1UUWB

Naphthalene 1,2-dioxygenase with nitric oxide bound in the active site.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuwB00
2HMNB 5AEUB 1O7HB 1OH0A 3H3HA 3OX9A 3A76A 1GY6A 1UUWB 1W02A 1JB5A 2GEXA 3KE7A 3KZTA 3DM8A 3GWRA 3G0KA 1O7WB 4K1UA 2IMJA 4XDVA 5JPUA 2BMQB 3Q90A 4U13A 1ASKA 3JUMA 2YFJB 1SJWA 3F7SA 1DMNA 3KSPA 5AIFA 5G2GA 3I0YA 3BLZA 3K7CA 1DMQA 1JKGA 2F86B 5FW5A 5TGNA 1NWWA 2HMMB 2Z76A 3BB9A 3FSDA 1OUNA 2Z7AA 4FCJA 3STDA 1EA2A 3F8HA 2BMRB 3E99A 3EBYA 4XBXA 4L8PA 5KP1A 3G16A 3K0ZA 1OCVA 3MG3A 3DZLA 3JUPA 4J9AA 2PZVA 1E97A 4HM2B 3EX9A 2QGUA 1WQLB 3S5CA 3MHEA 3OWSA 4XBTA 3MG1A 1A2KA 5IG4A 5CF2A 3EF8A 3ER7A 4HZBB 1OGXA 4X2OA 1E3VA 3GZXB 3VGNA 2GXFA 4L7KA 3F14A 2A15A 3JUNA 3FKAA 4XBYA 4PEJA 3MKIA 3GZBA 4RZMA 4HM5B 3GZYB 2GEYA 5AIGA 2YFLB 4HM3B 4OUQA 5KP3A 4WYKA 4OVMA 1TUHA 3UNLA 1GY7A 3RGAA 5AEWB 4MJDA 1OF5A 5DRVA 1ULJB 2GBXB 2BNGA 2QIYA 2OWPA 3UJMA 2BMOB 4HM1B 2HMLB 4XB5A 2STDA 3FLJA 5HGRA 3NBRA 3NHXA 2RCDA 4WWUC 2XR8B 2I9WA 1HKXA 1O7MB 2R4IA 5CK6A 5AIHA 1OHPA 1ISKA 2XSOB 5CXOA 1O7GB 1NU3A 1CQSA 3F9SA 6STDA 1BUQA 3MYTA 3EQQB 3HK4A 4XM4A 2GBWB 3CPOA 4HKVB 4R9KA 3WMDA 1JN5B 3EC9A 8CHOA 7STDA 2HMJB 1Q40B 2B1XB 4HM4B 1ZO2A 5BXQA 3NV0B 4I4KA 3EN8A 1OPYA 1W6YA 1GYBA 3EBTA 3FF2A 4N3VA 1DMMA 3VSYA 1GS3A 1QMAA 4L8OA 1O7PB 5STDA 1JB2A 3OWYA 5KP4A 3OV4A 5CF1A 3CNMA 3NUVA 2W2CA 4J8TA 3DMCA 3FZWA 5DREA 1TP6A 3B4PA 3MSOA 3T8NA 1W00A 3DUKA 2RGQA 5IG3A 3HZPA 1JN5A 3OXAA 4HM8B 5D82A 3NV0A 4STDA 5IERA 5BVBA 1O7NB 2UX0A 4ORLA 3F7XA 3LYGA 1EG9B 3B4OA 1OGZA 5AI1A 4HJLB 3FH1A 2HMKB 3JUOA 1ZX2A 2INXA 1GY5A 1K41A 1Q42A 2XRXB 2K54A 1STDA 1OHSA 3FF0A 4H3UA 1AR0A 3NM2A 4R9LA 1C7HA 3D9RA 3IPTA 5IG5A 3CNXA 2CHCA 3MG2A 3CU3A 2B24B 5D81A 4CDLA 1VZZA 1NDOB 1W01A 5AIIA 4HM7B 3H51A 3RGRA 4HVNA 4Q53A 2RFRA 3LZAA 2HMOB 3FGYA 4LGQA 3G8ZA 3OWUA 2XSHB 3KKGA 3HX8A 3EJVA 4LEHA 5IG0A 1UUVB 3B8LA 3F8XA 5IEPA 2F99A 2F98A 4FCMA 4GB5A 1Z1SA 1S5AA 4KVHA 3SOAA 4R1KA 3JUQA 4WYKB 1E3RA 3EN1B 4HZ9B 1ULIB 4HM6B 4XDWA 3EHCA 4WP5A 3B7CA 3DXOA 4HM0B 1OHOA 1U5OA 3M8CA 1OF5B 2Z77A 1JB4A 3SEDA 2YFIB 3GZRA 1QJGA 4LMIA 5D83A 3ROBA 5IF6A 2CKFB 4K1VA 3T8UA 5EVHA 5IEOA 1Q40A 5JPPA 3F40A 4X2HA 1IDPA 3NXJA 3GRDA 1JKGB 3SOYA 3ECFA 2JQ5A 5IENA 4IIAA 5CLKA
chains in the Genus database with same CATH superfamily
2HMNB 3AMOA 4HOHA 3N9HA 2RBIA 1BUJA 5AEUB 1Y4KA 1BRGA 1O7HB 1OH0A 1K734 3H3HA 3OX9A 3A76A 1AVKA 2SARA 4KFEA 1GY6A 2F4YA 1IT7A 1QAKA 3X40A 1UUWB 1Q824 1BSAA 1MWUA 2CWUA 3WOFB 1W02A 1A67A 1JB5A 2P05A 2GEXA 3S28A 3KE7A 2O9UX 1SQWA 2CWTA 1B27A 1FGMA 3ALAA 5IW9A 3KZTA 2CW9A 3DM8A 3GWRA 3G0KA 1DVDA 1O7WB 3LOYA 1GOUA 1JV2B 4K1UA 2CK3H 2IMJA 4XDVA 5JPUA 2BMQB 3Q90A 1B2XA 3KFQC 1M904 1YVSA 2BIRA 1US1A 1FGTA 1N5PA 1UCKA 1K28A 4U13A 1ASKA 1T5YA 2R41A 2YFJB 3JUMA 3RDEA 2WOFA 2LQVA 1SJWA 3F7SA 3DGOA 1UI8A 2KF4A 1DMNA 1T2HA 3KSPA 2OOVA 4FMBA 1BSCA 2F56A 1W4NA 3G713 5AIFA 5G2GA 1Q864 3I0YA 1SARA 2P09A 4EC6A 3JVCA 2OTL3 1VQN3 1RGGA 1RN4A 3BLZA 1UCIA 3K7CA 1BRHA 1CEWI 1DMQA 3LTBA 1JKGA 1M1XB 2F86B 3GAXA 3LTDA 3NBJA 1Q7HA 1BNJA 4FMAA 5FW5A 3IJEB 1FYSA 1B21A 3WR2A 5TGNA 1NWWA 2HMMB 3FCSB 1N5HA 2Z76A 1FW7A 3BB9A 2CX1A 3FSDA 5EEOA 1OUNA 3LMLA 1B2MA 2Z7AA 2IYJA 1RKYA 4N6TA 2P38A 1G96A 1J2BA 2BHMA 2BT3A 1BNIA 1M9GA 1BAOA 1BNSA 1I3IA 4FCJA 2JDIH 3STDA 5RNTA 1EA2A 1YVBI 1UGHI 3F8HA 2BMRB 2CFDA 1AV4A 3E99A 1AQZA 1FGRA 3PGBA 4BU4A 2YX9A 3CCR3 3EBYA 4XBXA 1FUTA 1RN1A 4L8PA 1RGLA 1I2EA 1JJ22 2W04A 5KP1A 1STFI 2OQEC 3G16A 4R80A 1GD3A 3K0ZA 1OCVA 1I3FA 2W0QA 2UGIA 3MG3A 3DZLA 1MGWA 3PCRA 3JUPA 1RSNA 4J9AA 2PZVA 2P0MA 1E97A 2KF5A 4HM2B 3QK9A 4MEIA 4N6V0 3X42A 3CME3 3EX9A 2QGUA 1WQLB 4ILFA 1TFKA 2XFTA 1LQGC 3MHEA 4O02B 1A2PA 3OWSA 4XBTA 3S5CA 3TDGA 4DKIA 4G1MB 1YIJ3 1IVXA 1PU4A 3MG1A 1A2KA 1YI23 5IG4A 5CF2A 3CCL3 3EF8A 3ER7A 1LOVA 4CPKA 3LXUX 1LOXA 1OGXA 2Q07A 4HZBB 4X2OA 3X3YA 1E3VA 3GZXB 1MOLA 1BGSA 2CX0A 1AY7A 1YNVX 3ZFZA 3K63A 1W7CA 3VGNA 2GXFA 4LSOA 4MMYB 3X41A 3PYJA 1NO3A 4L7KA 1IK3A 3F14A 1W5ZA 2A15A 3FKAA 3FG3A 2W03A 3JUNA 4XBYA 4PEJA 4EBGA 2KCDA 1IT8A 3WDGB 2K3DA 1VQM3 1W2B2 3CMA3 3MKIA 2HOHA 1V57A 2XF3A 3GZBA 4K61A 3S27A 1V58A 2Z6BA 4RZMA 4AKZA 1W6CA 2XGNA 4HM5B 2OCTA 7RNTA 3T0UA 1HYFA 1BRIA 1TTOA 3GZYB 1NNVA 2GEYA 5AIGA 2YFLB 4HM3B 3A5EA 1FGQA 3CCE3 4OUQA 5KP3A 4EYCA 4RBNA 4WYKA 4ZM8A 1LRAA 4OVMA 3URPA 1Q7Y4 1GMQA 3D5IA 2KXGA 4N6OB 5EQLA 1TUHA 1F8NA 3UNLA 1WTHA 2W9QA 4EW5A 1X1XA 1GY7A 1FA3A 1W2ZA 3RGAA 1IU7A 1RMSA 4MMZB 5AEWB 3AHWA 4MJDA 3CC43 1BSBA 1A2VA 1OF5A 1GMRA 3PZWA 1V74A 4IPBA 1K8A4 1MWSA 2IY2A 2K0MA 1IQXA 1UDII 3U97A 1IYYA 5DRVA 3CCJ3 1ULJB 2GBXB 3LT9A 2BNGA 2QIYA 1RJOA 1T3BA 1LOWA 2OWPA 3CPW2 3UJMA 2BMOB 4HM1B 1ZGXA 2HMLB 4XB5A 2CWVA 1EUIC 2CG1A 1FUWA 3BNBA 1MGRA 2STDA 2KF6A 3FLJA 1VQL3 3U1WA 1DETA 3DGYA 1IV7A 5HGRA 3G4S3 2RNTA 1N8R4 2ZL8A 4OK0A 3NBRA 3NHXA 1RRHA 5M19A 1VQQA 1CYVA 2RCDA 3KSED 4R4KA 2XR8B 4KFFA 2AAEA 4WWUC 4CJNA 2I9WA 4RNYA 3FG4A 1G02A 1HKXA 1B2UA 1WMPA 2BO9B 1O7MB 3SYUA 1QALA 1RLSA 4J5GA 2R4IA 5CK6A 5AIHA 5HOHA 3LH4A 3MWZA 3RNTA 3ZG5A 3SVAA 1LXEA 1OHPA 2XH9A 1K9M4 1JZDA 1ZS7A 4WFOA 4WHAA 1ISKA 2XSOB 5CXOA 1BVIA 1W6GA 1O7GB 2V1LA 2XFSA 1VQ93 2W6JH 1NU3A 1CQSA 3F9SA 6STDA 2E2TA 4JF8A 2C4BA 1I0XA 1BUQA 2L1SA 4O3VA 1I70A 2KAAA 3HIIA 3PXMA 3WA3A 4BL3A 3LT8A 1RGEA 3K5TA 3MYTA 3UL6A 1GD4A 3EQQB 3G6E3 1UUGB 4BTWA 3HK4A 4XM4A 3HOHA 2GBWB 2KRTA 3CPOA 1QAFA 1L5GB 4BIRA 4HKVB 1WNHA 3N8BA 1RDSA 4R9KA 2W56B 3WMDA 1JN5B 3EC9A 4BTYA 8CHOA 7STDA 4NREA 2E2UA 2HMJB 1Q40B 2Y73A 5FGOA 4EXRA 1KWIA 1YGEA 2B1XB 1TRQA 1ROAA 1ZO2A 3EE1A 3NV0B 4HM4B 4I4KA 5BXQA 1R4CA 3EN8A 2CFWA 1OPYA 1W6YA 1GYBA 1SIIA 3EBTA 3FF2A 1GOYA 2MC8A 1UCJA 1U8CB 2WOHA 3GSPA 4N3VA 1ROVA 1N9EA 1DMMA 4RNZA 1B3SA 3VSYA 4N6LA 1GS3A 1QMAA 1RGFA 4N6MA 3AMOB 1IV9A 1IVVA 1LNHA 4N6NB 1VQ73 1JBTA 1YJW3 1IQYA 4L8OA 1O7PB 5STDA 1RN7A 3EB8A 3MPHA 1JB2A 1SPUA 2OOVC 1B20A 4J5KA 4N6UA 5LC6A 6RNTA 1DVCA 2GU3A 4NPBA 3OWYA 1VQ43 1RGAA 3DH2A 5KP4A 1BNEA 1G0TA 3OV4A 5CF1A 1B2ZA 1X1UA 1TU5A 8RNTA 1BRSA 2W9PA 4GSPA 4LYLB 3X3ZA 5JBSA 3S67A 3CNMA 1KC84 3NUVA 1VQ63 3DGLA 1HZ1A 1LQMB 3J7Yd 1RRLA 5AYRB 3CD63 4CCVA 2W2CA 5M1AA 3Q2PA 3HI7A 3NM7A 4J8TA 1KSIA 3DMCA 1I8VA 3BNDA 2D42A 3CCV3 2WO0A 1QVG2 1C54A 3BU4A 2ZA4A 3FZWA 1A90A 5DREA 1TP6A 3B4PA 3MSOA 1BNGA 3T8NA 1W00A 3DUKA 1BIRA 2E2VA 1JBRA 2OTJ3 1JRQA 2M7OA 3V99A 2RGQA 1AVLA 1GOVA 1JZOA 3HZPA 3PCSA 3UL5A 1JN5A 4AKYA 5IG3A 3OXAA 2WGOA 3S29A 2C11A 1Q814 2CFLA 3WA2X 5A0OB 4HM8B 5D82A 3NV0A 1UW1A 4STDA 4IT7A 5IERA 1FUSA 5BVBA 3I553 1BU4A 1O7NB 2UX0A 1D6UA 2F5WA 1T2IA 3F7XA 3LYGA 4ORLA 3CC73 1VQ83 1EG9B 3B4OA 5LC7A 1DYUA 7GSPA 1OGZA 4K90B 4FCZA 5AI1A 1BRNL 4HJLB 2GSPA 3FH1A 1VQP3 5AYSC 1RCLA 5BIRA 2HMKB 3JUOA 1RGHA 4JRFA 3Q1CA 1ZX2A 1BNFA 1TFOA 2INXA 3DGMA 4GL6A 4HYZA 1YIT3 1CH0A 2IA7A 3D79A 1GY5A 1K41A 1Q42A 2XRXB 1LNIA 1X1WA 2K54A 2D1WA 4EV2A 3WOEB 1STDA 1OHSA 3FF0A 2J8XB 1BRKA 4H3UA 1IVWA 1VQK3 1AR0A 3NM2A 4R9LA 1C7HA 1LVNA 2H0GA 1IQ8A 1HU9A 4HAAA 3NQYA 1JBSA 1YGWA 4FMCA 1VQ53 2LYXA 3D9RA 3IPTA 4EV5A 5IG5A 2OQEA 1S723 2BU4A 3CCU3 3CNXA 2CHCA 5M18A 1I0VA 1PY3A 2XGLA 3WODG 1BNRA 4BL2A 3MG2A 4FR9A 2QEX3 1RNBA 3CU3A 1MNLA 2B24B 2O3OA 1JNQA 4NHFA 5D81A 4KZ1A 3PS8A 5I97A 3NBBA 1BSDA 2ZHXB 2Y74A 4CDLA 1VZZA 1TRPA 3O8YA 1UI7A 1YHQ3 1YJN3 1M1K4 2ML5A 3VF1A 1NDOB 3X3XA 1NB5I 1W01A 5AIIA 3K9MC 4HM7B 3H51A 3RGRA 4HVNA 1NJI4 4MMXB 4Q53A 2RFRA 1KD14 3NX0A 1RGKA 3KCHA 3BIRA 3N54B 3LZAA 2WGQA 5GSPA 4TX4A 2HMOB 3FGYA 1UCLA 3BNEA 4LGQA 1GMPA 2IUKA 2CG0A 3G8ZA 1KQS2 3OWUA 1D6YA 1X1YA 2XSHB 3KKGA 3WHOA 3HX8A 3EJVA 3CCM3 1PYLA 3OW22 4LEHA 5IG0A 1NB3I 1UUVB 1RCKA 2PNCA 1RNTA 2KF3A 3B8LA 4I5QA 3F8XA 5IEPA 4GHOA 1PFPA 2F98A 2F99A 3D5GA 4FCMA 4GB5A 3V98A 2CH9A 1GSPA 1Z1SA 1S5AA 1UGIA 2IUJA 1TIJA 3SX1A 2C10A 3DY5A 3D3LA 2P0XA 2SBLA 4KT3B 4KVHA 5BU4A 1VQO3 3SOAA 4R1KA 3KIIA 3JUQA 4WYKB 1MWTA 3CXC2 1FZUA 1E3RA 2UUGC 3QRDA 1EKMA 2F5MA 4HBRA 3EN1B 1N8QA 3DGNA 4HZ9B 1ULIB 4HM6B 4XDWA 1TJDA 3I563 3EHCA 4WP5A 2QA43 1RTUA 4AEQA 1RHLA 3B7CA 3DXOA 4HM0B 1IVUA 1OHOA 4FMDA 4KFDA 1D6ZA 3UB1A 3ZG0A 1U5OA 9RNTA 1CYUA 3M8CA 5G1LA 3V92A 1EQKA 1OACA 2FGTA 1Q9EA 1OF5B 2CFGA 3CCS3 3KN4A 2GU1A 3HIGA 2AADA 2Z77A 2CC3A 1JB4A 1EEJA 3SEDA 1BSEA 2YFIB 3GZRA 3IMAB 4O2HA 1B2SA 1LOYA 1R4YA 2MF7A 1I2FA 1MWRA 1QJGA 3AHSA 2L4VA 5G1KA 3CCQ3 5ELJA 4LMIA 1WMNA 5ELUA 3NQZA 2XEPA 1BANA 3AGNA 6GSPA 5D83A 4LZIA 2ML6A 4BTXA 3L0RA 1N9JA 1BRJA 1RGCA 3Q3FA 3ROBA 5IF6A 3D4AA 2CKFB 1I2GA 4H61A 1BOXA 4K1VA 3LTAA 3FG1A 2H0IA 2W56A 2RSXA 3T8UA 5EVHA 4QWTA 5IEOA 1Q40A 2H0HA 5JPPA 3F40A 1FGOA 4X2HA 2CFKA 2FXTA 1YJ93 1IDPA 2FNQA 3NXJA 3LTCA 3AGOA 3GRDA 1JKGB 3BNCA 3SOYA 4O8SA 2CIUA 3ECFA 2ZDJA 2JQ5A 4RNTA 3SLUA 4IIAA 3SXXA 5IENA 3CC23 1SIHA 1DE3A 1WMOA 5CLKA 1QVF2
chains in the Genus database with same CATH topology
2HMNB 3AMOA 3N9HA 5AEUB 1Y4KA 1O7HB 1OH0A 1K734 3H3HA 3OX9A 3A76A 1AVKA 4KFEA 1GY6A 1IT7A 1QAKA 3X40A 1UUWB 1Q824 2CWUA 3WOFB 1W02A 1A67A 1JB5A 2P05A 2GEXA 3S28A 3KE7A 2O9UX 1SQWA 2CWTA 1FGMA 3ALAA 5IW9A 3KZTA 2CW9A 3DM8A 3GWRA 3G0KA 1DVDA 1O7WB 3LOYA 1JV2B 4K1UA 2CK3H 2IMJA 4XDVA 5JPUA 2BMQB 3Q90A 3KFQC 1M904 1US1A 1FGTA 1N5PA 1K28A 4U13A 1ASKA 1T5YA 2YFJB 3JUMA 3RDEA 2WOFA 2LQVA 1SJWA 3F7SA 3DGOA 1UI8A 1DMNA 3KSPA 2OOVA 4FMBA 1Q864 1W4NA 3G713 5AIFA 5G2GA 3I0YA 4EC6A 2P09A 2OTL3 3JVCA 1VQN3 3BLZA 3K7CA 1CEWI 1DMQA 3LTBA 1JKGA 1M1XB 2F86B 3GAXA 3LTDA 3NBJA 4FMAA 5FW5A 3IJEB 5TGNA 1NWWA 2HMMB 3FCSB 1N5HA 2Z76A 3BB9A 5EEOA 3FSDA 1OUNA 3LMLA 2Z7AA 1RKYA 4N6TA 2P38A 1G96A 1J2BA 2BHMA 2BT3A 1M9GA 4FCJA 2JDIH 3STDA 1EA2A 1YVBI 3F8HA 2BMRB 2CFDA 1AV4A 3E99A 1FGRA 3PGBA 2YX9A 3CCR3 3EBYA 4XBXA 4L8PA 1JJ22 2W04A 5KP1A 1STFI 2OQEC 3G16A 4R80A 1GD3A 3K0ZA 1OCVA 2W0QA 3MG3A 3DZLA 3PCRA 3JUPA 4J9AA 2PZVA 2P0MA 1E97A 4HM2B 3QK9A 4MEIA 4N6V0 3X42A 3CME3 3EX9A 2QGUA 1WQLB 1TFKA 2XFTA 3MHEA 4O02B 3OWSA 4XBTA 3S5CA 3TDGA 1YIJ3 4G1MB 1IVXA 1PU4A 3MG1A 1A2KA 1YI23 5IG4A 5CF2A 3CCL3 3EF8A 3ER7A 3LXUX 1LOXA 1OGXA 2Q07A 4HZBB 4X2OA 3X3YA 1E3VA 3GZXB 1MOLA 3K63A 1W7CA 3VGNA 2GXFA 4LSOA 4MMYB 3X41A 3PYJA 1NO3A 4L7KA 1IK3A 3F14A 1W5ZA 2A15A 3FKAA 3FG3A 2W03A 3JUNA 4XBYA 4PEJA 4EBGA 2KCDA 1IT8A 3WDGB 1VQM3 1W2B2 3CMA3 3MKIA 2XF3A 3GZBA 4K61A 3S27A 2Z6BA 4RZMA 4AKZA 1W6CA 2XGNA 4HM5B 2OCTA 3T0UA 3GZYB 2GEYA 5AIGA 2YFLB 4HM3B 1FGQA 3CCE3 4OUQA 5KP3A 4EYCA 4RBNA 4WYKA 4ZM8A 4OVMA 1Q7Y4 4N6OB 2KXGA 5EQLA 1TUHA 1F8NA 3UNLA 1WTHA 2W9QA 1GY7A 1FA3A 1W2ZA 3RGAA 1IU7A 4MMZB 5AEWB 4MJDA 3CC43 1A2VA 1OF5A 3PZWA 1V74A 4IPBA 1K8A4 2K0MA 3U97A 1IQXA 5DRVA 3CCJ3 1ULJB 2GBXB 3LT9A 2BNGA 2QIYA 1RJOA 2OWPA 3CPW2 3UJMA 2BMOB 4HM1B 2CG1A 2HMLB 4XB5A 2CWVA 1FUWA 3BNBA 2STDA 3FLJA 1VQL3 3U1WA 1N8R4 1IV7A 5HGRA 3G4S3 2ZL8A 4OK0A 3NBRA 3NHXA 1RRHA 2RCDA 1CYVA 3KSED 4R4KA 4WWUC 2XR8B 4KFFA 2I9WA 4RNYA 3FG4A 1HKXA 1WMPA 2BO9B 1O7MB 1QALA 2R4IA 5CK6A 5AIHA 3LH4A 3MWZA 3SVAA 1LXEA 1OHPA 2XH9A 1K9M4 4WFOA 4WHAA 1ISKA 2XSOB 5CXOA 1W6GA 1O7GB 2V1LA 2XFSA 1VQ93 2W6JH 1NU3A 1CQSA 3F9SA 6STDA 2E2TA 4JF8A 1BUQA 4O3VA 3PXMA 3HIIA 3WA3A 3LT8A 3K5TA 3MYTA 3UL6A 1GD4A 3EQQB 3G6E3 4BTWA 3HK4A 4XM4A 2GBWB 2KRTA 3CPOA 1QAFA 1L5GB 4HKVB 1WNHA 3N8BA 4R9KA 2W56B 3WMDA 1JN5B 3EC9A 4BTYA 8CHOA 7STDA 4NREA 2E2UA 2HMJB 1Q40B 2Y73A 5FGOA 4EXRA 1KWIA 1YGEA 2B1XB 4HM4B 1ROAA 1ZO2A 3EE1A 3NV0B 4I4KA 5BXQA 1R4CA 3EN8A 2CFWA 1OPYA 1W6YA 1GYBA 1SIIA 3EBTA 3FF2A 2MC8A 1U8CB 2WOHA 4N3VA 1ROVA 1N9EA 1DMMA 4RNZA 3VSYA 4N6LA 1GS3A 1QMAA 4N6MA 3AMOB 1IV9A 1IVVA 1LNHA 4N6NB 1VQ73 1YJW3 1IQYA 4L8OA 1O7PB 5STDA 1RN7A 3EB8A 3MPHA 1JB2A 1SPUA 2OOVC 4N6UA 5LC6A 1DVCA 2GU3A 3OWYA 1VQ43 5KP4A 3OV4A 5CF1A 1TU5A 2W9PA 3X3ZA 5JBSA 3S67A 3CNMA 1KC84 3NUVA 1VQ63 3DGLA 3J7Yd 1RRLA 5AYRB 3CD63 4CCVA 2W2CA 3Q2PA 3HI7A 3NM7A 4J8TA 1KSIA 3DMCA 3BNDA 2D42A 3CCV3 2WO0A 1QVG2 3FZWA 1A90A 5DREA 1TP6A 3B4PA 3MSOA 3T8NA 1W00A 3DUKA 2E2VA 2OTJ3 1JRQA 2M7OA 3V99A 2RGQA 1AVLA 3HZPA 3UL5A 5IG3A 3PCSA 4AKYA 1JN5A 3OXAA 2WGOA 3S29A 2C11A 1Q814 2CFLA 3WA2X 5A0OB 4HM8B 5D82A 3NV0A 1UW1A 4STDA 4IT7A 5IERA 5BVBA 3I553 1O7NB 2UX0A 1D6UA 4ORLA 3F7XA 3LYGA 3CC73 1VQ83 1EG9B 3B4OA 5LC7A 1DYUA 1OGZA 4K90B 4FCZA 5AI1A 4HJLB 3FH1A 1VQP3 5AYSC 2HMKB 3JUOA 4JRFA 3Q1CA 1ZX2A 3DGMA 1TFOA 2INXA 4HYZA 4GL6A 1YIT3 2IA7A 1GY5A 1K41A 1Q42A 2XRXB 2K54A 2D1WA 4EV2A 3WOEB 1STDA 1OHSA 3FF0A 4H3UA 1IVWA 1VQK3 1AR0A 3NM2A 4R9LA 1C7HA 1LVNA 1IQ8A 1HU9A 1VQ53 3NQYA 4FMCA 2LYXA 3D9RA 3IPTA 4EV5A 5IG5A 2OQEA 1S723 3CCU3 3CNXA 2CHCA 2XGLA 3WODG 3MG2A 4FR9A 2QEX3 3CU3A 1MNLA 2B24B 2O3OA 1JNQA 4NHFA 5D81A 4KZ1A 3PS8A 5I97A 3NBBA 2Y74A 4CDLA 1VZZA 3O8YA 1UI7A 1YHQ3 1YJN3 1M1K4 2ML5A 3VF1A 1NDOB 3X3XA 1NB5I 1W01A 5AIIA 3K9MC 4HM7B 3H51A 3RGRA 4HVNA 1NJI4 4MMXB 4Q53A 2RFRA 1KD14 3NX0A 3N54B 3LZAA 2WGQA 4TX4A 2HMOB 3FGYA 3BNEA 4LGQA 2IUKA 2CG0A 3G8ZA 1KQS2 3OWUA 1D6YA 2XSHB 3KKGA 3CCM3 3HX8A 3EJVA 3OW22 4LEHA 5IG0A 1NB3I 1UUVB 2PNCA 3B8LA 3F8XA 5IEPA 1PFPA 2F98A 2F99A 4FCMA 4GB5A 3V98A 2CH9A 1Z1SA 1S5AA 2IUJA 1TIJA 3SX1A 2C10A 3DY5A 3D3LA 2P0XA 2SBLA 4KVHA 1VQO3 3SOAA 4R1KA 3KIIA 3JUQA 4WYKB 3CXC2 1E3RA 3QRDA 1EKMA 4HBRA 3EN1B 1N8QA 3DGNA 4HZ9B 1ULIB 4HM6B 4XDWA 3I563 3EHCA 4WP5A 2QA43 4AEQA 3B7CA 3DXOA 4HM0B 1IVUA 1OHOA 4FMDA 4KFDA 1D6ZA 3UB1A 1CYUA 1U5OA 1EQKA 3M8CA 3V92A 1OACA 2FGTA 1OF5B 2CFGA 3CCS3 3KN4A 2GU1A 3HIGA 2Z77A 2CC3A 1JB4A 3SEDA 2YFIB 3GZRA 3IMAB 4O2HA 2MF7A 1QJGA 3CCQ3 2L4VA 5ELJA 4LMIA 1WMNA 5ELUA 3NQZA 2XEPA 5D83A 4LZIA 2ML6A 4BTXA 3L0RA 1N9JA 3ROBA 5IF6A 2CKFB 4H61A 4K1VA 3LTAA 3FG1A 2W56A 2RSXA 3T8UA 5EVHA 4QWTA 5IEOA 1Q40A 5JPPA 3F40A 1FGOA 4X2HA 2CFKA 2FXTA 1YJ93 1IDPA 2FNQA 3NXJA 3LTCA 3GRDA 1JKGB 3BNCA 3SOYA 4O8SA 2CIUA 3ECFA 2ZDJA 2JQ5A 3SLUA 3SXXA 4IIAA 5IENA 3CC23 1SIHA 1WMOA 5CLKA 1QVF2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMN B;  5AEU B;  1O7H B;  1OH0 A;  3H3H A;  3OX9 A;  3A76 A;  1GY6 A;  1UUW B;  1W02 A;  1JB5 A;  2GEX A;  3KE7 A;  3KZT A;  3DM8 A;  3GWR A;  3G0K A;  1O7W B;  4K1U A;  2IMJ A;  4XDV A;  5JPU A;  2BMQ B;  3Q90 A;  4U13 A;  1ASK A;  3JUM A;  2YFJ B;  1SJW A;  3F7S A;  1DMN A;  3KSP A;  5AIF A;  5G2G A;  3I0Y A;  3BLZ A;  3K7C A;  1DMQ A;  1JKG A;  2F86 B;  5FW5 A;  5TGN A;  1NWW A;  2HMM B;  2Z76 A;  3BB9 A;  3FSD A;  1OUN A;  2Z7A A;  4FCJ A;  3STD A;  1EA2 A;  3F8H A;  2BMR B;  3E99 A;  3EBY A;  4XBX A;  4L8P A;  5KP1 A;  3G16 A;  3K0Z A;  1OCV A;  3MG3 A;  3DZL A;  3JUP A;  4J9A A;  2PZV A;  1E97 A;  4HM2 B;  3EX9 A;  2QGU A;  1WQL B;  3S5C A;  3MHE A;  3OWS A;  4XBT A;  3MG1 A;  1A2K A;  5IG4 A;  5CF2 A;  3EF8 A;  3ER7 A;  4HZB B;  1OGX A;  4X2O A;  1E3V A;  3GZX B;  3VGN A;  2GXF A;  4L7K A;  3F14 A;  2A15 A;  3JUN A;  3FKA A;  4XBY A;  4PEJ A;  3MKI A;  3GZB A;  4RZM A;  4HM5 B;  3GZY B;  2GEY A;  5AIG A;  2YFL B;  4HM3 B;  4OUQ A;  5KP3 A;  4WYK A;  4OVM A;  1TUH A;  3UNL A;  1GY7 A;  3RGA A;  5AEW B;  4MJD A;  1OF5 A;  5DRV A;  1ULJ B;  2GBX B;  2BNG A;  2QIY A;  2OWP A;  3UJM A;  2BMO B;  4HM1 B;  2HML B;  4XB5 A;  2STD A;  3FLJ A;  5HGR A;  3NBR A;  3NHX A;  2RCD A;  4WWU C;  2XR8 B;  2I9W A;  1HKX A;  1O7M B;  2R4I A;  5CK6 A;  5AIH A;  1OHP A;  1ISK A;  2XSO B;  5CXO A;  1O7G B;  1NU3 A;  1CQS A;  3F9S A;  6STD A;  1BUQ A;  3MYT A;  3EQQ B;  3HK4 A;  4XM4 A;  2GBW B;  3CPO A;  4HKV B;  4R9K A;  3WMD A;  1JN5 B;  3EC9 A;  8CHO A;  7STD A;  2HMJ B;  1Q40 B;  2B1X B;  4HM4 B;  1ZO2 A;  5BXQ A;  3NV0 B;  4I4K A;  3EN8 A;  1OPY A;  1W6Y A;  1GYB A;  3EBT A;  3FF2 A;  4N3V A;  1DMM A;  3VSY A;  1GS3 A;  1QMA A;  4L8O A;  1O7P B;  5STD A;  1JB2 A;  3OWY A;  5KP4 A;  3OV4 A;  5CF1 A;  3CNM A;  3NUV A;  2W2C A;  4J8T A;  3DMC A;  3FZW A;  5DRE A;  1TP6 A;  3B4P A;  3MSO A;  3T8N A;  1W00 A;  3DUK A;  2RGQ A;  5IG3 A;  3HZP A;  1JN5 A;  3OXA A;  4HM8 B;  5D82 A;  3NV0 A;  4STD A;  5IER A;  5BVB A;  1O7N B;  2UX0 A;  4ORL A;  3F7X A;  3LYG A;  1EG9 B;  3B4O A;  1OGZ A;  5AI1 A;  4HJL B;  3FH1 A;  2HMK B;  3JUO A;  1ZX2 A;  2INX A;  1GY5 A;  1K41 A;  1Q42 A;  2XRX B;  2K54 A;  1STD A;  1OHS A;  3FF0 A;  4H3U A;  1AR0 A;  3NM2 A;  4R9L A;  1C7H A;  3D9R A;  3IPT A;  5IG5 A;  3CNX A;  2CHC A;  3MG2 A;  3CU3 A;  2B24 B;  5D81 A;  4CDL A;  1VZZ A;  1NDO B;  1W01 A;  5AII A;  4HM7 B;  3H51 A;  3RGR A;  4HVN A;  4Q53 A;  2RFR A;  3LZA A;  2HMO B;  3FGY A;  4LGQ A;  3G8Z A;  3OWU A;  2XSH B;  3KKG A;  3HX8 A;  3EJV A;  4LEH A;  5IG0 A;  1UUV B;  3B8L A;  3F8X A;  5IEP A;  2F99 A;  2F98 A;  4FCM A;  4GB5 A;  1Z1S A;  1S5A A;  4KVH A;  3SOA A;  4R1K A;  3JUQ A;  4WYK B;  1E3R A;  3EN1 B;  4HZ9 B;  1ULI B;  4HM6 B;  4XDW A;  3EHC A;  4WP5 A;  3B7C A;  3DXO A;  4HM0 B;  1OHO A;  1U5O A;  3M8C A;  1OF5 B;  2Z77 A;  1JB4 A;  3SED A;  2YFI B;  3GZR A;  1QJG A;  4LMI A;  5D83 A;  3ROB A;  5IF6 A;  2CKF B;  4K1V A;  3T8U A;  5EVH A;  5IEO A;  1Q40 A;  5JPP A;  3F40 A;  4X2H A;  1IDP A;  3NXJ A;  3GRD A;  1JKG B;  3SOY A;  3ECF A;  2JQ5 A;  5IEN A;  4IIA A;  5CLK A; 
#chains in the Genus database with same CATH topology
 2HMN B;  3AMO A;  4HOH A;  3N9H A;  2RBI A;  1BUJ A;  5AEU B;  1Y4K A;  1BRG A;  1O7H B;  1OH0 A;  1K73 4;  3H3H A;  3OX9 A;  3A76 A;  1AVK A;  2SAR A;  4KFE A;  1GY6 A;  2F4Y A;  1IT7 A;  1QAK A;  3X40 A;  1UUW B;  1Q82 4;  1BSA A;  1MWU A;  2CWU A;  3WOF B;  1W02 A;  1A67 A;  1JB5 A;  2P05 A;  2GEX A;  3S28 A;  3KE7 A;  2O9U X;  1SQW A;  2CWT A;  1B27 A;  1FGM A;  3ALA A;  5IW9 A;  3KZT A;  2CW9 A;  3DM8 A;  3GWR A;  3G0K A;  1DVD A;  1O7W B;  3LOY A;  1GOU A;  1JV2 B;  4K1U A;  2CK3 H;  2IMJ A;  4XDV A;  5JPU A;  2BMQ B;  3Q90 A;  1B2X A;  3KFQ C;  1M90 4;  1YVS A;  2BIR A;  1US1 A;  1FGT A;  1N5P A;  1UCK A;  1K28 A;  4U13 A;  1ASK A;  1T5Y A;  2R41 A;  2YFJ B;  3JUM A;  3RDE A;  2WOF A;  2LQV A;  1SJW A;  3F7S A;  3DGO A;  1UI8 A;  2KF4 A;  1DMN A;  1T2H A;  3KSP A;  2OOV A;  4FMB A;  1BSC A;  2F56 A;  1W4N A;  3G71 3;  5AIF A;  5G2G A;  1Q86 4;  3I0Y A;  1SAR A;  2P09 A;  4EC6 A;  3JVC A;  2OTL 3;  1VQN 3;  1RGG A;  1RN4 A;  3BLZ A;  1UCI A;  3K7C A;  1BRH A;  1CEW I;  1DMQ A;  3LTB A;  1JKG A;  1M1X B;  2F86 B;  3GAX A;  3LTD A;  3NBJ A;  1Q7H A;  1BNJ A;  4FMA A;  5FW5 A;  3IJE B;  1FYS A;  1B21 A;  3WR2 A;  5TGN A;  1NWW A;  2HMM B;  3FCS B;  1N5H A;  2Z76 A;  1FW7 A;  3BB9 A;  2CX1 A;  3FSD A;  5EEO A;  1OUN A;  3LML A;  1B2M A;  2Z7A A;  2IYJ A;  1RKY A;  4N6T A;  2P38 A;  1G96 A;  1J2B A;  2BHM A;  2BT3 A;  1BNI A;  1M9G A;  1BAO A;  1BNS A;  1I3I A;  4FCJ A;  2JDI H;  3STD A;  5RNT A;  1EA2 A;  1YVB I;  1UGH I;  3F8H A;  2BMR B;  2CFD A;  1AV4 A;  3E99 A;  1AQZ A;  1FGR A;  3PGB A;  4BU4 A;  2YX9 A;  3CCR 3;  3EBY A;  4XBX A;  1FUT A;  1RN1 A;  4L8P A;  1RGL A;  1I2E A;  1JJ2 2;  2W04 A;  5KP1 A;  1STF I;  2OQE C;  3G16 A;  4R80 A;  1GD3 A;  3K0Z A;  1OCV A;  1I3F A;  2W0Q A;  2UGI A;  3MG3 A;  3DZL A;  1MGW A;  3PCR A;  3JUP A;  1RSN A;  4J9A A;  2PZV A;  2P0M A;  1E97 A;  2KF5 A;  4HM2 B;  3QK9 A;  4MEI A;  4N6V 0;  3X42 A;  3CME 3;  3EX9 A;  2QGU A;  1WQL B;  4ILF A;  1TFK A;  2XFT A;  1LQG C;  3MHE A;  4O02 B;  1A2P A;  3OWS A;  4XBT A;  3S5C A;  3TDG A;  4DKI A;  4G1M B;  1YIJ 3;  1IVX A;  1PU4 A;  3MG1 A;  1A2K A;  1YI2 3;  5IG4 A;  5CF2 A;  3CCL 3;  3EF8 A;  3ER7 A;  1LOV A;  4CPK A;  3LXU X;  1LOX A;  1OGX A;  2Q07 A;  4HZB B;  4X2O A;  3X3Y A;  1E3V A;  3GZX B;  1MOL A;  1BGS A;  2CX0 A;  1AY7 A;  1YNV X;  3ZFZ A;  3K63 A;  1W7C A;  3VGN A;  2GXF A;  4LSO A;  4MMY B;  3X41 A;  3PYJ A;  1NO3 A;  4L7K A;  1IK3 A;  3F14 A;  1W5Z A;  2A15 A;  3FKA A;  3FG3 A;  2W03 A;  3JUN A;  4XBY A;  4PEJ A;  4EBG A;  2KCD A;  1IT8 A;  3WDG B;  2K3D A;  1VQM 3;  1W2B 2;  3CMA 3;  3MKI A;  2HOH A;  1V57 A;  2XF3 A;  3GZB A;  4K61 A;  3S27 A;  1V58 A;  2Z6B A;  4RZM A;  4AKZ A;  1W6C A;  2XGN A;  4HM5 B;  2OCT A;  7RNT A;  3T0U A;  1HYF A;  1BRI A;  1TTO A;  3GZY B;  1NNV A;  2GEY A;  5AIG A;  2YFL B;  4HM3 B;  3A5E A;  1FGQ A;  3CCE 3;  4OUQ A;  5KP3 A;  4EYC A;  4RBN A;  4WYK A;  4ZM8 A;  1LRA A;  4OVM A;  3URP A;  1Q7Y 4;  1GMQ A;  3D5I A;  2KXG A;  4N6O B;  5EQL A;  1TUH A;  1F8N A;  3UNL A;  1WTH A;  2W9Q A;  4EW5 A;  1X1X A;  1GY7 A;  1FA3 A;  1W2Z A;  3RGA A;  1IU7 A;  1RMS A;  4MMZ B;  5AEW B;  3AHW A;  4MJD A;  3CC4 3;  1BSB A;  1A2V A;  1OF5 A;  1GMR A;  3PZW A;  1V74 A;  4IPB A;  1K8A 4;  1MWS A;  2IY2 A;  2K0M A;  1IQX A;  1UDI I;  3U97 A;  1IYY A;  5DRV A;  3CCJ 3;  1ULJ B;  2GBX B;  3LT9 A;  2BNG A;  2QIY A;  1RJO A;  1T3B A;  1LOW A;  2OWP A;  3CPW 2;  3UJM A;  2BMO B;  4HM1 B;  1ZGX A;  2HML B;  4XB5 A;  2CWV A;  1EUI C;  2CG1 A;  1FUW A;  3BNB A;  1MGR A;  2STD A;  2KF6 A;  3FLJ A;  1VQL 3;  3U1W A;  1DET A;  3DGY A;  1IV7 A;  5HGR A;  3G4S 3;  2RNT A;  1N8R 4;  2ZL8 A;  4OK0 A;  3NBR A;  3NHX A;  1RRH A;  5M19 A;  1VQQ A;  1CYV A;  2RCD A;  3KSE D;  4R4K A;  2XR8 B;  4KFF A;  2AAE A;  4WWU C;  4CJN A;  2I9W A;  4RNY A;  3FG4 A;  1G02 A;  1HKX A;  1B2U A;  1WMP A;  2BO9 B;  1O7M B;  3SYU A;  1QAL A;  1RLS A;  4J5G A;  2R4I A;  5CK6 A;  5AIH A;  5HOH A;  3LH4 A;  3MWZ A;  3RNT A;  3ZG5 A;  3SVA A;  1LXE A;  1OHP A;  2XH9 A;  1K9M 4;  1JZD A;  1ZS7 A;  4WFO A;  4WHA A;  1ISK A;  2XSO B;  5CXO A;  1BVI A;  1W6G A;  1O7G B;  2V1L A;  2XFS A;  1VQ9 3;  2W6J H;  1NU3 A;  1CQS A;  3F9S A;  6STD A;  2E2T A;  4JF8 A;  2C4B A;  1I0X A;  1BUQ A;  2L1S A;  4O3V A;  1I70 A;  2KAA A;  3HII A;  3PXM A;  3WA3 A;  4BL3 A;  3LT8 A;  1RGE A;  3K5T A;  3MYT A;  3UL6 A;  1GD4 A;  3EQQ B;  3G6E 3;  1UUG B;  4BTW A;  3HK4 A;  4XM4 A;  3HOH A;  2GBW B;  2KRT A;  3CPO A;  1QAF A;  1L5G B;  4BIR A;  4HKV B;  1WNH A;  3N8B A;  1RDS A;  4R9K A;  2W56 B;  3WMD A;  1JN5 B;  3EC9 A;  4BTY A;  8CHO A;  7STD A;  4NRE A;  2E2U A;  2HMJ B;  1Q40 B;  2Y73 A;  5FGO A;  4EXR A;  1KWI A;  1YGE A;  2B1X B;  1TRQ A;  1ROA A;  1ZO2 A;  3EE1 A;  3NV0 B;  4HM4 B;  4I4K A;  5BXQ A;  1R4C A;  3EN8 A;  2CFW A;  1OPY A;  1W6Y A;  1GYB A;  1SII A;  3EBT A;  3FF2 A;  1GOY A;  2MC8 A;  1UCJ A;  1U8C B;  2WOH A;  3GSP A;  4N3V A;  1ROV A;  1N9E A;  1DMM A;  4RNZ A;  1B3S A;  3VSY A;  4N6L A;  1GS3 A;  1QMA A;  1RGF A;  4N6M A;  3AMO B;  1IV9 A;  1IVV A;  1LNH A;  4N6N B;  1VQ7 3;  1JBT A;  1YJW 3;  1IQY A;  4L8O A;  1O7P B;  5STD A;  1RN7 A;  3EB8 A;  3MPH A;  1JB2 A;  1SPU A;  2OOV C;  1B20 A;  4J5K A;  4N6U A;  5LC6 A;  6RNT A;  1DVC A;  2GU3 A;  4NPB A;  3OWY A;  1VQ4 3;  1RGA A;  3DH2 A;  5KP4 A;  1BNE A;  1G0T A;  3OV4 A;  5CF1 A;  1B2Z A;  1X1U A;  1TU5 A;  8RNT A;  1BRS A;  2W9P A;  4GSP A;  4LYL B;  3X3Z A;  5JBS A;  3S67 A;  3CNM A;  1KC8 4;  3NUV A;  1VQ6 3;  3DGL A;  1HZ1 A;  1LQM B;  3J7Y d;  1RRL A;  5AYR B;  3CD6 3;  4CCV A;  2W2C A;  5M1A A;  3Q2P A;  3HI7 A;  3NM7 A;  4J8T A;  1KSI A;  3DMC A;  1I8V A;  3BND A;  2D42 A;  3CCV 3;  2WO0 A;  1QVG 2;  1C54 A;  3BU4 A;  2ZA4 A;  3FZW A;  1A90 A;  5DRE A;  1TP6 A;  3B4P A;  3MSO A;  1BNG A;  3T8N A;  1W00 A;  3DUK A;  1BIR A;  2E2V A;  1JBR A;  2OTJ 3;  1JRQ A;  2M7O A;  3V99 A;  2RGQ A;  1AVL A;  1GOV A;  1JZO A;  3HZP A;  3PCS A;  3UL5 A;  1JN5 A;  4AKY A;  5IG3 A;  3OXA A;  2WGO A;  3S29 A;  2C11 A;  1Q81 4;  2CFL A;  3WA2 X;  5A0O B;  4HM8 B;  5D82 A;  3NV0 A;  1UW1 A;  4STD A;  4IT7 A;  5IER A;  1FUS A;  5BVB A;  3I55 3;  1BU4 A;  1O7N B;  2UX0 A;  1D6U A;  2F5W A;  1T2I A;  3F7X A;  3LYG A;  4ORL A;  3CC7 3;  1VQ8 3;  1EG9 B;  3B4O A;  5LC7 A;  1DYU A;  7GSP A;  1OGZ A;  4K90 B;  4FCZ A;  5AI1 A;  1BRN L;  4HJL B;  2GSP A;  3FH1 A;  1VQP 3;  5AYS C;  1RCL A;  5BIR A;  2HMK B;  3JUO A;  1RGH A;  4JRF A;  3Q1C A;  1ZX2 A;  1BNF A;  1TFO A;  2INX A;  3DGM A;  4GL6 A;  4HYZ A;  1YIT 3;  1CH0 A;  2IA7 A;  3D79 A;  1GY5 A;  1K41 A;  1Q42 A;  2XRX B;  1LNI A;  1X1W A;  2K54 A;  2D1W A;  4EV2 A;  3WOE B;  1STD A;  1OHS A;  3FF0 A;  2J8X B;  1BRK A;  4H3U A;  1IVW A;  1VQK 3;  1AR0 A;  3NM2 A;  4R9L A;  1C7H A;  1LVN A;  2H0G A;  1IQ8 A;  1HU9 A;  4HAA A;  3NQY A;  1JBS A;  1YGW A;  4FMC A;  1VQ5 3;  2LYX A;  3D9R A;  3IPT A;  4EV5 A;  5IG5 A;  2OQE A;  1S72 3;  2BU4 A;  3CCU 3;  3CNX A;  2CHC A;  5M18 A;  1I0V A;  1PY3 A;  2XGL A;  3WOD G;  1BNR A;  4BL2 A;  3MG2 A;  4FR9 A;  2QEX 3;  1RNB A;  3CU3 A;  1MNL A;  2B24 B;  2O3O A;  1JNQ A;  4NHF A;  5D81 A;  4KZ1 A;  3PS8 A;  5I97 A;  3NBB A;  1BSD A;  2ZHX B;  2Y74 A;  4CDL A;  1VZZ A;  1TRP A;  3O8Y A;  1UI7 A;  1YHQ 3;  1YJN 3;  1M1K 4;  2ML5 A;  3VF1 A;  1NDO B;  3X3X A;  1NB5 I;  1W01 A;  5AII A;  3K9M C;  4HM7 B;  3H51 A;  3RGR A;  4HVN A;  1NJI 4;  4MMX B;  4Q53 A;  2RFR A;  1KD1 4;  3NX0 A;  1RGK A;  3KCH A;  3BIR A;  3N54 B;  3LZA A;  2WGQ A;  5GSP A;  4TX4 A;  2HMO B;  3FGY A;  1UCL A;  3BNE A;  4LGQ A;  1GMP A;  2IUK A;  2CG0 A;  3G8Z A;  1KQS 2;  3OWU A;  1D6Y A;  1X1Y A;  2XSH B;  3KKG A;  3WHO A;  3HX8 A;  3EJV A;  3CCM 3;  1PYL A;  3OW2 2;  4LEH A;  5IG0 A;  1NB3 I;  1UUV B;  1RCK A;  2PNC A;  1RNT A;  2KF3 A;  3B8L A;  4I5Q A;  3F8X A;  5IEP A;  4GHO A;  1PFP A;  2F98 A;  2F99 A;  3D5G A;  4FCM A;  4GB5 A;  3V98 A;  2CH9 A;  1GSP A;  1Z1S A;  1S5A A;  1UGI A;  2IUJ A;  1TIJ A;  3SX1 A;  2C10 A;  3DY5 A;  3D3L A;  2P0X A;  2SBL A;  4KT3 B;  4KVH A;  5BU4 A;  1VQO 3;  3SOA A;  4R1K A;  3KII A;  3JUQ A;  4WYK B;  1MWT A;  3CXC 2;  1FZU A;  1E3R A;  2UUG C;  3QRD A;  1EKM A;  2F5M A;  4HBR A;  3EN1 B;  1N8Q A;  3DGN A;  4HZ9 B;  1ULI B;  4HM6 B;  4XDW A;  1TJD A;  3I56 3;  3EHC A;  4WP5 A;  2QA4 3;  1RTU A;  4AEQ A;  1RHL A;  3B7C A;  3DXO A;  4HM0 B;  1IVU A;  1OHO A;  4FMD A;  4KFD A;  1D6Z A;  3UB1 A;  3ZG0 A;  1U5O A;  9RNT A;  1CYU A;  3M8C A;  5G1L A;  3V92 A;  1EQK A;  1OAC A;  2FGT A;  1Q9E A;  1OF5 B;  2CFG A;  3CCS 3;  3KN4 A;  2GU1 A;  3HIG A;  2AAD A;  2Z77 A;  2CC3 A;  1JB4 A;  1EEJ A;  3SED A;  1BSE A;  2YFI B;  3GZR A;  3IMA B;  4O2H A;  1B2S A;  1LOY A;  1R4Y A;  2MF7 A;  1I2F A;  1MWR A;  1QJG A;  3AHS A;  2L4V A;  5G1K A;  3CCQ 3;  5ELJ A;  4LMI A;  1WMN A;  5ELU A;  3NQZ A;  2XEP A;  1BAN A;  3AGN A;  6GSP A;  5D83 A;  4LZI A;  2ML6 A;  4BTX A;  3L0R A;  1N9J A;  1BRJ A;  1RGC A;  3Q3F A;  3ROB A;  5IF6 A;  3D4A A;  2CKF B;  1I2G A;  4H61 A;  1BOX A;  4K1V A;  3LTA A;  3FG1 A;  2H0I A;  2W56 A;  2RSX A;  3T8U A;  5EVH A;  4QWT A;  5IEO A;  1Q40 A;  2H0H A;  5JPP A;  3F40 A;  1FGO A;  4X2H A;  2CFK A;  2FXT A;  1YJ9 3;  1IDP A;  2FNQ A;  3NXJ A;  3LTC A;  3AGO A;  3GRD A;  1JKG B;  3BNC A;  3SOY A;  4O8S A;  2CIU A;  3ECF A;  2ZDJ A;  2JQ5 A;  4RNT A;  3SLU A;  4IIA A;  3SXX A;  5IEN A;  3CC2 3;  1SIH A;  1DE3 A;  1WMO A;  5CLK A;  1QVF 2; 
#chains in the Genus database with same CATH homology
 2HMN B;  3AMO A;  3N9H A;  5AEU B;  1Y4K A;  1O7H B;  1OH0 A;  1K73 4;  3H3H A;  3OX9 A;  3A76 A;  1AVK A;  4KFE A;  1GY6 A;  1IT7 A;  1QAK A;  3X40 A;  1UUW B;  1Q82 4;  2CWU A;  3WOF B;  1W02 A;  1A67 A;  1JB5 A;  2P05 A;  2GEX A;  3S28 A;  3KE7 A;  2O9U X;  1SQW A;  2CWT A;  1FGM A;  3ALA A;  5IW9 A;  3KZT A;  2CW9 A;  3DM8 A;  3GWR A;  3G0K A;  1DVD A;  1O7W B;  3LOY A;  1JV2 B;  4K1U A;  2CK3 H;  2IMJ A;  4XDV A;  5JPU A;  2BMQ B;  3Q90 A;  3KFQ C;  1M90 4;  1US1 A;  1FGT A;  1N5P A;  1K28 A;  4U13 A;  1ASK A;  1T5Y A;  2YFJ B;  3JUM A;  3RDE A;  2WOF A;  2LQV A;  1SJW A;  3F7S A;  3DGO A;  1UI8 A;  1DMN A;  3KSP A;  2OOV A;  4FMB A;  1Q86 4;  1W4N A;  3G71 3;  5AIF A;  5G2G A;  3I0Y A;  4EC6 A;  2P09 A;  2OTL 3;  3JVC A;  1VQN 3;  3BLZ A;  3K7C A;  1CEW I;  1DMQ A;  3LTB A;  1JKG A;  1M1X B;  2F86 B;  3GAX A;  3LTD A;  3NBJ A;  4FMA A;  5FW5 A;  3IJE B;  5TGN A;  1NWW A;  2HMM B;  3FCS B;  1N5H A;  2Z76 A;  3BB9 A;  5EEO A;  3FSD A;  1OUN A;  3LML A;  2Z7A A;  1RKY A;  4N6T A;  2P38 A;  1G96 A;  1J2B A;  2BHM A;  2BT3 A;  1M9G A;  4FCJ A;  2JDI H;  3STD A;  1EA2 A;  1YVB I;  3F8H A;  2BMR B;  2CFD A;  1AV4 A;  3E99 A;  1FGR A;  3PGB A;  2YX9 A;  3CCR 3;  3EBY A;  4XBX A;  4L8P A;  1JJ2 2;  2W04 A;  5KP1 A;  1STF I;  2OQE C;  3G16 A;  4R80 A;  1GD3 A;  3K0Z A;  1OCV A;  2W0Q A;  3MG3 A;  3DZL A;  3PCR A;  3JUP A;  4J9A A;  2PZV A;  2P0M A;  1E97 A;  4HM2 B;  3QK9 A;  4MEI A;  4N6V 0;  3X42 A;  3CME 3;  3EX9 A;  2QGU A;  1WQL B;  1TFK A;  2XFT A;  3MHE A;  4O02 B;  3OWS A;  4XBT A;  3S5C A;  3TDG A;  1YIJ 3;  4G1M B;  1IVX A;  1PU4 A;  3MG1 A;  1A2K A;  1YI2 3;  5IG4 A;  5CF2 A;  3CCL 3;  3EF8 A;  3ER7 A;  3LXU X;  1LOX A;  1OGX A;  2Q07 A;  4HZB B;  4X2O A;  3X3Y A;  1E3V A;  3GZX B;  1MOL A;  3K63 A;  1W7C A;  3VGN A;  2GXF A;  4LSO A;  4MMY B;  3X41 A;  3PYJ A;  1NO3 A;  4L7K A;  1IK3 A;  3F14 A;  1W5Z A;  2A15 A;  3FKA A;  3FG3 A;  2W03 A;  3JUN A;  4XBY A;  4PEJ A;  4EBG A;  2KCD A;  1IT8 A;  3WDG B;  1VQM 3;  1W2B 2;  3CMA 3;  3MKI A;  2XF3 A;  3GZB A;  4K61 A;  3S27 A;  2Z6B A;  4RZM A;  4AKZ A;  1W6C A;  2XGN A;  4HM5 B;  2OCT A;  3T0U A;  3GZY B;  2GEY A;  5AIG A;  2YFL B;  4HM3 B;  1FGQ A;  3CCE 3;  4OUQ A;  5KP3 A;  4EYC A;  4RBN A;  4WYK A;  4ZM8 A;  4OVM A;  1Q7Y 4;  4N6O B;  2KXG A;  5EQL A;  1TUH A;  1F8N A;  3UNL A;  1WTH A;  2W9Q A;  1GY7 A;  1FA3 A;  1W2Z A;  3RGA A;  1IU7 A;  4MMZ B;  5AEW B;  4MJD A;  3CC4 3;  1A2V A;  1OF5 A;  3PZW A;  1V74 A;  4IPB A;  1K8A 4;  2K0M A;  3U97 A;  1IQX A;  5DRV A;  3CCJ 3;  1ULJ B;  2GBX B;  3LT9 A;  2BNG A;  2QIY A;  1RJO A;  2OWP A;  3CPW 2;  3UJM A;  2BMO B;  4HM1 B;  2CG1 A;  2HML B;  4XB5 A;  2CWV A;  1FUW A;  3BNB A;  2STD A;  3FLJ A;  1VQL 3;  3U1W A;  1N8R 4;  1IV7 A;  5HGR A;  3G4S 3;  2ZL8 A;  4OK0 A;  3NBR A;  3NHX A;  1RRH A;  2RCD A;  1CYV A;  3KSE D;  4R4K A;  4WWU C;  2XR8 B;  4KFF A;  2I9W A;  4RNY A;  3FG4 A;  1HKX A;  1WMP A;  2BO9 B;  1O7M B;  1QAL A;  2R4I A;  5CK6 A;  5AIH A;  3LH4 A;  3MWZ A;  3SVA A;  1LXE A;  1OHP A;  2XH9 A;  1K9M 4;  4WFO A;  4WHA A;  1ISK A;  2XSO B;  5CXO A;  1W6G A;  1O7G B;  2V1L A;  2XFS A;  1VQ9 3;  2W6J H;  1NU3 A;  1CQS A;  3F9S A;  6STD A;  2E2T A;  4JF8 A;  1BUQ A;  4O3V A;  3PXM A;  3HII A;  3WA3 A;  3LT8 A;  3K5T A;  3MYT A;  3UL6 A;  1GD4 A;  3EQQ B;  3G6E 3;  4BTW A;  3HK4 A;  4XM4 A;  2GBW B;  2KRT A;  3CPO A;  1QAF A;  1L5G B;  4HKV B;  1WNH A;  3N8B A;  4R9K A;  2W56 B;  3WMD A;  1JN5 B;  3EC9 A;  4BTY A;  8CHO A;  7STD A;  4NRE A;  2E2U A;  2HMJ B;  1Q40 B;  2Y73 A;  5FGO A;  4EXR A;  1KWI A;  1YGE A;  2B1X B;  4HM4 B;  1ROA A;  1ZO2 A;  3EE1 A;  3NV0 B;  4I4K A;  5BXQ A;  1R4C A;  3EN8 A;  2CFW A;  1OPY A;  1W6Y A;  1GYB A;  1SII A;  3EBT A;  3FF2 A;  2MC8 A;  1U8C B;  2WOH A;  4N3V A;  1ROV A;  1N9E A;  1DMM A;  4RNZ A;  3VSY A;  4N6L A;  1GS3 A;  1QMA A;  4N6M A;  3AMO B;  1IV9 A;  1IVV A;  1LNH A;  4N6N B;  1VQ7 3;  1YJW 3;  1IQY A;  4L8O A;  1O7P B;  5STD A;  1RN7 A;  3EB8 A;  3MPH A;  1JB2 A;  1SPU A;  2OOV C;  4N6U A;  5LC6 A;  1DVC A;  2GU3 A;  3OWY A;  1VQ4 3;  5KP4 A;  3OV4 A;  5CF1 A;  1TU5 A;  2W9P A;  3X3Z A;  5JBS A;  3S67 A;  3CNM A;  1KC8 4;  3NUV A;  1VQ6 3;  3DGL A;  3J7Y d;  1RRL A;  5AYR B;  3CD6 3;  4CCV A;  2W2C A;  3Q2P A;  3HI7 A;  3NM7 A;  4J8T A;  1KSI A;  3DMC A;  3BND A;  2D42 A;  3CCV 3;  2WO0 A;  1QVG 2;  3FZW A;  1A90 A;  5DRE A;  1TP6 A;  3B4P A;  3MSO A;  3T8N A;  1W00 A;  3DUK A;  2E2V A;  2OTJ 3;  1JRQ A;  2M7O A;  3V99 A;  2RGQ A;  1AVL A;  3HZP A;  3UL5 A;  5IG3 A;  3PCS A;  4AKY A;  1JN5 A;  3OXA A;  2WGO A;  3S29 A;  2C11 A;  1Q81 4;  2CFL A;  3WA2 X;  5A0O B;  4HM8 B;  5D82 A;  3NV0 A;  1UW1 A;  4STD A;  4IT7 A;  5IER A;  5BVB A;  3I55 3;  1O7N B;  2UX0 A;  1D6U A;  4ORL A;  3F7X A;  3LYG A;  3CC7 3;  1VQ8 3;  1EG9 B;  3B4O A;  5LC7 A;  1DYU A;  1OGZ A;  4K90 B;  4FCZ A;  5AI1 A;  4HJL B;  3FH1 A;  1VQP 3;  5AYS C;  2HMK B;  3JUO A;  4JRF A;  3Q1C A;  1ZX2 A;  3DGM A;  1TFO A;  2INX A;  4HYZ A;  4GL6 A;  1YIT 3;  2IA7 A;  1GY5 A;  1K41 A;  1Q42 A;  2XRX B;  2K54 A;  2D1W A;  4EV2 A;  3WOE B;  1STD A;  1OHS A;  3FF0 A;  4H3U A;  1IVW A;  1VQK 3;  1AR0 A;  3NM2 A;  4R9L A;  1C7H A;  1LVN A;  1IQ8 A;  1HU9 A;  1VQ5 3;  3NQY A;  4FMC A;  2LYX A;  3D9R A;  3IPT A;  4EV5 A;  5IG5 A;  2OQE A;  1S72 3;  3CCU 3;  3CNX A;  2CHC A;  2XGL A;  3WOD G;  3MG2 A;  4FR9 A;  2QEX 3;  3CU3 A;  1MNL A;  2B24 B;  2O3O A;  1JNQ A;  4NHF A;  5D81 A;  4KZ1 A;  3PS8 A;  5I97 A;  3NBB A;  2Y74 A;  4CDL A;  1VZZ A;  3O8Y A;  1UI7 A;  1YHQ 3;  1YJN 3;  1M1K 4;  2ML5 A;  3VF1 A;  1NDO B;  3X3X A;  1NB5 I;  1W01 A;  5AII A;  3K9M C;  4HM7 B;  3H51 A;  3RGR A;  4HVN A;  1NJI 4;  4MMX B;  4Q53 A;  2RFR A;  1KD1 4;  3NX0 A;  3N54 B;  3LZA A;  2WGQ A;  4TX4 A;  2HMO B;  3FGY A;  3BNE A;  4LGQ A;  2IUK A;  2CG0 A;  3G8Z A;  1KQS 2;  3OWU A;  1D6Y A;  2XSH B;  3KKG A;  3CCM 3;  3HX8 A;  3EJV A;  3OW2 2;  4LEH A;  5IG0 A;  1NB3 I;  1UUV B;  2PNC A;  3B8L A;  3F8X A;  5IEP A;  1PFP A;  2F98 A;  2F99 A;  4FCM A;  4GB5 A;  3V98 A;  2CH9 A;  1Z1S A;  1S5A A;  2IUJ A;  1TIJ A;  3SX1 A;  2C10 A;  3DY5 A;  3D3L A;  2P0X A;  2SBL A;  4KVH A;  1VQO 3;  3SOA A;  4R1K A;  3KII A;  3JUQ A;  4WYK B;  3CXC 2;  1E3R A;  3QRD A;  1EKM A;  4HBR A;  3EN1 B;  1N8Q A;  3DGN A;  4HZ9 B;  1ULI B;  4HM6 B;  4XDW A;  3I56 3;  3EHC A;  4WP5 A;  2QA4 3;  4AEQ A;  3B7C A;  3DXO A;  4HM0 B;  1IVU A;  1OHO A;  4FMD A;  4KFD A;  1D6Z A;  3UB1 A;  1CYU A;  1U5O A;  1EQK A;  3M8C A;  3V92 A;  1OAC A;  2FGT A;  1OF5 B;  2CFG A;  3CCS 3;  3KN4 A;  2GU1 A;  3HIG A;  2Z77 A;  2CC3 A;  1JB4 A;  3SED A;  2YFI B;  3GZR A;  3IMA B;  4O2H A;  2MF7 A;  1QJG A;  3CCQ 3;  2L4V A;  5ELJ A;  4LMI A;  1WMN A;  5ELU A;  3NQZ A;  2XEP A;  5D83 A;  4LZI A;  2ML6 A;  4BTX A;  3L0R A;  1N9J A;  3ROB A;  5IF6 A;  2CKF B;  4H61 A;  4K1V A;  3LTA A;  3FG1 A;  2W56 A;  2RSX A;  3T8U A;  5EVH A;  4QWT A;  5IEO A;  1Q40 A;  5JPP A;  3F40 A;  1FGO A;  4X2H A;  2CFK A;  2FXT A;  1YJ9 3;  1IDP A;  2FNQ A;  3NXJ A;  3LTC A;  3GRD A;  1JKG B;  3BNC A;  3SOY A;  4O8S A;  2CIU A;  3ECF A;  2ZDJ A;  2JQ5 A;  3SLU A;  3SXX A;  4IIA A;  5IEN A;  3CC2 3;  1SIH A;  1WMO A;  5CLK A;  1QVF 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...