1R4CA

N-truncated human cystatin c; dimeric form with 3d domain swapping
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
GGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain swapping in N-truncated human cystatin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords Cystatin C
total genus 19
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1r4cA00
1M9GA 1NB3I 1IV9A 1EQKA 4N6LA 4TX4A 5LC7A 1GD4A 1STFI 1RN7A 1A90A 1FA3A 2O9UX 4LZIA 3UL5A 1A67A 4N6UA 1NB5I 3PXMA 4N6TA 1CYUA 1N9JA 3KFQC 1MNLA 3PYJA 5ELJA 3MWZA 1CEWI 1DVDA 1DVCA 2CH9A 3L0RA 1GD3A 3GAXA 1PFPA 3KSED 4N6V0 3PS8A 1LXEA 1N5PA 2OCTA 3NX0A 2W9PA 4CCVA 1KWIA 1MOLA 4EYCA 3K9MC 1R4CA 3S67A 1ROAA 5A0OB 1CYVA 5EQLA 2W9QA 1YVBI 1N5HA 1G96A 2BO9B 3QRDA 3LH4A 4N6NB 5ELUA 5LC6A 3SVAA 1IV7A 3Q2PA 4IT7A 4N6MA 4ZM8A 3UL6A 1FUWA 1WNHA 1TIJA 3IMAB 4N6OB 2KXGA
chains in the Genus database with same CATH superfamily
4G1MB 1NB3I 1EQKA 3U1WA 3LTBA 1BSAA 1VQ53 3AHWA 3N54B 1RKYA 3RNTA 1O7GB 2B24B 1YIJ3 1BUJA 2I9WA 1TTOA 4IIAA 1RNTA 2XEPA 2HMLB 4KFEA 1RGFA 4LYLB 1DVDA 1NO3A 3SOYA 1D6UA 5HOHA 3KCHA 2D1WA 2J8XB 3HIIA 2BMQB 1Q824 3A5EA 1YVSA 1K734 3T8NA 1RGHA 1BNJA 4LEHA 2UUGC 1I3FA 3F8HA 3B4OA 1W2B2 5AIIA 1WTHA 3CPOA 5D83A 4BTWA 1LRAA 3LZAA 2D42A 1RCLA 1ZO2A 4HM6B 3X3ZA 1FUWA 5IF6A 3DY5A 3EX9A 2XH9A 3X3YA 4QWTA 1U5OA 2WO0A 3K7CA 1UUVB 5AEUB 2BT3A 1RSNA 1B2SA 1HKXA 5KP4A 3SLUA 2E2TA 3V99A 2WGOA 1M1K4 1I0XA 2H0IA 3AGOA 5JBSA 2CH9A 2GU3A 1GD3A 2H0HA 4WWUC 3UNLA 1C54A 1TP6A 1BNEA 1Q40B 4RZMA 3NM7A 3X3XA 3NX0A 1D6YA 3BU4A 4CCVA 1JBTA 1B2XA 3F9SA 5IW9A 3X40A 4EW5A 1GSPA 1DMMA 4MMYB 2CFWA 4KFFA 3LH4A 1Q7Y4 1U8CB 2HMMB 5IEOA 2Z77A 3AMOB 3ZG0A 1TIJA 2BIRA 3WDGB 1B2MA 2C4BA 2Z6BA 3CC43 7RNTA 1SJWA 3ALAA 4IPBA 1TRQA 3NBRA 1BSDA 1DMQA 8RNTA 3MSOA 2W56A 1IK3A 1STDA 2K3DA 1IQYA 1G0TA 4L8OA 3DGLA 1V57A 3EF8A 3KSPA 4STDA 2H0GA 1YGEA 2O3OA 1YJ93 1RNBA 2Y73A 4LMIA 1BRKA 1GMQA 5EVHA 3EJVA 4RNZA 2OOVA 1Q864 3KSED 9RNTA 1VQP3 2RFRA 1JB5A 3Q1CA 3T8UA 2RSXA 1S5AA 5RNTA 3G713 1IVUA 4J5GA 1RRHA 1LQMB 3D9RA 4EYCA 2PNCA 1OH0A 3FGYA 3QRDA 6GSPA 6STDA 4HYZA 3FG4A 3LMLA 1JBSA 1LOXA 1HZ1A 4HZ9B 1B27A 1M9GA 2MF7A 3F7XA 3I0YA 4FCMA 5DRVA 1W7CA 3AMOA 3VGNA 3NM2A 1E97A 2AAEA 2W6JH 3FG1A 4WP5A 3F8XA 2RBIA 1V58A 3CD63 1I2EA 4EXRA 1VQ43 2W56B 5KP3A 2CKFB 1CEWI 5JPPA 3FZWA 3BLZA 1PFPA 2LQVA 2C11A 4N6V0 3T0UA 1VQ83 1FGQA 3I563 2W9PA 3ECFA 5I97A 3BB9A 1UGHI 3MYTA 2CX0A 3DH2A 1RDSA 2MC8A 4HBRA 3CCQ3 2INXA 3GZRA 3UL6A 4O02B 3SVAA 1Y4KA 1OF5A 4N6LA 1MWUA 3NQYA 1IV9A 5CF2A 1B21A 4NREA 1GY5A 5GSPA 1EKMA 1UI8A 1JZOA 2HOHA 3D5IA 1I2FA 4LZIA 1A2PA 3WOFB 4HM7B 4FMDA 4HM8B 1NB5I 2XFTA 3OW22 2KRTA 5G1LA 7GSPA 3KFQC 1UCLA 4AKZA 1YHQ3 1JB4A 3Q3FA 2FXTA 3MG3A 4U13A 1LOYA 1I2GA 3BNBA 1FYSA 3MG2A 2Z76A 4RNYA 3EBYA 3ER7A 3LT8A 4FMAA 1RMSA 4J9AA 3PCSA 4ILFA 1IQ8A 4RBNA 1E3VA 1IQXA 1BIRA 2XSHB 1FZUA 3SYUA 2QA43 2GBXB 2FNQA 2P05A 2YFLB 1O7HB 2CIUA 3WR2A 1OGXA 2B1XB 1RN7A 3EB8A 3FF0A 2ML5A 2OQEC 3UL5A 3OV4A 3OWYA 3DUKA 3FSDA 3U97A 1BRGA 5D82A 1WQLB 1FW7A 3ZFZA 2XR8B 4K1VA 4HM0B 1UCIA 3A76A 1QAFA 2IYJA 1BRSA 4HM3B 4L7KA 5STDA 1PY3A 2LYXA 2R4IA 1Q814 3PS8A 1KC84 2F99A 1IVWA 4FMCA 1DETA 1OCVA 1FUTA 3K9MC 2HMNB 5A0OB 5EQLA 1IU7A 3NBJA 3NXJA 2BO9B 4PEJA 2E2VA 2OOVC 3NV0B 4CPKA 2WGQA 4BL2A 1BRNL 3KZTA 3BIRA 1B2ZA 3HX8A 4N6OB 4X2OA 1QVG2 2IMJA 1DMNA 1GD4A 1OPYA 1UUGB 3HIGA 4EV2A 3B7CA 4XBTA 3GRDA 3DGOA 1MGWA 1IVVA 1AQZA 1N9JA 3DGMA 2ZL8A 4HM4B 4R9KA 3S67A 1DVCA 1T5YA 5IG5A 4Q53A 5IG0A 2XGLA 2ML6A 2CWVA 2P0MA 3BNDA 1X1XA 5M1AA 2GU1A 3RGAA 1TUHA 5IERA 1UCKA 3OWUA 3WMDA 1KWIA 2BMOB 3V98A 3D4AA 1RN1A 4NHFA 2F5WA 3X42A 1CQSA 5AI1A 4EV5A 1BOXA 1V74A 4N6NB 3ZG5A 3S28A 3CCV3 3CXC2 1NDOB 2CG1A 3EN8A 1QJGA 2STDA 3HZPA 4BTYA 4GHOA 1X1YA 1SARA 3RGRA 1E3RA 4DKIA 2OTJ3 1TU5A 1GMPA 2CW9A 3G16A 4KT3B 1W6GA 1UGIA 2JDIH 4LGQA 2QIYA 2KAAA 2CX1A 1VQQA 4I5QA 1ZS7A 2A15A 4R1KA 4CDLA 1W01A 5G2GA 1YIT3 1VQO3 1WMPA 3GZBA 4AKYA 3DGNA 5AEWB 7STDA 1BANA 4K90B 3PCRA 1O7PB 3F40A 1BNGA 4ORLA 1ROAA 4FCZA 1BRHA 3EQQB 1W5ZA 4JF8A 1D6ZA 1IVXA 2KF5A 1W4NA 2BU4A 3DGYA 1LVNA 3QK9A 2CK3H 4H61A 2SBLA 3GSPA 1BVIA 2IUJA 5AYRB 1VQL3 3GZXB 1FA3A 1QALA 1BSCA 2HMOB 4HZBB 3URPA 1IYYA 3WODG 1GMRA 1IDPA 2L1SA 5CK6A 5IG3A 4R4KA 4R9LA 4HKVB 4MMXB 3V92A 5EEOA 3WA2X 1N8R4 2CC3A 4J8TA 1UCJA 3LYGA 3WA3A 1MWRA 3NQZA 4O2HA 1PYLA 1OGZA 5G1KA 1WMNA 1NWWA 4JRFA 4MMZB 2CFLA 3CCR3 1FGRA 1ZGXA 1TFOA 2BNGA 1LQGC 1R4CA 4FMBA 3NBBA 4WYKA 4XBXA 3JUMA 2BMRB 1IV7A 3Q2PA 1Q7HA 2P09A 4BIRA 1VQ93 1Z1SA 3IPTA 2QEX3 2C10A 3D5GA 2XFSA 1T3BA 4HAAA 5CXOA 4HVNA 3K0ZA 3NUVA 3CME3 4HM2B 1RGCA 1GYBA 4N3VA 3MPHA 1AVLA 1A2VA 2YFJB 1RGLA 2K0MA 4CJNA 2OTL3 2W03A 5BIRA 2P38A 2UX0A 1HYFA 5IEPA 1OHSA 3LTAA 1LXEA 1SQWA 2WOHA 4WFOA 1OHPA 2KF6A 3FCSB 1FGOA 1L5GB 1FGMA 1I8VA 1RN4A 1W6CA 2SARA 1YGWA 5AIHA 3CCL3 5AYSC 1FUSA 1BRIA 1MGRA 2KF4A 3CU3A 3BNCA 2JQ5A 3EE1A 3FF2A 5AIGA 1AY7A 1ROVA 3O8YA 5ELUA 2K54A 2XF3A 3HK4A 1WNHA 1K9M4 2Z7AA 3MHEA 5BXQA 1JJ22 2HMKB 1GY7A 1QAKA 1EG9B 1X1WA 1NU3A 3CMA3 2RNTA 4K1UA 1UI7A 3AHSA 1OUNA 4N6UA 1AR0A 3LXUX 5TGNA 3F14A 1T2IA 3OWSA 3PYJA 1MNLA 2UGIA 4O8SA 2CFDA 5FGOA 1VQN3 2HMJB 5FW5A 1B2UA 2WOFA 3KE7A 1DYUA 1LNHA 2R41A 1US1A 3WHOA 8CHOA 3MG1A 3S5CA 1W2ZA 3NV0A 4GSPA 1O7MB 2XSOB 3LT9A 1CYVA 4XDWA 1ASKA 1WMOA 2AADA 4FCJA 3SXXA 3D3LA 4IT7A 5CF1A 3J7Yd 1S723 4I4KA 2CHCA 5IG4A 1BNRA 1K28A 1BSEA 4HM5B 1UDII 1TRPA 4K61A 3CCE3 1GOYA 2P0XA 3G0KA 4XBYA 2GXFA 3GZYB 3HOHA 1RHLA 1EA2A 2Q07A 1JB2A 2CFKA 3JUQA 3K5TA 3ROBA 1FGTA 2GBWB 1VQM3 5BU4A 1CYUA 3Q90A 1R4YA 3S27A 4BTXA 5ELJA 1QVF2 1MWSA 3G6E3 4H3UA 3MWZA 1A2KA 3L0RA 3B8LA 3GAXA 2IUKA 3SOAA 1OHOA 2Y74A 2L4VA 3CCU3 4GL6A 1JRQA 3PZWA 2CG0A 2XGNA 1BNSA 1GOUA 3CCM3 3EBTA 3X41A 1BNFA 3AGNA 1JKGA 4LSOA 4EBGA 2ZA4A 5JPUA 1DE3A 1YVBI 1KD14 3IJEB 2RGQA 4ZM8A 1EEJA 1JNQA 3FH1A 4FR9A 2KXGA 1I3IA 1VZZA 1JZDA 4WHAA 2IY2A 1RRLA 2PZVA 1Q9EA 2CFGA 1RLSA 3JUOA 1Q42A 3OXAA 4MJDA 4BU4A 3B4PA 3KKGA 3TDGA 1T2HA 3DM8A 2F98A 3DXOA 3H51A 1RCKA 1CH0A 2M7OA 4KFDA 1JN5B 2QGUA 3EHCA 1ULJB 1N5PA 4XB5A 1LOVA 2CWUA 3CCS3 5M18A 2W0QA 4X2HA 4HOHA 1ULIB 1BNIA 1Q40A 1LOWA 1C7HA 1SIHA 3CNMA 2W9QA 3KIIA 1ISKA 1SIIA 1GS3A 2GEXA 1G02A 4N6MA 1TFKA 2OQEA 1JKGB 4KVHA 1LNIA 2F4YA 2RCDA 2W2CA 3EC9A 5CLKA 5M19A 2CWTA 2F5MA 1RGEA 3NHXA 3N9HA 4O3VA 4TX4A 3JUPA 5LC7A 3CPW2 2XRXB 1VQ73 1YJW3 1W00A 1RTUA 2KF3A 3EN1B 1K41A 2O9UX 1MWTA 3I553 4EC6A 1A67A 4KZ1A 4J5KA 5BVBA 3UJMA 1RGAA 1W6YA 2BHMA 1IT8A 3N8BA 2YX9A 2KCDA 4OK0A 4GB5A 1UUWB 1EUIC 3E99A 3FG3A 3LTDA 4R80A 1JV2B 1RGGA 3CC23 4WYKB 1SPUA 4XM4A 1J2BA 5DREA 1MOLA 3OX9A 1JN5A 3RDEA 1N5HA 1G96A 1BU4A 4OVMA 5LC6A 3H3HA 2YFIB 1B20A 1O7WB 2E2UA 1BSBA 1K8A4 3SX1A 1YNVX 1STFI 2IA7A 3G8ZA 3JVCA 4MEIA 3KN4A 3CCJ3 3DMCA 1HU9A 3PXMA 2ZDJA 1BGSA 1RJOA 5AIFA 5IENA 1N9EA 1TJDA 5KP1A 6RNTA 4BL3A 1GOVA 3S29A 2GEYA 1ZX2A 4RNTA 2F86B 1B3SA 3JUNA 1QMAA 1N8QA 2ZHXB 3WOEB 1PU4A 4OUQA 1YJN3 4AEQA 2FGTA 1NNVA 3F7SA 1W02A 1I70A 5D81A 1YI23 2F56A 2OWPA 4HJLB 1BRJA 1F8NA 3IMAB 3VF1A 1OACA 1I0VA 1UW1A 3K63A 1JBRA 1A90A 3M8CA 1BAOA 1OF5B 1IT7A 1NJI4 2GSPA 3STDA 3GWRA 3LOYA 1M904 3CC73 4N6TA 4NPBA 1M1XB 4HM1B 3LTCA 3D79A 2V1LA 3G4S3 1VQ63 3FLJA 3FKAA 1O7NB 1X1UA 4L8PA 3HI7A 2OCTA 1AVKA 3UB1A 1GY6A 1AV4A 2W04A 1KSIA 3VSYA 3CNXA 3MKIA 1RGKA 1BUQA 4XDVA 3BNEA 3SEDA 1VQK3 5HGRA 3DZLA 3PGBA 1KQS2
chains in the Genus database with same CATH topology
4G1MB 1NB3I 1EQKA 3U1WA 3LTBA 1VQ53 3N54B 1RKYA 1YIJ3 1O7GB 2B24B 2I9WA 4IIAA 2XEPA 2HMLB 4KFEA 1DVDA 1NO3A 3SOYA 1D6UA 2D1WA 3HIIA 2BMQB 1Q824 1K734 3T8NA 4LEHA 3F8HA 3B4OA 1W2B2 5AIIA 1WTHA 3CPOA 5D83A 4BTWA 3LZAA 2D42A 1ZO2A 4HM6B 3X3ZA 1FUWA 5IF6A 3DY5A 3EX9A 2XH9A 3X3YA 4QWTA 1U5OA 2WO0A 3K7CA 1UUVB 5AEUB 2BT3A 1HKXA 5KP4A 3SLUA 2E2TA 3V99A 2WGOA 1M1K4 5JBSA 2CH9A 2GU3A 1GD3A 4WWUC 3UNLA 1TP6A 1Q40B 4RZMA 3NM7A 3X3XA 3NX0A 1D6YA 4CCVA 5IW9A 3F9SA 3X40A 1DMMA 4MMYB 2CFWA 4KFFA 3LH4A 1Q7Y4 1U8CB 2HMMB 5IEOA 2Z77A 3AMOB 1TIJA 3WDGB 2Z6BA 3CC43 1SJWA 3ALAA 4IPBA 3NBRA 1DMQA 3MSOA 2W56A 1IK3A 1STDA 1IQYA 4L8OA 3EF8A 3DGLA 3KSPA 4STDA 1YGEA 2O3OA 1YJ93 2Y73A 4LMIA 5EVHA 3EJVA 4RNZA 2OOVA 1Q864 3KSED 1VQP3 2RFRA 1JB5A 3Q1CA 3T8UA 2RSXA 1S5AA 3G713 1IVUA 1RRHA 3D9RA 4EYCA 2PNCA 1OH0A 3FGYA 3QRDA 6STDA 4HYZA 3FG4A 3LMLA 1LOXA 4HZ9B 1M9GA 2MF7A 3F7XA 3I0YA 4FCMA 5DRVA 1W7CA 3AMOA 3VGNA 3NM2A 1E97A 2W6JH 3FG1A 4WP5A 3F8XA 3CD63 4EXRA 1VQ43 2W56B 5KP3A 2CKFB 1CEWI 5JPPA 3FZWA 3BLZA 1PFPA 2LQVA 2C11A 4N6V0 3T0UA 1VQ83 1FGQA 3I563 2W9PA 3ECFA 5I97A 3BB9A 3MYTA 2MC8A 3CCQ3 4HBRA 2INXA 3GZRA 3UL6A 4O02B 3SVAA 1Y4KA 1OF5A 4N6LA 3NQYA 1IV9A 5CF2A 4NREA 1GY5A 1EKMA 1UI8A 4LZIA 3WOFB 4HM7B 4FMDA 4HM8B 1NB5I 2XFTA 3OW22 2KRTA 1YHQ3 3KFQC 4AKZA 1JB4A 2FXTA 3MG3A 4U13A 3BNBA 3MG2A 2Z76A 4RNYA 3EBYA 3ER7A 3LT8A 4FMAA 4J9AA 3PCSA 1IQ8A 4RBNA 1E3VA 1IQXA 2XSHB 2QA43 2GBXB 2FNQA 2YFLB 2P05A 1O7HB 2CIUA 1OGXA 2B1XB 1RN7A 3EB8A 3FF0A 2ML5A 2OQEC 3UL5A 3OV4A 3OWYA 3DUKA 3FSDA 3U97A 5D82A 1WQLB 2XR8B 4K1VA 4HM0B 4L7KA 3A76A 1QAFA 5STDA 4HM3B 2LYXA 2R4IA 1Q814 1KC84 3PS8A 2F99A 1IVWA 4FMCA 1OCVA 3K9MC 2HMNB 5A0OB 5EQLA 1IU7A 3NBJA 3NXJA 2BO9B 4PEJA 2E2VA 2OOVC 3NV0B 2WGQA 3KZTA 3HX8A 4N6OB 4X2OA 1QVG2 2IMJA 1DMNA 1GD4A 1OPYA 3HIGA 4EV2A 3B7CA 4XBTA 3GRDA 3DGOA 1IVVA 1N9JA 3DGMA 2ZL8A 4HM4B 4R9KA 5IG5A 1DVCA 1T5YA 4Q53A 5IG0A 2XGLA 2ML6A 2CWVA 2P0MA 3BNDA 3RGAA 5IERA 2GU1A 1TUHA 3OWUA 3WMDA 1KWIA 2BMOB 3V98A 4NHFA 3X42A 1CQSA 5AI1A 4EV5A 1V74A 4N6NB 3S28A 3CCV3 3CXC2 1NDOB 2CG1A 3EN8A 1QJGA 2STDA 3HZPA 4BTYA 3RGRA 1E3RA 2OTJ3 1TU5A 2CW9A 3G16A 1W6GA 2JDIH 4LGQA 2QIYA 3CMA3 4R1KA 2A15A 4CDLA 1YIT3 1W01A 5G2GA 1VQO3 1WMPA 3GZBA 4AKYA 3DGNA 5AEWB 7STDA 4K90B 3PCRA 1O7PB 3F40A 4ORLA 1ROAA 4FCZA 3EQQB 1W5ZA 4JF8A 1D6ZA 1IVXA 1W4NA 1LVNA 3QK9A 2CK3H 4H61A 2SBLA 2IUJA 5AYRB 1VQL3 3GZXB 1FA3A 1QALA 2HMOB 4HZBB 3WODG 1IDPA 5CK6A 5IG3A 4R4KA 4R9LA 4HKVB 4MMXB 3V92A 5EEOA 3WA2X 1N8R4 2CC3A 4J8TA 3LYGA 3WA3A 3NQZA 4O2HA 1OGZA 1WMNA 1NWWA 4JRFA 4MMZB 2CFLA 3CCR3 1FGRA 1TFOA 2BNGA 1R4CA 4FMBA 3NBBA 4WYKA 4XBXA 3JUMA 2BMRB 1IV7A 3Q2PA 2P09A 1VQ93 1Z1SA 3IPTA 2QEX3 2C10A 2XFSA 5CXOA 4HVNA 3K0ZA 3NUVA 3CME3 4HM2B 1GYBA 4N3VA 3MPHA 1A2VA 1AVLA 2YFJB 2K0MA 2OTL3 2W03A 2P38A 2UX0A 5IEPA 1OHSA 3LTAA 1LXEA 1SQWA 2WOHA 4WFOA 1OHPA 3FCSB 1L5GB 1FGOA 1FGMA 1W6CA 5AIHA 3CCL3 5AYSC 3CU3A 3BNCA 3EE1A 2JQ5A 3FF2A 5AIGA 1ROVA 3O8YA 5ELUA 2K54A 2XF3A 3HK4A 1WNHA 1K9M4 2Z7AA 3MHEA 5BXQA 1JJ22 2HMKB 1GY7A 1QAKA 1EG9B 1NU3A 4K1UA 1UI7A 1OUNA 4N6UA 1AR0A 3LXUX 5TGNA 3F14A 3OWSA 3PYJA 1MNLA 4O8SA 5FGOA 2CFDA 1VQN3 2HMJB 5FW5A 2WOFA 3KE7A 1DYUA 1LNHA 8CHOA 1US1A 3MG1A 3S5CA 1W2ZA 3NV0A 1O7MB 2XSOB 3LT9A 1CYVA 4XDWA 1ASKA 1WMOA 3SXXA 4FCJA 3D3LA 4IT7A 5CF1A 3J7Yd 1S723 4I4KA 2CHCA 5IG4A 1K28A 4HM5B 4K61A 3CCE3 2P0XA 3G0KA 4XBYA 2GXFA 3GZYB 1EA2A 2Q07A 1JB2A 2CFKA 3JUQA 3K5TA 3ROBA 1FGTA 2GBWB 1VQM3 1CYUA 3Q90A 3S27A 4BTXA 5ELJA 1QVF2 3G6E3 4H3UA 3MWZA 1A2KA 3L0RA 3B8LA 3GAXA 2IUKA 3SOAA 1OHOA 2Y74A 2L4VA 3CCU3 4GL6A 1JRQA 3PZWA 2CG0A 2XGNA 3CCM3 3EBTA 3X41A 1JKGA 4LSOA 4EBGA 5JPUA 1YVBI 1KD14 3IJEB 2RGQA 4ZM8A 1JNQA 3FH1A 4FR9A 2KXGA 1VZZA 4WHAA 1RRLA 2PZVA 2CFGA 3JUOA 1Q42A 3OXAA 4MJDA 3B4PA 3KKGA 3TDGA 3DM8A 2F98A 3DXOA 3H51A 4KFDA 2M7OA 1JN5B 2QGUA 3EHCA 1ULJB 1N5PA 4XB5A 2CWUA 3CCS3 2W0QA 4X2HA 3S67A 1ULIB 1Q40A 1SIHA 3CNMA 1C7HA 3KIIA 2W9QA 1ISKA 1SIIA 1GS3A 2GEXA 4N6MA 1TFKA 2OQEA 1JKGB 4KVHA 2RCDA 2W2CA 3EC9A 5CLKA 2CWTA 3NHXA 3CC23 1VQ73 3N9HA 4O3VA 4TX4A 3JUPA 5LC7A 3CPW2 2XRXB 1YJW3 1W00A 3EN1B 1K41A 2O9UX 3I553 4EC6A 1A67A 4KZ1A 5BVBA 3UJMA 1W6YA 2BHMA 1IT8A 3N8BA 2YX9A 2KCDA 4OK0A 4GB5A 1UUWB 3E99A 3FG3A 3LTDA 4R80A 1JV2B 4WYKB 1SPUA 4XM4A 1J2BA 5DREA 1MOLA 3OX9A 1JN5A 3RDEA 1N5HA 1G96A 4OVMA 5LC6A 3H3HA 2YFIB 1O7WB 2E2UA 1K8A4 3SX1A 2IA7A 1STFI 3G8ZA 3JVCA 4MEIA 3KN4A 3CCJ3 3DMCA 1HU9A 3PXMA 2ZDJA 5AIFA 1RJOA 5IENA 1N9EA 5KP1A 3S29A 2GEYA 1ZX2A 2F86B 3JUNA 1QMAA 1N8QA 3WOEB 1PU4A 4OUQA 1YJN3 4AEQA 2FGTA 3F7SA 1W02A 5D81A 1YI23 2OWPA 4HJLB 1F8NA 3IMAB 3VF1A 1OACA 1UW1A 3K63A 1A90A 3M8CA 1OF5B 1IT7A 1NJI4 3STDA 3GWRA 3LOYA 1M904 3CC73 4N6TA 1M1XB 4HM1B 3LTCA 3G4S3 2V1LA 1VQ63 3FLJA 3FKAA 1O7NB 4L8PA 3HI7A 2OCTA 1AVKA 3UB1A 1GY6A 1AV4A 2W04A 1KSIA 3VSYA 3CNXA 3MKIA 1BUQA 4XDVA 3BNEA 3SEDA 1VQK3 5HGRA 3DZLA 3PGBA 1KQS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9G A;  1NB3 I;  1IV9 A;  1EQK A;  4N6L A;  4TX4 A;  5LC7 A;  1GD4 A;  1STF I;  1RN7 A;  1A90 A;  1FA3 A;  2O9U X;  4LZI A;  3UL5 A;  1A67 A;  4N6U A;  1NB5 I;  3PXM A;  4N6T A;  1CYU A;  1N9J A;  3KFQ C;  1MNL A;  3PYJ A;  5ELJ A;  3MWZ A;  1CEW I;  1DVD A;  1DVC A;  2CH9 A;  3L0R A;  1GD3 A;  3GAX A;  1PFP A;  3KSE D;  4N6V 0;  3PS8 A;  1LXE A;  1N5P A;  2OCT A;  3NX0 A;  2W9P A;  4CCV A;  1KWI A;  1MOL A;  4EYC A;  3K9M C;  1R4C A;  3S67 A;  1ROA A;  5A0O B;  1CYV A;  5EQL A;  2W9Q A;  1YVB I;  1N5H A;  1G96 A;  2BO9 B;  3QRD A;  3LH4 A;  4N6N B;  5ELU A;  5LC6 A;  3SVA A;  1IV7 A;  3Q2P A;  4IT7 A;  4N6M A;  4ZM8 A;  3UL6 A;  1FUW A;  1WNH A;  1TIJ A;  3IMA B;  4N6O B;  2KXG A; 
#chains in the Genus database with same CATH topology
 4G1M B;  1NB3 I;  1EQK A;  3U1W A;  3LTB A;  1BSA A;  1VQ5 3;  3AHW A;  3N54 B;  1RKY A;  3RNT A;  1O7G B;  2B24 B;  1YIJ 3;  1BUJ A;  2I9W A;  1TTO A;  4IIA A;  1RNT A;  2XEP A;  2HML B;  4KFE A;  1RGF A;  4LYL B;  1DVD A;  1NO3 A;  3SOY A;  1D6U A;  5HOH A;  3KCH A;  2D1W A;  2J8X B;  3HII A;  2BMQ B;  1Q82 4;  3A5E A;  1YVS A;  1K73 4;  3T8N A;  1RGH A;  1BNJ A;  4LEH A;  2UUG C;  1I3F A;  3F8H A;  3B4O A;  1W2B 2;  5AII A;  1WTH A;  3CPO A;  5D83 A;  4BTW A;  1LRA A;  3LZA A;  2D42 A;  1RCL A;  1ZO2 A;  4HM6 B;  3X3Z A;  1FUW A;  5IF6 A;  3DY5 A;  3EX9 A;  2XH9 A;  3X3Y A;  4QWT A;  1U5O A;  2WO0 A;  3K7C A;  1UUV B;  5AEU B;  2BT3 A;  1RSN A;  1B2S A;  1HKX A;  5KP4 A;  3SLU A;  2E2T A;  3V99 A;  2WGO A;  1M1K 4;  1I0X A;  2H0I A;  3AGO A;  5JBS A;  2CH9 A;  2GU3 A;  1GD3 A;  2H0H A;  4WWU C;  3UNL A;  1C54 A;  1TP6 A;  1BNE A;  1Q40 B;  4RZM A;  3NM7 A;  3X3X A;  3NX0 A;  1D6Y A;  3BU4 A;  4CCV A;  1JBT A;  1B2X A;  3F9S A;  5IW9 A;  3X40 A;  4EW5 A;  1GSP A;  1DMM A;  4MMY B;  2CFW A;  4KFF A;  3LH4 A;  1Q7Y 4;  1U8C B;  2HMM B;  5IEO A;  2Z77 A;  3AMO B;  3ZG0 A;  1TIJ A;  2BIR A;  3WDG B;  1B2M A;  2C4B A;  2Z6B A;  3CC4 3;  7RNT A;  1SJW A;  3ALA A;  4IPB A;  1TRQ A;  3NBR A;  1BSD A;  1DMQ A;  8RNT A;  3MSO A;  2W56 A;  1IK3 A;  1STD A;  2K3D A;  1IQY A;  1G0T A;  4L8O A;  3DGL A;  1V57 A;  3EF8 A;  3KSP A;  4STD A;  2H0G A;  1YGE A;  2O3O A;  1YJ9 3;  1RNB A;  2Y73 A;  4LMI A;  1BRK A;  1GMQ A;  5EVH A;  3EJV A;  4RNZ A;  2OOV A;  1Q86 4;  3KSE D;  9RNT A;  1VQP 3;  2RFR A;  1JB5 A;  3Q1C A;  3T8U A;  2RSX A;  1S5A A;  5RNT A;  3G71 3;  1IVU A;  4J5G A;  1RRH A;  1LQM B;  3D9R A;  4EYC A;  2PNC A;  1OH0 A;  3FGY A;  3QRD A;  6GSP A;  6STD A;  4HYZ A;  3FG4 A;  3LML A;  1JBS A;  1LOX A;  1HZ1 A;  4HZ9 B;  1B27 A;  1M9G A;  2MF7 A;  3F7X A;  3I0Y A;  4FCM A;  5DRV A;  1W7C A;  3AMO A;  3VGN A;  3NM2 A;  1E97 A;  2AAE A;  2W6J H;  3FG1 A;  4WP5 A;  3F8X A;  2RBI A;  1V58 A;  3CD6 3;  1I2E A;  4EXR A;  1VQ4 3;  2W56 B;  5KP3 A;  2CKF B;  1CEW I;  5JPP A;  3FZW A;  3BLZ A;  1PFP A;  2LQV A;  2C11 A;  4N6V 0;  3T0U A;  1VQ8 3;  1FGQ A;  3I56 3;  2W9P A;  3ECF A;  5I97 A;  3BB9 A;  1UGH I;  3MYT A;  2CX0 A;  3DH2 A;  1RDS A;  2MC8 A;  4HBR A;  3CCQ 3;  2INX A;  3GZR A;  3UL6 A;  4O02 B;  3SVA A;  1Y4K A;  1OF5 A;  4N6L A;  1MWU A;  3NQY A;  1IV9 A;  5CF2 A;  1B21 A;  4NRE A;  1GY5 A;  5GSP A;  1EKM A;  1UI8 A;  1JZO A;  2HOH A;  3D5I A;  1I2F A;  4LZI A;  1A2P A;  3WOF B;  4HM7 B;  4FMD A;  4HM8 B;  1NB5 I;  2XFT A;  3OW2 2;  2KRT A;  5G1L A;  7GSP A;  3KFQ C;  1UCL A;  4AKZ A;  1YHQ 3;  1JB4 A;  3Q3F A;  2FXT A;  3MG3 A;  4U13 A;  1LOY A;  1I2G A;  3BNB A;  1FYS A;  3MG2 A;  2Z76 A;  4RNY A;  3EBY A;  3ER7 A;  3LT8 A;  4FMA A;  1RMS A;  4J9A A;  3PCS A;  4ILF A;  1IQ8 A;  4RBN A;  1E3V A;  1IQX A;  1BIR A;  2XSH B;  1FZU A;  3SYU A;  2QA4 3;  2GBX B;  2FNQ A;  2P05 A;  2YFL B;  1O7H B;  2CIU A;  3WR2 A;  1OGX A;  2B1X B;  1RN7 A;  3EB8 A;  3FF0 A;  2ML5 A;  2OQE C;  3UL5 A;  3OV4 A;  3OWY A;  3DUK A;  3FSD A;  3U97 A;  1BRG A;  5D82 A;  1WQL B;  1FW7 A;  3ZFZ A;  2XR8 B;  4K1V A;  4HM0 B;  1UCI A;  3A76 A;  1QAF A;  2IYJ A;  1BRS A;  4HM3 B;  4L7K A;  5STD A;  1PY3 A;  2LYX A;  2R4I A;  1Q81 4;  3PS8 A;  1KC8 4;  2F99 A;  1IVW A;  4FMC A;  1DET A;  1OCV A;  1FUT A;  3K9M C;  2HMN B;  5A0O B;  5EQL A;  1IU7 A;  3NBJ A;  3NXJ A;  2BO9 B;  4PEJ A;  2E2V A;  2OOV C;  3NV0 B;  4CPK A;  2WGQ A;  4BL2 A;  1BRN L;  3KZT A;  3BIR A;  1B2Z A;  3HX8 A;  4N6O B;  4X2O A;  1QVG 2;  2IMJ A;  1DMN A;  1GD4 A;  1OPY A;  1UUG B;  3HIG A;  4EV2 A;  3B7C A;  4XBT A;  3GRD A;  3DGO A;  1MGW A;  1IVV A;  1AQZ A;  1N9J A;  3DGM A;  2ZL8 A;  4HM4 B;  4R9K A;  3S67 A;  1DVC A;  1T5Y A;  5IG5 A;  4Q53 A;  5IG0 A;  2XGL A;  2ML6 A;  2CWV A;  2P0M A;  3BND A;  1X1X A;  5M1A A;  2GU1 A;  3RGA A;  1TUH A;  5IER A;  1UCK A;  3OWU A;  3WMD A;  1KWI A;  2BMO B;  3V98 A;  3D4A A;  1RN1 A;  4NHF A;  2F5W A;  3X42 A;  1CQS A;  5AI1 A;  4EV5 A;  1BOX A;  1V74 A;  4N6N B;  3ZG5 A;  3S28 A;  3CCV 3;  3CXC 2;  1NDO B;  2CG1 A;  3EN8 A;  1QJG A;  2STD A;  3HZP A;  4BTY A;  4GHO A;  1X1Y A;  1SAR A;  3RGR A;  1E3R A;  4DKI A;  2OTJ 3;  1TU5 A;  1GMP A;  2CW9 A;  3G16 A;  4KT3 B;  1W6G A;  1UGI A;  2JDI H;  4LGQ A;  2QIY A;  2KAA A;  2CX1 A;  1VQQ A;  4I5Q A;  1ZS7 A;  2A15 A;  4R1K A;  4CDL A;  1W01 A;  5G2G A;  1YIT 3;  1VQO 3;  1WMP A;  3GZB A;  4AKY A;  3DGN A;  5AEW B;  7STD A;  1BAN A;  4K90 B;  3PCR A;  1O7P B;  3F40 A;  1BNG A;  4ORL A;  1ROA A;  4FCZ A;  1BRH A;  3EQQ B;  1W5Z A;  4JF8 A;  1D6Z A;  1IVX A;  2KF5 A;  1W4N A;  2BU4 A;  3DGY A;  1LVN A;  3QK9 A;  2CK3 H;  4H61 A;  2SBL A;  3GSP A;  1BVI A;  2IUJ A;  5AYR B;  1VQL 3;  3GZX B;  1FA3 A;  1QAL A;  1BSC A;  2HMO B;  4HZB B;  3URP A;  1IYY A;  3WOD G;  1GMR A;  1IDP A;  2L1S A;  5CK6 A;  5IG3 A;  4R4K A;  4R9L A;  4HKV B;  4MMX B;  3V92 A;  5EEO A;  3WA2 X;  1N8R 4;  2CC3 A;  4J8T A;  1UCJ A;  3LYG A;  3WA3 A;  1MWR A;  3NQZ A;  4O2H A;  1PYL A;  1OGZ A;  5G1K A;  1WMN A;  1NWW A;  4JRF A;  4MMZ B;  2CFL A;  3CCR 3;  1FGR A;  1ZGX A;  1TFO A;  2BNG A;  1LQG C;  1R4C A;  4FMB A;  3NBB A;  4WYK A;  4XBX A;  3JUM A;  2BMR B;  1IV7 A;  3Q2P A;  1Q7H A;  2P09 A;  4BIR A;  1VQ9 3;  1Z1S A;  3IPT A;  2QEX 3;  2C10 A;  3D5G A;  2XFS A;  1T3B A;  4HAA A;  5CXO A;  4HVN A;  3K0Z A;  3NUV A;  3CME 3;  4HM2 B;  1RGC A;  1GYB A;  4N3V A;  3MPH A;  1AVL A;  1A2V A;  2YFJ B;  1RGL A;  2K0M A;  4CJN A;  2OTL 3;  2W03 A;  5BIR A;  2P38 A;  2UX0 A;  1HYF A;  5IEP A;  1OHS A;  3LTA A;  1LXE A;  1SQW A;  2WOH A;  4WFO A;  1OHP A;  2KF6 A;  3FCS B;  1FGO A;  1L5G B;  1FGM A;  1I8V A;  1RN4 A;  1W6C A;  2SAR A;  1YGW A;  5AIH A;  3CCL 3;  5AYS C;  1FUS A;  1BRI A;  1MGR A;  2KF4 A;  3CU3 A;  3BNC A;  2JQ5 A;  3EE1 A;  3FF2 A;  5AIG A;  1AY7 A;  1ROV A;  3O8Y A;  5ELU A;  2K54 A;  2XF3 A;  3HK4 A;  1WNH A;  1K9M 4;  2Z7A A;  3MHE A;  5BXQ A;  1JJ2 2;  2HMK B;  1GY7 A;  1QAK A;  1EG9 B;  1X1W A;  1NU3 A;  3CMA 3;  2RNT A;  4K1U A;  1UI7 A;  3AHS A;  1OUN A;  4N6U A;  1AR0 A;  3LXU X;  5TGN A;  3F14 A;  1T2I A;  3OWS A;  3PYJ A;  1MNL A;  2UGI A;  4O8S A;  2CFD A;  5FGO A;  1VQN 3;  2HMJ B;  5FW5 A;  1B2U A;  2WOF A;  3KE7 A;  1DYU A;  1LNH A;  2R41 A;  1US1 A;  3WHO A;  8CHO A;  3MG1 A;  3S5C A;  1W2Z A;  3NV0 A;  4GSP A;  1O7M B;  2XSO B;  3LT9 A;  1CYV A;  4XDW A;  1ASK A;  1WMO A;  2AAD A;  4FCJ A;  3SXX A;  3D3L A;  4IT7 A;  5CF1 A;  3J7Y d;  1S72 3;  4I4K A;  2CHC A;  5IG4 A;  1BNR A;  1K28 A;  1BSE A;  4HM5 B;  1UDI I;  1TRP A;  4K61 A;  3CCE 3;  1GOY A;  2P0X A;  3G0K A;  4XBY A;  2GXF A;  3GZY B;  3HOH A;  1RHL A;  1EA2 A;  2Q07 A;  1JB2 A;  2CFK A;  3JUQ A;  3K5T A;  3ROB A;  1FGT A;  2GBW B;  1VQM 3;  5BU4 A;  1CYU A;  3Q90 A;  1R4Y A;  3S27 A;  4BTX A;  5ELJ A;  1QVF 2;  1MWS A;  3G6E 3;  4H3U A;  3MWZ A;  1A2K A;  3L0R A;  3B8L A;  3GAX A;  2IUK A;  3SOA A;  1OHO A;  2Y74 A;  2L4V A;  3CCU 3;  4GL6 A;  1JRQ A;  3PZW A;  2CG0 A;  2XGN A;  1BNS A;  1GOU A;  3CCM 3;  3EBT A;  3X41 A;  1BNF A;  3AGN A;  1JKG A;  4LSO A;  4EBG A;  2ZA4 A;  5JPU A;  1DE3 A;  1YVB I;  1KD1 4;  3IJE B;  2RGQ A;  4ZM8 A;  1EEJ A;  1JNQ A;  3FH1 A;  4FR9 A;  2KXG A;  1I3I A;  1VZZ A;  1JZD A;  4WHA A;  2IY2 A;  1RRL A;  2PZV A;  1Q9E A;  2CFG A;  1RLS A;  3JUO A;  1Q42 A;  3OXA A;  4MJD A;  4BU4 A;  3B4P A;  3KKG A;  3TDG A;  1T2H A;  3DM8 A;  2F98 A;  3DXO A;  3H51 A;  1RCK A;  1CH0 A;  2M7O A;  4KFD A;  1JN5 B;  2QGU A;  3EHC A;  1ULJ B;  1N5P A;  4XB5 A;  1LOV A;  2CWU A;  3CCS 3;  5M18 A;  2W0Q A;  4X2H A;  4HOH A;  1ULI B;  1BNI A;  1Q40 A;  1LOW A;  1C7H A;  1SIH A;  3CNM A;  2W9Q A;  3KII A;  1ISK A;  1SII A;  1GS3 A;  2GEX A;  1G02 A;  4N6M A;  1TFK A;  2OQE A;  1JKG B;  4KVH A;  1LNI A;  2F4Y A;  2RCD A;  2W2C A;  3EC9 A;  5CLK A;  5M19 A;  2CWT A;  2F5M A;  1RGE A;  3NHX A;  3N9H A;  4O3V A;  4TX4 A;  3JUP A;  5LC7 A;  3CPW 2;  2XRX B;  1VQ7 3;  1YJW 3;  1W00 A;  1RTU A;  2KF3 A;  3EN1 B;  1K41 A;  2O9U X;  1MWT A;  3I55 3;  4EC6 A;  1A67 A;  4KZ1 A;  4J5K A;  5BVB A;  3UJM A;  1RGA A;  1W6Y A;  2BHM A;  1IT8 A;  3N8B A;  2YX9 A;  2KCD A;  4OK0 A;  4GB5 A;  1UUW B;  1EUI C;  3E99 A;  3FG3 A;  3LTD A;  4R80 A;  1JV2 B;  1RGG A;  3CC2 3;  4WYK B;  1SPU A;  4XM4 A;  1J2B A;  5DRE A;  1MOL A;  3OX9 A;  1JN5 A;  3RDE A;  1N5H A;  1G96 A;  1BU4 A;  4OVM A;  5LC6 A;  3H3H A;  2YFI B;  1B20 A;  1O7W B;  2E2U A;  1BSB A;  1K8A 4;  3SX1 A;  1YNV X;  1STF I;  2IA7 A;  3G8Z A;  3JVC A;  4MEI A;  3KN4 A;  3CCJ 3;  3DMC A;  1HU9 A;  3PXM A;  2ZDJ A;  1BGS A;  1RJO A;  5AIF A;  5IEN A;  1N9E A;  1TJD A;  5KP1 A;  6RNT A;  4BL3 A;  1GOV A;  3S29 A;  2GEY A;  1ZX2 A;  4RNT A;  2F86 B;  1B3S A;  3JUN A;  1QMA A;  1N8Q A;  2ZHX B;  3WOE B;  1PU4 A;  4OUQ A;  1YJN 3;  4AEQ A;  2FGT A;  1NNV A;  3F7S A;  1W02 A;  1I70 A;  5D81 A;  1YI2 3;  2F56 A;  2OWP A;  4HJL B;  1BRJ A;  1F8N A;  3IMA B;  3VF1 A;  1OAC A;  1I0V A;  1UW1 A;  3K63 A;  1JBR A;  1A90 A;  3M8C A;  1BAO A;  1OF5 B;  1IT7 A;  1NJI 4;  2GSP A;  3STD A;  3GWR A;  3LOY A;  1M90 4;  3CC7 3;  4N6T A;  4NPB A;  1M1X B;  4HM1 B;  3LTC A;  3D79 A;  2V1L A;  3G4S 3;  1VQ6 3;  3FLJ A;  3FKA A;  1O7N B;  1X1U A;  4L8P A;  3HI7 A;  2OCT A;  1AVK A;  3UB1 A;  1GY6 A;  1AV4 A;  2W04 A;  1KSI A;  3VSY A;  3CNX A;  3MKI A;  1RGK A;  1BUQ A;  4XDV A;  3BNE A;  3SED A;  1VQK 3;  5HGR A;  3DZL A;  3PGB A;  1KQS 2; 
#chains in the Genus database with same CATH homology
 4G1M B;  1NB3 I;  1EQK A;  3U1W A;  3LTB A;  1VQ5 3;  3N54 B;  1RKY A;  1YIJ 3;  1O7G B;  2B24 B;  2I9W A;  4IIA A;  2XEP A;  2HML B;  4KFE A;  1DVD A;  1NO3 A;  3SOY A;  1D6U A;  2D1W A;  3HII A;  2BMQ B;  1Q82 4;  1K73 4;  3T8N A;  4LEH A;  3F8H A;  3B4O A;  1W2B 2;  5AII A;  1WTH A;  3CPO A;  5D83 A;  4BTW A;  3LZA A;  2D42 A;  1ZO2 A;  4HM6 B;  3X3Z A;  1FUW A;  5IF6 A;  3DY5 A;  3EX9 A;  2XH9 A;  3X3Y A;  4QWT A;  1U5O A;  2WO0 A;  3K7C A;  1UUV B;  5AEU B;  2BT3 A;  1HKX A;  5KP4 A;  3SLU A;  2E2T A;  3V99 A;  2WGO A;  1M1K 4;  5JBS A;  2CH9 A;  2GU3 A;  1GD3 A;  4WWU C;  3UNL A;  1TP6 A;  1Q40 B;  4RZM A;  3NM7 A;  3X3X A;  3NX0 A;  1D6Y A;  4CCV A;  5IW9 A;  3F9S A;  3X40 A;  1DMM A;  4MMY B;  2CFW A;  4KFF A;  3LH4 A;  1Q7Y 4;  1U8C B;  2HMM B;  5IEO A;  2Z77 A;  3AMO B;  1TIJ A;  3WDG B;  2Z6B A;  3CC4 3;  1SJW A;  3ALA A;  4IPB A;  3NBR A;  1DMQ A;  3MSO A;  2W56 A;  1IK3 A;  1STD A;  1IQY A;  4L8O A;  3EF8 A;  3DGL A;  3KSP A;  4STD A;  1YGE A;  2O3O A;  1YJ9 3;  2Y73 A;  4LMI A;  5EVH A;  3EJV A;  4RNZ A;  2OOV A;  1Q86 4;  3KSE D;  1VQP 3;  2RFR A;  1JB5 A;  3Q1C A;  3T8U A;  2RSX A;  1S5A A;  3G71 3;  1IVU A;  1RRH A;  3D9R A;  4EYC A;  2PNC A;  1OH0 A;  3FGY A;  3QRD A;  6STD A;  4HYZ A;  3FG4 A;  3LML A;  1LOX A;  4HZ9 B;  1M9G A;  2MF7 A;  3F7X A;  3I0Y A;  4FCM A;  5DRV A;  1W7C A;  3AMO A;  3VGN A;  3NM2 A;  1E97 A;  2W6J H;  3FG1 A;  4WP5 A;  3F8X A;  3CD6 3;  4EXR A;  1VQ4 3;  2W56 B;  5KP3 A;  2CKF B;  1CEW I;  5JPP A;  3FZW A;  3BLZ A;  1PFP A;  2LQV A;  2C11 A;  4N6V 0;  3T0U A;  1VQ8 3;  1FGQ A;  3I56 3;  2W9P A;  3ECF A;  5I97 A;  3BB9 A;  3MYT A;  2MC8 A;  3CCQ 3;  4HBR A;  2INX A;  3GZR A;  3UL6 A;  4O02 B;  3SVA A;  1Y4K A;  1OF5 A;  4N6L A;  3NQY A;  1IV9 A;  5CF2 A;  4NRE A;  1GY5 A;  1EKM A;  1UI8 A;  4LZI A;  3WOF B;  4HM7 B;  4FMD A;  4HM8 B;  1NB5 I;  2XFT A;  3OW2 2;  2KRT A;  1YHQ 3;  3KFQ C;  4AKZ A;  1JB4 A;  2FXT A;  3MG3 A;  4U13 A;  3BNB A;  3MG2 A;  2Z76 A;  4RNY A;  3EBY A;  3ER7 A;  3LT8 A;  4FMA A;  4J9A A;  3PCS A;  1IQ8 A;  4RBN A;  1E3V A;  1IQX A;  2XSH B;  2QA4 3;  2GBX B;  2FNQ A;  2YFL B;  2P05 A;  1O7H B;  2CIU A;  1OGX A;  2B1X B;  1RN7 A;  3EB8 A;  3FF0 A;  2ML5 A;  2OQE C;  3UL5 A;  3OV4 A;  3OWY A;  3DUK A;  3FSD A;  3U97 A;  5D82 A;  1WQL B;  2XR8 B;  4K1V A;  4HM0 B;  4L7K A;  3A76 A;  1QAF A;  5STD A;  4HM3 B;  2LYX A;  2R4I A;  1Q81 4;  1KC8 4;  3PS8 A;  2F99 A;  1IVW A;  4FMC A;  1OCV A;  3K9M C;  2HMN B;  5A0O B;  5EQL A;  1IU7 A;  3NBJ A;  3NXJ A;  2BO9 B;  4PEJ A;  2E2V A;  2OOV C;  3NV0 B;  2WGQ A;  3KZT A;  3HX8 A;  4N6O B;  4X2O A;  1QVG 2;  2IMJ A;  1DMN A;  1GD4 A;  1OPY A;  3HIG A;  4EV2 A;  3B7C A;  4XBT A;  3GRD A;  3DGO A;  1IVV A;  1N9J A;  3DGM A;  2ZL8 A;  4HM4 B;  4R9K A;  5IG5 A;  1DVC A;  1T5Y A;  4Q53 A;  5IG0 A;  2XGL A;  2ML6 A;  2CWV A;  2P0M A;  3BND A;  3RGA A;  5IER A;  2GU1 A;  1TUH A;  3OWU A;  3WMD A;  1KWI A;  2BMO B;  3V98 A;  4NHF A;  3X42 A;  1CQS A;  5AI1 A;  4EV5 A;  1V74 A;  4N6N B;  3S28 A;  3CCV 3;  3CXC 2;  1NDO B;  2CG1 A;  3EN8 A;  1QJG A;  2STD A;  3HZP A;  4BTY A;  3RGR A;  1E3R A;  2OTJ 3;  1TU5 A;  2CW9 A;  3G16 A;  1W6G A;  2JDI H;  4LGQ A;  2QIY A;  3CMA 3;  4R1K A;  2A15 A;  4CDL A;  1YIT 3;  1W01 A;  5G2G A;  1VQO 3;  1WMP A;  3GZB A;  4AKY A;  3DGN A;  5AEW B;  7STD A;  4K90 B;  3PCR A;  1O7P B;  3F40 A;  4ORL A;  1ROA A;  4FCZ A;  3EQQ B;  1W5Z A;  4JF8 A;  1D6Z A;  1IVX A;  1W4N A;  1LVN A;  3QK9 A;  2CK3 H;  4H61 A;  2SBL A;  2IUJ A;  5AYR B;  1VQL 3;  3GZX B;  1FA3 A;  1QAL A;  2HMO B;  4HZB B;  3WOD G;  1IDP A;  5CK6 A;  5IG3 A;  4R4K A;  4R9L A;  4HKV B;  4MMX B;  3V92 A;  5EEO A;  3WA2 X;  1N8R 4;  2CC3 A;  4J8T A;  3LYG A;  3WA3 A;  3NQZ A;  4O2H A;  1OGZ A;  1WMN A;  1NWW A;  4JRF A;  4MMZ B;  2CFL A;  3CCR 3;  1FGR A;  1TFO A;  2BNG A;  1R4C A;  4FMB A;  3NBB A;  4WYK A;  4XBX A;  3JUM A;  2BMR B;  1IV7 A;  3Q2P A;  2P09 A;  1VQ9 3;  1Z1S A;  3IPT A;  2QEX 3;  2C10 A;  2XFS A;  5CXO A;  4HVN A;  3K0Z A;  3NUV A;  3CME 3;  4HM2 B;  1GYB A;  4N3V A;  3MPH A;  1A2V A;  1AVL A;  2YFJ B;  2K0M A;  2OTL 3;  2W03 A;  2P38 A;  2UX0 A;  5IEP A;  1OHS A;  3LTA A;  1LXE A;  1SQW A;  2WOH A;  4WFO A;  1OHP A;  3FCS B;  1L5G B;  1FGO A;  1FGM A;  1W6C A;  5AIH A;  3CCL 3;  5AYS C;  3CU3 A;  3BNC A;  3EE1 A;  2JQ5 A;  3FF2 A;  5AIG A;  1ROV A;  3O8Y A;  5ELU A;  2K54 A;  2XF3 A;  3HK4 A;  1WNH A;  1K9M 4;  2Z7A A;  3MHE A;  5BXQ A;  1JJ2 2;  2HMK B;  1GY7 A;  1QAK A;  1EG9 B;  1NU3 A;  4K1U A;  1UI7 A;  1OUN A;  4N6U A;  1AR0 A;  3LXU X;  5TGN A;  3F14 A;  3OWS A;  3PYJ A;  1MNL A;  4O8S A;  5FGO A;  2CFD A;  1VQN 3;  2HMJ B;  5FW5 A;  2WOF A;  3KE7 A;  1DYU A;  1LNH A;  8CHO A;  1US1 A;  3MG1 A;  3S5C A;  1W2Z A;  3NV0 A;  1O7M B;  2XSO B;  3LT9 A;  1CYV A;  4XDW A;  1ASK A;  1WMO A;  3SXX A;  4FCJ A;  3D3L A;  4IT7 A;  5CF1 A;  3J7Y d;  1S72 3;  4I4K A;  2CHC A;  5IG4 A;  1K28 A;  4HM5 B;  4K61 A;  3CCE 3;  2P0X A;  3G0K A;  4XBY A;  2GXF A;  3GZY B;  1EA2 A;  2Q07 A;  1JB2 A;  2CFK A;  3JUQ A;  3K5T A;  3ROB A;  1FGT A;  2GBW B;  1VQM 3;  1CYU A;  3Q90 A;  3S27 A;  4BTX A;  5ELJ A;  1QVF 2;  3G6E 3;  4H3U A;  3MWZ A;  1A2K A;  3L0R A;  3B8L A;  3GAX A;  2IUK A;  3SOA A;  1OHO A;  2Y74 A;  2L4V A;  3CCU 3;  4GL6 A;  1JRQ A;  3PZW A;  2CG0 A;  2XGN A;  3CCM 3;  3EBT A;  3X41 A;  1JKG A;  4LSO A;  4EBG A;  5JPU A;  1YVB I;  1KD1 4;  3IJE B;  2RGQ A;  4ZM8 A;  1JNQ A;  3FH1 A;  4FR9 A;  2KXG A;  1VZZ A;  4WHA A;  1RRL A;  2PZV A;  2CFG A;  3JUO A;  1Q42 A;  3OXA A;  4MJD A;  3B4P A;  3KKG A;  3TDG A;  3DM8 A;  2F98 A;  3DXO A;  3H51 A;  4KFD A;  2M7O A;  1JN5 B;  2QGU A;  3EHC A;  1ULJ B;  1N5P A;  4XB5 A;  2CWU A;  3CCS 3;  2W0Q A;  4X2H A;  3S67 A;  1ULI B;  1Q40 A;  1SIH A;  3CNM A;  1C7H A;  3KII A;  2W9Q A;  1ISK A;  1SII A;  1GS3 A;  2GEX A;  4N6M A;  1TFK A;  2OQE A;  1JKG B;  4KVH A;  2RCD A;  2W2C A;  3EC9 A;  5CLK A;  2CWT A;  3NHX A;  3CC2 3;  1VQ7 3;  3N9H A;  4O3V A;  4TX4 A;  3JUP A;  5LC7 A;  3CPW 2;  2XRX B;  1YJW 3;  1W00 A;  3EN1 B;  1K41 A;  2O9U X;  3I55 3;  4EC6 A;  1A67 A;  4KZ1 A;  5BVB A;  3UJM A;  1W6Y A;  2BHM A;  1IT8 A;  3N8B A;  2YX9 A;  2KCD A;  4OK0 A;  4GB5 A;  1UUW B;  3E99 A;  3FG3 A;  3LTD A;  4R80 A;  1JV2 B;  4WYK B;  1SPU A;  4XM4 A;  1J2B A;  5DRE A;  1MOL A;  3OX9 A;  1JN5 A;  3RDE A;  1N5H A;  1G96 A;  4OVM A;  5LC6 A;  3H3H A;  2YFI B;  1O7W B;  2E2U A;  1K8A 4;  3SX1 A;  2IA7 A;  1STF I;  3G8Z A;  3JVC A;  4MEI A;  3KN4 A;  3CCJ 3;  3DMC A;  1HU9 A;  3PXM A;  2ZDJ A;  5AIF A;  1RJO A;  5IEN A;  1N9E A;  5KP1 A;  3S29 A;  2GEY A;  1ZX2 A;  2F86 B;  3JUN A;  1QMA A;  1N8Q A;  3WOE B;  1PU4 A;  4OUQ A;  1YJN 3;  4AEQ A;  2FGT A;  3F7S A;  1W02 A;  5D81 A;  1YI2 3;  2OWP A;  4HJL B;  1F8N A;  3IMA B;  3VF1 A;  1OAC A;  1UW1 A;  3K63 A;  1A90 A;  3M8C A;  1OF5 B;  1IT7 A;  1NJI 4;  3STD A;  3GWR A;  3LOY A;  1M90 4;  3CC7 3;  4N6T A;  1M1X B;  4HM1 B;  3LTC A;  3G4S 3;  2V1L A;  1VQ6 3;  3FLJ A;  3FKA A;  1O7N B;  4L8P A;  3HI7 A;  2OCT A;  1AVK A;  3UB1 A;  1GY6 A;  1AV4 A;  2W04 A;  1KSI A;  3VSY A;  3CNX A;  3MKI A;  1BUQ A;  4XDV A;  3BNE A;  3SED A;  1VQK 3;  5HGR A;  3DZL A;  3PGB A;  1KQS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...