU4 A;  2P0M A;  2XSO B;  1EG9 B;  2O3O A;  2A15 A;  4HOH A;  3ER7 A;  3KE7 A;  4FCM A;  3RGA A;  5STD A;  2HMM B;  1NWW A;  3K9M C;  1S5A A;  1HYF A;  3CCJ 3;  1NO3 A;  2Z77 A;  3DXO A;  3KFQ C;  4ILF A;  4N3V A;  2FXT A;  4HM2 B;  3FSD A;  1O7M B;  3NUV A;  1ZO2 A;  3FH1 A;  1Q81 4;  2R41 A;  4FMC A;  4MMX B;  4DKI A;  3FG4 A;  1JNQ A;  1G96 A;  1V58 A;  1Q9E A;  1YVB I;  4HZB B;  3RGR A;  3X41 A;  3FG3 A;  3G6E 3;  1GSP A;  2ML5 A;  1RTU A;  4I4K A;  1GMP A;  4MEI A;  5AIG A;  1OPY A;  3Q2P A;  5IEO A;  1N9E A;  1CYU A;  1QVG 2;  1Q42 A;  2J8X B;  3ZFZ A;  3CCM 3;  1ZX2 A;  5IW9 A;  3UL5 A;  3J7Y d;  1AVK A;  2WGQ A;  3MYT A;  1YNV X;  1BVI A;  2XEP A;  2INX A;  4JF8 A;  3AHS A;  2BIR A;  2UGI A;  1A2K A;  1US1 A;  3UJM A;  1YGE A;  3MG3 A;  1B20 A;  4FMD A;  3PCR A;  1GY5 A;  2CFW A;  2SBL A;  5AIH A;  2HMO B;  2IUK A;  5D82 A;  1BRH A;  2H0H A;  2XGN A;  3CC7 3;  4TX4 A;  5RNT A;  1BNF A;  3OV4 A;  3DGM A;  2W0Q A;  4CPK A;  1JN5 A;  2YFJ B;  4N6U A;  3DZL A;  1EQK A;  4FCZ A;  1RN1 A;  5BIR A;  4IIA A;  4EYC A;  4HVN A;  3VGN A;  3NV0 B;  1D6U A;  1UI8 A;  2BMR B;  2W56 B;  3WOF B;  1ROA A;  2W9P A;  4O2H A;  1B21 A;  3EHC A;  1B27 A;  1CH0 A;  3T8U A;  4BTW A;  1BOX A;  1MWT A;  2UUG C;  2Y73 A;  4EXR A;  1BSB A;  1E3R A;  3F8H A;  1UI7 A;  2MC8 A;  1LOW A;  1YVS A;  1JZD A;  2E2V A;  3FGY A;  1W6Y A;  4HM5 B;  4R1K A;  3S27 A;  1O7H B;  4HZ9 B;  2CX1 A;  4LSO A;  4BTX A;  1PY3 A;  1D6Y A;  2CIU A;  3GSP A;  3S67 A;  2E2T A;  2K54 A;  3LOY A;  4GB5 A;  5M1A A;  3UNL A;  5CF2 A;  1BUQ A;  4LEH A;  4LZI A;  1RMS A;  2HMJ B;  4BTY A;  4J5G A;  1NU3 A;  2KCD A;  3B4P A;  1QAF A;  1VQO 3;  1K41 A;  1RGE A;  4HM7 B;  1KC8 4;  1AR0 A;  3STD A;  1NDO B;  5HGR A;  1IVU A;  5D81 A;  1OUN A;  1GD4 A;  1B2X A;  1I3F A;  1V57 A;  2XGL A;  2V1L A;  3EBY A;  1BRJ A;  1DMM A;  1NB3 I;  4FMB A;  4STD A;  1O7W B;  1RNB A;  3PXM A;  1VQP 3;  1K9M 4;  1YGW A;  3F7S A;  3V92 A;  2P0X A;  3NBB A;  1ZS7 A;  4CJN A;  2BMQ B;  3LTA A;  1TJD A;  3NXJ A;  1IQX A;  3B4O A;  1CEW I;  1BSC A;  2F99 A;  1Y4K A;  3LYG A;  3DMC A;  2YX9 A;  3EQQ B;  3S28 A;  1QMA A;  3QK9 A;  2OTL 3;  3H51 A;  1EA2 A;  4ZM8 A;  1BNG A;  3MKI A;  3CNM A;  3EN1 B;  3RNT A;  1TUH A;  1BU4 A;  1DYU A;  1OGZ A;  1W4N A;  5KP3 A;  2RGQ A;  3WR2 A;  1N5P A;  2W6J H;  1U8C B;  1T2H A;  3NV0 A;  4RZM A;  2CWT A;  1EUI C;  2H0G A;  2W56 A;  3HII A;  3IJE B;  4HM0 B;  3CCR 3;  1M1X B;  1W2B 2;  5M18 A;  1DVC A;  1FYS A;  4CCV A;  2JQ5 A;  2CG1 A;  1VZZ A;  3CCU 3;  2QA4 3;  1W02 A;  2GU1 A;  2XFT A;  3BND A;  1BNS A;  1JB5 A;  4XB5 A;  1UUV B;  7GSP A;  2IYJ A;  1LQM B;  1VQ5 3;  5JPU A;  3OWS A;  4GHO A;  5IF6 A;  3NQZ A;  2GBX B;  1T5Y A;  1RJO A;  5KP4 A;  4FCJ A;  1TRQ A;  1IDP A;  2XF3 A;  5G1K A;  1IT7 A;  3LT8 A;  1BRK A;  4WWU C;  3TDG A;  2SAR A;  2BNG A;  2OOV C;  3CCQ 3;  4K90 B;  1TTO A;  2AAE A;  1K28 A;  3BNB A;  1N5H A;  1TFO A;  3ALA A;  2CFK A;  4N6O B;  2K3D A;  1IVX A;  1UCJ A;  4RBN A;  3Q90 A;  3T0U A;  1OHS A;  1Q82 4;  2Z76 A;  7STD A;  2F5M A;  5IG5 A;  3OXA A;  3X3Z A;  1Q40 B;  1MWU A;  1LOY A;  4N6T A;  4EW5 A;  5TGN A;  1JZO A;  4LMI A;  2W03 A;  2P05 A;  2BHM A;  5CK6 A;  3D5I A;  1L5G B;  1IK3 A;  2XRX B;  3K0Z A;  2HMN B;  2Z7A A;  4MJD A;  3URP A;  1ULI B;  1RRL A;  2CX0 A;  2GEX A;  3BIR A;  4BU4 A;  3JUQ A;  2IY2 A;  1D6Z A;  3MWZ A;  1FGR A;  2GXF A;  3EC9 A;  3PYJ A;  1KSI A;  1X1U A;  1SJW A;  4WYK B;  4AKY A;  1VQQ A;  1LNI A;  3AGO A;  3JUM A;  4U13 A;  4NRE A;  1YIT 3;  3CU3 A;  3WOE B;  2ML6 A;  2CFL A;  2E2U A;  1BIR A;  1BUJ A;  1G0T A;  4EV5 A;  1FW7 A;  1VQ8 3;  3MG1 A;  5IG0 A;  1I8V A;  1RNT A;  2D1W A;  3NQY A;  1O7N B;  1PU4 A;  5ELJ A;  3HOH A;  3JVC A;  4J8T A;  5IER A;  1YHQ 3;  3PZW A;  1M9G A;  3K5T A;  3OWU A;  3X3Y A;  5FGO A;  3V98 A;  4IPB A;  2KF4 A;  1RHL A;  1IQY A;  1RGA A;  3LH4 A;  2CH9 A;  5BU4 A;  1VQM 3;  1JV2 B;  1FUS A;  1DMQ A;  1SPU A;  4EC6 A;  4JRF A;  5CXO A;  4LYL B;  2CW9 A;  6RNT A;  8RNT A;  1UCL A;  2RCD A;  3BNE A;  4H61 A;  5HOH A;  1BSE A;  1GY6 A;  3CXC 2;  2ZA4 A;  3BNC A;  3SXX A;  1M90 4;  3WHO A;  4AEQ A;  5IEP A;  1Q7H A;  4N6V 0;  1Q86 4;  6STD A;  2B24 B;  3FF0 A;  3GZY B;  3KCH A;  3LT9 A;  3OX9 A;  1A67 A;  1W00 A;  4NHF A;  1HZ1 A;  1HU9 A;  3NX0 A;  3F14 A;  2BT3 A;  4RNY A;  2OOV A;  5M19 A;  1FGM A;  1LRA A;  4BL2 A;  1Q40 A;  3D4A A;  5CLK A;  4EV2 A;  2F4Y A;  2Y74 A;  1OGX A;  3KII A;  4WHA A;  1AV4 A;  3HK4 A;  3B7C A;  3S5C A;  2M7O A;  4R80 A;  3FLJ A;  3FZW A;  1A2P A;  1UDI I;  1JRQ A;  1BSD A;  4R9L A;  2OTJ 3;  2Z6B A;  1MOL A;  2OCT A;  4WYK A;  2HMK B;  1FUW A;  1RGC A;  4AKZ A;  3SX1 A;  1DVD A;  1GYB A;  1PFP A;  4J5K A;  3ROB A;  4KZ1 A;  5FW5 A;  3MHE A;  5D83 A;  3CPW 2;  4XDV A;  1LOX A;  3F8X A;  3AHW A;  3MSO A;  1OAC A;  2CKF B;  3NM7 A;  1RGH A;  2CFG A;  1WMN A;  2IA7 A;  4O3V A;  2QGU A;  3GWR A;  3CD6 3;  4GSP A;  2CC3 A;  2ZL8 A;  2K0M A;  3H3H A;  3CCS 3;  1YI2 3;  3NM2 A;  1WMO A;  1S72 3;  4IT7 A;  2CWU A;  1AVL A;  3I0Y A;  1UUW B;  1GMQ A;  4OVM A;  1I0V A;  4I5Q A;  2IMJ A;  2W04 A;  3AMO B;  3FKA A;  3VF1 A;  1RKY A;  4ORL A;  1T2I A;  1RRH A;  1W6G A;  2FGT A;  2I9W A;  4KFF A;  4L7K A;  1LNH A;  3K7C A;  1IU7 A;  4HM4 B;  5AI1 A;  1U5O A;  3U97 A;  1VQ6 3;  3VSY A;  3SED A;  1G02 A;  1QAK A;  1JJ2 2;  4XBY A;  1KQS 2;  3N9H A;  2C10 A;  3CC2 3;  1OHP A;  5LC6 A;  6GSP A;  4Q53 A;  1WNH A;  2PNC A;  1BAN A;  5IEN A;  4CDL A;  2CWV A;  4K61 A;  1DE3 A;  3T8N A;  2AAD A;  3KKG A;  1JB2 A;  2RFR A;  3GZX B;  3K63 A;  3EE1 A;  1NJI 4;  3KSE D;  1FGQ A;  2QIY A;  3V99 A;  3A76 A;  3I56 3;  2GEY A;  2CHC A;  2WOF A;  1J2B A;  4QWT A;  1FZU A;  3WMD A;  3KN4 A;  3UL6 A;  2GU3 A;  1N9J A;  1RSN A;  2O9U X;  3HZP A;  2STD A;  1EEJ A;  3N54 B;  1K73 4;  3GAX A;  1BRN L;  1C54 A;  1IV9 A;  1RDS A;  1W01 A;  1Z1S A;  3WA2 X;  1MGR A;  1OHO A;  1RLS A;  1LQG C;  4NPB A;  5CF1 A;  3DH2 A;  3IMA B;  3CPO A;  3CCV 3;  5A0O B;  3HX8 A;  4RNZ A;  1TFK A;  1SQW A;  4OK0 A;  2F5W A;  4L8O A;  5AYS C;  2LYX A;  4J9A A;  1W7C A;  2P09 A;  2RBI A;  3D3L A;  1OH0 A;  1W6C A;  1I70 A;  2F56 A;  2WO0 A;  2XH9 A;  4R4K A;  1BNI A;  1FGO A;  2HOH A;  1RGK A;  1X1Y A;  1CYV A;  1TIJ A;  3X40 A;  3CC4 3;  1A90 A;  1TU5 A;  2KRT A;  1STD A;  3PCS A;  1ASK A;  1I2F A;  2UX0 A;  3DM8 A;  4N6M A;  4HM1 B;  4WP5 A;  1I2E A;  2CFD A;  1VQ4 3;  3SYU A;  3LTB A;  1OCV A;  3G16 A;  2JDI H;  1C7H A;  3AMO A;  1ULJ B;  1YJ9 3;  1B2Z A;  1GOU A;  2YFL B;  3FF2 A;  1JBR A;  2P38 A;  3SOY A;  1IT8 A;  1UGI A;  2CG0 A;  2FNQ A;  1QJG A;  3ECF A;  5AII A;  4MMZ B;  1DET A;  1JBT A;  5EQL A;  5GSP A;  2KF3 A;  1I3I A;  4FR9 A;  4X2O A;  3I55 3;  4XBT A;  1SII A;  3DGY A;  1RCK A;  4R9K A;  5EEO A;  1JBS A;  3G71 3;  1A2V A;  1BNE A;  3F7X A;  3LTC A;  4RNT A;  3S29 A;  9RNT A;  2GSP A;  4K1V A;  2C4B A;  5IG4 A;  3L0R A;  1O7P B;  1KD1 4;  5AEW B;  4FMA A;  3HIG A;  5BXQ A;  2OQE C;  2BMO B;  1DMN A;  2H0I A;  2KF6 A;  3EN8 A;  2RSX A;  1TP6 A;  3O8Y A;  1FUT A;  3X3X A;  1GS3 A;  1OF5 B;  3AGN A;  3HI7 A;  4PEJ A;  1VQL 3;  1IVV A;  3BLZ A;  5IG3 A;  2B1X B;  1GOY A;  3E99 A;  2Q07 A;  4N6N B;  1QVF 2;  2QEX 3;  2OWP A;  2L4V A;  3LTD A;  4XDW A;  1UUG B;  1B2M A;  3F40 A;  3Q1C A;  4HYZ A;  3PS8 A;  3DY5 A;  3ZG0 A;  4KFD A;  3MPH A;  1BSA A;  1TRP A;  3D79 A;  3EF8 A;  3NBJ A;  3SOA A;  1BRG A;  1RGF A;  5G1L A;  3ZG5 A;  1R4C A;  1BGS A;  1YJN 3;  2R4I A;  3FCS B;  7RNT A;  1RGL A;  5EVH A;  3KSP A;  1BNJ A;  2RNT A;  4G1M B;  2ZHX B;  1JB4 A;  1LOV A;  5JPP A;  4EBG A;  1Q7Y 4;  1T3B A;  3JUN A;  3B8L A;  3LXU X;  4HKV B;  5ELU A;  2KAA A;  2L1S A;  1JKG B;  5G2G A;  3GZB A;  3BB9 A;  1BRI A;  3SVA A;  2XFS A;  3M8C A;  4HM6 B;  3EB8 A;  4BIR A;  1RN4 A;  4H3U A;  1YJW 3;  1GY7 A;  3LZA A;  4GL6 A;  5LC7 A;  3WDG B;  1PYL A;  1MWS A;  2WOH A;  2IUJ A; 
#chains in the Genus database with same CATH homology
 1STF I;  1WQL B;  2BO9 B;  1V74 A;  1ROV A;  1EKM A;  3EBT A;  3WOD G;  2W9Q A;  3F9S A;  3EX9 A;  5AIF A;  1RN7 A;  1VQ9 3;  1W2Z A;  1N8R 4;  1W5Z A;  5DRV A;  1N8Q A;  3X42 A;  1GD3 A;  1K8A 4;  1NB5 I;  1YIJ 3;  3DGN A;  1VQ7 3;  2PZV A;  1WTH A;  4WFO A;  2XSH B;  2OQE A;  4LGQ A;  1FA3 A;  4KVH A;  3KZT A;  1OF5 A;  3IPT A;  1O7G B;  5AYR B;  1WMP A;  3WA3 A;  2D42 A;  4K1U A;  3RDE A;  3OW2 2;  1MNL A;  2CK3 H;  2W2C A;  1UW1 A;  4XM4 A;  1VQN 3;  3OWY A;  3G8Z A;  3NBR A;  3QRD A;  1IV7 A;  1LXE A;  3U1W A;  2XR8 B;  3GZR A;  3CME 3;  3NHX A;  3N8B A;  5AEU B;  3LML A;  3EJV A;  3GRD A;  5I97 A;  1HKX A;  2F98 A;  1SIH A;  3CCL 3;  4OUQ A;  5KP1 A;  1ISK A;  3UB1 A;  1E3V A;  1IVW A;  2KXG A;  3CMA 3;  3FG1 A;  2LQV A;  4XBX A;  4HM3 B;  2YFI B;  2ZDJ A;  1JKG A;  3CNX A;  1VQK 3;  4HBR A;  5DRE A;  3JUO A;  4KFE A;  4HM8 B;  1QAL A;  2MF7 A;  3MG2 A;  1LVN A;  4HJL B;  5BVB A;  8CHO A;  4O02 B;  3G4S 3;  2HML B;  2C11 A;  3JUP A;  5JBS A;  3DGO A;  2GBW B;  2F86 B;  1M1K 4;  3SLU A;  1FGT A;  2WGO A;  1IQ8 A;  4N6L A;  1JN5 B;  3DGL A;  4X2H A;  1KWI A;  4L8P A;  1F8N A;  1CQS A;  3DUK A;  3PGB A;  3D9R A;  4MMY B;  4O8S A;  3CCE 3;  1E97 A;  2P0M A;  2XSO B;  1EG9 B;  2O3O A;  2A15 A;  3ER7 A;  3KE7 A;  4FCM A;  3RGA A;  5STD A;  2HMM B;  1NWW A;  3K9M C;  1S5A A;  3CCJ 3;  1NO3 A;  2Z77 A;  3DXO A;  3KFQ C;  4N3V A;  2FXT A;  4HM2 B;  3FSD A;  1O7M B;  3NUV A;  1ZO2 A;  3FH1 A;  1Q81 4;  4FMC A;  4MMX B;  1JNQ A;  1G96 A;  4HZB B;  1YVB I;  3RGR A;  3X41 A;  3FG3 A;  3G6E 3;  2ML5 A;  4I4K A;  4MEI A;  5AIG A;  1OPY A;  3Q2P A;  5IEO A;  1N9E A;  1CYU A;  1QVG 2;  1Q42 A;  3CCM 3;  1ZX2 A;  5IW9 A;  3UL5 A;  3J7Y d;  1AVK A;  2WGQ A;  3MYT A;  2XEP A;  2INX A;  4JF8 A;  1A2K A;  1US1 A;  3UJM A;  1YGE A;  3MG3 A;  4FMD A;  3PCR A;  1GY5 A;  2CFW A;  2SBL A;  5AIH A;  2HMO B;  2IUK A;  5D82 A;  2XGN A;  3CC7 3;  4TX4 A;  3OV4 A;  3DGM A;  2W0Q A;  1JN5 A;  2YFJ B;  4N6U A;  3DZL A;  1EQK A;  4FCZ A;  4IIA A;  4EYC A;  4HVN A;  3VGN A;  3NV0 B;  1D6U A;  1UI8 A;  2BMR B;  2W56 B;  3WOF B;  1ROA A;  2W9P A;  4O2H A;  3T8U A;  3EHC A;  4BTW A;  2Y73 A;  4EXR A;  1E3R A;  3F8H A;  1UI7 A;  2MC8 A;  2E2V A;  4HM5 B;  3FGY A;  1W6Y A;  4R1K A;  3S27 A;  1O7H B;  4HZ9 B;  4LSO A;  4BTX A;  2CIU A;  1D6Y A;  3S67 A;  2E2T A;  2K54 A;  3LOY A;  4GB5 A;  3UNL A;  5CF2 A;  1BUQ A;  4LEH A;  4LZI A;  2HMJ B;  4BTY A;  1NU3 A;  2KCD A;  3B4P A;  1QAF A;  1VQO 3;  1K41 A;  4HM7 B;  1KC8 4;  1AR0 A;  3STD A;  1NDO B;  5HGR A;  1IVU A;  5D81 A;  1OUN A;  1GD4 A;  2XGL A;  3EBY A;  2V1L A;  4STD A;  1NB3 I;  1DMM A;  4FMB A;  1O7W B;  3PXM A;  1VQP 3;  1K9M 4;  3F7S A;  3V92 A;  2P0X A;  3NBB A;  2BMQ B;  3LTA A;  3NXJ A;  1IQX A;  3B4O A;  1CEW I;  2F99 A;  1Y4K A;  3LYG A;  3DMC A;  2YX9 A;  3EQQ B;  3S28 A;  1QMA A;  3QK9 A;  2OTL 3;  3H51 A;  1EA2 A;  4ZM8 A;  3MKI A;  3CNM A;  3EN1 B;  1TUH A;  1DYU A;  1OGZ A;  1W4N A;  5KP3 A;  2RGQ A;  1N5P A;  2W6J H;  1U8C B;  3NV0 A;  4RZM A;  2CWT A;  4HM0 B;  2W56 A;  3HII A;  3IJE B;  3CCR 3;  1W2B 2;  1M1X B;  1DVC A;  4CCV A;  2JQ5 A;  2CG1 A;  1VZZ A;  3CCU 3;  2QA4 3;  1W02 A;  2GU1 A;  2XFT A;  3BND A;  1JB5 A;  4XB5 A;  1UUV B;  1VQ5 3;  5JPU A;  3OWS A;  5IF6 A;  3NQZ A;  2GBX B;  1T5Y A;  1RJO A;  5KP4 A;  4FCJ A;  1IDP A;  2XF3 A;  1IT7 A;  3LT8 A;  4WWU C;  3TDG A;  2BNG A;  2OOV C;  3CCQ 3;  4K90 B;  1K28 A;  3BNB A;  1N5H A;  1TFO A;  3ALA A;  2CFK A;  4N6O B;  1IVX A;  4RBN A;  3Q90 A;  3T0U A;  1OHS A;  1Q82 4;  2Z76 A;  7STD A;  5IG5 A;  3OXA A;  3X3Z A;  1Q40 B;  4N6T A;  5TGN A;  4LMI A;  2W03 A;  2P05 A;  2BHM A;  5CK6 A;  1L5G B;  1IK3 A;  2XRX B;  3K0Z A;  2HMN B;  2Z7A A;  4MJD A;  1ULI B;  1RRL A;  2GEX A;  3JUQ A;  1D6Z A;  3MWZ A;  1FGR A;  2GXF A;  3EC9 A;  3PYJ A;  1KSI A;  1SJW A;  4WYK B;  4AKY A;  3JUM A;  4U13 A;  4NRE A;  1YIT 3;  3CU3 A;  3WOE B;  2ML6 A;  2CFL A;  2E2U A;  4EV5 A;  1VQ8 3;  3MG1 A;  5IG0 A;  2D1W A;  3NQY A;  1O7N B;  1PU4 A;  5ELJ A;  3JVC A;  4J8T A;  5IER A;  1YHQ 3;  3PZW A;  1M9G A;  3K5T A;  3OWU A;  3X3Y A;  5FGO A;  3V98 A;  4IPB A;  1VQM 3;  1IQY A;  3LH4 A;  2CH9 A;  1JV2 B;  1SPU A;  1DMQ A;  4EC6 A;  4JRF A;  5CXO A;  2CW9 A;  2RCD A;  3BNE A;  4H61 A;  3CXC 2;  1GY6 A;  3BNC A;  3SXX A;  1M90 4;  5IEP A;  4AEQ A;  4N6V 0;  1Q86 4;  6STD A;  2B24 B;  3FF0 A;  3GZY B;  3LT9 A;  3OX9 A;  1A67 A;  1W00 A;  4NHF A;  1HU9 A;  3NX0 A;  3F14 A;  2BT3 A;  4RNY A;  2OOV A;  1FGM A;  1Q40 A;  5CLK A;  4EV2 A;  2Y74 A;  1OGX A;  3KII A;  4WHA A;  1AV4 A;  3HK4 A;  3B7C A;  3S5C A;  2M7O A;  4R80 A;  3FLJ A;  3FZW A;  1JRQ A;  4R9L A;  2OTJ 3;  2Z6B A;  1MOL A;  2OCT A;  4WYK A;  2HMK B;  1FUW A;  4AKZ A;  1DVD A;  3SX1 A;  1GYB A;  1PFP A;  3ROB A;  4KZ1 A;  5FW5 A;  3MHE A;  5D83 A;  3CPW 2;  4XDV A;  1LOX A;  3F8X A;  3MSO A;  1OAC A;  2CKF B;  3NM7 A;  2CFG A;  1WMN A;  2IA7 A;  4O3V A;  2QGU A;  3GWR A;  3CD6 3;  2CC3 A;  2ZL8 A;  2K0M A;  3H3H A;  3CCS 3;  1YI2 3;  3NM2 A;  1WMO A;  1S72 3;  4IT7 A;  2CWU A;  1AVL A;  3I0Y A;  1UUW B;  4OVM A;  2IMJ A;  2W04 A;  3AMO B;  3FKA A;  3VF1 A;  1RKY A;  4ORL A;  1RRH A;  1W6G A;  2FGT A;  2I9W A;  4KFF A;  4L7K A;  1LNH A;  3K7C A;  1IU7 A;  4HM4 B;  5AI1 A;  1U5O A;  3U97 A;  1VQ6 3;  3VSY A;  3SED A;  1QAK A;  1JJ2 2;  4XBY A;  1KQS 2;  3N9H A;  2C10 A;  3CC2 3;  1OHP A;  5LC6 A;  4Q53 A;  1WNH A;  2PNC A;  5IEN A;  4CDL A;  2CWV A;  4K61 A;  3T8N A;  3KKG A;  2RFR A;  1JB2 A;  3GZX B;  3K63 A;  3EE1 A;  1NJI 4;  3KSE D;  1FGQ A;  2QIY A;  3V99 A;  3A76 A;  3I56 3;  2GEY A;  2CHC A;  2WOF A;  1J2B A;  4QWT A;  3WMD A;  3KN4 A;  3UL6 A;  2GU3 A;  1N9J A;  2O9U X;  3HZP A;  2STD A;  3N54 B;  1K73 4;  3GAX A;  1IV9 A;  1Z1S A;  1W01 A;  3WA2 X;  1OHO A;  5CF1 A;  3IMA B;  3CPO A;  3CCV 3;  5A0O B;  3HX8 A;  4RNZ A;  1TFK A;  1SQW A;  4OK0 A;  4L8O A;  5AYS C;  2LYX A;  4J9A A;  1W7C A;  2P09 A;  3D3L A;  1OH0 A;  1W6C A;  2WO0 A;  2XH9 A;  4R4K A;  1FGO A;  1CYV A;  1TIJ A;  3X40 A;  3CC4 3;  1A90 A;  1TU5 A;  2KRT A;  1STD A;  3PCS A;  1ASK A;  2UX0 A;  3DM8 A;  4N6M A;  4HM1 B;  4WP5 A;  2CFD A;  1VQ4 3;  3LTB A;  1OCV A;  3G16 A;  2JDI H;  1C7H A;  3AMO A;  1ULJ B;  1YJ9 3;  2YFL B;  3FF2 A;  2P38 A;  3SOY A;  1IT8 A;  2CG0 A;  2FNQ A;  1QJG A;  3ECF A;  5AII A;  4MMZ B;  5EQL A;  4X2O A;  4FR9 A;  3I55 3;  4XBT A;  1SII A;  5EEO A;  4R9K A;  3G71 3;  1A2V A;  3F7X A;  3LTC A;  3S29 A;  4K1V A;  5IG4 A;  3L0R A;  1O7P B;  1KD1 4;  5AEW B;  4FMA A;  3HIG A;  5BXQ A;  2OQE C;  2BMO B;  1DMN A;  3EN8 A;  2RSX A;  1TP6 A;  3O8Y A;  3X3X A;  1GS3 A;  1OF5 B;  3HI7 A;  4PEJ A;  1VQL 3;  1IVV A;  3BLZ A;  5IG3 A;  2B1X B;  3E99 A;  4N6N B;  2Q07 A;  1QVF 2;  2QEX 3;  2OWP A;  2L4V A;  3LTD A;  4XDW A;  3F40 A;  3Q1C A;  4HYZ A;  3PS8 A;  3DY5 A;  4KFD A;  3MPH A;  3EF8 A;  3NBJ A;  3SOA A;  1R4C A;  1YJN 3;  2R4I A;  3FCS B;  5EVH A;  3KSP A;  4G1M B;  1JB4 A;  5JPP A;  4EBG A;  1Q7Y 4;  3JUN A;  3B8L A;  3LXU X;  4HKV B;  5ELU A;  1JKG B;  5G2G A;  3GZB A;  3BB9 A;  3SVA A;  2XFS A;  3M8C A;  4HM6 B;  3EB8 A;  4H3U A;  1YJW 3;  1GY7 A;  3LZA A;  4GL6 A;  5LC7 A;  3WDG B;  2WOH A;  3G0K A;  3FG4 A;  2IUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...