1UUWB

Naphthalene 1,2-dioxygenase with nitric oxide bound in the active site.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuwB00
3H3HA 3JUQA 1O7HB 4STDA 2HMNB 5CF1A 7STDA 1ULJB 1JB4A 1OHOA 3E99A 4FCJA 1OPYA 4XDVA 3JUOA 2GEYA 3ER7A 3UNLA 2INXA 1GS3A 3BLZA 3F40A 1OF5A 2R4IA 3EBYA 5AIFA 3SOYA 1EG9B 5IG0A 5IF6A 2F99A 3MG1A 2GEXA 3K7CA 4WYKA 3S5CA 2BMOB 2HMOB 5DREA 1GYBA 1O7NB 4IIAA 3LYGA 3I0YA 1K41A 3KZTA 3BB9A 1HKXA 2HMKB 3NBRA 2A15A 4OUQA 4XDWA 3F8XA 1JN5A 3VGNA 3G16A 4LEHA 3EX9A 3CU3A 3NM2A 3F7XA 3Q90A 3ECFA 3KE7A 4K1VA 1OCVA 3LZAA 4OVMA 1JKGA 3STDA 3VSYA 8CHOA 4PEJA 4U13A 3OWYA 5IERA 2K54A 3NUVA 1SJWA 5IEPA 3JUMA 5AIIA 1TP6A 1IDPA 3FGYA 5AEWB 2B1XB 3EF8A 3EN1B 4XBXA 1S5AA 1W02A 2BMRB 2Z7AA 3MKIA 1TUHA 3SOAA 1W00A 5AEUB 1Z1SA 5IENA 1GY7A 3UJMA 5JPPA 2GBWB 4I4KA 3B4OA 4XBTA 1OUNA 5D82A 5EVHA 5IG5A 1ULIB 4R9LA 3RGRA 2PZVA 4HKVB 3B7CA 5AI1A 2XRXB 4N3VA 3T8NA 3DXOA 1AR0A 4RZMA 3DM8A 1U5OA 5KP1A 2STDA 4LGQA 1W6YA 3F9SA 5IEOA 1DMNA 1DMQA 4MJDA 1ISKA 1UUVB 1O7PB 1NDOB 1Q40B 1UUWB 5BXQA 1E97A 1OHSA 1ZO2A 4HM8B 3K0ZA 2IMJA 3D9RA 2Z76A 2CKFB 2W2CA 3NV0B 3FLJA 1ASKA 4J8TA 1A2KA 4HM6B 4HJLB 4WWUC 3GZXB 3MG2A 5KP3A 1VZZA 2RCDA 5STDA 1OHPA 1QJGA 4XM4A 5IG4A 4HZ9B 4HM1B 1DMMA 5D81A 2HMJB 3FKAA 3G8ZA 2BMQB 3KSPA 4Q53A 4WP5A 3MYTA 4H3UA 4HVNA 2CHCA 2GBXB 4WYKB 3HK4A 4GB5A 1CQSA 3CNMA 4J9AA 3EHCA 3OWSA 3JUPA 3A76A 4HM3B 4K1UA 5JPUA 1JN5B 3CPOA 2XSHB 5BVBA 3FSDA 4L8OA 1GY5A 4R9KA 3DZLA 4HM4B 3F8HA 1OGZA 3DUKA 2RFRA 3MHEA 3GWRA 5HGRA 4FCMA 3MG3A 4CDLA 3F14A 1JKGB 3NXJA 3F7SA 1W01A 3GZBA 5D83A 3RGAA 2RGQA 1E3VA 4LMIA 3CNXA 3EQQB 3EC9A 1Q42A 3H51A 3HX8A 5G2GA 1OGXA 5CXOA 1O7GB 1NWWA 5FW5A 3FF2A 3OX9A 2HMLB 1JB5A 2XR8B 1WQLB 2I9WA 1BUQA 6STDA 3KKGA 4HZBB 2QIYA 5CLKA 5AIGA 4HM0B 1O7WB 5CF2A 2Z77A 2XSOB 5TGNA 1GY6A 1NU3A 2F98A 2HMMB 1EA2A 4HM5B 5DRVA 5KP4A 4L8PA 3JUNA 1OF5B 3EBTA 3T8UA 3OWUA 1E3RA 3OV4A 4ORLA 3B4PA 3ROBA 3WMDA 4R1KA 3NHXA 1JB2A 3FZWA 4X2OA 4XB5A 3EN8A 2UX0A 3GZRA 3B8LA 5CK6A 5IG3A 3G0KA 2YFLB 3DMCA 2YFJB 3IPTA 3SEDA 2GXFA 1ZX2A 3MSOA 2JQ5A 1STDA 4L7KA 5AIHA 2OWPA 3FH1A 2QGUA 1QMAA 2B24B 3M8CA 4KVHA 1Q40A 3GZYB 3EJVA 4X2HA 3OXAA 1O7MB 1OH0A 2YFIB 3GRDA 4HM7B 3HZPA 3NV0A 4HM2B 1C7HA 3FF0A 2F86B 2BNGA 4XBYA
chains in the Genus database with same CATH superfamily
3H3HA 3JUQA 2P0MA 1O7HB 1T3BA 1Q814 1VQO3 4STDA 1LRAA 2CIUA 2HMNB 2P0XA 2W04A 4N6LA 1BU4A 5CF1A 7STDA 1X1WA 1ULJB 2E2VA 3UB1A 3IJEB 1IV7A 2CWTA 1JB4A 1LVNA 3GSPA 1OHOA 1K734 2CW9A 1IQ8A 1IVVA 1LOYA 3E99A 4FCJA 1OPYA 1BNRA 4AKYA 4EV5A 1S723 5G1LA 4XDVA 1A2PA 1D6ZA 5A0OB 1GMRA 3JUOA 1LOVA 1GOYA 1U8CB 1UCJA 2GEYA 1BSDA 2INXA 3ER7A 3UNLA 1GS3A 4DKIA 7GSPA 3BLZA 3F40A 1OF5A 3PZWA 1D6UA 2OOVA 3X40A 3HIIA 2R4IA 3X41A 3EBYA 5AIFA 2Y74A 3SOYA 1EG9B 5IG0A 2WO0A 5IF6A 1BVIA 3S28A 2RBIA 1RGFA 4FMBA 1MOLA 2F99A 4HBRA 6RNTA 1QVG2 3MG1A 2GEXA 1BNIA 3K7CA 4N6V0 3TDGA 1FUSA 4WYKA 3S5CA 1D6YA 1GSPA 2BMOB 1WTHA 2F5WA 2HMOB 1FZUA 5DREA 1GYBA 3RNTA 3U97A 1GMQA 1O7NB 2CWUA 3V99A 1FUTA 3EE1A 4IIAA 4N6MA 3LYGA 3I0YA 1BAOA 4LSOA 1K41A 2Z6BA 3UL5A 1SQWA 3KZTA 3BB9A 1HKXA 2HMKB 3NBRA 2A15A 4OUQA 4XDWA 1AY7A 3WA3A 1FUWA 3F8XA 3LT9A 1YJW3 4IPBA 3Q2PA 3SYUA 2KF4A 2C10A 3LTDA 2W03A 3DGYA 1TFKA 2MF7A 1JN5A 3VGNA 3G16A 1UI7A 1K28A 1IVUA 1X1YA 1BRSA 2GSPA 2CX1A 4AEQA 4LEHA 3CC43 3O8YA 1YJ93 1UGIA 3EX9A 1N9JA 2GU1A 1BRHA 1B21A 3CU3A 1IK3A 4HAAA 2WOFA 4R80A 3NM2A 3F7XA 3CCQ3 1VQ53 3Q90A 3ECFA 3KE7A 3AGNA 3SXXA 7RNTA 1RHLA 4HYZA 1QALA 1WMOA 1YJN3 2L1SA 4K1VA 2O9UX 2W0QA 1IT7A 1OCVA 1JBSA 2ML6A 3LZAA 3WR2A 2IUJA 2BU4A 3NQZA 2CG0A 1TRPA 4EBGA 1IYYA 4OVMA 3S27A 1X1XA 1N8R4 3BNBA 3D5GA 1VQK3 2SARA 1L5GB 5AYRB 3CPW2 1JKGA 4J5GA 2H0HA 1B2ZA 2Q07A 3STDA 1IT8A 1UDII 1AVKA 3MWZA 2GU3A 3ALAA 3VSYA 8CHOA 1JBTA 2XEPA 1V58A 4FR9A 4K61A 4PEJA 4U13A 3OWYA 4BIRA 1N8QA 3CCV3 3CD63 2WOHA 3L0RA 5IERA 2K54A 3NUVA 2OOVC 1I2FA 3UL6A 4K90B 3DGOA 1SJWA 4O8SA 1SPUA 2KCDA 3JUMA 5AIIA 4O2HA 5IEPA 3CC23 1TP6A 1CYUA 1NO3A 2FXTA 1VQN3 4RNTA 1IDPA 1M904 3FGYA 1FW7A 5AEWB 3KSED 2B1XB 3EF8A 1RN7A 4KZ1A 1JJ22 2OQEA 4ZM8A 3Q1CA 3DGNA 2W9PA 1STFI 3EN1B 1S5AA 4XBXA 1W02A 2BMRB 2CFGA 2W56B 1VQ83 3LTBA 1JV2B 2Z7AA 3MKIA 1TUHA 3SOAA 3G713 4N6UA 1W00A 1RRLA 1Z1SA 1RGGA 5AEUB 5IENA 5IW9A 4EV2A 4EC6A 2IA7A 1M1K4 1GY7A 1N5PA 1KQS2 3KIIA 3UJMA 5JPPA 2GBWB 4FCZA 4EW5A 1EUIC 2RSXA 4WFOA 3ZFZA 4I4KA 3PXMA 1B2SA 1YGEA 3B4OA 4XBTA 2OTJ3 1OUNA 5D82A 1GOUA 1RSNA 1MWSA 5FGOA 5EVHA 4CCVA 5IG5A 1QVF2 1DE3A 1ULIB 4G1MB 4R9LA 3RGRA 1WMNA 3CCJ3 1CYVA 2CFWA 1EKMA 2PZVA 3HI7A 4HKVB 5BU4A 1LQGC 3HOHA 3B7CA 5AI1A 2XRXB 2JDIH 4N3VA 3T8NA 1RGKA 3I563 1I2GA 2BIRA 1W5ZA 1BRIA 1G02A 1ROVA 4MMZB 5ELUA 1I0VA 3G6E3 2H0IA 3CCR3 1US1A 3DXOA 1RJOA 1BIRA 1AVLA 1AR0A 4RZMA 2D1WA 2KAAA 1U5OA 3DM8A 1QAKA 2XH9A 5KP1A 2STDA 4LGQA 1VQ43 3LH4A 1W6YA 2IY2A 1FGMA 3F9SA 5IEOA 1DMNA 1I8VA 3N8BA 4O02B 1RGEA 3LMLA 3SX1A 1HU9A 1DMQA 1LOWA 8RNTA 1TJDA 1AV4A 4MJDA 2CWVA 1ISKA 3IMAB 1B27A 2H0GA 4N6TA 1LXEA 1UUVB 1LNHA 4BL2A 1O7PB 1NDOB 1Q40B 1OACA 1UUWB 2KXGA 4FMDA 1R4YA 5RNTA 2CFLA 3AHSA 1MWRA 3WODG 3LTAA 1FGTA 1E97A 1OHSA 5BXQA 2YX9A 2O3OA 5LC7A 1ZO2A 3D4AA 4HM8B 3K0ZA 1BUJA 1BSAA 1JZDA 1W2B2 2K0MA 2W6JH 1A67A 1DVDA 1T5YA 2OQEC 2IMJA 1YIJ3 3D9RA 2E2UA 2Z76A 2CKFB 3NX0A 1TRQA 2C4BA 2W2CA 3LOYA 3NV0B 2CG1A 1Q7Y4 3FLJA 4MEIA 2F5MA 4O3VA 1ASKA 4RNZA 4R4KA 1VQQA 1B2MA 4J8TA 1LQMB 2XFSA 3NM7A 4GHOA 3V98A 1A2KA 4BL3A 1T2IA 4HM6B 4HJLB 4WWUC 2HOHA 2KF5A 6GSPA 3G4S3 2P38A 3BNDA 3GZXB 3MG2A 5KP3A 1VZZA 3AMOA 3D3LA 3SVAA 4BTYA 2RCDA 5STDA 1QJGA 4XM4A 3A5EA 3D79A 1BSBA 4NPBA 1TTOA 5IG4A 3FCSB 4HZ9B 3PYJA 1RN1A 4HM1B 1DMMA 5D81A 2HMJB 3FKAA 2CFKA 1RGAA 3G8ZA 2BMQB 1BANA 5EQLA 3KSPA 4GSPA 3DGLA 4Q53A 4H61A 4WP5A 4LYLB 1UGHI 3T0UA 2BNGA 1MGWA 1IVWA 4LZIA 1DVCA 1MWTA 3MYTA 4H3UA 4GL6A 1G0TA 2PNCA 3D5IA 1I3FA 1SARA 3FG1A 4WHAA 4HVNA 3URPA 1X1UA 5JBSA 2CHCA 2CFDA 2E2TA 4RBNA 3WHOA 3X3XA 3EB8A 3NBJA 2GBXB 1IQYA 2FNQA 2ZDJA 3HK4A 4WYKB 2XFTA 1PFPA 1RGLA 4GB5A 1GD3A 4JRFA 1PYLA 1CQSA 2KRTA 2R41A 2XF3A 1BRJA 1BSEA 5BIRA 2XGLA 3CNMA 4J5KA 4J9AA 1CH0A 3EHCA 1NB5I 3OWSA 1NNVA 2L4VA 2F4YA 3CCS3 2P05A 3CCM3 2UUGC 2KF3A 3JUPA 1IVXA 5M18A 5AYSC 1KWIA 1BNGA 3A76A 4FMCA 4HM3B 2M7OA 4IT7A 4K1UA 5GSPA 1YVSA 1F8NA 4BTWA 1LNIA 1BNJA 2CC3A 3S29A 5JPUA 1Q824 1GD4A 1RGHA 9RNTA 2CK3H 1JN5B 1VQ63 3CPOA 2LYXA 1BOXA 1JRQA 1DYUA 2XSHB 5BVBA 3DH2A 3FSDA 1EQKA 1FGQA 1WMPA 3X42A 3ZG5A 4BU4A 1TU5A 4L8OA 3PCSA 1GY5A 4R9KA 2V1LA 3I553 4RNYA 3V92A 3DZLA 2D42A 3LTCA 1HYFA 3NQYA 4HM4B 3F8HA 1J2BA 1OGZA 3DUKA 1LOXA 4ILFA 3K9MC 3PCRA 2RFRA 1Q9EA 1I2EA 1GOVA 3KFQC 1YNVX 2CH9A 3MHEA 3GWRA 1A90A 2BO9B 2W9QA 5HGRA 4FCMA 3GAXA 3MG3A 1BGSA 1B20A 1YVBI 4CDLA 1VQM3 1UI8A 3F14A 1VQ93 1JKGB 2ML5A 4FMAA 3NXJA 1I70A 3F7SA 1W01A 3GZBA 5D83A 1G96A 1V57A 3RGAA 2QEX3 1T2HA 2IYJA 4CPKA 3J7Yd 2RGQA 1K8A4 1N9EA 1W6GA 3K5TA 1E3VA 2SBLA 4LMIA 3CNXA 3RDEA 5M19A 2AADA 4NREA 1RN4A 1RKYA 1W7CA 1KC84 3CCU3 3EQQB 1GMPA 1KD14 1KSIA 3EC9A 3FG4A 4QWTA 1CEWI 1Q42A 3H51A 3HX8A 1SIHA 5G1KA 3AGOA 1OGXA 5G2GA 1RNTA 3WOFB 1W2ZA 5CXOA 1RTUA 1O7GB 3KN4A 3BNEA 1JNQA 1NWWA 3SLUA 1Q864 3LT8A 5FW5A 3FF2A 4EXRA 2FGTA 3K63A 1I0XA 1YIT3 4JF8A 3OX9A 1YHQ3 1RDSA 2HMLB 2Y73A 4HOHA 1JB5A 2OTL3 1HZ1A 2OCTA 3QRDA 1FA3A 2XR8B 1WQLB 2I9WA 1BUQA 2MC8A 6STDA 3KKGA 4KFDA 1NJI4 5HOHA 1IU7A 1WNHA 4HZBB 2QIYA 5CLKA 2J8XB 5AIGA 1Y4KA 4HM0B 3CCL3 1O7WB 3HIGA 4EYCA 1MNLA 1DETA 3DGMA 3JVCA 3Q3FA 4NHFA 1UW1A 5CF2A 1VQL3 2RNTA 2Z77A 1MWUA 1C54A 1TFOA 2W56A 2XSOB 1BNSA 3CC73 5TGNA 1GY6A 1NU3A 2F98A 2HMMB 1EA2A 5LC6A 4I5QA 2ZA4A 2UGIA 4HM5B 3OW22 1MGRA 3FG3A 1JZOA 2IUKA 5DRVA 5KP4A 3X3ZA 1PY3A 4L8PA 3NBBA 2QA43 3JUNA 2BT3A 1M1XB 1OF5B 2LQVA 3EBTA 2WGQA 1EEJA 1B3SA 1RCKA 1UCLA 3N9HA 4MMYB 3MPHA 1NB3I 3T8UA 4AKZA 4CJNA 1VQP3 3OWUA 1E3RA 3OV4A 4BTXA 4ORLA 3B4PA 1R4CA 2KF6A 1B2UA 3ROBA 3WMDA 1QAFA 1W6CA 4R1KA 3CMA3 3NHXA 1JB2A 1ZS7A 3WOEB 1AQZA 2CX0A 3FZWA 1BRKA 4X2OA 4XB5A 3EN8A 3PGBA 1BNFA 4KFEA 3U1WA 5M1AA 2UX0A 3GZRA 3PS8A 1BRNL 3B8LA 5CK6A 5IG3A 3G0KA 5EEOA 3LXUX 2P09A 2YFLB 3BIRA 4N6NB 1K9M4 1FGOA 3DMCA 2YFJB 4KT3B 3IPTA 4OK0A 1BRGA 3ZG0A 3SEDA 1RLSA 2XGNA 2GXFA 5ELJA 1JBRA 2ZHXB 3KCHA 1ZX2A 1IV9A 3AHWA 4N6OB 3MSOA 1VQ73 2JQ5A 1Q7HA 1ROAA 1BNEA 1STDA 1BSCA 5I97A 1FGRA 2AAEA 1PU4A 4L7KA 3CCE3 1RNBA 5AIHA 1UCKA 2ZL8A 2C11A 2OWPA 4TX4A 3CXC2 1I3IA 3FH1A 4KFFA 2QGUA 1QMAA 2B24B 1A2VA 3AMOB 3VF1A 4MMXB 3WA2X 3M8CA 3CME3 1V74A 2WGOA 1UUGB 4KVHA 3X3YA 1B2XA 1Q40A 3GZYB 3EJVA 1FYSA 1YGWA 4X2HA 1RGCA 1YI23 3DY5A 2K3DA 3OXAA 1RMSA 1O7MB 1OH0A 1M9GA 3S67A 1RCLA 2YFIB 3GRDA 4HM7B 2F56A 1SIIA 3HZPA 2BHMA 3BU4A 3NV0A 3QK9A 4HM2B 1IQXA 3N54B 1ZGXA 1C7HA 3BNCA 1UCIA 3FF0A 1N5HA 1W4NA 3WDGB 1TIJA 2F86B 1RRHA 1OHPA 4XBYA
chains in the Genus database with same CATH topology
3H3HA 3JUQA 2P0MA 1O7HB 1Q814 1VQO3 4STDA 2P0XA 2CIUA 2HMNB 2W04A 4N6LA 5CF1A 7STDA 1ULJB 2E2VA 3UB1A 3IJEB 1IV7A 2CWTA 1JB4A 1LVNA 1OHOA 1K734 2CW9A 1IQ8A 1IVVA 3E99A 4FCJA 1OPYA 4AKYA 4EV5A 1S723 4XDVA 1D6ZA 5A0OB 3JUOA 1U8CB 2GEYA 3ER7A 3UNLA 3OW22 2INXA 1GS3A 3BLZA 3F40A 1OF5A 3PZWA 1D6UA 2OOVA 3X40A 3HIIA 2R4IA 3X41A 3EBYA 5AIFA 2Y74A 3SOYA 1EG9B 5IG0A 2WO0A 5IF6A 3S28A 4FMBA 1MOLA 2F99A 4HBRA 1QVG2 3MG1A 2GEXA 3K7CA 4N6V0 3TDGA 4WYKA 3S5CA 1D6YA 2BMOB 1WTHA 2HMOB 5DREA 1GYBA 3U97A 3V99A 1O7NB 2CWUA 3EE1A 4IIAA 4N6MA 3LYGA 3I0YA 4LSOA 1K41A 2Z6BA 3UL5A 1SQWA 3KZTA 3BB9A 1HKXA 2HMKB 3NBRA 2A15A 4OUQA 4XDWA 3WA3A 1FUWA 3F8XA 3LT9A 1YJW3 4IPBA 3Q2PA 2C10A 3LTDA 2W03A 1TFKA 2MF7A 1JN5A 3VGNA 3G16A 1UI7A 1K28A 1IVUA 4AEQA 4LEHA 3CC43 3O8YA 1YJ93 3EX9A 1N9JA 2GU1A 1IK3A 3CU3A 2WOFA 4R80A 3NM2A 3F7XA 3CCQ3 1VQ53 3Q90A 3ECFA 3KE7A 3SXXA 4HYZA 1QALA 1WMOA 1YJN3 4K1VA 2O9UX 2W0QA 1IT7A 1OCVA 2ML6A 3LZAA 2IUJA 3NQZA 2CG0A 4EBGA 4OVMA 3S27A 1N8R4 3BNBA 1VQK3 1L5GB 3CPW2 1JKGA 3STDA 2Q07A 1IT8A 3VSYA 1AVKA 3MWZA 2GU3A 3ALAA 8CHOA 2XEPA 4FR9A 4K61A 4PEJA 4U13A 3OWYA 3CCV3 1N8QA 3CD63 2WOHA 3L0RA 5IERA 2K54A 3NUVA 2OOVC 3UL6A 4K90B 3DGOA 1SJWA 4O8SA 1SPUA 2KCDA 3JUMA 5AIIA 4O2HA 5IEPA 3CC23 1TP6A 1CYUA 1NO3A 2FXTA 1VQN3 1IDPA 1M904 3FGYA 5AEWB 3KSED 2B1XB 3EF8A 1RN7A 4KZ1A 1JJ22 2OQEA 4ZM8A 3Q1CA 3DGNA 2W9PA 1STFI 3EN1B 1S5AA 4XBXA 1W02A 2BMRB 2CFGA 2W56B 1VQ83 3LTBA 1JV2B 2Z7AA 3MKIA 1TUHA 3SOAA 3G713 4N6UA 1W00A 1RRLA 1Z1SA 5AEUB 5IENA 5IW9A 4EV2A 4EC6A 2IA7A 1M1K4 1GY7A 1N5PA 1KQS2 3KIIA 3UJMA 5JPPA 2GBWB 4FCZA 2RSXA 4WFOA 4I4KA 3PXMA 1YGEA 3B4OA 4XBTA 2OTJ3 1OUNA 5D82A 5FGOA 5EVHA 4CCVA 5IG5A 1QVF2 1ULIB 4G1MB 4R9LA 3RGRA 1WMNA 3CCJ3 1CYVA 2CFWA 1EKMA 2PZVA 3HI7A 4HKVB 3B7CA 5AI1A 2XRXB 2JDIH 4N3VA 3T8NA 3I563 1W5ZA 1ROVA 4MMZB 5ELUA 3G6E3 3CCR3 1US1A 3DXOA 1RJOA 1AVLA 1AR0A 4RZMA 2D1WA 3DM8A 1U5OA 1QAKA 2XH9A 5KP1A 2STDA 4LGQA 1VQ43 3LH4A 1W6YA 1FGMA 3F9SA 5IEOA 1DMNA 3N8BA 4O02B 3LMLA 3SX1A 1HU9A 1DMQA 1AV4A 4MJDA 2CWVA 1ISKA 3IMAB 4N6TA 1LXEA 1UUVB 1LNHA 1O7PB 1NDOB 1Q40B 1OACA 1UUWB 2KXGA 4FMDA 2CFLA 3WODG 3LTAA 1FGTA 1E97A 1OHSA 5BXQA 2YX9A 2O3OA 5LC7A 1ZO2A 4HM8B 3K0ZA 1W2B2 1A67A 2K0MA 2W6JH 1DVDA 1T5YA 2OQEC 2IMJA 1YIJ3 3D9RA 2E2UA 2Z76A 2CKFB 3NX0A 2W2CA 3LOYA 3NV0B 2CG1A 1Q7Y4 3FLJA 4MEIA 4O3VA 1ASKA 4RNZA 4R4KA 4J8TA 3NM7A 2XFSA 3V98A 1A2KA 4HM6B 3G4S3 4HJLB 4WWUC 2P38A 3BNDA 3GZXB 3MG2A 5KP3A 1VZZA 3AMOA 3D3LA 3SVAA 4BTYA 2RCDA 5STDA 1OHPA 1QJGA 4XM4A 5IG4A 3FCSB 4HZ9B 3PYJA 4HM1B 1DMMA 5D81A 2HMJB 3FKAA 2CFKA 5EQLA 3G8ZA 2BMQB 3KSPA 3DGLA 4Q53A 4H61A 4WP5A 3T0UA 1IVWA 4LZIA 1DVCA 3MYTA 4H3UA 4GL6A 2PNCA 3FG1A 4WHAA 4HVNA 5JBSA 2CHCA 2CFDA 2E2TA 4RBNA 3X3XA 3EB8A 3NBJA 2GBXB 1IQYA 2FNQA 2ZDJA 3HK4A 4WYKB 2XFTA 1PFPA 4GB5A 5AYRB 1GD3A 4JRFA 2XF3A 1CQSA 2KRTA 2XGLA 3CNMA 4J9AA 3EHCA 1NB5I 3OWSA 2L4VA 3CCS3 2P05A 3CCM3 3JUPA 1IVXA 5AYSC 1KWIA 3A76A 4FMCA 4HM3B 2M7OA 4IT7A 4K1UA 1F8NA 4BTWA 2CC3A 3S29A 5JPUA 1Q824 1GD4A 2CK3H 1JN5B 1VQ63 3CPOA 2LYXA 1JRQA 1DYUA 2XSHB 5BVBA 3FSDA 1EQKA 1FGQA 1WMPA 3X42A 1TU5A 4L8OA 3PCSA 1GY5A 4R9KA 2V1LA 3I553 4RNYA 3V92A 3DZLA 2D42A 3LTCA 3NQYA 4HM4B 3F8HA 1J2BA 1OGZA 3DUKA 1LOXA 3K9MC 3PCRA 2RFRA 3KFQC 2CH9A 3MHEA 3GWRA 1A90A 2BO9B 2W9QA 5HGRA 4FCMA 3GAXA 3MG3A 4CDLA 1YVBI 1VQM3 1UI8A 3F14A 1VQ93 1JKGB 2ML5A 4FMAA 3NXJA 3F7SA 1W01A 3GZBA 5D83A 1G96A 3RGAA 2QEX3 3J7Yd 2RGQA 1K8A4 1N9EA 1W6GA 3K5TA 1E3VA 2SBLA 4LMIA 3CNXA 3RDEA 1RKYA 4NREA 1KC84 1W7CA 3CCU3 3EQQB 1KD14 1KSIA 3EC9A 3FG4A 4QWTA 1CEWI 1Q42A 3H51A 3HX8A 1SIHA 5G2GA 1OGXA 3WOFB 1W2ZA 5CXOA 1O7GB 3KN4A 3BNEA 1JNQA 1NWWA 3SLUA 1Q864 3LT8A 5FW5A 3FF2A 4EXRA 2FGTA 3K63A 1YIT3 4JF8A 3OX9A 1YHQ3 2HMLB 2Y73A 1JB5A 2OTL3 3QRDA 2OCTA 1FA3A 2XR8B 1WQLB 2I9WA 1BUQA 2MC8A 6STDA 3KKGA 4KFDA 1NJI4 1IU7A 1WNHA 4HZBB 2QIYA 5CLKA 5AIGA 1Y4KA 4HM0B 3CCL3 1O7WB 3HIGA 4EYCA 1MNLA 3DGMA 3JVCA 4NHFA 1VQL3 1UW1A 5CF2A 2Z77A 1TFOA 2W56A 2XSOB 3CC73 5TGNA 1GY6A 1NU3A 2F98A 2HMMB 1EA2A 5LC6A 4HM5B 3FG3A 5DRVA 2IUKA 5KP4A 3X3ZA 4L8PA 3NBBA 2QA43 3JUNA 2BT3A 1M1XB 1OF5B 2LQVA 3EBTA 2WGQA 1VQP3 3N9HA 4MMYB 3T8UA 3MPHA 1NB3I 4AKZA 3OWUA 1E3RA 3OV4A 4BTXA 4ORLA 3B4PA 1R4CA 3ROBA 3WMDA 1QAFA 1W6CA 4R1KA 3CMA3 3NHXA 1JB2A 3WOEB 3FZWA 4X2OA 4XB5A 3EN8A 3PGBA 4KFEA 3U1WA 2UX0A 3GZRA 3PS8A 3B8LA 5CK6A 5IG3A 3G0KA 5EEOA 3LXUX 2P09A 2YFLB 4N6NB 1K9M4 1FGOA 3DMCA 2YFJB 3IPTA 4OK0A 3SEDA 2XGNA 2GXFA 5ELJA 1ZX2A 1IV9A 4N6OB 3MSOA 1VQ73 2JQ5A 1ROAA 1STDA 5I97A 1FGRA 1PU4A 4L7KA 3CCE3 5AIHA 2ZL8A 4TX4A 2C11A 2OWPA 3CXC2 3FH1A 4KFFA 2QGUA 1QMAA 2B24B 1A2VA 3AMOB 3VF1A 4MMXB 3WA2X 3M8CA 3CME3 1V74A 2WGOA 4KVHA 3X3YA 1Q40A 3GZYB 3EJVA 1YI23 4X2HA 3DY5A 3OXAA 1O7MB 1OH0A 1M9GA 3S67A 2YFIB 3GRDA 4HM7B 1SIIA 3HZPA 2BHMA 3NV0A 3QK9A 4HM2B 1IQXA 3N54B 3BNCA 1C7HA 3FF0A 1N5HA 1W4NA 3WDGB 1TIJA 2F86B 1RRHA 2BNGA 4XBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3H A;  3JUQ A;  1O7H B;  4STD A;  2HMN B;  5CF1 A;  7STD A;  1ULJ B;  1JB4 A;  1OHO A;  3E99 A;  4FCJ A;  1OPY A;  4XDV A;  3JUO A;  2GEY A;  3ER7 A;  3UNL A;  2INX A;  1GS3 A;  3BLZ A;  3F40 A;  1OF5 A;  2R4I A;  3EBY A;  5AIF A;  3SOY A;  1EG9 B;  5IG0 A;  5IF6 A;  2F99 A;  3MG1 A;  2GEX A;  3K7C A;  4WYK A;  3S5C A;  2BMO B;  2HMO B;  5DRE A;  1GYB A;  1O7N B;  4IIA A;  3LYG A;  3I0Y A;  1K41 A;  3KZT A;  3BB9 A;  1HKX A;  2HMK B;  3NBR A;  2A15 A;  4OUQ A;  4XDW A;  3F8X A;  1JN5 A;  3VGN A;  3G16 A;  4LEH A;  3EX9 A;  3CU3 A;  3NM2 A;  3F7X A;  3Q90 A;  3ECF A;  3KE7 A;  4K1V A;  1OCV A;  3LZA A;  4OVM A;  1JKG A;  3STD A;  3VSY A;  8CHO A;  4PEJ A;  4U13 A;  3OWY A;  5IER A;  2K54 A;  3NUV A;  1SJW A;  5IEP A;  3JUM A;  5AII A;  1TP6 A;  1IDP A;  3FGY A;  5AEW B;  2B1X B;  3EF8 A;  3EN1 B;  4XBX A;  1S5A A;  1W02 A;  2BMR B;  2Z7A A;  3MKI A;  1TUH A;  3SOA A;  1W00 A;  5AEU B;  1Z1S A;  5IEN A;  1GY7 A;  3UJM A;  5JPP A;  2GBW B;  4I4K A;  3B4O A;  4XBT A;  1OUN A;  5D82 A;  5EVH A;  5IG5 A;  1ULI B;  4R9L A;  3RGR A;  2PZV A;  4HKV B;  3B7C A;  5AI1 A;  2XRX B;  4N3V A;  3T8N A;  3DXO A;  1AR0 A;  4RZM A;  3DM8 A;  1U5O A;  5KP1 A;  2STD A;  4LGQ A;  1W6Y A;  3F9S A;  5IEO A;  1DMN A;  1DMQ A;  4MJD A;  1ISK A;  1UUV B;  1O7P B;  1NDO B;  1Q40 B;  1UUW B;  5BXQ A;  1E97 A;  1OHS A;  1ZO2 A;  4HM8 B;  3K0Z A;  2IMJ A;  3D9R A;  2Z76 A;  2CKF B;  2W2C A;  3NV0 B;  3FLJ A;  1ASK A;  4J8T A;  1A2K A;  4HM6 B;  4HJL B;  4WWU C;  3GZX B;  3MG2 A;  5KP3 A;  1VZZ A;  2RCD A;  5STD A;  1OHP A;  1QJG A;  4XM4 A;  5IG4 A;  4HZ9 B;  4HM1 B;  1DMM A;  5D81 A;  2HMJ B;  3FKA A;  3G8Z A;  2BMQ B;  3KSP A;  4Q53 A;  4WP5 A;  3MYT A;  4H3U A;  4HVN A;  2CHC A;  2GBX B;  4WYK B;  3HK4 A;  4GB5 A;  1CQS A;  3CNM A;  4J9A A;  3EHC A;  3OWS A;  3JUP A;  3A76 A;  4HM3 B;  4K1U A;  5JPU A;  1JN5 B;  3CPO A;  2XSH B;  5BVB A;  3FSD A;  4L8O A;  1GY5 A;  4R9K A;  3DZL A;  4HM4 B;  3F8H A;  1OGZ A;  3DUK A;  2RFR A;  3MHE A;  3GWR A;  5HGR A;  4FCM A;  3MG3 A;  4CDL A;  3F14 A;  1JKG B;  3NXJ A;  3F7S A;  1W01 A;  3GZB A;  5D83 A;  3RGA A;  2RGQ A;  1E3V A;  4LMI A;  3CNX A;  3EQQ B;  3EC9 A;  1Q42 A;  3H51 A;  3HX8 A;  5G2G A;  1OGX A;  5CXO A;  1O7G B;  1NWW A;  5FW5 A;  3FF2 A;  3OX9 A;  2HML B;  1JB5 A;  2XR8 B;  1WQL B;  2I9W A;  1BUQ A;  6STD A;  3KKG A;  4HZB B;  2QIY A;  5CLK A;  5AIG A;  4HM0 B;  1O7W B;  5CF2 A;  2Z77 A;  2XSO B;  5TGN A;  1GY6 A;  1NU3 A;  2F98 A;  2HMM B;  1EA2 A;  4HM5 B;  5DRV A;  5KP4 A;  4L8P A;  3JUN A;  1OF5 B;  3EBT A;  3T8U A;  3OWU A;  1E3R A;  3OV4 A;  4ORL A;  3B4P A;  3ROB A;  3WMD A;  4R1K A;  3NHX A;  1JB2 A;  3FZW A;  4X2O A;  4XB5 A;  3EN8 A;  2UX0 A;  3GZR A;  3B8L A;  5CK6 A;  5IG3 A;  3G0K A;  2YFL B;  3DMC A;  2YFJ B;  3IPT A;  3SED A;  2GXF A;  1ZX2 A;  3MSO A;  2JQ5 A;  1STD A;  4L7K A;  5AIH A;  2OWP A;  3FH1 A;  2QGU A;  1QMA A;  2B24 B;  3M8C A;  4KVH A;  1Q40 A;  3GZY B;  3EJV A;  4X2H A;  3OXA A;  1O7M B;  1OH0 A;  2YFI B;  3GRD A;  4HM7 B;  3HZP A;  3NV0 A;  4HM2 B;  1C7H A;  3FF0 A;  2F86 B;  2BNG A;  4XBY A; 
#chains in the Genus database with same CATH topology
 3H3H A;  3JUQ A;  2P0M A;  1O7H B;  1T3B A;  1Q81 4;  1VQO 3;  4STD A;  1LRA A;  2CIU A;  2HMN B;  2P0X A;  2W04 A;  4N6L A;  1BU4 A;  5CF1 A;  7STD A;  1X1W A;  1ULJ B;  2E2V A;  3UB1 A;  3IJE B;  1IV7 A;  2CWT A;  1JB4 A;  1LVN A;  3GSP A;  1OHO A;  1K73 4;  2CW9 A;  1IQ8 A;  1IVV A;  1LOY A;  3E99 A;  4FCJ A;  1OPY A;  1BNR A;  4AKY A;  4EV5 A;  1S72 3;  5G1L A;  4XDV A;  1A2P A;  1D6Z A;  5A0O B;  1GMR A;  3JUO A;  1LOV A;  1GOY A;  1U8C B;  1UCJ A;  2GEY A;  1BSD A;  2INX A;  3ER7 A;  3UNL A;  1GS3 A;  4DKI A;  7GSP A;  3BLZ A;  3F40 A;  1OF5 A;  3PZW A;  1D6U A;  2OOV A;  3X40 A;  3HII A;  2R4I A;  3X41 A;  3EBY A;  5AIF A;  2Y74 A;  3SOY A;  1EG9 B;  5IG0 A;  2WO0 A;  5IF6 A;  1BVI A;  3S28 A;  2RBI A;  1RGF A;  4FMB A;  1MOL A;  2F99 A;  4HBR A;  6RNT A;  1QVG 2;  3MG1 A;  2GEX A;  1BNI A;  3K7C A;  4N6V 0;  3TDG A;  1FUS A;  4WYK A;  3S5C A;  1D6Y A;  1GSP A;  2BMO B;  1WTH A;  2F5W A;  2HMO B;  1FZU A;  5DRE A;  1GYB A;  3RNT A;  3U97 A;  1GMQ A;  1O7N B;  2CWU A;  3V99 A;  1FUT A;  3EE1 A;  4IIA A;  4N6M A;  3LYG A;  3I0Y A;  1BAO A;  4LSO A;  1K41 A;  2Z6B A;  3UL5 A;  1SQW A;  3KZT A;  3BB9 A;  1HKX A;  2HMK B;  3NBR A;  2A15 A;  4OUQ A;  4XDW A;  1AY7 A;  3WA3 A;  1FUW A;  3F8X A;  3LT9 A;  1YJW 3;  4IPB A;  3Q2P A;  3SYU A;  2KF4 A;  2C10 A;  3LTD A;  2W03 A;  3DGY A;  1TFK A;  2MF7 A;  1JN5 A;  3VGN A;  3G16 A;  1UI7 A;  1K28 A;  1IVU A;  1X1Y A;  1BRS A;  2GSP A;  2CX1 A;  4AEQ A;  4LEH A;  3CC4 3;  3O8Y A;  1YJ9 3;  1UGI A;  3EX9 A;  1N9J A;  2GU1 A;  1BRH A;  1B21 A;  3CU3 A;  1IK3 A;  4HAA A;  2WOF A;  4R80 A;  3NM2 A;  3F7X A;  3CCQ 3;  1VQ5 3;  3Q90 A;  3ECF A;  3KE7 A;  3AGN A;  3SXX A;  7RNT A;  1RHL A;  4HYZ A;  1QAL A;  1WMO A;  1YJN 3;  2L1S A;  4K1V A;  2O9U X;  2W0Q A;  1IT7 A;  1OCV A;  1JBS A;  2ML6 A;  3LZA A;  3WR2 A;  2IUJ A;  2BU4 A;  3NQZ A;  2CG0 A;  1TRP A;  4EBG A;  1IYY A;  4OVM A;  3S27 A;  1X1X A;  1N8R 4;  3BNB A;  3D5G A;  1VQK 3;  2SAR A;  1L5G B;  5AYR B;  3CPW 2;  1JKG A;  4J5G A;  2H0H A;  1B2Z A;  2Q07 A;  3STD A;  1IT8 A;  1UDI I;  1AVK A;  3MWZ A;  2GU3 A;  3ALA A;  3VSY A;  8CHO A;  1JBT A;  2XEP A;  1V58 A;  4FR9 A;  4K61 A;  4PEJ A;  4U13 A;  3OWY A;  4BIR A;  1N8Q A;  3CCV 3;  3CD6 3;  2WOH A;  3L0R A;  5IER A;  2K54 A;  3NUV A;  2OOV C;  1I2F A;  3UL6 A;  4K90 B;  3DGO A;  1SJW A;  4O8S A;  1SPU A;  2KCD A;  3JUM A;  5AII A;  4O2H A;  5IEP A;  3CC2 3;  1TP6 A;  1CYU A;  1NO3 A;  2FXT A;  1VQN 3;  4RNT A;  1IDP A;  1M90 4;  3FGY A;  1FW7 A;  5AEW B;  3KSE D;  2B1X B;  3EF8 A;  1RN7 A;  4KZ1 A;  1JJ2 2;  2OQE A;  4ZM8 A;  3Q1C A;  3DGN A;  2W9P A;  1STF I;  3EN1 B;  1S5A A;  4XBX A;  1W02 A;  2BMR B;  2CFG A;  2W56 B;  1VQ8 3;  3LTB A;  1JV2 B;  2Z7A A;  3MKI A;  1TUH A;  3SOA A;  3G71 3;  4N6U A;  1W00 A;  1RRL A;  1Z1S A;  1RGG A;  5AEU B;  5IEN A;  5IW9 A;  4EV2 A;  4EC6 A;  2IA7 A;  1M1K 4;  1GY7 A;  1N5P A;  1KQS 2;  3KII A;  3UJM A;  5JPP A;  2GBW B;  4FCZ A;  4EW5 A;  1EUI C;  2RSX A;  4WFO A;  3ZFZ A;  4I4K A;  3PXM A;  1B2S A;  1YGE A;  3B4O A;  4XBT A;  2OTJ 3;  1OUN A;  5D82 A;  1GOU A;  1RSN A;  1MWS A;  5FGO A;  5EVH A;  4CCV A;  5IG5 A;  1QVF 2;  1DE3 A;  1ULI B;  4G1M B;  4R9L A;  3RGR A;  1WMN A;  3CCJ 3;  1CYV A;  2CFW A;  1EKM A;  2PZV A;  3HI7 A;  4HKV B;  5BU4 A;  1LQG C;  3HOH A;  3B7C A;  5AI1 A;  2XRX B;  2JDI H;  4N3V A;  3T8N A;  1RGK A;  3I56 3;  1I2G A;  2BIR A;  1W5Z A;  1BRI A;  1G02 A;  1ROV A;  4MMZ B;  5ELU A;  1I0V A;  3G6E 3;  2H0I A;  3CCR 3;  1US1 A;  3DXO A;  1RJO A;  1BIR A;  1AVL A;  1AR0 A;  4RZM A;  2D1W A;  2KAA A;  1U5O A;  3DM8 A;  1QAK A;  2XH9 A;  5KP1 A;  2STD A;  4LGQ A;  1VQ4 3;  3LH4 A;  1W6Y A;  2IY2 A;  1FGM A;  3F9S A;  5IEO A;  1DMN A;  1I8V A;  3N8B A;  4O02 B;  1RGE A;  3LML A;  3SX1 A;  1HU9 A;  1DMQ A;  1LOW A;  8RNT A;  1TJD A;  1AV4 A;  4MJD A;  2CWV A;  1ISK A;  3IMA B;  1B27 A;  2H0G A;  4N6T A;  1LXE A;  1UUV B;  1LNH A;  4BL2 A;  1O7P B;  1NDO B;  1Q40 B;  1OAC A;  1UUW B;  2KXG A;  4FMD A;  1R4Y A;  5RNT A;  2CFL A;  3AHS A;  1MWR A;  3WOD G;  3LTA A;  1FGT A;  1E97 A;  1OHS A;  5BXQ A;  2YX9 A;  2O3O A;  5LC7 A;  1ZO2 A;  3D4A A;  4HM8 B;  3K0Z A;  1BUJ A;  1BSA A;  1JZD A;  1W2B 2;  2K0M A;  2W6J H;  1A67 A;  1DVD A;  1T5Y A;  2OQE C;  2IMJ A;  1YIJ 3;  3D9R A;  2E2U A;  2Z76 A;  2CKF B;  3NX0 A;  1TRQ A;  2C4B A;  2W2C A;  3LOY A;  3NV0 B;  2CG1 A;  1Q7Y 4;  3FLJ A;  4MEI A;  2F5M A;  4O3V A;  1ASK A;  4RNZ A;  4R4K A;  1VQQ A;  1B2M A;  4J8T A;  1LQM B;  2XFS A;  3NM7 A;  4GHO A;  3V98 A;  1A2K A;  4BL3 A;  1T2I A;  4HM6 B;  4HJL B;  4WWU C;  2HOH A;  2KF5 A;  6GSP A;  3G4S 3;  2P38 A;  3BND A;  3GZX B;  3MG2 A;  5KP3 A;  1VZZ A;  3AMO A;  3D3L A;  3SVA A;  4BTY A;  2RCD A;  5STD A;  1QJG A;  4XM4 A;  3A5E A;  3D79 A;  1BSB A;  4NPB A;  1TTO A;  5IG4 A;  3FCS B;  4HZ9 B;  3PYJ A;  1RN1 A;  4HM1 B;  1DMM A;  5D81 A;  2HMJ B;  3FKA A;  2CFK A;  1RGA A;  3G8Z A;  2BMQ B;  1BAN A;  5EQL A;  3KSP A;  4GSP A;  3DGL A;  4Q53 A;  4H61 A;  4WP5 A;  4LYL B;  1UGH I;  3T0U A;  2BNG A;  1MGW A;  1IVW A;  4LZI A;  1DVC A;  1MWT A;  3MYT A;  4H3U A;  4GL6 A;  1G0T A;  2PNC A;  3D5I A;  1I3F A;  1SAR A;  3FG1 A;  4WHA A;  4HVN A;  3URP A;  1X1U A;  5JBS A;  2CHC A;  2CFD A;  2E2T A;  4RBN A;  3WHO A;  3X3X A;  3EB8 A;  3NBJ A;  2GBX B;  1IQY A;  2FNQ A;  2ZDJ A;  3HK4 A;  4WYK B;  2XFT A;  1PFP A;  1RGL A;  4GB5 A;  1GD3 A;  4JRF A;  1PYL A;  1CQS A;  2KRT A;  2R41 A;  2XF3 A;  1BRJ A;  1BSE A;  5BIR A;  2XGL A;  3CNM A;  4J5K A;  4J9A A;  1CH0 A;  3EHC A;  1NB5 I;  3OWS A;  1NNV A;  2L4V A;  2F4Y A;  3CCS 3;  2P05 A;  3CCM 3;  2UUG C;  2KF3 A;  3JUP A;  1IVX A;  5M18 A;  5AYS C;  1KWI A;  1BNG A;  3A76 A;  4FMC A;  4HM3 B;  2M7O A;  4IT7 A;  4K1U A;  5GSP A;  1YVS A;  1F8N A;  4BTW A;  1LNI A;  1BNJ A;  2CC3 A;  3S29 A;  5JPU A;  1Q82 4;  1GD4 A;  1RGH A;  9RNT A;  2CK3 H;  1JN5 B;  1VQ6 3;  3CPO A;  2LYX A;  1BOX A;  1JRQ A;  1DYU A;  2XSH B;  5BVB A;  3DH2 A;  3FSD A;  1EQK A;  1FGQ A;  1WMP A;  3X42 A;  3ZG5 A;  4BU4 A;  1TU5 A;  4L8O A;  3PCS A;  1GY5 A;  4R9K A;  2V1L A;  3I55 3;  4RNY A;  3V92 A;  3DZL A;  2D42 A;  3LTC A;  1HYF A;  3NQY A;  4HM4 B;  3F8H A;  1J2B A;  1OGZ A;  3DUK A;  1LOX A;  4ILF A;  3K9M C;  3PCR A;  2RFR A;  1Q9E A;  1I2E A;  1GOV A;  3KFQ C;  1YNV X;  2CH9 A;  3MHE A;  3GWR A;  1A90 A;  2BO9 B;  2W9Q A;  5HGR A;  4FCM A;  3GAX A;  3MG3 A;  1BGS A;  1B20 A;  1YVB I;  4CDL A;  1VQM 3;  1UI8 A;  3F14 A;  1VQ9 3;  1JKG B;  2ML5 A;  4FMA A;  3NXJ A;  1I70 A;  3F7S A;  1W01 A;  3GZB A;  5D83 A;  1G96 A;  1V57 A;  3RGA A;  2QEX 3;  1T2H A;  2IYJ A;  4CPK A;  3J7Y d;  2RGQ A;  1K8A 4;  1N9E A;  1W6G A;  3K5T A;  1E3V A;  2SBL A;  4LMI A;  3CNX A;  3RDE A;  5M19 A;  2AAD A;  4NRE A;  1RN4 A;  1RKY A;  1W7C A;  1KC8 4;  3CCU 3;  3EQQ B;  1GMP A;  1KD1 4;  1KSI A;  3EC9 A;  3FG4 A;  4QWT A;  1CEW I;  1Q42 A;  3H51 A;  3HX8 A;  1SIH A;  5G1K A;  3AGO A;  1OGX A;  5G2G A;  1RNT A;  3WOF B;  1W2Z A;  5CXO A;  1RTU A;  1O7G B;  3KN4 A;  3BNE A;  1JNQ A;  1NWW A;  3SLU A;  1Q86 4;  3LT8 A;  5FW5 A;  3FF2 A;  4EXR A;  2FGT A;  3K63 A;  1I0X A;  1YIT 3;  4JF8 A;  3OX9 A;  1YHQ 3;  1RDS A;  2HML B;  2Y73 A;  4HOH A;  1JB5 A;  2OTL 3;  1HZ1 A;  2OCT A;  3QRD A;  1FA3 A;  2XR8 B;  1WQL B;  2I9W A;  1BUQ A;  2MC8 A;  6STD A;  3KKG A;  4KFD A;  1NJI 4;  5HOH A;  1IU7 A;  1WNH A;  4HZB B;  2QIY A;  5CLK A;  2J8X B;  5AIG A;  1Y4K A;  4HM0 B;  3CCL 3;  1O7W B;  3HIG A;  4EYC A;  1MNL A;  1DET A;  3DGM A;  3JVC A;  3Q3F A;  4NHF A;  1UW1 A;  5CF2 A;  1VQL 3;  2RNT A;  2Z77 A;  1MWU A;  1C54 A;  1TFO A;  2W56 A;  2XSO B;  1BNS A;  3CC7 3;  5TGN A;  1GY6 A;  1NU3 A;  2F98 A;  2HMM B;  1EA2 A;  5LC6 A;  4I5Q A;  2ZA4 A;  2UGI A;  4HM5 B;  3OW2 2;  1MGR A;  3FG3 A;  1JZO A;  2IUK A;  5DRV A;  5KP4 A;  3X3Z A;  1PY3 A;  4L8P A;  3NBB A;  2QA4 3;  3JUN A;  2BT3 A;  1M1X B;  1OF5 B;  2LQV A;  3EBT A;  2WGQ A;  1EEJ A;  1B3S A;  1RCK A;  1UCL A;  3N9H A;  4MMY B;  3MPH A;  1NB3 I;  3T8U A;  4AKZ A;  4CJN A;  1VQP 3;  3OWU A;  1E3R A;  3OV4 A;  4BTX A;  4ORL A;  3B4P A;  1R4C A;  2KF6 A;  1B2U A;  3ROB A;  3WMD A;  1QAF A;  1W6C A;  4R1K A;  3CMA 3;  3NHX A;  1JB2 A;  1ZS7 A;  3WOE B;  1AQZ A;  2CX0 A;  3FZW A;  1BRK A;  4X2O A;  4XB5 A;  3EN8 A;  3PGB A;  1BNF A;  4KFE A;  3U1W A;  5M1A A;  2UX0 A;  3GZR A;  3PS8 A;  1BRN L;  3B8L A;  5CK6 A;  5IG3 A;  3G0K A;  5EEO A;  3LXU X;  2P09 A;  2YFL B;  3BIR A;  4N6N B;  1K9M 4;  1FGO A;  3DMC A;  2YFJ B;  4KT3 B;  3IPT A;  4OK0 A;  1BRG A;  3ZG0 A;  3SED A;  1RLS A;  2XGN A;  2GXF A;  5ELJ A;  1JBR A;  2ZHX B;  3KCH A;  1ZX2 A;  1IV9 A;  3AHW A;  4N6O B;  3MSO A;  1VQ7 3;  2JQ5 A;  1Q7H A;  1ROA A;  1BNE A;  1STD A;  1BSC A;  5I97 A;  1FGR A;  2AAE A;  1PU4 A;  4L7K A;  3CCE 3;  1RNB A;  5AIH A;  1UCK A;  2ZL8 A;  2C11 A;  2OWP A;  4TX4 A;  3CXC 2;  1I3I A;  3FH1 A;  4KFF A;  2QGU A;  1QMA A;  2B24 B;  1A2V A;  3AMO B;  3VF1 A;  4MMX B;  3WA2 X;  3M8C A;  3CME 3;  1V74 A;  2WGO A;  1UUG B;  4KVH A;  3X3Y A;  1B2X A;  1Q40 A;  3GZY B;  3EJV A;  1FYS A;  1YGW A;  4X2H A;  1RGC A;  1YI2 3;  3DY5 A;  2K3D A;  3OXA A;  1RMS A;  1O7M B;  1OH0 A;  1M9G A;  3S67 A;  1RCL A;  2YFI B;  3GRD A;  4HM7 B;  2F56 A;  1SII A;  3HZP A;  2BHM A;  3BU4 A;  3NV0 A;  3QK9 A;  4HM2 B;  1IQX A;  3N54 B;  1ZGX A;  1C7H A;  3BNC A;  1UCI A;  3FF0 A;  1N5H A;  1W4N A;  3WDG B;  1TIJ A;  2F86 B;  1RRH A;  1OHP A;  4XBY A; 
#chains in the Genus database with same CATH homology
 3H3H A;  3JUQ A;  2P0M A;  1O7H B;  1Q81 4;  1VQO 3;  4STD A;  2P0X A;  2CIU A;  2HMN B;  2W04 A;  4N6L A;  5CF1 A;  7STD A;  1ULJ B;  2E2V A;  3UB1 A;  3IJE B;  1IV7 A;  2CWT A;  1JB4 A;  1LVN A;  1OHO A;  1K73 4;  2CW9 A;  1IQ8 A;  1IVV A;  3E99 A;  4FCJ A;  1OPY A;  4AKY A;  4EV5 A;  1S72 3;  4XDV A;  1D6Z A;  5A0O B;  3JUO A;  1U8C B;  2GEY A;  3ER7 A;  3UNL A;  3OW2 2;  2INX A;  1GS3 A;  3BLZ A;  3F40 A;  1OF5 A;  3PZW A;  1D6U A;  2OOV A;  3X40 A;  3HII A;  2R4I A;  3X41 A;  3EBY A;  5AIF A;  2Y74 A;  3SOY A;  1EG9 B;  5IG0 A;  2WO0 A;  5IF6 A;  3S28 A;  4FMB A;  1MOL A;  2F99 A;  4HBR A;  1QVG 2;  3MG1 A;  2GEX A;  3K7C A;  4N6V 0;  3TDG A;  4WYK A;  3S5C A;  1D6Y A;  2BMO B;  1WTH A;  2HMO B;  5DRE A;  1GYB A;  3U97 A;  3V99 A;  1O7N B;  2CWU A;  3EE1 A;  4IIA A;  4N6M A;  3LYG A;  3I0Y A;  4LSO A;  1K41 A;  2Z6B A;  3UL5 A;  1SQW A;  3KZT A;  3BB9 A;  1HKX A;  2HMK B;  3NBR A;  2A15 A;  4OUQ A;  4XDW A;  3WA3 A;  1FUW A;  3F8X A;  3LT9 A;  1YJW 3;  4IPB A;  3Q2P A;  2C10 A;  3LTD A;  2W03 A;  1TFK A;  2MF7 A;  1JN5 A;  3VGN A;  3G16 A;  1UI7 A;  1K28 A;  1IVU A;  4AEQ A;  4LEH A;  3CC4 3;  3O8Y A;  1YJ9 3;  3EX9 A;  1N9J A;  2GU1 A;  1IK3 A;  3CU3 A;  2WOF A;  4R80 A;  3NM2 A;  3F7X A;  3CCQ 3;  1VQ5 3;  3Q90 A;  3ECF A;  3KE7 A;  3SXX A;  4HYZ A;  1QAL A;  1WMO A;  1YJN 3;  4K1V A;  2O9U X;  2W0Q A;  1IT7 A;  1OCV A;  2ML6 A;  3LZA A;  2IUJ A;  3NQZ A;  2CG0 A;  4EBG A;  4OVM A;  3S27 A;  1N8R 4;  3BNB A;  1VQK 3;  1L5G B;  3CPW 2;  1JKG A;  3STD A;  2Q07 A;  1IT8 A;  3VSY A;  1AVK A;  3MWZ A;  2GU3 A;  3ALA A;  8CHO A;  2XEP A;  4FR9 A;  4K61 A;  4PEJ A;  4U13 A;  3OWY A;  3CCV 3;  1N8Q A;  3CD6 3;  2WOH A;  3L0R A;  5IER A;  2K54 A;  3NUV A;  2OOV C;  3UL6 A;  4K90 B;  3DGO A;  1SJW A;  4O8S A;  1SPU A;  2KCD A;  3JUM A;  5AII A;  4O2H A;  5IEP A;  3CC2 3;  1TP6 A;  1CYU A;  1NO3 A;  2FXT A;  1VQN 3;  1IDP A;  1M90 4;  3FGY A;  5AEW B;  3KSE D;  2B1X B;  3EF8 A;  1RN7 A;  4KZ1 A;  1JJ2 2;  2OQE A;  4ZM8 A;  3Q1C A;  3DGN A;  2W9P A;  1STF I;  3EN1 B;  1S5A A;  4XBX A;  1W02 A;  2BMR B;  2CFG A;  2W56 B;  1VQ8 3;  3LTB A;  1JV2 B;  2Z7A A;  3MKI A;  1TUH A;  3SOA A;  3G71 3;  4N6U A;  1W00 A;  1RRL A;  1Z1S A;  5AEU B;  5IEN A;  5IW9 A;  4EV2 A;  4EC6 A;  2IA7 A;  1M1K 4;  1GY7 A;  1N5P A;  1KQS 2;  3KII A;  3UJM A;  5JPP A;  2GBW B;  4FCZ A;  2RSX A;  4WFO A;  4I4K A;  3PXM A;  1YGE A;  3B4O A;  4XBT A;  2OTJ 3;  1OUN A;  5D82 A;  5FGO A;  5EVH A;  4CCV A;  5IG5 A;  1QVF 2;  1ULI B;  4G1M B;  4R9L A;  3RGR A;  1WMN A;  3CCJ 3;  1CYV A;  2CFW A;  1EKM A;  2PZV A;  3HI7 A;  4HKV B;  3B7C A;  5AI1 A;  2XRX B;  2JDI H;  4N3V A;  3T8N A;  3I56 3;  1W5Z A;  1ROV A;  4MMZ B;  5ELU A;  3G6E 3;  3CCR 3;  1US1 A;  3DXO A;  1RJO A;  1AVL A;  1AR0 A;  4RZM A;  2D1W A;  3DM8 A;  1U5O A;  1QAK A;  2XH9 A;  5KP1 A;  2STD A;  4LGQ A;  1VQ4 3;  3LH4 A;  1W6Y A;  1FGM A;  3F9S A;  5IEO A;  1DMN A;  3N8B A;  4O02 B;  3LML A;  3SX1 A;  1HU9 A;  1DMQ A;  1AV4 A;  4MJD A;  2CWV A;  1ISK A;  3IMA B;  4N6T A;  1LXE A;  1UUV B;  1LNH A;  1O7P B;  1NDO B;  1Q40 B;  1OAC A;  1UUW B;  2KXG A;  4FMD A;  2CFL A;  3WOD G;  3LTA A;  1FGT A;  1E97 A;  1OHS A;  5BXQ A;  2YX9 A;  2O3O A;  5LC7 A;  1ZO2 A;  4HM8 B;  3K0Z A;  1W2B 2;  1A67 A;  2K0M A;  2W6J H;  1DVD A;  1T5Y A;  2OQE C;  2IMJ A;  1YIJ 3;  3D9R A;  2E2U A;  2Z76 A;  2CKF B;  3NX0 A;  2W2C A;  3LOY A;  3NV0 B;  2CG1 A;  1Q7Y 4;  3FLJ A;  4MEI A;  4O3V A;  1ASK A;  4RNZ A;  4R4K A;  4J8T A;  3NM7 A;  2XFS A;  3V98 A;  1A2K A;  4HM6 B;  3G4S 3;  4HJL B;  4WWU C;  2P38 A;  3BND A;  3GZX B;  3MG2 A;  5KP3 A;  1VZZ A;  3AMO A;  3D3L A;  3SVA A;  4BTY A;  2RCD A;  5STD A;  1OHP A;  1QJG A;  4XM4 A;  5IG4 A;  3FCS B;  4HZ9 B;  3PYJ A;  4HM1 B;  1DMM A;  5D81 A;  2HMJ B;  3FKA A;  2CFK A;  5EQL A;  3G8Z A;  2BMQ B;  3KSP A;  3DGL A;  4Q53 A;  4H61 A;  4WP5 A;  3T0U A;  1IVW A;  4LZI A;  1DVC A;  3MYT A;  4H3U A;  4GL6 A;  2PNC A;  3FG1 A;  4WHA A;  4HVN A;  5JBS A;  2CHC A;  2CFD A;  2E2T A;  4RBN A;  3X3X A;  3EB8 A;  3NBJ A;  2GBX B;  1IQY A;  2FNQ A;  2ZDJ A;  3HK4 A;  4WYK B;  2XFT A;  1PFP A;  4GB5 A;  5AYR B;  1GD3 A;  4JRF A;  2XF3 A;  1CQS A;  2KRT A;  2XGL A;  3CNM A;  4J9A A;  3EHC A;  1NB5 I;  3OWS A;  2L4V A;  3CCS 3;  2P05 A;  3CCM 3;  3JUP A;  1IVX A;  5AYS C;  1KWI A;  3A76 A;  4FMC A;  4HM3 B;  2M7O A;  4IT7 A;  4K1U A;  1F8N A;  4BTW A;  2CC3 A;  3S29 A;  5JPU A;  1Q82 4;  1GD4 A;  2CK3 H;  1JN5 B;  1VQ6 3;  3CPO A;  2LYX A;  1JRQ A;  1DYU A;  2XSH B;  5BVB A;  3FSD A;  1EQK A;  1FGQ A;  1WMP A;  3X42 A;  1TU5 A;  4L8O A;  3PCS A;  1GY5 A;  4R9K A;  2V1L A;  3I55 3;  4RNY A;  3V92 A;  3DZL A;  2D42 A;  3LTC A;  3NQY A;  4HM4 B;  3F8H A;  1J2B A;  1OGZ A;  3DUK A;  1LOX A;  3K9M C;  3PCR A;  2RFR A;  3KFQ C;  2CH9 A;  3MHE A;  3GWR A;  1A90 A;  2BO9 B;  2W9Q A;  5HGR A;  4FCM A;  3GAX A;  3MG3 A;  4CDL A;  1YVB I;  1VQM 3;  1UI8 A;  3F14 A;  1VQ9 3;  1JKG B;  2ML5 A;  4FMA A;  3NXJ A;  3F7S A;  1W01 A;  3GZB A;  5D83 A;  1G96 A;  3RGA A;  2QEX 3;  3J7Y d;  2RGQ A;  1K8A 4;  1N9E A;  1W6G A;  3K5T A;  1E3V A;  2SBL A;  4LMI A;  3CNX A;  3RDE A;  1RKY A;  4NRE A;  1KC8 4;  1W7C A;  3CCU 3;  3EQQ B;  1KD1 4;  1KSI A;  3EC9 A;  3FG4 A;  4QWT A;  1CEW I;  1Q42 A;  3H51 A;  3HX8 A;  1SIH A;  5G2G A;  1OGX A;  3WOF B;  1W2Z A;  5CXO A;  1O7G B;  3KN4 A;  3BNE A;  1JNQ A;  1NWW A;  3SLU A;  1Q86 4;  3LT8 A;  5FW5 A;  3FF2 A;  4EXR A;  2FGT A;  3K63 A;  1YIT 3;  4JF8 A;  3OX9 A;  1YHQ 3;  2HML B;  2Y73 A;  1JB5 A;  2OTL 3;  3QRD A;  2OCT A;  1FA3 A;  2XR8 B;  1WQL B;  2I9W A;  1BUQ A;  2MC8 A;  6STD A;  3KKG A;  4KFD A;  1NJI 4;  1IU7 A;  1WNH A;  4HZB B;  2QIY A;  5CLK A;  5AIG A;  1Y4K A;  4HM0 B;  3CCL 3;  1O7W B;  3HIG A;  4EYC A;  1MNL A;  3DGM A;  3JVC A;  4NHF A;  1VQL 3;  1UW1 A;  5CF2 A;  2Z77 A;  1TFO A;  2W56 A;  2XSO B;  3CC7 3;  5TGN A;  1GY6 A;  1NU3 A;  2F98 A;  2HMM B;  1EA2 A;  5LC6 A;  4HM5 B;  3FG3 A;  5DRV A;  2IUK A;  5KP4 A;  3X3Z A;  4L8P A;  3NBB A;  2QA4 3;  3JUN A;  2BT3 A;  1M1X B;  1OF5 B;  2LQV A;  3EBT A;  2WGQ A;  1VQP 3;  3N9H A;  4MMY B;  3T8U A;  3MPH A;  1NB3 I;  4AKZ A;  3OWU A;  1E3R A;  3OV4 A;  4BTX A;  4ORL A;  3B4P A;  1R4C A;  3ROB A;  3WMD A;  1QAF A;  1W6C A;  4R1K A;  3CMA 3;  3NHX A;  1JB2 A;  3WOE B;  3FZW A;  4X2O A;  4XB5 A;  3EN8 A;  3PGB A;  4KFE A;  3U1W A;  2UX0 A;  3GZR A;  3PS8 A;  3B8L A;  5CK6 A;  5IG3 A;  3G0K A;  5EEO A;  3LXU X;  2P09 A;  2YFL B;  4N6N B;  1K9M 4;  1FGO A;  3DMC A;  2YFJ B;  3IPT A;  4OK0 A;  3SED A;  2XGN A;  2GXF A;  5ELJ A;  1ZX2 A;  1IV9 A;  4N6O B;  3MSO A;  1VQ7 3;  2JQ5 A;  1ROA A;  1STD A;  5I97 A;  1FGR A;  1PU4 A;  4L7K A;  3CCE 3;  5AIH A;  2ZL8 A;  4TX4 A;  2C11 A;  2OWP A;  3CXC 2;  3FH1 A;  4KFF A;  2QGU A;  1QMA A;  2B24 B;  1A2V A;  3AMO B;  3VF1 A;  4MMX B;  3WA2 X;  3M8C A;  3CME 3;  1V74 A;  2WGO A;  4KVH A;  3X3Y A;  1Q40 A;  3GZY B;  3EJV A;  1YI2 3;  4X2H A;  3DY5 A;  3OXA A;  1O7M B;  1OH0 A;  1M9G A;  3S67 A;  2YFI B;  3GRD A;  4HM7 B;  1SII A;  3HZP A;  2BHM A;  3NV0 A;  3QK9 A;  4HM2 B;  1IQX A;  3N54 B;  3BNC A;  1C7H A;  3FF0 A;  1N5H A;  1W4N A;  3WDG B;  1TIJ A;  2F86 B;  1RRH A;  2BNG A;  4XBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...