1R4CA

N-truncated human cystatin c; dimeric form with 3d domain swapping
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
GGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin C
publication title Domain swapping in N-truncated human cystatin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 19
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1r4cA00
4ZM8A 1KWIA 5ELUA 4CCVA 4N6NB 3SVAA 2W9QA 5LC7A 1TIJA 3QRDA 4N6V0 4IT7A 3UL5A 3KSED 1FA3A 1PFPA 2CH9A 5LC6A 4N6OB 5A0OB 1NB3I 4N6LA 2W9PA 1MOLA 1IV7A 5ELJA 2O9UX 1A67A 1N5PA 1G96A 4N6UA 3IMAB 1CYVA 1LXEA 1R4CA 1FUWA 3PXMA 1WNHA 3PYJA 3MWZA 4LZIA 1MNLA 2OCTA 1DVCA 3NX0A 1A90A 1CYUA 1STFI 1GD4A 1M9GA 1ROAA 3PS8A 3KFQC 1NB5I 1IV9A 3GAXA 1RN7A 1CEWI 1EQKA 4EYCA 1DVDA 1N5HA 2BO9B 3LH4A 3UL6A 4N6TA 3S67A 3L0RA 3Q2PA 4N6MA 1GD3A 2KXGA 3K9MC 5EQLA 1YVBI 4TX4A 1N9JA
chains in the Genus database with same CATH superfamily
4I5QA 1BRJA 4BIRA 1MGRA 1T2IA 1YHQ3 1B20A 1DMNA 1LQGC 7RNTA 1LQMB 3DZLA 1VQ63 2C11A 3RGRA 1IK3A 1KWIA 5G1LA 2R4IA 1QAFA 2SARA 2F99A 1IVUA 1I8VA 1KC84 4LGQA 2XGNA 1FGQA 5AEUB 4ORLA 5AIFA 1DE3A 3JVCA 1DMMA 2ML5A 3SOAA 2WGQA 3SOYA 1K8A4 4HM4B 5CF1A 3QRDA 1BU4A 2ZDJA 2ML6A 2CFGA 1VQ43 1TP6A 1OUNA 2K3DA 1EG9B 1FA3A 2D1WA 4K90B 2H0GA 3JUPA 8CHOA 2A15A 5IG4A 3QK9A 1IQ8A 3DM8A 1NB3I 1UI7A 3AGOA 3LTDA 3NQYA 4FMBA 2W56A 1YJ93 4MMYB 3NM2A 1DMQA 1MWUA 3M8CA 4DKIA 2CFLA 2CWVA 4XBXA 2BMQB 1NU3A 1WQLB 3KE7A 5M18A 2IYJA 3D4AA 1G96A 1GY6A 2K54A 3FGYA 2UX0A 4CJNA 5JBSA 2INXA 2P05A 4IPBA 4N6UA 3K0ZA 1RCLA 3D3LA 3KSPA 3MG3A 1RNTA 2HMNB 1T3BA 1RCKA 3TDGA 3X41A 2R41A 4NPBA 2E2TA 1GOYA 1A2PA 3CCS3 3ER7A 1M904 1IVVA 5CXOA 5BU4A 2YX9A 3FLJA 3WMDA 1TUHA 3CD63 3BB9A 1BUJA 4RZMA 3GZYB 1J2BA 3B7CA 3MYTA 2QGUA 3AHWA 4RNZA 1OHOA 3CC43 2IMJA 1BUQA 2IY2A 4KT3B 1JJ22 1UGIA 4WWUC 3CPOA 1RGHA 3HI7A 2KF4A 1ROAA 3LXUX 1LRAA 4KFFA 1FUTA 3MHEA 3Q1CA 1LOXA 3MSOA 4GB5A 3J7Yd 3I563 3CC23 1CQSA 2P0XA 3EQQB 3F14A 3HX8A 3CXC2 1LVNA 3NUVA 4N3VA 4O2HA 3T8UA 1JBRA 2BHMA 4K1VA 5AYSC 1GMPA 1OH0A 1W02A 1N8QA 1YGEA 1IQXA 1ISKA 3H51A 5IF6A 3GZXB 1VQ73 1AV4A 1BSCA 1W00A 4IIAA 1CEWI 1EQKA 3CNXA 3MKIA 1I3IA 3NQZA 1C7HA 2XH9A 2MF7A 3UL6A 5M19A 1JB2A 3A5EA 2GBWB 3U97A 4LYLB 3GWRA 3OW22 4G1MB 4N6TA 1Q7HA 3D5IA 1MWRA 3S67A 3OWYA 1BOXA 1IVXA 2XR8B 1GD3A 4LMIA 2KXGA 1FUSA 3RDEA 1Z1SA 1JZDA 2KAAA 3LTCA 4J5KA 1GY5A 1BIRA 3OWSA 4JF8A 2UUGC 1HYFA 5AIHA 1B3SA 1US1A 3EHCA 1FGTA 3EX9A 3AGNA 3NBBA 4HBRA 4K1UA 1RN4A 1BNGA 2D42A 6RNTA 1S723 3I0YA 3DXOA 3UJMA 2C10A 3S27A 3G0KA 5AEWB 1GMQA 1IYYA 1RGFA 3X3YA 2RCDA 1UCIA 2CFKA 3PGBA 1NJI4 4N6NB 3EJVA 1K9M4 1BNFA 1OF5B 2ZHXB 2RGQA 2RSXA 4L7KA 2GXFA 2Z76A 5FGOA 3Q90A 1K28A 3ECFA 3SEDA 1YGWA 1Y4KA 4WYKB 4BL3A 1STDA 2YFJB 5DREA 1OCVA 3IPTA 4Q53A 1FZUA 1AVKA 1A2KA 3U1WA 3NBJA 4R9KA 1IVWA 1B2ZA 4BTYA 3S29A 2CH9A 5LC6A 2E2VA 4BTXA 1X1UA 1NNVA 3RNTA 2W2CA 3EN1B 2C4BA 1QALA 1MOLA 7GSPA 1SIHA 6GSPA 5JPPA 5ELJA 4HZ9B 5AYRB 1N9EA 3F8XA 4HJLB 4OK0A 1A67A 1MWSA 8RNTA 2RFRA 1U8CB 2YFIB 3EN8A 1O7PB 5IW9A 3E99A 1M1XB 3HK4A 3ZFZA 4HKVB 3CCM3 2IA7A 5EEOA 2GEXA 3F40A 3OX9A 2XRXB 3HIIA 3MPHA 2FNQA 4EV5A 3SX1A 3CCU3 1VQO3 4R9LA 3PXMA 2FGTA 4XBYA 3WDGB 1UGHI 3B8LA 2H0HA 5BXQA 1UUVB 2LYXA 2STDA 1RRHA 3AMOA 3EBTA 2KF6A 3F8HA 3PYJA 2BNGA 4LZIA 5AIGA 2PZVA 3CCJ3 4K61A 1YIT3 5G2GA 1NO3A 1Q40B 1LOWA 1VQ83 1N8R4 1BRHA 1UI8A 3FG4A 4EC6A 1RGCA 1JN5B 3G713 1YNVX 4PEJA 1WTHA 1M9GA 2UGIA 2KCDA 1Q814 2P0MA 3WHOA 2CHCA 5CF2A 1D6YA 9RNTA 2CWUA 3DY5A 1UUGB 3LT9A 1SIIA 1UCLA 2V1LA 2MC8A 2Y74A 2XF3A 3GZBA 2Z7AA 1W6GA 3K63A 2BMOB 4XM4A 3VF1A 1F8NA 1ZGXA 3X40A 3CNMA 3DUKA 1LNHA 2SBLA 3LZAA 4ILFA 1O7WB 3NXJA 2BO9B 1W6CA 2ZA4A 1UCKA 1B2SA 1ZS7A 1GS3A 1NWWA 3CME3 4U13A 3V92A 1HZ1A 1JNQA 4X2OA 4FMCA 3JUMA 1R4YA 3F9SA 1IT7A 4HM3B 4GHOA 1ASKA 4N6MA 3WA3A 1X1YA 1BNRA 3DGNA 1SPUA 1Q9EA 4RBNA 5EQLA 1DETA 1TTOA 1TRQA 1YJN3 1O7MB 3CCL3 4LSOA 4R80A 1FGOA 2BIRA 1ZX2A 1SQWA 5HOHA 1I70A 1IQYA 5IG5A 3WOEB 3S5CA 3CCQ3 1RGKA 1GSPA 1JB5A 1S5AA 5D82A 2YFLB 3JUNA 3CPW2 1VZZA 3NV0B 1I2GA 5ELUA 2B24B 1BRKA 1QVF2 4EW5A 3I553 5JPUA 1BNEA 3BLZA 3SVAA 2Y73A 5RNTA 1B2UA 2W9QA 5IEPA 2XGLA 2GEYA 1RTUA 1NDOB 1L5GB 1UUWB 2CWTA 3UL5A 2AADA 3KSED 2CK3H 1LOVA 1FGRA 3K5TA 3FH1A 1IU7A 1PFPA 1UDII 3HZPA 3T8NA 1BSDA 4HYZA 1RGGA 3CCV3 1YVSA 3BNBA 4XDVA 4RNTA 3D79A 3PCRA 2Z77A 1I0VA 1JZOA 1BANA 3FG1A 4N6LA 5IG3A 2F5MA 3EBYA 4O8SA 7STDA 1V58A 2HMJB 1K41A 3FSDA 4HM2B 1RRLA 3CU3A 3H3HA 4NREA 1IV7A 1WMPA 3IJEB 4FMAA 2O9UX 2W6JH 1PU4A 2KF3A 4H3UA 4MMZB 4R1KA 1UCJA 5M1AA 3NHXA 1V74A 5AIIA 2CC3A 3LMLA 2I9WA 2OQEC 1OHSA 1YJW3 3BNDA 1BNSA 1EA2A 1T5YA 3BNEA 1E3VA 1CYVA 3DGLA 3JUOA 4RNYA 2BMRB 3RGAA 3X42A 3X3ZA 4HAAA 1R4CA 3B4OA 3KKGA 1FUWA 3ALAA 1A2VA 3CCR3 1TJDA 5D83A 1VQ53 4BTWA 3GSPA 3ZG0A 3WODG 1HKXA 3MWZA 3GZRA 3OV4A 1MNLA 3DMCA 5KP4A 4O02B 2HOHA 1ULIB 2OCTA 1DVCA 2W56B 3NX0A 1EEJA 1A90A 3GRDA 1OHPA 4FCMA 1STFI 2CG0A 2O3OA 1WMNA 1GYBA 2WGOA 4L8OA 3KZTA 1BAOA 3G16A 1VQK3 1RGLA 3URPA 1VQN3 4EV2A 2LQVA 1DYUA 1GD4A 4I4KA 2BT3A 4WFOA 1FGMA 5TGNA 1RDSA 1QJGA 1BVIA 2CKFB 1BSEA 3MG2A 3LT8A 4HM8B 3MG1A 4AKYA 4J9AA 3PS8A 1BRNL 3EF8A 2L4VA 2F98A 4BL2A 2E2UA 3O8YA 1OGZA 1BRIA 1GOVA 3ZG5A 1NB5I 1D6ZA 3X3XA 4OUQA 3OXAA 1IV9A 4KFDA 1W5ZA 5I97A 2H0IA 4MJDA 2L1SA 2RNTA 1PYLA 3SYUA 1QMAA 1RN7A 1KQS2 2CW9A 1BRGA 2IUJA 1Q42A 1DVDA 1TRPA 1TU5A 2W04A 3LH4A 1G0TA 2XFTA 3FZWA 3FCSB 4GL6A 4STDA 5CK6A 1W7CA 3DH2A 5FW5A 1FYSA 3BU4A 1AQZA 3FG3A 2CFWA 2F86B 3L0RA 3CMA3 2CIUA 1RKYA 1OF5A 3S28A 1I0XA 1V57A 1I3FA 3Q2PA 3D9RA 1ULJB 2KF5A 1M1K4 1W2ZA 1AR0A 3K9MC 4O3VA 4WYKA 2XSHB 1QAKA 1VQP3 5KP1A 1YVBI 2PNCA 2HMLB 1EUIC 4TX4A 1N9JA 5AI1A 2P09A 2QA43 2J8XB 1B27A 4CDLA 2JDIH 2CG1A 5BIRA 1E3RA 2FXTA 5IEOA 4ZM8A 1WMOA 1YIJ3 4FMDA 1GY7A 3UNLA 1W2B2 1KD14 1VQ93 2BU4A 1BSAA 4OVMA 1Q824 3K7CA 4L8PA 2B1XB 3KN4A 1Q864 1C54A 1JBTA 2XSOB 2AAEA 4CCVA 4XBTA 1HU9A 3DGOA 3V98A 4XB5A 5IG0A 1RJOA 5STDA 3PZWA 5LC7A 3FF2A 1TIJA 4WHAA 2P38A 1FW7A 4N6V0 4LEHA 4IT7A 1QVG2 4X2HA 4EXRA 1K734 2HMMB 4EBGA 3AHSA 2F56A 1VQQA 1AVLA 1O7NB 1B2MA 1SJWA 4H61A 1T2HA 2XEPA 4N6OB 3ROBA 2F4YA 5A0OB 5D81A 1EKMA 2W9PA 1VQM3 3F7SA 1Q40A 1BNIA 3DGYA 1RHLA 5GSPA 2Z6BA 3V99A 4KVHA 5KP3A 1KSIA 3SXXA 2WOHA 2KRTA 1X1WA 1N5PA 4R4KA 4J5GA 3VSYA 4AKZA 3HIGA 1JN5A 4HVNA 2OTJ3 2GSPA 3OWUA 1BRSA 3LTBA 4MEIA 1W4NA 3IMAB 2IUKA 1JV2B 1LXEA 3A76A 4HM0B 3CCE3 1JKGB 1UW1A 2XFSA 4HM5B 1CH0A 1RNBA 1JBSA 1WNHA 1E97A 3KIIA 3PCSA 1OPYA 2Q07A 4J8TA 1RGEA 1MGWA 3N8BA 1RMSA 1SARA 4HOHA 1B21A 1GMRA 1OGXA 3N54B 3N9HA 3UB1A 2GBXB 2WOFA 1W6YA 3BNCA 1W01A 2CFDA 3CC73 1CYUA 1TFKA 4FCJA 1O7HB 4CPKA 2OTL3 1Q7Y4 3EB8A 1OACA 1LOYA 1X1XA 4FR9A 2GU3A 5G1KA 5EVHA 3T0UA 1JRQA 1RSNA 1RN1A 2K0MA 2F5WA 3DGMA 3NBRA 3WOFB 3B4PA 5BVBA 4HM1B 3G4S3 3D5GA 3LYGA 4GSPA 2OQEA 4HM6B 3STDA 4HM7B 1I2EA 2CX0A 3KFQC 1ZO2A 4QWTA 3WR2A 1IDPA 1O7GB 3AMOB 3FF0A 3LTAA 1GOUA 4HZBB 3GAXA 1IT8A 3LOYA 2ZL8A 1RGAA 4NHFA 4KZ1A 1B2XA 3G6E3 3EC9A 3EE1A 2QIYA 4JRFA 2GU1A 1N5HA 4MMXB 2W03A 3NM7A 4EYCA 5IERA 4BU4A 1U5OA 5DRVA 1I2FA 4WP5A 5HGRA 3Q3FA 1MWTA 2W0QA 1AY7A 1BNJA 3FKAA 1BSBA 3NV0A 1YI23 1JB4A 3VGNA 5CLKA 3HOHA 5IENA 3BIRA 1G02A 2OWPA 6STDA 2OOVC 2M7OA 3SLUA 2RBIA 3G8ZA 4AEQA 2HMOB 2OOVA 1JKGA 1ROVA 4XDWA 3WA2X 2QEX3 1TFOA 2HMKB 4FCZA 4KFEA 1LNIA 1VQL3 3JUQA 1D6UA 3KCHA 2JQ5A 3F7XA 1PY3A 1RLSA 2CX1A 2WO0A 1BGSA
chains in the Genus database with same CATH topology
1YHQ3 1DMNA 3DZLA 1VQ63 2C11A 3RGRA 1IK3A 1KWIA 2R4IA 1QAFA 2F99A 1IVUA 1KC84 4LGQA 2XGNA 1FGQA 5AEUB 4ORLA 5AIFA 3JVCA 1DMMA 2ML5A 3SOAA 2WGQA 3SOYA 1K8A4 4HM4B 5CF1A 3QRDA 2ZDJA 2ML6A 2CFGA 1VQ43 1TP6A 1OUNA 1EG9B 1FA3A 2D1WA 4K90B 3JUPA 8CHOA 2A15A 5IG4A 3QK9A 1IQ8A 3DM8A 1NB3I 1UI7A 3LTDA 4FMBA 3NQYA 2W56A 1YJ93 4MMYB 3NM2A 1DMQA 3M8CA 2CFLA 2CWVA 4XBXA 2BMQB 1NU3A 1WQLB 3KE7A 1G96A 1GY6A 2K54A 3FGYA 2UX0A 5JBSA 2INXA 2P05A 4IPBA 4N6UA 3K0ZA 3D3LA 3KSPA 3MG3A 2HMNB 3TDGA 3X41A 2E2TA 3CCS3 3ER7A 1M904 1IVVA 5CXOA 2YX9A 3FLJA 3WMDA 1TUHA 3CD63 3BB9A 4RZMA 3GZYB 1J2BA 3B7CA 3MYTA 2QGUA 4RNZA 1OHOA 3CC43 2IMJA 1BUQA 1JJ22 4WWUC 3CPOA 3HI7A 1ROAA 3LXUX 4KFFA 3MHEA 3Q1CA 1LOXA 3MSOA 4GB5A 3J7Yd 3I563 3CC23 1CQSA 2P0XA 3EQQB 3F14A 3HX8A 3CXC2 1LVNA 3NUVA 4N3VA 4O2HA 3T8UA 2BHMA 4K1VA 5AYSC 1OH0A 1W02A 1N8QA 1YGEA 1IQXA 1ISKA 3H51A 5IF6A 3GZXB 1VQ73 1AV4A 1W00A 4IIAA 1CEWI 1EQKA 3CNXA 3MKIA 3NQZA 1C7HA 2XH9A 2MF7A 3UL6A 1JB2A 2GBWB 3U97A 3OW22 3GWRA 4G1MB 4N6TA 3S67A 3OWYA 1IVXA 2XR8B 1GD3A 4LMIA 2KXGA 3RDEA 1Z1SA 3LTCA 1GY5A 3OWSA 4JF8A 5AIHA 1US1A 3EHCA 1FGTA 3EX9A 4HBRA 3NBBA 4K1UA 2D42A 1S723 3I0YA 3DXOA 3UJMA 2C10A 3S27A 3G0KA 5AEWB 3X3YA 2RCDA 2CFKA 3PGBA 1NJI4 4N6NB 3EJVA 1K9M4 1OF5B 2RGQA 2RSXA 4L7KA 2GXFA 2Z76A 5FGOA 3Q90A 1K28A 3ECFA 3SEDA 4WYKB 1Y4KA 1STDA 2YFJB 5DREA 1OCVA 3IPTA 4Q53A 1AVKA 1A2KA 3U1WA 3NBJA 4R9KA 1IVWA 4BTYA 3S29A 2CH9A 5LC6A 2E2VA 4BTXA 2W2CA 3EN1B 1QALA 1MOLA 1SIHA 5JPPA 5ELJA 4HZ9B 5AYRB 1N9EA 3F8XA 4HJLB 4OK0A 1A67A 2RFRA 1U8CB 2YFIB 3EN8A 1O7PB 5IW9A 3E99A 1M1XB 3HK4A 3CCM3 4HKVB 2IA7A 5EEOA 2GEXA 3F40A 3OX9A 2XRXB 3HIIA 3MPHA 2FNQA 4EV5A 3SX1A 3CCU3 1VQO3 4R9LA 3PXMA 2FGTA 4XBYA 3WDGB 3B8LA 5BXQA 1UUVB 2LYXA 2STDA 1RRHA 3AMOA 3EBTA 3F8HA 3PYJA 5AIGA 2BNGA 4LZIA 1KQS2 2PZVA 3CCJ3 4K61A 1YIT3 5G2GA 1NO3A 1Q40B 1VQ83 1N8R4 3FG4A 1UI8A 4EC6A 1JN5B 3G713 4PEJA 1WTHA 1M9GA 2KCDA 1Q814 2P0MA 2CHCA 5CF2A 1D6YA 2CWUA 3DY5A 3LT9A 1SIIA 2V1LA 2MC8A 2Y74A 2XF3A 3GZBA 2Z7AA 1W6GA 3K63A 2BMOB 4XM4A 3VF1A 1F8NA 3X40A 3CNMA 3DUKA 1LNHA 2SBLA 3LZAA 1O7WB 3NXJA 2BO9B 1W6CA 1GS3A 1NWWA 3CME3 4U13A 3V92A 1JNQA 4X2OA 4FMCA 3JUMA 4HM3B 3F9SA 1IT7A 4N6MA 1ASKA 3WA3A 3DGNA 1SPUA 4RBNA 5EQLA 1YJN3 1O7MB 3CCL3 4LSOA 4R80A 1FGOA 5IG5A 1ZX2A 1SQWA 1IQYA 3WOEB 3S5CA 3CCQ3 1JB5A 1S5AA 5D82A 2YFLB 3JUNA 3CPW2 1VZZA 3NV0B 5ELUA 2B24B 1QVF2 3I553 5JPUA 3BLZA 3SVAA 2Y73A 2W9QA 5IEPA 2XGLA 2GEYA 1NDOB 1L5GB 1UUWB 2CWTA 3UL5A 3KSED 2CK3H 3K5TA 1FGRA 3FH1A 1IU7A 1PFPA 3HZPA 3T8NA 4HYZA 3CCV3 4XDVA 3BNBA 3PCRA 2Z77A 3FG1A 4N6LA 5IG3A 3EBYA 7STDA 4O8SA 2HMJB 1K41A 3FSDA 4HM2B 1RRLA 3CU3A 3H3HA 4NREA 1IV7A 1WMPA 3IJEB 4FMAA 2O9UX 1PU4A 4MMZB 4H3UA 4R1KA 3NHXA 1V74A 5AIIA 2CC3A 3LMLA 2I9WA 2OQEC 1OHSA 1YJW3 3BNDA 1EA2A 1T5YA 3BNEA 1E3VA 1CYVA 3DGLA 3JUOA 4RNYA 2BMRB 3RGAA 3X42A 3X3ZA 1R4CA 3B4OA 3KKGA 1FUWA 3ALAA 1A2VA 3CCR3 1VQ53 5D83A 4BTWA 3WODG 1HKXA 3MWZA 3GZRA 3OV4A 1MNLA 3DMCA 5KP4A 4O02B 1ULIB 2OCTA 1DVCA 2W56B 3NX0A 1A90A 3GRDA 1OHPA 4FCMA 1STFI 2CG0A 2O3OA 1WMNA 1GYBA 2WGOA 4L8OA 3KZTA 1VQK3 3G16A 1VQN3 4EV2A 2LQVA 1DYUA 1GD4A 4I4KA 2BT3A 4WFOA 1FGMA 5TGNA 2CKFB 1QJGA 3MG2A 3LT8A 4HM8B 3MG1A 4AKYA 4J9AA 3PS8A 3EF8A 2L4VA 2F98A 2E2UA 3O8YA 1OGZA 1NB5I 1D6ZA 3X3XA 4OUQA 3OXAA 1IV9A 4KFDA 1W5ZA 5I97A 4MJDA 1QMAA 1RN7A 2CW9A 2IUJA 1Q42A 1DVDA 1TU5A 2W04A 3LH4A 2XFTA 4GL6A 3FZWA 3FCSB 4STDA 5CK6A 1W7CA 5FW5A 3FG3A 2CFWA 2F86B 3L0RA 3CMA3 2CIUA 1RKYA 1OF5A 3S28A 3Q2PA 3D9RA 1ULJB 1M1K4 1W2ZA 1AR0A 3K9MC 4O3VA 4WYKA 2XSHB 1QAKA 1VQP3 5KP1A 1YVBI 2PNCA 2HMLB 4TX4A 5AI1A 1N9JA 2P09A 2QA43 4CDLA 2JDIH 2CG1A 1E3RA 2FXTA 5IEOA 4ZM8A 1WMOA 1YIJ3 1GY7A 3UNLA 1W2B2 1KD14 1VQ93 4OVMA 1Q824 3K7CA 4L8PA 2B1XB 3KN4A 1Q864 2XSOB 4CCVA 4XBTA 1HU9A 3DGOA 3V98A 4XB5A 5IG0A 1RJOA 5STDA 3PZWA 5LC7A 3FF2A 1TIJA 4WHAA 2P38A 4N6V0 4LEHA 4IT7A 1QVG2 4X2HA 4EXRA 1K734 2HMMB 4EBGA 1AVLA 1O7NB 1SJWA 4H61A 2XEPA 4N6OB 3ROBA 5A0OB 5D81A 1EKMA 2W9PA 1VQM3 3F7SA 1Q40A 2Z6BA 3V99A 4KVHA 5KP3A 1KSIA 3SXXA 2WOHA 2KRTA 1N5PA 4R4KA 3VSYA 4AKZA 3HIGA 1JN5A 4HVNA 2OTJ3 3OWUA 3LTBA 4MEIA 1W4NA 3IMAB 2IUKA 1JV2B 1LXEA 3A76A 4HM0B 3CCE3 1JKGB 1UW1A 2XFSA 4HM5B 1WNHA 1E97A 3KIIA 3PCSA 1OPYA 2Q07A 4J8TA 3N8BA 1OGXA 3N54B 3N9HA 3UB1A 2GBXB 2WOFA 1W6YA 3BNCA 1W01A 2CFDA 3CC73 1CYUA 1TFKA 4FCJA 1O7HB 2OTL3 1Q7Y4 3EB8A 1OACA 4FR9A 2GU3A 5EVHA 3T0UA 1JRQA 2K0MA 3DGMA 3NBRA 3WOFB 3B4PA 5BVBA 4HM1B 3G4S3 2OQEA 3LYGA 4HM6B 3STDA 4HM7B 3KFQC 4QWTA 1ZO2A 1IDPA 1O7GB 3AMOB 3FF0A 3LTAA 4HZBB 3GAXA 1IT8A 3LOYA 2ZL8A 4NHFA 4KZ1A 3G6E3 3EC9A 3EE1A 2QIYA 4JRFA 2GU1A 1N5HA 4MMXB 2W03A 3NM7A 4EYCA 5IERA 1U5OA 5DRVA 4WP5A 5HGRA 2W0QA 3NV0A 3FKAA 1YI23 1JB4A 3VGNA 5CLKA 5IENA 2OWPA 6STDA 2OOVC 2M7OA 3SLUA 3G8ZA 4AEQA 2HMOB 2OOVA 1JKGA 1ROVA 4XDWA 3WA2X 2QEX3 1TFOA 2HMKB 4FCZA 4KFEA 1VQL3 3JUQA 1D6UA 2JQ5A 3F7XA 4FMDA 2W6JH 2WO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZM8 A;  1KWI A;  5ELU A;  4CCV A;  4N6N B;  3SVA A;  2W9Q A;  5LC7 A;  1TIJ A;  3QRD A;  4N6V 0;  4IT7 A;  3UL5 A;  3KSE D;  1FA3 A;  1PFP A;  2CH9 A;  5LC6 A;  4N6O B;  5A0O B;  1NB3 I;  4N6L A;  2W9P A;  1MOL A;  1IV7 A;  5ELJ A;  2O9U X;  1A67 A;  1N5P A;  1G96 A;  4N6U A;  3IMA B;  1CYV A;  1LXE A;  1R4C A;  1FUW A;  3PXM A;  1WNH A;  3PYJ A;  3MWZ A;  4LZI A;  1MNL A;  2OCT A;  1DVC A;  3NX0 A;  1A90 A;  1CYU A;  1STF I;  1GD4 A;  1M9G A;  1ROA A;  3PS8 A;  3KFQ C;  1NB5 I;  1IV9 A;  3GAX A;  1RN7 A;  1CEW I;  1EQK A;  4EYC A;  1DVD A;  1N5H A;  2BO9 B;  3LH4 A;  3UL6 A;  4N6T A;  3S67 A;  3L0R A;  3Q2P A;  4N6M A;  1GD3 A;  2KXG A;  3K9M C;  5EQL A;  1YVB I;  4TX4 A;  1N9J A; 
#chains in the Genus database with same CATH topology
 4I5Q A;  1BRJ A;  4BIR A;  1MGR A;  1T2I A;  1YHQ 3;  1B20 A;  1DMN A;  1LQG C;  7RNT A;  1LQM B;  3DZL A;  1VQ6 3;  2C11 A;  3RGR A;  1IK3 A;  1KWI A;  5G1L A;  2R4I A;  1QAF A;  2SAR A;  2F99 A;  1IVU A;  1I8V A;  1KC8 4;  4LGQ A;  2XGN A;  1FGQ A;  5AEU B;  4ORL A;  5AIF A;  1DE3 A;  3JVC A;  1DMM A;  2ML5 A;  3SOA A;  2WGQ A;  3SOY A;  1K8A 4;  4HM4 B;  5CF1 A;  3QRD A;  1BU4 A;  2ZDJ A;  2ML6 A;  2CFG A;  1VQ4 3;  1TP6 A;  1OUN A;  2K3D A;  1EG9 B;  1FA3 A;  2D1W A;  4K90 B;  2H0G A;  3JUP A;  8CHO A;  2A15 A;  5IG4 A;  3QK9 A;  1IQ8 A;  3DM8 A;  1NB3 I;  1UI7 A;  3AGO A;  3LTD A;  3NQY A;  4FMB A;  2W56 A;  1YJ9 3;  4MMY B;  3NM2 A;  1DMQ A;  1MWU A;  3M8C A;  4DKI A;  2CFL A;  2CWV A;  4XBX A;  2BMQ B;  1NU3 A;  1WQL B;  3KE7 A;  5M18 A;  2IYJ A;  3D4A A;  1G96 A;  1GY6 A;  2K54 A;  3FGY A;  2UX0 A;  4CJN A;  5JBS A;  2INX A;  2P05 A;  4IPB A;  4N6U A;  3K0Z A;  1RCL A;  3D3L A;  3KSP A;  3MG3 A;  1RNT A;  2HMN B;  1T3B A;  1RCK A;  3TDG A;  3X41 A;  2R41 A;  4NPB A;  2E2T A;  1GOY A;  1A2P A;  3CCS 3;  3ER7 A;  1M90 4;  1IVV A;  5CXO A;  5BU4 A;  2YX9 A;  3FLJ A;  3WMD A;  1TUH A;  3CD6 3;  3BB9 A;  1BUJ A;  4RZM A;  3GZY B;  1J2B A;  3B7C A;  3MYT A;  2QGU A;  3AHW A;  4RNZ A;  1OHO A;  3CC4 3;  2IMJ A;  1BUQ A;  2IY2 A;  4KT3 B;  1JJ2 2;  1UGI A;  4WWU C;  3CPO A;  1RGH A;  3HI7 A;  2KF4 A;  1ROA A;  3LXU X;  1LRA A;  4KFF A;  1FUT A;  3MHE A;  3Q1C A;  1LOX A;  3MSO A;  4GB5 A;  3J7Y d;  3I56 3;  3CC2 3;  1CQS A;  2P0X A;  3EQQ B;  3F14 A;  3HX8 A;  3CXC 2;  1LVN A;  3NUV A;  4N3V A;  4O2H A;  3T8U A;  1JBR A;  2BHM A;  4K1V A;  5AYS C;  1GMP A;  1OH0 A;  1W02 A;  1N8Q A;  1YGE A;  1IQX A;  1ISK A;  3H51 A;  5IF6 A;  3GZX B;  1VQ7 3;  1AV4 A;  1BSC A;  1W00 A;  4IIA A;  1CEW I;  1EQK A;  3CNX A;  3MKI A;  1I3I A;  3NQZ A;  1C7H A;  2XH9 A;  2MF7 A;  3UL6 A;  5M19 A;  1JB2 A;  3A5E A;  2GBW B;  3U97 A;  4LYL B;  3GWR A;  3OW2 2;  4G1M B;  4N6T A;  1Q7H A;  3D5I A;  1MWR A;  3S67 A;  3OWY A;  1BOX A;  1IVX A;  2XR8 B;  1GD3 A;  4LMI A;  2KXG A;  1FUS A;  3RDE A;  1Z1S A;  1JZD A;  2KAA A;  3LTC A;  4J5K A;  1GY5 A;  1BIR A;  3OWS A;  4JF8 A;  2UUG C;  1HYF A;  5AIH A;  1B3S A;  1US1 A;  3EHC A;  1FGT A;  3EX9 A;  3AGN A;  3NBB A;  4HBR A;  4K1U A;  1RN4 A;  1BNG A;  2D42 A;  6RNT A;  1S72 3;  3I0Y A;  3DXO A;  3UJM A;  2C10 A;  3S27 A;  3G0K A;  5AEW B;  1GMQ A;  1IYY A;  1RGF A;  3X3Y A;  2RCD A;  1UCI A;  2CFK A;  3PGB A;  1NJI 4;  4N6N B;  3EJV A;  1K9M 4;  1BNF A;  1OF5 B;  2ZHX B;  2RGQ A;  2RSX A;  4L7K A;  2GXF A;  2Z76 A;  5FGO A;  3Q90 A;  1K28 A;  3ECF A;  3SED A;  1YGW A;  1Y4K A;  4WYK B;  4BL3 A;  1STD A;  2YFJ B;  5DRE A;  1OCV A;  3IPT A;  4Q53 A;  1FZU A;  1AVK A;  1A2K A;  3U1W A;  3NBJ A;  4R9K A;  1IVW A;  1B2Z A;  4BTY A;  3S29 A;  2CH9 A;  5LC6 A;  2E2V A;  4BTX A;  1X1U A;  1NNV A;  3RNT A;  2W2C A;  3EN1 B;  2C4B A;  1QAL A;  1MOL A;  7GSP A;  1SIH A;  6GSP A;  5JPP A;  5ELJ A;  4HZ9 B;  5AYR B;  1N9E A;  3F8X A;  4HJL B;  4OK0 A;  1A67 A;  1MWS A;  8RNT A;  2RFR A;  1U8C B;  2YFI B;  3EN8 A;  1O7P B;  5IW9 A;  3E99 A;  1M1X B;  3HK4 A;  3ZFZ A;  4HKV B;  3CCM 3;  2IA7 A;  5EEO A;  2GEX A;  3F40 A;  3OX9 A;  2XRX B;  3HII A;  3MPH A;  2FNQ A;  4EV5 A;  3SX1 A;  3CCU 3;  1VQO 3;  4R9L A;  3PXM A;  2FGT A;  4XBY A;  3WDG B;  1UGH I;  3B8L A;  2H0H A;  5BXQ A;  1UUV B;  2LYX A;  2STD A;  1RRH A;  3AMO A;  3EBT A;  2KF6 A;  3F8H A;  3PYJ A;  2BNG A;  4LZI A;  5AIG A;  2PZV A;  3CCJ 3;  4K61 A;  1YIT 3;  5G2G A;  1NO3 A;  1Q40 B;  1LOW A;  1VQ8 3;  1N8R 4;  1BRH A;  1UI8 A;  3FG4 A;  4EC6 A;  1RGC A;  1JN5 B;  3G71 3;  1YNV X;  4PEJ A;  1WTH A;  1M9G A;  2UGI A;  2KCD A;  1Q81 4;  2P0M A;  3WHO A;  2CHC A;  5CF2 A;  1D6Y A;  9RNT A;  2CWU A;  3DY5 A;  1UUG B;  3LT9 A;  1SII A;  1UCL A;  2V1L A;  2MC8 A;  2Y74 A;  2XF3 A;  3GZB A;  2Z7A A;  1W6G A;  3K63 A;  2BMO B;  4XM4 A;  3VF1 A;  1F8N A;  1ZGX A;  3X40 A;  3CNM A;  3DUK A;  1LNH A;  2SBL A;  3LZA A;  4ILF A;  1O7W B;  3NXJ A;  2BO9 B;  1W6C A;  2ZA4 A;  1UCK A;  1B2S A;  1ZS7 A;  1GS3 A;  1NWW A;  3CME 3;  4U13 A;  3V92 A;  1HZ1 A;  1JNQ A;  4X2O A;  4FMC A;  3JUM A;  1R4Y A;  3F9S A;  1IT7 A;  4HM3 B;  4GHO A;  1ASK A;  4N6M A;  3WA3 A;  1X1Y A;  1BNR A;  3DGN A;  1SPU A;  1Q9E A;  4RBN A;  5EQL A;  1DET A;  1TTO A;  1TRQ A;  1YJN 3;  1O7M B;  3CCL 3;  4LSO A;  4R80 A;  1FGO A;  2BIR A;  1ZX2 A;  1SQW A;  5HOH A;  1I70 A;  1IQY A;  5IG5 A;  3WOE B;  3S5C A;  3CCQ 3;  1RGK A;  1GSP A;  1JB5 A;  1S5A A;  5D82 A;  2YFL B;  3JUN A;  3CPW 2;  1VZZ A;  3NV0 B;  1I2G A;  5ELU A;  2B24 B;  1BRK A;  1QVF 2;  4EW5 A;  3I55 3;  5JPU A;  1BNE A;  3BLZ A;  3SVA A;  2Y73 A;  5RNT A;  1B2U A;  2W9Q A;  5IEP A;  2XGL A;  2GEY A;  1RTU A;  1NDO B;  1L5G B;  1UUW B;  2CWT A;  3UL5 A;  2AAD A;  3KSE D;  2CK3 H;  1LOV A;  1FGR A;  3K5T A;  3FH1 A;  1IU7 A;  1PFP A;  1UDI I;  3HZP A;  3T8N A;  1BSD A;  4HYZ A;  1RGG A;  3CCV 3;  1YVS A;  3BNB A;  4XDV A;  4RNT A;  3D79 A;  3PCR A;  2Z77 A;  1I0V A;  1JZO A;  1BAN A;  3FG1 A;  4N6L A;  5IG3 A;  2F5M A;  3EBY A;  4O8S A;  7STD A;  1V58 A;  2HMJ B;  1K41 A;  3FSD A;  4HM2 B;  1RRL A;  3CU3 A;  3H3H A;  4NRE A;  1IV7 A;  1WMP A;  3IJE B;  4FMA A;  2O9U X;  2W6J H;  1PU4 A;  2KF3 A;  4H3U A;  4MMZ B;  4R1K A;  1UCJ A;  5M1A A;  3NHX A;  1V74 A;  5AII A;  2CC3 A;  3LML A;  2I9W A;  2OQE C;  1OHS A;  1YJW 3;  3BND A;  1BNS A;  1EA2 A;  1T5Y A;  3BNE A;  1E3V A;  1CYV A;  3DGL A;  3JUO A;  4RNY A;  2BMR B;  3RGA A;  3X42 A;  3X3Z A;  4HAA A;  1R4C A;  3B4O A;  3KKG A;  1FUW A;  3ALA A;  1A2V A;  3CCR 3;  1TJD A;  5D83 A;  1VQ5 3;  4BTW A;  3GSP A;  3ZG0 A;  3WOD G;  1HKX A;  3MWZ A;  3GZR A;  3OV4 A;  1MNL A;  3DMC A;  5KP4 A;  4O02 B;  2HOH A;  1ULI B;  2OCT A;  1DVC A;  2W56 B;  3NX0 A;  1EEJ A;  1A90 A;  3GRD A;  1OHP A;  4FCM A;  1STF I;  2CG0 A;  2O3O A;  1WMN A;  1GYB A;  2WGO A;  4L8O A;  3KZT A;  1BAO A;  3G16 A;  1VQK 3;  1RGL A;  3URP A;  1VQN 3;  4EV2 A;  2LQV A;  1DYU A;  1GD4 A;  4I4K A;  2BT3 A;  4WFO A;  1FGM A;  5TGN A;  1RDS A;  1QJG A;  1BVI A;  2CKF B;  1BSE A;  3MG2 A;  3LT8 A;  4HM8 B;  3MG1 A;  4AKY A;  4J9A A;  3PS8 A;  1BRN L;  3EF8 A;  2L4V A;  2F98 A;  4BL2 A;  2E2U A;  3O8Y A;  1OGZ A;  1BRI A;  1GOV A;  3ZG5 A;  1NB5 I;  1D6Z A;  3X3X A;  4OUQ A;  3OXA A;  1IV9 A;  4KFD A;  1W5Z A;  5I97 A;  2H0I A;  4MJD A;  2L1S A;  2RNT A;  1PYL A;  3SYU A;  1QMA A;  1RN7 A;  1KQS 2;  2CW9 A;  1BRG A;  2IUJ A;  1Q42 A;  1DVD A;  1TRP A;  1TU5 A;  2W04 A;  3LH4 A;  1G0T A;  2XFT A;  3FZW A;  3FCS B;  4GL6 A;  4STD A;  5CK6 A;  1W7C A;  3DH2 A;  5FW5 A;  1FYS A;  3BU4 A;  1AQZ A;  3FG3 A;  2CFW A;  2F86 B;  3L0R A;  3CMA 3;  2CIU A;  1RKY A;  1OF5 A;  3S28 A;  1I0X A;  1V57 A;  1I3F A;  3Q2P A;  3D9R A;  1ULJ B;  2KF5 A;  1M1K 4;  1W2Z A;  1AR0 A;  3K9M C;  4O3V A;  4WYK A;  2XSH B;  1QAK A;  1VQP 3;  5KP1 A;  1YVB I;  2PNC A;  2HML B;  1EUI C;  4TX4 A;  1N9J A;  5AI1 A;  2P09 A;  2QA4 3;  2J8X B;  1B27 A;  4CDL A;  2JDI H;  2CG1 A;  5BIR A;  1E3R A;  2FXT A;  5IEO A;  4ZM8 A;  1WMO A;  1YIJ 3;  4FMD A;  1GY7 A;  3UNL A;  1W2B 2;  1KD1 4;  1VQ9 3;  2BU4 A;  1BSA A;  4OVM A;  1Q82 4;  3K7C A;  4L8P A;  2B1X B;  3KN4 A;  1Q86 4;  1C54 A;  1JBT A;  2XSO B;  2AAE A;  4CCV A;  4XBT A;  1HU9 A;  3DGO A;  3V98 A;  4XB5 A;  5IG0 A;  1RJO A;  5STD A;  3PZW A;  5LC7 A;  3FF2 A;  1TIJ A;  4WHA A;  2P38 A;  1FW7 A;  4N6V 0;  4LEH A;  4IT7 A;  1QVG 2;  4X2H A;  4EXR A;  1K73 4;  2HMM B;  4EBG A;  3AHS A;  2F56 A;  1VQQ A;  1AVL A;  1O7N B;  1B2M A;  1SJW A;  4H61 A;  1T2H A;  2XEP A;  4N6O B;  3ROB A;  2F4Y A;  5A0O B;  5D81 A;  1EKM A;  2W9P A;  1VQM 3;  3F7S A;  1Q40 A;  1BNI A;  3DGY A;  1RHL A;  5GSP A;  2Z6B A;  3V99 A;  4KVH A;  5KP3 A;  1KSI A;  3SXX A;  2WOH A;  2KRT A;  1X1W A;  1N5P A;  4R4K A;  4J5G A;  3VSY A;  4AKZ A;  3HIG A;  1JN5 A;  4HVN A;  2OTJ 3;  2GSP A;  3OWU A;  1BRS A;  3LTB A;  4MEI A;  1W4N A;  3IMA B;  2IUK A;  1JV2 B;  1LXE A;  3A76 A;  4HM0 B;  3CCE 3;  1JKG B;  1UW1 A;  2XFS A;  4HM5 B;  1CH0 A;  1RNB A;  1JBS A;  1WNH A;  1E97 A;  3KII A;  3PCS A;  1OPY A;  2Q07 A;  4J8T A;  1RGE A;  1MGW A;  3N8B A;  1RMS A;  1SAR A;  4HOH A;  1B21 A;  1GMR A;  1OGX A;  3N54 B;  3N9H A;  3UB1 A;  2GBX B;  2WOF A;  1W6Y A;  3BNC A;  1W01 A;  2CFD A;  3CC7 3;  1CYU A;  1TFK A;  4FCJ A;  1O7H B;  4CPK A;  2OTL 3;  1Q7Y 4;  3EB8 A;  1OAC A;  1LOY A;  1X1X A;  4FR9 A;  2GU3 A;  5G1K A;  5EVH A;  3T0U A;  1JRQ A;  1RSN A;  1RN1 A;  2K0M A;  2F5W A;  3DGM A;  3NBR A;  3WOF B;  3B4P A;  5BVB A;  4HM1 B;  3G4S 3;  3D5G A;  3LYG A;  4GSP A;  2OQE A;  4HM6 B;  3STD A;  4HM7 B;  1I2E A;  2CX0 A;  3KFQ C;  1ZO2 A;  4QWT A;  3WR2 A;  1IDP A;  1O7G B;  3AMO B;  3FF0 A;  3LTA A;  1GOU A;  4HZB B;  3GAX A;  1IT8 A;  3LOY A;  2ZL8 A;  1RGA A;  4NHF A;  4KZ1 A;  1B2X A;  3G6E 3;  3EC9 A;  3EE1 A;  2QIY A;  4JRF A;  2GU1 A;  1N5H A;  4MMX B;  2W03 A;  3NM7 A;  4EYC A;  5IER A;  4BU4 A;  1U5O A;  5DRV A;  1I2F A;  4WP5 A;  5HGR A;  3Q3F A;  1MWT A;  2W0Q A;  1AY7 A;  1BNJ A;  3FKA A;  1BSB A;  3NV0 A;  1YI2 3;  1JB4 A;  3VGN A;  5CLK A;  3HOH A;  5IEN A;  3BIR A;  1G02 A;  2OWP A;  6STD A;  2OOV C;  2M7O A;  3SLU A;  2RBI A;  3G8Z A;  4AEQ A;  2HMO B;  2OOV A;  1JKG A;  1ROV A;  4XDW A;  3WA2 X;  2QEX 3;  1TFO A;  2HMK B;  4FCZ A;  4KFE A;  1LNI A;  1VQL 3;  3JUQ A;  1D6U A;  3KCH A;  2JQ5 A;  3F7X A;  1PY3 A;  1RLS A;  2CX1 A;  2WO0 A;  1BGS A; 
#chains in the Genus database with same CATH homology
 1YHQ 3;  1DMN A;  3DZL A;  1VQ6 3;  2C11 A;  3RGR A;  1IK3 A;  1KWI A;  2R4I A;  1QAF A;  2F99 A;  1IVU A;  1KC8 4;  4LGQ A;  2XGN A;  1FGQ A;  5AEU B;  4ORL A;  5AIF A;  3JVC A;  1DMM A;  2ML5 A;  3SOA A;  2WGQ A;  3SOY A;  1K8A 4;  4HM4 B;  5CF1 A;  3QRD A;  2ZDJ A;  2ML6 A;  2CFG A;  1VQ4 3;  1TP6 A;  1OUN A;  1EG9 B;  1FA3 A;  2D1W A;  4K90 B;  3JUP A;  8CHO A;  2A15 A;  5IG4 A;  3QK9 A;  1IQ8 A;  3DM8 A;  1NB3 I;  1UI7 A;  3LTD A;  4FMB A;  3NQY A;  2W56 A;  1YJ9 3;  4MMY B;  3NM2 A;  1DMQ A;  3M8C A;  2CFL A;  2CWV A;  4XBX A;  2BMQ B;  1NU3 A;  1WQL B;  3KE7 A;  1G96 A;  1GY6 A;  2K54 A;  3FGY A;  2UX0 A;  5JBS A;  2INX A;  2P05 A;  4IPB A;  4N6U A;  3K0Z A;  3D3L A;  3KSP A;  3MG3 A;  2HMN B;  3TDG A;  3X41 A;  2E2T A;  3CCS 3;  3ER7 A;  1M90 4;  1IVV A;  5CXO A;  2YX9 A;  3FLJ A;  3WMD A;  1TUH A;  3CD6 3;  3BB9 A;  4RZM A;  3GZY B;  1J2B A;  3B7C A;  3MYT A;  2QGU A;  4RNZ A;  1OHO A;  3CC4 3;  2IMJ A;  1BUQ A;  1JJ2 2;  4WWU C;  3CPO A;  3HI7 A;  1ROA A;  3LXU X;  4KFF A;  3MHE A;  3Q1C A;  1LOX A;  3MSO A;  4GB5 A;  3J7Y d;  3I56 3;  3CC2 3;  1CQS A;  2P0X A;  3EQQ B;  3F14 A;  3HX8 A;  3CXC 2;  1LVN A;  3NUV A;  4N3V A;  4O2H A;  3T8U A;  2BHM A;  4K1V A;  5AYS C;  1OH0 A;  1W02 A;  1N8Q A;  1YGE A;  1IQX A;  1ISK A;  3H51 A;  5IF6 A;  3GZX B;  1VQ7 3;  1AV4 A;  1W00 A;  4IIA A;  1CEW I;  1EQK A;  3CNX A;  3MKI A;  3NQZ A;  1C7H A;  2XH9 A;  2MF7 A;  3UL6 A;  1JB2 A;  2GBW B;  3U97 A;  3OW2 2;  3GWR A;  4G1M B;  4N6T A;  3S67 A;  3OWY A;  1IVX A;  2XR8 B;  1GD3 A;  4LMI A;  2KXG A;  3RDE A;  1Z1S A;  3LTC A;  1GY5 A;  3OWS A;  4JF8 A;  5AIH A;  1US1 A;  3EHC A;  1FGT A;  3EX9 A;  4HBR A;  3NBB A;  4K1U A;  2D42 A;  1S72 3;  3I0Y A;  3DXO A;  3UJM A;  2C10 A;  3S27 A;  3G0K A;  5AEW B;  3X3Y A;  2RCD A;  2CFK A;  3PGB A;  1NJI 4;  4N6N B;  3EJV A;  1K9M 4;  1OF5 B;  2RGQ A;  2RSX A;  4L7K A;  2GXF A;  2Z76 A;  5FGO A;  3Q90 A;  1K28 A;  3ECF A;  3SED A;  4WYK B;  1Y4K A;  1STD A;  2YFJ B;  5DRE A;  1OCV A;  3IPT A;  4Q53 A;  1AVK A;  1A2K A;  3U1W A;  3NBJ A;  4R9K A;  1IVW A;  4BTY A;  3S29 A;  2CH9 A;  5LC6 A;  2E2V A;  4BTX A;  2W2C A;  3EN1 B;  1QAL A;  1MOL A;  1SIH A;  5JPP A;  5ELJ A;  4HZ9 B;  5AYR B;  1N9E A;  3F8X A;  4HJL B;  4OK0 A;  1A67 A;  2RFR A;  1U8C B;  2YFI B;  3EN8 A;  1O7P B;  5IW9 A;  3E99 A;  1M1X B;  3HK4 A;  3CCM 3;  4HKV B;  2IA7 A;  5EEO A;  2GEX A;  3F40 A;  3OX9 A;  2XRX B;  3HII A;  3MPH A;  2FNQ A;  4EV5 A;  3SX1 A;  3CCU 3;  1VQO 3;  4R9L A;  3PXM A;  2FGT A;  4XBY A;  3WDG B;  3B8L A;  5BXQ A;  1UUV B;  2LYX A;  2STD A;  1RRH A;  3AMO A;  3EBT A;  3F8H A;  3PYJ A;  5AIG A;  2BNG A;  4LZI A;  1KQS 2;  2PZV A;  3CCJ 3;  4K61 A;  1YIT 3;  5G2G A;  1NO3 A;  1Q40 B;  1VQ8 3;  1N8R 4;  3FG4 A;  1UI8 A;  4EC6 A;  1JN5 B;  3G71 3;  4PEJ A;  1WTH A;  1M9G A;  2KCD A;  1Q81 4;  2P0M A;  2CHC A;  5CF2 A;  1D6Y A;  2CWU A;  3DY5 A;  3LT9 A;  1SII A;  2V1L A;  2MC8 A;  2Y74 A;  2XF3 A;  3GZB A;  2Z7A A;  1W6G A;  3K63 A;  2BMO B;  4XM4 A;  3VF1 A;  1F8N A;  3X40 A;  3CNM A;  3DUK A;  1LNH A;  2SBL A;  3LZA A;  1O7W B;  3NXJ A;  2BO9 B;  1W6C A;  1GS3 A;  1NWW A;  3CME 3;  4U13 A;  3V92 A;  1JNQ A;  4X2O A;  4FMC A;  3JUM A;  4HM3 B;  3F9S A;  1IT7 A;  4N6M A;  1ASK A;  3WA3 A;  3DGN A;  1SPU A;  4RBN A;  5EQL A;  1YJN 3;  1O7M B;  3CCL 3;  4LSO A;  4R80 A;  1FGO A;  5IG5 A;  1ZX2 A;  1SQW A;  1IQY A;  3WOE B;  3S5C A;  3CCQ 3;  1JB5 A;  1S5A A;  5D82 A;  2YFL B;  3JUN A;  3CPW 2;  1VZZ A;  3NV0 B;  5ELU A;  2B24 B;  1QVF 2;  3I55 3;  5JPU A;  3BLZ A;  3SVA A;  2Y73 A;  2W9Q A;  5IEP A;  2XGL A;  2GEY A;  1NDO B;  1L5G B;  1UUW B;  2CWT A;  3UL5 A;  3KSE D;  2CK3 H;  3K5T A;  1FGR A;  3FH1 A;  1IU7 A;  1PFP A;  3HZP A;  3T8N A;  4HYZ A;  3CCV 3;  4XDV A;  3BNB A;  3PCR A;  2Z77 A;  3FG1 A;  4N6L A;  5IG3 A;  3EBY A;  7STD A;  4O8S A;  2HMJ B;  1K41 A;  3FSD A;  4HM2 B;  1RRL A;  3CU3 A;  3H3H A;  4NRE A;  1IV7 A;  1WMP A;  3IJE B;  4FMA A;  2O9U X;  1PU4 A;  4MMZ B;  4H3U A;  4R1K A;  3NHX A;  1V74 A;  5AII A;  2CC3 A;  3LML A;  2I9W A;  2OQE C;  1OHS A;  1YJW 3;  3BND A;  1EA2 A;  1T5Y A;  3BNE A;  1E3V A;  1CYV A;  3DGL A;  3JUO A;  4RNY A;  2BMR B;  3RGA A;  3X42 A;  3X3Z A;  1R4C A;  3B4O A;  3KKG A;  1FUW A;  3ALA A;  1A2V A;  3CCR 3;  1VQ5 3;  5D83 A;  4BTW A;  3WOD G;  1HKX A;  3MWZ A;  3GZR A;  3OV4 A;  1MNL A;  3DMC A;  5KP4 A;  4O02 B;  1ULI B;  2OCT A;  1DVC A;  2W56 B;  3NX0 A;  1A90 A;  3GRD A;  1OHP A;  4FCM A;  1STF I;  2CG0 A;  2O3O A;  1WMN A;  1GYB A;  2WGO A;  4L8O A;  3KZT A;  1VQK 3;  3G16 A;  1VQN 3;  4EV2 A;  2LQV A;  1DYU A;  1GD4 A;  4I4K A;  2BT3 A;  4WFO A;  1FGM A;  5TGN A;  2CKF B;  1QJG A;  3MG2 A;  3LT8 A;  4HM8 B;  3MG1 A;  4AKY A;  4J9A A;  3PS8 A;  3EF8 A;  2L4V A;  2F98 A;  2E2U A;  3O8Y A;  1OGZ A;  1NB5 I;  1D6Z A;  3X3X A;  4OUQ A;  3OXA A;  1IV9 A;  4KFD A;  1W5Z A;  5I97 A;  4MJD A;  1QMA A;  1RN7 A;  2CW9 A;  2IUJ A;  1Q42 A;  1DVD A;  1TU5 A;  2W04 A;  3LH4 A;  2XFT A;  4GL6 A;  3FZW A;  3FCS B;  4STD A;  5CK6 A;  1W7C A;  5FW5 A;  3FG3 A;  2CFW A;  2F86 B;  3L0R A;  3CMA 3;  2CIU A;  1RKY A;  1OF5 A;  3S28 A;  3Q2P A;  3D9R A;  1ULJ B;  1M1K 4;  1W2Z A;  1AR0 A;  3K9M C;  4O3V A;  4WYK A;  2XSH B;  1QAK A;  1VQP 3;  5KP1 A;  1YVB I;  2PNC A;  2HML B;  4TX4 A;  5AI1 A;  1N9J A;  2P09 A;  2QA4 3;  4CDL A;  2JDI H;  2CG1 A;  1E3R A;  2FXT A;  5IEO A;  4ZM8 A;  1WMO A;  1YIJ 3;  1GY7 A;  3UNL A;  1W2B 2;  1KD1 4;  1VQ9 3;  4OVM A;  1Q82 4;  3K7C A;  4L8P A;  2B1X B;  3KN4 A;  1Q86 4;  2XSO B;  4CCV A;  4XBT A;  1HU9 A;  3DGO A;  3V98 A;  4XB5 A;  5IG0 A;  1RJO A;  5STD A;  3PZW A;  5LC7 A;  3FF2 A;  1TIJ A;  4WHA A;  2P38 A;  4N6V 0;  4LEH A;  4IT7 A;  1QVG 2;  4X2H A;  4EXR A;  1K73 4;  2HMM B;  4EBG A;  1AVL A;  1O7N B;  1SJW A;  4H61 A;  2XEP A;  4N6O B;  3ROB A;  5A0O B;  5D81 A;  1EKM A;  2W9P A;  1VQM 3;  3F7S A;  1Q40 A;  2Z6B A;  3V99 A;  4KVH A;  5KP3 A;  1KSI A;  3SXX A;  2WOH A;  2KRT A;  1N5P A;  4R4K A;  3VSY A;  4AKZ A;  3HIG A;  1JN5 A;  4HVN A;  2OTJ 3;  3OWU A;  3LTB A;  4MEI A;  1W4N A;  3IMA B;  2IUK A;  1JV2 B;  1LXE A;  3A76 A;  4HM0 B;  3CCE 3;  1JKG B;  1UW1 A;  2XFS A;  4HM5 B;  1WNH A;  1E97 A;  3KII A;  3PCS A;  1OPY A;  2Q07 A;  4J8T A;  3N8B A;  1OGX A;  3N54 B;  3N9H A;  3UB1 A;  2GBX B;  2WOF A;  1W6Y A;  3BNC A;  1W01 A;  2CFD A;  3CC7 3;  1CYU A;  1TFK A;  4FCJ A;  1O7H B;  2OTL 3;  1Q7Y 4;  3EB8 A;  1OAC A;  4FR9 A;  2GU3 A;  5EVH A;  3T0U A;  1JRQ A;  2K0M A;  3DGM A;  3NBR A;  3WOF B;  3B4P A;  5BVB A;  4HM1 B;  3G4S 3;  2OQE A;  3LYG A;  4HM6 B;  3STD A;  4HM7 B;  3KFQ C;  4QWT A;  1ZO2 A;  1IDP A;  1O7G B;  3AMO B;  3FF0 A;  3LTA A;  4HZB B;  3GAX A;  1IT8 A;  3LOY A;  2ZL8 A;  4NHF A;  4KZ1 A;  3G6E 3;  3EC9 A;  3EE1 A;  2QIY A;  4JRF A;  2GU1 A;  1N5H A;  4MMX B;  2W03 A;  3NM7 A;  4EYC A;  5IER A;  1U5O A;  5DRV A;  4WP5 A;  5HGR A;  2W0Q A;  3NV0 A;  3FKA A;  1YI2 3;  1JB4 A;  3VGN A;  5CLK A;  5IEN A;  2OWP A;  6STD A;  2OOV C;  2M7O A;  3SLU A;  3G8Z A;  4AEQ A;  2HMO B;  2OOV A;  1JKG A;  1ROV A;  4XDW A;  3WA2 X;  2QEX 3;  1TFO A;  2HMK B;  4FCZ A;  4KFE A;  1VQL 3;  3JUQ A;  1D6U A;  2JQ5 A;  3F7X A;  4FMD A;  2W6J H;  2WO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...