3HK4A

Crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
GMTIAEIAKDFTELLKQGDNAGAAEKYNADDIASYEAMEGPMAVSHGKEALRQKSQWWQENHEVHGGSVEGPYVNGDQFALRFKFDVTPKATGERVTMDEVGLYTVKNGKITEERFYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mlr7391 protein
publication title Crystal structure of NTF2-like protein of unknown function (NP_107719.1) from Mesorhizobium loti at 1.96 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Lyase
total genus 34
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3hk4A00
5CLKA 2B24B 3JUOA 2QGUA 5AIGA 5DREA 5AI1A 2BMRB 3GZYB 2HMOB 1O7MB 3OWYA 1HKXA 2HMLB 4FCMA 4LGQA 1W00A 4U13A 3KE7A 5AIHA 3K0ZA 3DXOA 3ROBA 4X2HA 4GB5A 3ECFA 3DZLA 1SJWA 1W02A 1E3VA 4HZBB 4MJDA 1O7HB 4HM2B 4WWUC 1OUNA 2RFRA 1GY5A 2BMQB 3EF8A 3CPOA 3F7XA 4KVHA 2Z7AA 3UNLA 1U5OA 5AIIA 8CHOA 3FGYA 2QIYA 3SEDA 4H3UA 3STDA 3UJMA 3F9SA 3WMDA 4L7KA 4R9LA 1DMNA 3F8HA 1JKGB 3EQQB 3GZXB 5IERA 4Q53A 3KSPA 1OCVA 2YFLB 1JN5A 2YFJB 3MG3A 3JUQA 3B7CA 3BLZA 3FH1A 1JB5A 3NBRA 4LEHA 4HM1B 5AEUB 3EN8A 4L8PA 5IG0A 4L8OA 4LMIA 4HKVB 3CNMA 4HM6B 3VGNA 4I4KA 6STDA 3CU3A 5IG3A 7STDA 4XBXA 1STDA 3B4PA 4R1KA 2CHCA 4STDA 2OWPA 1QJGA 2XSOB 2RGQA 5D81A 2HMNB 1ULIB 2GXFA 5JPUA 4WP5A 1EA2A 5KP1A 3K7CA 3NV0B 3G8ZA 5FW5A 3EBYA 5AEWB 3MYTA 1OF5A 4FCJA 1O7NB 5BXQA 4OUQA 3I0YA 4HJLB 2INXA 1DMQA 3RGRA 1K41A 5CF1A 3GZBA 2R4IA 1OH0A 2A15A 1GS3A 4HM8B 2RCDA 5STDA 3GRDA 3LZAA 1NU3A 4K1UA 3JUNA 3DMCA 3LYGA 4HM0B 4OVMA 1GY6A 3FF2A 2PZVA 3DUKA 4XBYA 3DM8A 1NWWA 3NM2A 5JPPA 3CNXA 1C7HA 3KZTA 1BUQA 3OWUA 3KKGA 3SOAA 5DRVA 5KP4A 1DMMA 5KP3A 3EHCA 1E97A 3MKIA 3MHEA 2UX0A 2I9WA 4RZMA 1VZZA 3EN1B 3F14A 3MG1A 2XRXB 3VSYA 3GWRA 3NXJA 1ASKA 3FLJA 5D82A 4XM4A 1QMAA 5EVHA 1OF5B 1WQLB 3EJVA 3JUMA 1AR0A 3FZWA 1OPYA 3FF0A 2HMKB 2BNGA 1IDPA 5IF6A 4HM3B 3H51A 5CF2A 1OHPA 1TP6A 3D9RA 2BMOB 4XDWA 3JUPA 4XDVA 1JB4A 3OX9A 3E99A 1Q40A 1W6YA 5D83A 3HK4A 3EX9A 3B8LA 1W01A 2K54A 3IPTA 1ZX2A 3MG2A 1TUHA 4HZ9B 1UUWB 2IMJA 5IENA 5IEOA 1JB2A 4WYKA 3SOYA 2HMMB 3EBTA 4CDLA 3FKAA 3GZRA 4N3VA 4R9KA 2CKFB 3H3HA 4HM5B 4HM7B 2XR8B 1UUVB 3M8CA 1ISKA 1JN5B 2F86B 1O7PB 1OGZA 1NDOB 4X2OA 5CK6A 3F40A 3F8XA 1Q42A 2Z77A 3NHXA 3OV4A 1OHOA 4J8TA 4HVNA 3G0KA 2Z76A 5BVBA 3S5CA 3OWSA 1Z1SA 1GYBA 1CQSA 4IIAA 4ORLA 5CXOA 5IEPA 4XB5A 2JQ5A 3OXAA 5G2GA 1S5AA 3BB9A 3FSDA 5AIFA 2XSHB 1E3RA 1ULJB 2YFIB 2W2CA 5IG5A 2GEXA 3EC9A 4J9AA 2GBXB 1JKGA 1Q40B 4XBTA 5TGNA 2B1XB 3ER7A 1ZO2A 3NUVA 4WYKB 1A2KA 3A76A 2GBWB 3G16A 3MSOA 2GEYA 3HX8A 2F99A 4K1VA 2F98A 1O7GB 2STDA 3B4OA 3Q90A 1EG9B 3RGAA 3T8UA 1GY7A 3F7SA 3HZPA 1OHSA 4PEJA 1OGXA 5IG4A 3T8NA 3NV0A 4HM4B 1O7WB 2HMJB 5HGRA
chains in the Genus database with same CATH superfamily
5CLKA 2B24B 3S67A 1PY3A 3JUOA 1TJDA 1VQ53 1UCLA 3FG1A 2QGUA 2UUGC 4FMAA 4RBNA 1JZOA 1BRGA 5AIGA 2BT3A 2BMRB 5AI1A 5DREA 4O3VA 3I553 2C11A 5BU4A 1U8CB 3GZYB 3FG3A 3N8BA 1B20A 2L4VA 4WHAA 1K9M4 5LC6A 2HMOB 1O7MB 3LTAA 3A5EA 3OWYA 1HKXA 1I0VA 1LRAA 2HMLB 4FCMA 1W00A 4LGQA 3LTDA 4U13A 1IT8A 2D42A 3KE7A 5AIHA 1SIHA 1BOXA 3K0ZA 4AKZA 3DXOA 4N6V0 3ROBA 2J8XB 4X2HA 4GB5A 1L5GB 4MMYB 1VQQA 1DVDA 1G0TA 1RN4A 1TFKA 4N6TA 2K0MA 3ECFA 3DZLA 1SJWA 1IVWA 1W02A 1FGOA 4EV2A 1E3VA 1J2BA 3LMLA 1BSEA 2R41A 4HZBB 1O7HB 1EEJA 4HM2B 4MJDA 4WWUC 3CD63 2ML5A 3LT8A 1VQ83 1OUNA 2RFRA 1GY5A 1N9JA 3X3XA 1LXEA 2XF3A 2CK3H 2M7OA 1B21A 1M9GA 3BNBA 2BMQB 3EF8A 5FGOA 3CPOA 3F7XA 2MC8A 4CPKA 3CC43 1NO3A 1B2XA 2Z7AA 4KVHA 4EYCA 1Q864 2W6JH 3NM7A 1T2IA 4EC6A 1RGCA 3UNLA 1U5OA 5AIIA 3K9MC 1MGWA 5EQLA 8CHOA 2KF4A 3KFQC 2SBLA 3FG4A 1BAOA 2V1LA 4EBGA 1BNGA 1ZS7A 1DYUA 3FGYA 2QIYA 3SEDA 4H3UA 3AMOB 3STDA 3UB1A 1IVVA 3UJMA 4MMXB 3F9SA 1A2PA 2CWVA 2JDIH 1HU9A 1RGKA 3DGYA 3D5GA 4L7KA 4R9LA 3WMDA 5JBSA 3CCR3 3CXC2 1DMNA 3F8HA 3BU4A 1JKGB 3LOYA 1GOVA 3EQQB 1CEWI 3GZXB 4NHFA 1JNQA 5IERA 4Q53A 1B2ZA 1Q7HA 3KSPA 1BSBA 1OCVA 4FMDA 1BRIA 1YVBI 3BIRA 3QK9A 4CJNA 3MWZA 2YFLB 1JN5A 2YFJB 3MG3A 3JUQA 3B7CA 3KSED 1WTHA 4K61A 5AYRB 3BLZA 1GOUA 2F56A 3FH1A 1JB5A 3NBRA 4LEHA 5HOHA 1S723 3V99A 2OCTA 4HM1B 3NQYA 5AEUB 1FGQA 3S28A 2OQEC 2ZL8A 3EN8A 1MWRA 4L8PA 1UCKA 4NPBA 2ML6A 5IG0A 4L8OA 4LMIA 3DH2A 2P0MA 4HKVB 3CNMA 3D5IA 4HM6B 1G96A 4FMCA 2W03A 3VGNA 2D1WA 2O3OA 4I4KA 1QAKA 3CU3A 4J5KA 4JRFA 4EXRA 6STDA 5IG3A 3ALAA 7STDA 4HYZA 4XBXA 1RGEA 1STDA 3NBJA 3B4PA 3UL5A 1IQYA 2HOHA 2KF3A 2CHCA 3DGMA 4R1KA 4STDA 2OWPA 1QAFA 3G713 3EE1A 1QJGA 2XSOB 3X40A 2RGQA 5D81A 1VQM3 2HMNB 1Q9EA 1ULIB 3PCSA 2GXFA 5JPUA 2CX1A 4WP5A 2CG1A 1EA2A 1LVNA 1IV7A 1GD3A 2XEPA 3K7CA 5KP1A 1I3IA 3NV0B 1VQK3 1BRKA 4N6LA 3G8ZA 5FW5A 3EBYA 5AEWB 1BIRA 3MYTA 2CFLA 1OF5A 4FCJA 1O7NB 1B2MA 1RKYA 3LTBA 1NJI4 7GSPA 2BU4A 5BXQA 1MWTA 1T3BA 4OUQA 6RNTA 9RNTA 1Q824 3I0YA 4HJLB 1R4YA 2E2UA 2INXA 1D6ZA 1TU5A 1DMQA 5G1LA 4TX4A 1UCJA 3RGRA 3LT9A 1K41A 2C10A 2GU3A 3GAXA 1I8VA 5CF1A 1FA3A 2P09A 1FUTA 3GZBA 1X1WA 3L0RA 2KCDA 4KFEA 4MMZB 1SPUA 2R4IA 4K90B 1G02A 1DETA 1OH0A 1NB5I 2A15A 1QALA 2KF6A 1I2GA 2CIUA 1TRPA 1MNLA 4BIRA 1GS3A 4LSOA 1KC84 4GSPA 4HM8B 1UCIA 1K8A4 2RCDA 5STDA 1T5YA 1M904 5G1KA 3PXMA 1BVIA 1BNRA 3GRDA 1RSNA 3LZAA 3X3YA 1NU3A 2YX9A 2RSXA 1JJ22 5BIRA 1YGWA 1RN7A 4K1UA 2MF7A 3JUNA 1AQZA 3DMCA 4O8SA 1Q814 1B2SA 1TTOA 3LYGA 4G1MB 1TRQA 1MWSA 1SIIA 4HM0B 1VQO3 4OVMA 1LNHA 1BU4A 2F5WA 3WDGB 4J9AA 1FGMA 3CC73 1GY6A 3FF2A 2PZVA 1B3SA 3TDGA 3DUKA 1KD14 1A90A 1RN1A 1ZGXA 4XBYA 3DM8A 1NWWA 3CCU3 3DGNA 3NM2A 1X1XA 5JPPA 1RMSA 3BNCA 3J7Yd 3CNXA 4RNTA 1C7HA 1BSDA 2XGNA 1SARA 3KZTA 5EEOA 1BUQA 5A0OB 3K63A 3G6E3 3OWUA 3KKGA 3SOAA 5DRVA 3CCV3 1FUSA 5KP4A 1I2EA 2IA7A 1DMMA 4H61A 5KP3A 3EHCA 4FMBA 1E97A 1PYLA 2KAAA 2XH9A 3T0UA 1I2FA 1YIT3 3HI7A 2XGLA 3MHEA 3MKIA 3ZG5A 2UX0A 1N8R4 4NREA 4EW5A 5LC7A 1DE3A 2I9WA 1WMOA 4RZMA 5I97A 1VZZA 3HIIA 1KWIA 3EN1B 3DY5A 3F14A 4HAAA 3MG1A 4HBRA 1FZUA 2XFTA 1UGIA 1VQ73 1W6CA 3BNEA 3CCE3 8RNTA 1I70A 2XRXB 4R80A 3GWRA 4RNYA 5GSPA 2OOVA 2WO0A 3IMAB 2IUJA 3VSYA 2SARA 3NXJA 2W9PA 3NQZA 3WOEB 1ASKA 3FLJA 4BTYA 2CFWA 1F8NA 5D82A 4OK0A 2H0HA 3X42A 1QVG2 4XM4A 1JV2B 1W2B2 1PFPA 1M1K4 1GMPA 1QMAA 1BGSA 1LQMB 4AEQA 4IPBA 5EVHA 2W56A 2KXGA 1OF5B 2RBIA 1WQLB 1EKMA 3S27A 3WOFB 3CCM3 1VQ43 3EJVA 1V58A 3JUMA 1Y4KA 1AR0A 4BL3A 3FZWA 1OPYA 4BTWA 6GSPA 2E2TA 3SVAA 3FF0A 2HMKB 2BNGA 3CCL3 1IDPA 3CC23 4QWTA 1UW1A 3G4S3 1Q7Y4 5IF6A 1KQS2 4HM3B 3H51A 5ELJA 5CF2A 3NBBA 2RNTA 1TP6A 1EQKA 4N6UA 2XFSA 1VQN3 2BIRA 5AYSC 4KFDA 3D9RA 3SXXA 1FGTA 1LNIA 1AVLA 4KFFA 2BMOB 2FGTA 3SYUA 2WOFA 4XDWA 2LQVA 3JUPA 4LZIA 4XDVA 1R4CA 4J5GA 1AVKA 1JB4A 3OX9A 1BRNL 3E99A 1Q40A 3S29A 1W6YA 1WMPA 2E2VA 1VQL3 1QVF2 5D83A 2QEX3 3GSPA 3PGBA 3SLUA 3HK4A 1LOWA 2ZHXB 3CCQ3 3EX9A 3B8LA 3LTCA 1W01A 2W9QA 2Y73A 2K54A 3IPTA 1RGFA 1JRQA 1ZX2A 1TUHA 3MG2A 3LXUX 4HZ9B 3CPW2 1UUWB 3HIGA 1ROAA 2IMJA 4CCVA 1T2HA 2W0QA 1BNJA 1RGHA 2OTJ3 2AADA 3D79A 4O02B 3SX1A 5IENA 5M18A 1YGEA 5IEOA 1MGRA 3EB8A 3D4AA 1W2ZA 1X1UA 1JB2A 1W5ZA 1RLSA 1V57A 1CYVA 2FXTA 3PYJA 4WYKA 3D3LA 1W6GA 1IQ8A 3SOYA 3I563 1UGHI 1K734 3WA2X 1BNIA 2HMMB 1VQP3 1BSAA 4O2HA 3X41A 1YHQ3 1TIJA 2W04A 3K5TA 3N54B 3EBTA 1JBTA 3U97A 4ZM8A 4CDLA 1STFI 1IU7A 1W7CA 4BTXA 1FUWA 3FKAA 1YI23 1UI7A 2F5MA 3GZRA 4N3VA 4R9KA 1YJ93 2CKFB 5ELUA 1BRHA 3H3HA 4HM5B 4HM7B 1UUGB 3DGOA 3OW22 1X1YA 1RGAA 2CC3A 2Z6BA 1BNSA 2XR8B 1GMQA 1UUVB 3M8CA 2OQEA 1YNVX 1A2VA 1RCKA 3ZG0A 4GL6A 1M1XB 3IJEB 1ISKA 3O8YA 5HGRA 2BHMA 1JN5B 1UI8A 1A67A 3HOHA 2F86B 1TFOA 2BO9B 2CX0A 1O7PB 1OGZA 2K3DA 3Q3FA 3WR2A 1NDOB 1RTUA 4KZ1A 1CYUA 4X2OA 5CK6A 3F40A 3CMA3 1VQ93 1BANA 2QA43 2ZDJA 3BNDA 3F8XA 4DKIA 5M1AA 1N5PA 1Q42A 2Z77A 3NHXA 3V92A 1RJOA 3OV4A 1OHOA 1BNFA 1HYFA 4J8TA 1FYSA 3MPHA 1IYYA 2P05A 1LQGC 4KT3B 1KSIA 2CFGA 4HVNA 2KRTA 1VQ63 2CWUA 3G0KA 3RNTA 1I0XA 2W56B 2Z76A 5BVBA 3WA3A 1I3FA 1RNTA 1RCLA 3URPA 3N9HA 3PS8A 3S5CA 1B2UA 5RNTA 3OWSA 4HOHA 1Z1SA 1GYBA 1YJN3 1CQSA 1WNHA 4IIAA 2CFKA 4BL2A 7RNTA 1IV9A 3AGNA 1RHLA 1AV4A 1NNVA 3WODG 4AKYA 1LOVA 3PZWA 4ORLA 5CXOA 5IEPA 4N6MA 1V74A 1C54A 3DGLA 2IUKA 2IYJA 5M19A 2ZA4A 2GSPA 4XB5A 2O9UX 1D6YA 2JQ5A 3OXAA 1YIJ3 5G2GA 1S5AA 3BB9A 3FSDA 1NB3I 5AIFA 1GOYA 2XSHB 2C4BA 1RRLA 1LOYA 1FGRA 4JF8A 1E3RA 1BNEA 1ULJB 3U1WA 1LOXA 1GSPA 1AY7A 2Y74A 2UGIA 4BU4A 1JBSA 2YFIB 2W2CA 3AMOA 3QRDA 3KN4A 5IG5A 1MOLA 2GEXA 1K28A 3EC9A 1N9EA 1CH0A 1IT7A 1GMRA 2GBXB 2IY2A 3Q1CA 4N6NB 1BRJA 1N5HA 4WFOA 1BRSA 3UL6A 1JKGA 1Q40B 3PCRA 3Q2PA 3KCHA 2WOHA 4XBTA 1BUJA 4FCZA 5TGNA 4RNZA 2AAEA 1WMNA 4N6OB 3CCS3 2CWTA 1MWUA 4GHOA 3CCJ3 2B1XB 1YJW3 4R4KA 1RRHA 1FW7A 3KIIA 1BSCA 1IK3A 2CH9A 2CFDA 4ILFA 3NX0A 4I5QA 3ER7A 1DVCA 2P0XA 3AHWA 1ZO2A 3ZFZA 5IW9A 3VF1A 2H0GA 3CME3 1US1A 3NUVA 4MEIA 3AHSA 1A2KA 3A76A 4WYKB 1IVXA 2F4YA 2GBWB 4EV5A 1RGGA 1ROVA 1W4NA 3G16A 1D6UA 1EUIC 3MSOA 2GEYA 2FNQA 3HX8A 2F99A 1IQXA 4K1VA 2WGOA 2OOVC 3RDEA 2F98A 1B27A 1IVUA 2WGQA 4LYLB 3FCSB 1O7GB 1JBRA 1HZ1A 2STDA 3B4OA 3X3ZA 2LYXA 2P38A 3JVCA 3Q90A 3AGOA 3WHOA 2H0IA 1PU4A 1EG9B 1OACA 1N8QA 2GU1A 1RDSA 3RGAA 2Q07A 1JZDA 3T8UA 1RNBA 4IT7A 3V98A 1GY7A 3F7SA 3HZPA 1OHSA 4PEJA 1GD4A 1SQWA 1OGXA 1YVSA 2L1SA 2PNCA 2HMJB 5IG4A 2OTL3 3T8NA 3NV0A 3LH4A 4HM4B 2CW9A 1RGLA 1O7WB 1UDII 2KF5A 1OHPA 2CG0A 4FR9A
chains in the Genus database with same CATH topology
5CLKA 2B24B 3S67A 3JUOA 1VQ53 3FG1A 2QGUA 4RBNA 4FMAA 5AIGA 5DREA 2BT3A 2BMRB 5AI1A 4O3VA 3I553 2C11A 1U8CB 3GZYB 3FG3A 3N8BA 2L4VA 4WHAA 1K9M4 5LC6A 2HMOB 1O7MB 3LTAA 3OWYA 1HKXA 2HMLB 4FCMA 4LGQA 1W00A 4U13A 3LTDA 1IT8A 2D42A 3KE7A 5AIHA 1SIHA 3K0ZA 4AKZA 3DXOA 4N6V0 3ROBA 4X2HA 4GB5A 1L5GB 4MMYB 1DVDA 1TFKA 4N6TA 2K0MA 3ECFA 3DZLA 1SJWA 1IVWA 1W02A 1FGOA 4EV2A 1E3VA 1J2BA 3LMLA 4HZBB 4MJDA 3CD63 1O7HB 4HM2B 4WWUC 2ML5A 3LT8A 1VQ83 1OUNA 2RFRA 1GY5A 1N9JA 3X3XA 1LXEA 2XF3A 2CK3H 2M7OA 1M9GA 3BNBA 2BMQB 3EF8A 5FGOA 3CPOA 3F7XA 2MC8A 3CC43 1NO3A 4KVHA 2Z7AA 4EYCA 1Q864 2W6JH 3NM7A 4EC6A 3UNLA 1U5OA 5AIIA 3K9MC 5EQLA 8CHOA 3KFQC 2SBLA 3FG4A 2V1LA 4EBGA 1DYUA 3FGYA 2QIYA 3SEDA 4H3UA 3AMOB 3STDA 3UB1A 1IVVA 3UJMA 4MMXB 3F9SA 2CWVA 2JDIH 3WMDA 1HU9A 3CCR3 4L7KA 4R9LA 5JBSA 3CXC2 1DMNA 3F8HA 1JKGB 3LOYA 3EQQB 1CEWI 3GZXB 4NHFA 1JNQA 5IERA 4Q53A 3KSPA 1OCVA 4FMDA 1YVBI 3QK9A 3MWZA 2YFLB 1JN5A 2YFJB 3MG3A 3JUQA 3B7CA 3KSED 1WTHA 4K61A 5AYRB 3BLZA 3FH1A 1JB5A 3NBRA 4LEHA 1S723 3V99A 2OCTA 4HM1B 3NQYA 5AEUB 1FGQA 3S28A 2OQEC 2ZL8A 3EN8A 4L8PA 5IG0A 2ML6A 4L8OA 4LMIA 2P0MA 4HKVB 3CNMA 4HM6B 1G96A 4FMCA 2W03A 3VGNA 2D1WA 2O3OA 4I4KA 1QAKA 3CU3A 4JRFA 4EXRA 6STDA 5IG3A 3ALAA 7STDA 4HYZA 4XBXA 1STDA 3NBJA 3B4PA 3UL5A 1IQYA 4R1KA 2CHCA 3DGMA 4STDA 2OWPA 1QAFA 3G713 3EE1A 1QJGA 2XSOB 3X40A 2RGQA 5D81A 1VQM3 2HMNB 1ULIB 3PCSA 2GXFA 5JPUA 4WP5A 2CG1A 1EA2A 1LVNA 1IV7A 1GD3A 2XEPA 3K7CA 5KP1A 3NV0B 1VQK3 4N6LA 3G8ZA 5FW5A 3EBYA 5AEWB 3MYTA 2CFLA 1OF5A 4FCJA 1O7NB 1RKYA 3LTBA 1NJI4 5BXQA 4OUQA 1Q824 3I0YA 4HJLB 2E2UA 2INXA 1D6ZA 1TU5A 1DMQA 3RGRA 4TX4A 3LT9A 1K41A 2C10A 2GU3A 3GAXA 5CF1A 1FA3A 2P09A 3GZBA 3L0RA 2KCDA 4KFEA 4MMZB 1SPUA 2R4IA 4K90B 1OH0A 1NB5I 2A15A 1QALA 2CIUA 1MNLA 1GS3A 4LSOA 1KC84 4HM8B 1K8A4 2RCDA 5STDA 1T5YA 1M904 3PXMA 3GRDA 3LZAA 3X3YA 1NU3A 2YX9A 2RSXA 1JJ22 1RN7A 4K1UA 2MF7A 3JUNA 1Q814 3DMCA 4O8SA 3LYGA 4G1MB 1SIIA 4HM0B 1VQO3 4OVMA 1LNHA 3WDGB 3CC73 1FGMA 1GY6A 3FF2A 2PZVA 1KD14 3TDGA 3DUKA 1A90A 4XBYA 3DM8A 1NWWA 3CCU3 3DGNA 3NM2A 5JPPA 3BNCA 3J7Yd 3CNXA 1C7HA 2XGNA 3KZTA 5EEOA 1BUQA 5A0OB 3K63A 3G6E3 3OWUA 3KKGA 3SOAA 5DRVA 3CCV3 5KP4A 2IA7A 1DMMA 4H61A 5KP3A 3EHCA 4FMBA 1E97A 2XH9A 3T0UA 1YIT3 3HI7A 2XGLA 3MHEA 3MKIA 2UX0A 1N8R4 4NREA 5LC7A 2I9WA 1WMOA 4RZMA 5I97A 1VZZA 3HIIA 1KWIA 3EN1B 3DY5A 3F14A 3MG1A 4HBRA 2XFTA 1VQ73 1W6CA 3BNEA 3CCE3 2XRXB 4R80A 4RNYA 3GWRA 2OOVA 3VSYA 2IUJA 2WO0A 3IMAB 3NXJA 2W9PA 3NQZA 3WOEB 1ASKA 3FLJA 4BTYA 2CFWA 1F8NA 5D82A 4OK0A 3X42A 1QVG2 4XM4A 1JV2B 1W2B2 1PFPA 1M1K4 1QMAA 4AEQA 4IPBA 5EVHA 2W56A 2KXGA 1OF5B 1VQ43 1WQLB 1EKMA 3S27A 3WOFB 3CCM3 3EJVA 3JUMA 1Y4KA 1AR0A 3FZWA 1OPYA 4BTWA 2E2TA 3SVAA 3FF0A 2HMKB 2BNGA 3CCL3 1IDPA 3CC23 4QWTA 1UW1A 3G4S3 1Q7Y4 5IF6A 1KQS2 4HM3B 3H51A 5ELJA 5CF2A 3NBBA 1TP6A 1EQKA 4N6UA 2XFSA 1VQN3 5AYSC 4KFDA 3D9RA 3SXXA 1FGTA 1AVLA 4KFFA 2BMOB 2FGTA 2WOFA 4XDWA 2LQVA 3JUPA 4LZIA 4XDVA 1R4CA 1AVKA 1JB4A 3OX9A 3E99A 1Q40A 3S29A 1W6YA 1WMPA 2E2VA 1VQL3 1QVF2 5D83A 2QEX3 3PGBA 3SLUA 3HK4A 3CCQ3 3EX9A 3B8LA 3LTCA 1W01A 2W9QA 2Y73A 2K54A 3IPTA 1ZX2A 1JRQA 3MG2A 1TUHA 3LXUX 3CPW2 4HZ9B 1UUWB 3HIGA 1ROAA 2IMJA 4CCVA 2W0QA 2OTJ3 3SX1A 4O02B 5IENA 1YGEA 5IEOA 3EB8A 1W2ZA 1JB2A 1W5ZA 2FXTA 3PYJA 1CYVA 4WYKA 3D3LA 1W6GA 1IQ8A 3SOYA 3I563 1K734 3WA2X 2HMMB 1VQP3 4O2HA 3X41A 1YHQ3 1TIJA 2W04A 3K5TA 3N54B 3EBTA 3U97A 4ZM8A 4CDLA 1STFI 1IU7A 1W7CA 4BTXA 1FUWA 3FKAA 1YI23 1UI7A 3GZRA 4N3VA 4R9KA 1YJ93 2CKFB 5ELUA 3H3HA 4HM5B 4HM7B 3DGOA 3OW22 2CC3A 2Z6BA 2XR8B 1UUVB 3M8CA 2OQEA 1A2VA 4GL6A 1M1XB 3IJEB 1ISKA 3O8YA 5HGRA 2BHMA 1JN5B 1UI8A 1A67A 2F86B 1TFOA 2BO9B 1O7PB 1OGZA 1NDOB 4KZ1A 1CYUA 4X2OA 5CK6A 3F40A 3CMA3 1VQ93 2QA43 2ZDJA 3BNDA 3F8XA 1N5PA 1Q42A 2Z77A 3NHXA 3V92A 1RJOA 3OV4A 1OHOA 4J8TA 3MPHA 2P05A 1KSIA 2CFGA 4HVNA 2KRTA 1VQ63 2CWUA 3G0KA 3WA3A 2W56B 2Z76A 5BVBA 3N9HA 3PS8A 3S5CA 3OWSA 1Z1SA 1GYBA 1YJN3 1CQSA 1WNHA 4IIAA 2CFKA 1IV9A 1AV4A 3WODG 4AKYA 4ORLA 3PZWA 5CXOA 5IEPA 4N6MA 1V74A 3DGLA 2IUKA 4XB5A 2O9UX 1D6YA 2JQ5A 3OXAA 1YIJ3 5G2GA 1S5AA 3BB9A 3FSDA 1NB3I 5AIFA 2XSHB 1RRLA 1FGRA 4JF8A 1E3RA 3U1WA 1ULJB 1LOXA 2Y74A 2YFIB 2W2CA 3AMOA 3QRDA 3KN4A 5IG5A 1MOLA 2GEXA 1K28A 3EC9A 1N9EA 2GBXB 1IT7A 3Q1CA 4J9AA 4N6NB 5IW9A 1N5HA 4WFOA 3UL6A 1JKGA 1Q40B 3PCRA 3Q2PA 4XBTA 2WOHA 4FCZA 5TGNA 4RNZA 1WMNA 4N6OB 3CCS3 2CWTA 3CCJ3 2B1XB 1YJW3 4R4KA 1RRHA 3KIIA 1IK3A 2CH9A 2CFDA 3NX0A 3ER7A 1DVCA 2P0XA 1ZO2A 3VF1A 3CME3 1US1A 3NUVA 4MEIA 4WYKB 1A2KA 3A76A 1IVXA 2GBWB 4EV5A 1ROVA 1W4NA 3G16A 1D6UA 3MSOA 2GEYA 2FNQA 3HX8A 2F99A 1IQXA 4K1VA 2WGOA 2OOVC 3RDEA 2F98A 1IVUA 2WGQA 3FCSB 1O7GB 2STDA 3B4OA 3X3ZA 2LYXA 2P38A 3JVCA 3Q90A 1PU4A 1EG9B 1OACA 1N8QA 2GU1A 3RGAA 2Q07A 3T8UA 4IT7A 3V98A 1GY7A 3F7SA 3HZPA 1OHSA 4PEJA 1GD4A 1SQWA 1OGXA 2PNCA 2HMJB 5IG4A 2OTL3 3T8NA 3NV0A 3LH4A 4HM4B 2CW9A 1O7WB 1OHPA 2CG0A 4FR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLK A;  2B24 B;  3JUO A;  2QGU A;  5AIG A;  5DRE A;  5AI1 A;  2BMR B;  3GZY B;  2HMO B;  1O7M B;  3OWY A;  1HKX A;  2HML B;  4FCM A;  4LGQ A;  1W00 A;  4U13 A;  3KE7 A;  5AIH A;  3K0Z A;  3DXO A;  3ROB A;  4X2H A;  4GB5 A;  3ECF A;  3DZL A;  1SJW A;  1W02 A;  1E3V A;  4HZB B;  4MJD A;  1O7H B;  4HM2 B;  4WWU C;  1OUN A;  2RFR A;  1GY5 A;  2BMQ B;  3EF8 A;  3CPO A;  3F7X A;  4KVH A;  2Z7A A;  3UNL A;  1U5O A;  5AII A;  8CHO A;  3FGY A;  2QIY A;  3SED A;  4H3U A;  3STD A;  3UJM A;  3F9S A;  3WMD A;  4L7K A;  4R9L A;  1DMN A;  3F8H A;  1JKG B;  3EQQ B;  3GZX B;  5IER A;  4Q53 A;  3KSP A;  1OCV A;  2YFL B;  1JN5 A;  2YFJ B;  3MG3 A;  3JUQ A;  3B7C A;  3BLZ A;  3FH1 A;  1JB5 A;  3NBR A;  4LEH A;  4HM1 B;  5AEU B;  3EN8 A;  4L8P A;  5IG0 A;  4L8O A;  4LMI A;  4HKV B;  3CNM A;  4HM6 B;  3VGN A;  4I4K A;  6STD A;  3CU3 A;  5IG3 A;  7STD A;  4XBX A;  1STD A;  3B4P A;  4R1K A;  2CHC A;  4STD A;  2OWP A;  1QJG A;  2XSO B;  2RGQ A;  5D81 A;  2HMN B;  1ULI B;  2GXF A;  5JPU A;  4WP5 A;  1EA2 A;  5KP1 A;  3K7C A;  3NV0 B;  3G8Z A;  5FW5 A;  3EBY A;  5AEW B;  3MYT A;  1OF5 A;  4FCJ A;  1O7N B;  5BXQ A;  4OUQ A;  3I0Y A;  4HJL B;  2INX A;  1DMQ A;  3RGR A;  1K41 A;  5CF1 A;  3GZB A;  2R4I A;  1OH0 A;  2A15 A;  1GS3 A;  4HM8 B;  2RCD A;  5STD A;  3GRD A;  3LZA A;  1NU3 A;  4K1U A;  3JUN A;  3DMC A;  3LYG A;  4HM0 B;  4OVM A;  1GY6 A;  3FF2 A;  2PZV A;  3DUK A;  4XBY A;  3DM8 A;  1NWW A;  3NM2 A;  5JPP A;  3CNX A;  1C7H A;  3KZT A;  1BUQ A;  3OWU A;  3KKG A;  3SOA A;  5DRV A;  5KP4 A;  1DMM A;  5KP3 A;  3EHC A;  1E97 A;  3MKI A;  3MHE A;  2UX0 A;  2I9W A;  4RZM A;  1VZZ A;  3EN1 B;  3F14 A;  3MG1 A;  2XRX B;  3VSY A;  3GWR A;  3NXJ A;  1ASK A;  3FLJ A;  5D82 A;  4XM4 A;  1QMA A;  5EVH A;  1OF5 B;  1WQL B;  3EJV A;  3JUM A;  1AR0 A;  3FZW A;  1OPY A;  3FF0 A;  2HMK B;  2BNG A;  1IDP A;  5IF6 A;  4HM3 B;  3H51 A;  5CF2 A;  1OHP A;  1TP6 A;  3D9R A;  2BMO B;  4XDW A;  3JUP A;  4XDV A;  1JB4 A;  3OX9 A;  3E99 A;  1Q40 A;  1W6Y A;  5D83 A;  3HK4 A;  3EX9 A;  3B8L A;  1W01 A;  2K54 A;  3IPT A;  1ZX2 A;  3MG2 A;  1TUH A;  4HZ9 B;  1UUW B;  2IMJ A;  5IEN A;  5IEO A;  1JB2 A;  4WYK A;  3SOY A;  2HMM B;  3EBT A;  4CDL A;  3FKA A;  3GZR A;  4N3V A;  4R9K A;  2CKF B;  3H3H A;  4HM5 B;  4HM7 B;  2XR8 B;  1UUV B;  3M8C A;  1ISK A;  1JN5 B;  2F86 B;  1O7P B;  1OGZ A;  1NDO B;  4X2O A;  5CK6 A;  3F40 A;  3F8X A;  1Q42 A;  2Z77 A;  3NHX A;  3OV4 A;  1OHO A;  4J8T A;  4HVN A;  3G0K A;  2Z76 A;  5BVB A;  3S5C A;  3OWS A;  1Z1S A;  1GYB A;  1CQS A;  4IIA A;  4ORL A;  5CXO A;  5IEP A;  4XB5 A;  2JQ5 A;  3OXA A;  5G2G A;  1S5A A;  3BB9 A;  3FSD A;  5AIF A;  2XSH B;  1E3R A;  1ULJ B;  2YFI B;  2W2C A;  5IG5 A;  2GEX A;  3EC9 A;  4J9A A;  2GBX B;  1JKG A;  1Q40 B;  4XBT A;  5TGN A;  2B1X B;  3ER7 A;  1ZO2 A;  3NUV A;  4WYK B;  1A2K A;  3A76 A;  2GBW B;  3G16 A;  3MSO A;  2GEY A;  3HX8 A;  2F99 A;  4K1V A;  2F98 A;  1O7G B;  2STD A;  3B4O A;  3Q90 A;  1EG9 B;  3RGA A;  3T8U A;  1GY7 A;  3F7S A;  3HZP A;  1OHS A;  4PEJ A;  1OGX A;  5IG4 A;  3T8N A;  3NV0 A;  4HM4 B;  1O7W B;  2HMJ B;  5HGR A; 
#chains in the Genus database with same CATH topology
 5CLK A;  2B24 B;  3S67 A;  1PY3 A;  3JUO A;  1TJD A;  1VQ5 3;  1UCL A;  3FG1 A;  2QGU A;  2UUG C;  4FMA A;  4RBN A;  1JZO A;  1BRG A;  5AIG A;  2BT3 A;  2BMR B;  5AI1 A;  5DRE A;  4O3V A;  3I55 3;  2C11 A;  5BU4 A;  1U8C B;  3GZY B;  3FG3 A;  3N8B A;  1B20 A;  2L4V A;  4WHA A;  1K9M 4;  5LC6 A;  2HMO B;  1O7M B;  3LTA A;  3A5E A;  3OWY A;  1HKX A;  1I0V A;  1LRA A;  2HML B;  4FCM A;  1W00 A;  4LGQ A;  3LTD A;  4U13 A;  1IT8 A;  2D42 A;  3KE7 A;  5AIH A;  1SIH A;  1BOX A;  3K0Z A;  4AKZ A;  3DXO A;  4N6V 0;  3ROB A;  2J8X B;  4X2H A;  4GB5 A;  1L5G B;  4MMY B;  1VQQ A;  1DVD A;  1G0T A;  1RN4 A;  1TFK A;  4N6T A;  2K0M A;  3ECF A;  3DZL A;  1SJW A;  1IVW A;  1W02 A;  1FGO A;  4EV2 A;  1E3V A;  1J2B A;  3LML A;  1BSE A;  2R41 A;  4HZB B;  1O7H B;  1EEJ A;  4HM2 B;  4MJD A;  4WWU C;  3CD6 3;  2ML5 A;  3LT8 A;  1VQ8 3;  1OUN A;  2RFR A;  1GY5 A;  1N9J A;  3X3X A;  1LXE A;  2XF3 A;  2CK3 H;  2M7O A;  1B21 A;  1M9G A;  3BNB A;  2BMQ B;  3EF8 A;  5FGO A;  3CPO A;  3F7X A;  2MC8 A;  4CPK A;  3CC4 3;  1NO3 A;  1B2X A;  2Z7A A;  4KVH A;  4EYC A;  1Q86 4;  2W6J H;  3NM7 A;  1T2I A;  4EC6 A;  1RGC A;  3UNL A;  1U5O A;  5AII A;  3K9M C;  1MGW A;  5EQL A;  8CHO A;  2KF4 A;  3KFQ C;  2SBL A;  3FG4 A;  1BAO A;  2V1L A;  4EBG A;  1BNG A;  1ZS7 A;  1DYU A;  3FGY A;  2QIY A;  3SED A;  4H3U A;  3AMO B;  3STD A;  3UB1 A;  1IVV A;  3UJM A;  4MMX B;  3F9S A;  1A2P A;  2CWV A;  2JDI H;  1HU9 A;  1RGK A;  3DGY A;  3D5G A;  4L7K A;  4R9L A;  3WMD A;  5JBS A;  3CCR 3;  3CXC 2;  1DMN A;  3F8H A;  3BU4 A;  1JKG B;  3LOY A;  1GOV A;  3EQQ B;  1CEW I;  3GZX B;  4NHF A;  1JNQ A;  5IER A;  4Q53 A;  1B2Z A;  1Q7H A;  3KSP A;  1BSB A;  1OCV A;  4FMD A;  1BRI A;  1YVB I;  3BIR A;  3QK9 A;  4CJN A;  3MWZ A;  2YFL B;  1JN5 A;  2YFJ B;  3MG3 A;  3JUQ A;  3B7C A;  3KSE D;  1WTH A;  4K61 A;  5AYR B;  3BLZ A;  1GOU A;  2F56 A;  3FH1 A;  1JB5 A;  3NBR A;  4LEH A;  5HOH A;  1S72 3;  3V99 A;  2OCT A;  4HM1 B;  3NQY A;  5AEU B;  1FGQ A;  3S28 A;  2OQE C;  2ZL8 A;  3EN8 A;  1MWR A;  4L8P A;  1UCK A;  4NPB A;  2ML6 A;  5IG0 A;  4L8O A;  4LMI A;  3DH2 A;  2P0M A;  4HKV B;  3CNM A;  3D5I A;  4HM6 B;  1G96 A;  4FMC A;  2W03 A;  3VGN A;  2D1W A;  2O3O A;  4I4K A;  1QAK A;  3CU3 A;  4J5K A;  4JRF A;  4EXR A;  6STD A;  5IG3 A;  3ALA A;  7STD A;  4HYZ A;  4XBX A;  1RGE A;  1STD A;  3NBJ A;  3B4P A;  3UL5 A;  1IQY A;  2HOH A;  2KF3 A;  2CHC A;  3DGM A;  4R1K A;  4STD A;  2OWP A;  1QAF A;  3G71 3;  3EE1 A;  1QJG A;  2XSO B;  3X40 A;  2RGQ A;  5D81 A;  1VQM 3;  2HMN B;  1Q9E A;  1ULI B;  3PCS A;  2GXF A;  5JPU A;  2CX1 A;  4WP5 A;  2CG1 A;  1EA2 A;  1LVN A;  1IV7 A;  1GD3 A;  2XEP A;  3K7C A;  5KP1 A;  1I3I A;  3NV0 B;  1VQK 3;  1BRK A;  4N6L A;  3G8Z A;  5FW5 A;  3EBY A;  5AEW B;  1BIR A;  3MYT A;  2CFL A;  1OF5 A;  4FCJ A;  1O7N B;  1B2M A;  1RKY A;  3LTB A;  1NJI 4;  7GSP A;  2BU4 A;  5BXQ A;  1MWT A;  1T3B A;  4OUQ A;  6RNT A;  9RNT A;  1Q82 4;  3I0Y A;  4HJL B;  1R4Y A;  2E2U A;  2INX A;  1D6Z A;  1TU5 A;  1DMQ A;  5G1L A;  4TX4 A;  1UCJ A;  3RGR A;  3LT9 A;  1K41 A;  2C10 A;  2GU3 A;  3GAX A;  1I8V A;  5CF1 A;  1FA3 A;  2P09 A;  1FUT A;  3GZB A;  1X1W A;  3L0R A;  2KCD A;  4KFE A;  4MMZ B;  1SPU A;  2R4I A;  4K90 B;  1G02 A;  1DET A;  1OH0 A;  1NB5 I;  2A15 A;  1QAL A;  2KF6 A;  1I2G A;  2CIU A;  1TRP A;  1MNL A;  4BIR A;  1GS3 A;  4LSO A;  1KC8 4;  4GSP A;  4HM8 B;  1UCI A;  1K8A 4;  2RCD A;  5STD A;  1T5Y A;  1M90 4;  5G1K A;  3PXM A;  1BVI A;  1BNR A;  3GRD A;  1RSN A;  3LZA A;  3X3Y A;  1NU3 A;  2YX9 A;  2RSX A;  1JJ2 2;  5BIR A;  1YGW A;  1RN7 A;  4K1U A;  2MF7 A;  3JUN A;  1AQZ A;  3DMC A;  4O8S A;  1Q81 4;  1B2S A;  1TTO A;  3LYG A;  4G1M B;  1TRQ A;  1MWS A;  1SII A;  4HM0 B;  1VQO 3;  4OVM A;  1LNH A;  1BU4 A;  2F5W A;  3WDG B;  4J9A A;  1FGM A;  3CC7 3;  1GY6 A;  3FF2 A;  2PZV A;  1B3S A;  3TDG A;  3DUK A;  1KD1 4;  1A90 A;  1RN1 A;  1ZGX A;  4XBY A;  3DM8 A;  1NWW A;  3CCU 3;  3DGN A;  3NM2 A;  1X1X A;  5JPP A;  1RMS A;  3BNC A;  3J7Y d;  3CNX A;  4RNT A;  1C7H A;  1BSD A;  2XGN A;  1SAR A;  3KZT A;  5EEO A;  1BUQ A;  5A0O B;  3K63 A;  3G6E 3;  3OWU A;  3KKG A;  3SOA A;  5DRV A;  3CCV 3;  1FUS A;  5KP4 A;  1I2E A;  2IA7 A;  1DMM A;  4H61 A;  5KP3 A;  3EHC A;  4FMB A;  1E97 A;  1PYL A;  2KAA A;  2XH9 A;  3T0U A;  1I2F A;  1YIT 3;  3HI7 A;  2XGL A;  3MHE A;  3MKI A;  3ZG5 A;  2UX0 A;  1N8R 4;  4NRE A;  4EW5 A;  5LC7 A;  1DE3 A;  2I9W A;  1WMO A;  4RZM A;  5I97 A;  1VZZ A;  3HII A;  1KWI A;  3EN1 B;  3DY5 A;  3F14 A;  4HAA A;  3MG1 A;  4HBR A;  1FZU A;  2XFT A;  1UGI A;  1VQ7 3;  1W6C A;  3BNE A;  3CCE 3;  8RNT A;  1I70 A;  2XRX B;  4R80 A;  3GWR A;  4RNY A;  5GSP A;  2OOV A;  2WO0 A;  3IMA B;  2IUJ A;  3VSY A;  2SAR A;  3NXJ A;  2W9P A;  3NQZ A;  3WOE B;  1ASK A;  3FLJ A;  4BTY A;  2CFW A;  1F8N A;  5D82 A;  4OK0 A;  2H0H A;  3X42 A;  1QVG 2;  4XM4 A;  1JV2 B;  1W2B 2;  1PFP A;  1M1K 4;  1GMP A;  1QMA A;  1BGS A;  1LQM B;  4AEQ A;  4IPB A;  5EVH A;  2W56 A;  2KXG A;  1OF5 B;  2RBI A;  1WQL B;  1EKM A;  3S27 A;  3WOF B;  3CCM 3;  1VQ4 3;  3EJV A;  1V58 A;  3JUM A;  1Y4K A;  1AR0 A;  4BL3 A;  3FZW A;  1OPY A;  4BTW A;  6GSP A;  2E2T A;  3SVA A;  3FF0 A;  2HMK B;  2BNG A;  3CCL 3;  1IDP A;  3CC2 3;  4QWT A;  1UW1 A;  3G4S 3;  1Q7Y 4;  5IF6 A;  1KQS 2;  4HM3 B;  3H51 A;  5ELJ A;  5CF2 A;  3NBB A;  2RNT A;  1TP6 A;  1EQK A;  4N6U A;  2XFS A;  1VQN 3;  2BIR A;  5AYS C;  4KFD A;  3D9R A;  3SXX A;  1FGT A;  1LNI A;  1AVL A;  4KFF A;  2BMO B;  2FGT A;  3SYU A;  2WOF A;  4XDW A;  2LQV A;  3JUP A;  4LZI A;  4XDV A;  1R4C A;  4J5G A;  1AVK A;  1JB4 A;  3OX9 A;  1BRN L;  3E99 A;  1Q40 A;  3S29 A;  1W6Y A;  1WMP A;  2E2V A;  1VQL 3;  1QVF 2;  5D83 A;  2QEX 3;  3GSP A;  3PGB A;  3SLU A;  3HK4 A;  1LOW A;  2ZHX B;  3CCQ 3;  3EX9 A;  3B8L A;  3LTC A;  1W01 A;  2W9Q A;  2Y73 A;  2K54 A;  3IPT A;  1RGF A;  1JRQ A;  1ZX2 A;  1TUH A;  3MG2 A;  3LXU X;  4HZ9 B;  3CPW 2;  1UUW B;  3HIG A;  1ROA A;  2IMJ A;  4CCV A;  1T2H A;  2W0Q A;  1BNJ A;  1RGH A;  2OTJ 3;  2AAD A;  3D79 A;  4O02 B;  3SX1 A;  5IEN A;  5M18 A;  1YGE A;  5IEO A;  1MGR A;  3EB8 A;  3D4A A;  1W2Z A;  1X1U A;  1JB2 A;  1W5Z A;  1RLS A;  1V57 A;  1CYV A;  2FXT A;  3PYJ A;  4WYK A;  3D3L A;  1W6G A;  1IQ8 A;  3SOY A;  3I56 3;  1UGH I;  1K73 4;  3WA2 X;  1BNI A;  2HMM B;  1VQP 3;  1BSA A;  4O2H A;  3X41 A;  1YHQ 3;  1TIJ A;  2W04 A;  3K5T A;  3N54 B;  3EBT A;  1JBT A;  3U97 A;  4ZM8 A;  4CDL A;  1STF I;  1IU7 A;  1W7C A;  4BTX A;  1FUW A;  3FKA A;  1YI2 3;  1UI7 A;  2F5M A;  3GZR A;  4N3V A;  4R9K A;  1YJ9 3;  2CKF B;  5ELU A;  1BRH A;  3H3H A;  4HM5 B;  4HM7 B;  1UUG B;  3DGO A;  3OW2 2;  1X1Y A;  1RGA A;  2CC3 A;  2Z6B A;  1BNS A;  2XR8 B;  1GMQ A;  1UUV B;  3M8C A;  2OQE A;  1YNV X;  1A2V A;  1RCK A;  3ZG0 A;  4GL6 A;  1M1X B;  3IJE B;  1ISK A;  3O8Y A;  5HGR A;  2BHM A;  1JN5 B;  1UI8 A;  1A67 A;  3HOH A;  2F86 B;  1TFO A;  2BO9 B;  2CX0 A;  1O7P B;  1OGZ A;  2K3D A;  3Q3F A;  3WR2 A;  1NDO B;  1RTU A;  4KZ1 A;  1CYU A;  4X2O A;  5CK6 A;  3F40 A;  3CMA 3;  1VQ9 3;  1BAN A;  2QA4 3;  2ZDJ A;  3BND A;  3F8X A;  4DKI A;  5M1A A;  1N5P A;  1Q42 A;  2Z77 A;  3NHX A;  3V92 A;  1RJO A;  3OV4 A;  1OHO A;  1BNF A;  1HYF A;  4J8T A;  1FYS A;  3MPH A;  1IYY A;  2P05 A;  1LQG C;  4KT3 B;  1KSI A;  2CFG A;  4HVN A;  2KRT A;  1VQ6 3;  2CWU A;  3G0K A;  3RNT A;  1I0X A;  2W56 B;  2Z76 A;  5BVB A;  3WA3 A;  1I3F A;  1RNT A;  1RCL A;  3URP A;  3N9H A;  3PS8 A;  3S5C A;  1B2U A;  5RNT A;  3OWS A;  4HOH A;  1Z1S A;  1GYB A;  1YJN 3;  1CQS A;  1WNH A;  4IIA A;  2CFK A;  4BL2 A;  7RNT A;  1IV9 A;  3AGN A;  1RHL A;  1AV4 A;  1NNV A;  3WOD G;  4AKY A;  1LOV A;  3PZW A;  4ORL A;  5CXO A;  5IEP A;  4N6M A;  1V74 A;  1C54 A;  3DGL A;  2IUK A;  2IYJ A;  5M19 A;  2ZA4 A;  2GSP A;  4XB5 A;  2O9U X;  1D6Y A;  2JQ5 A;  3OXA A;  1YIJ 3;  5G2G A;  1S5A A;  3BB9 A;  3FSD A;  1NB3 I;  5AIF A;  1GOY A;  2XSH B;  2C4B A;  1RRL A;  1LOY A;  1FGR A;  4JF8 A;  1E3R A;  1BNE A;  1ULJ B;  3U1W A;  1LOX A;  1GSP A;  1AY7 A;  2Y74 A;  2UGI A;  4BU4 A;  1JBS A;  2YFI B;  2W2C A;  3AMO A;  3QRD A;  3KN4 A;  5IG5 A;  1MOL A;  2GEX A;  1K28 A;  3EC9 A;  1N9E A;  1CH0 A;  1IT7 A;  1GMR A;  2GBX B;  2IY2 A;  3Q1C A;  4N6N B;  1BRJ A;  1N5H A;  4WFO A;  1BRS A;  3UL6 A;  1JKG A;  1Q40 B;  3PCR A;  3Q2P A;  3KCH A;  2WOH A;  4XBT A;  1BUJ A;  4FCZ A;  5TGN A;  4RNZ A;  2AAE A;  1WMN A;  4N6O B;  3CCS 3;  2CWT A;  1MWU A;  4GHO A;  3CCJ 3;  2B1X B;  1YJW 3;  4R4K A;  1RRH A;  1FW7 A;  3KII A;  1BSC A;  1IK3 A;  2CH9 A;  2CFD A;  4ILF A;  3NX0 A;  4I5Q A;  3ER7 A;  1DVC A;  2P0X A;  3AHW A;  1ZO2 A;  3ZFZ A;  5IW9 A;  3VF1 A;  2H0G A;  3CME 3;  1US1 A;  3NUV A;  4MEI A;  3AHS A;  1A2K A;  3A76 A;  4WYK B;  1IVX A;  2F4Y A;  2GBW B;  4EV5 A;  1RGG A;  1ROV A;  1W4N A;  3G16 A;  1D6U A;  1EUI C;  3MSO A;  2GEY A;  2FNQ A;  3HX8 A;  2F99 A;  1IQX A;  4K1V A;  2WGO A;  2OOV C;  3RDE A;  2F98 A;  1B27 A;  1IVU A;  2WGQ A;  4LYL B;  3FCS B;  1O7G B;  1JBR A;  1HZ1 A;  2STD A;  3B4O A;  3X3Z A;  2LYX A;  2P38 A;  3JVC A;  3Q90 A;  3AGO A;  3WHO A;  2H0I A;  1PU4 A;  1EG9 B;  1OAC A;  1N8Q A;  2GU1 A;  1RDS A;  3RGA A;  2Q07 A;  1JZD A;  3T8U A;  1RNB A;  4IT7 A;  3V98 A;  1GY7 A;  3F7S A;  3HZP A;  1OHS A;  4PEJ A;  1GD4 A;  1SQW A;  1OGX A;  1YVS A;  2L1S A;  2PNC A;  2HMJ B;  5IG4 A;  2OTL 3;  3T8N A;  3NV0 A;  3LH4 A;  4HM4 B;  2CW9 A;  1RGL A;  1O7W B;  1UDI I;  2KF5 A;  1OHP A;  2CG0 A;  4FR9 A; 
#chains in the Genus database with same CATH homology
 5CLK A;  2B24 B;  3S67 A;  3JUO A;  1VQ5 3;  3FG1 A;  2QGU A;  4RBN A;  4FMA A;  5AIG A;  5DRE A;  2BT3 A;  2BMR B;  5AI1 A;  4O3V A;  3I55 3;  2C11 A;  1U8C B;  3GZY B;  3FG3 A;  3N8B A;  2L4V A;  4WHA A;  1K9M 4;  5LC6 A;  2HMO B;  1O7M B;  3LTA A;  3OWY A;  1HKX A;  2HML B;  4FCM A;  4LGQ A;  1W00 A;  4U13 A;  3LTD A;  1IT8 A;  2D42 A;  3KE7 A;  5AIH A;  1SIH A;  3K0Z A;  4AKZ A;  3DXO A;  4N6V 0;  3ROB A;  4X2H A;  4GB5 A;  1L5G B;  4MMY B;  1DVD A;  1TFK A;  4N6T A;  2K0M A;  3ECF A;  3DZL A;  1SJW A;  1IVW A;  1W02 A;  1FGO A;  4EV2 A;  1E3V A;  1J2B A;  3LML A;  4HZB B;  4MJD A;  3CD6 3;  1O7H B;  4HM2 B;  4WWU C;  2ML5 A;  3LT8 A;  1VQ8 3;  1OUN A;  2RFR A;  1GY5 A;  1N9J A;  3X3X A;  1LXE A;  2XF3 A;  2CK3 H;  2M7O A;  1M9G A;  3BNB A;  2BMQ B;  3EF8 A;  5FGO A;  3CPO A;  3F7X A;  2MC8 A;  3CC4 3;  1NO3 A;  4KVH A;  2Z7A A;  4EYC A;  1Q86 4;  2W6J H;  3NM7 A;  4EC6 A;  3UNL A;  1U5O A;  5AII A;  3K9M C;  5EQL A;  8CHO A;  3KFQ C;  2SBL A;  3FG4 A;  2V1L A;  4EBG A;  1DYU A;  3FGY A;  2QIY A;  3SED A;  4H3U A;  3AMO B;  3STD A;  3UB1 A;  1IVV A;  3UJM A;  4MMX B;  3F9S A;  2CWV A;  2JDI H;  3WMD A;  1HU9 A;  3CCR 3;  4L7K A;  4R9L A;  5JBS A;  3CXC 2;  1DMN A;  3F8H A;  1JKG B;  3LOY A;  3EQQ B;  1CEW I;  3GZX B;  4NHF A;  1JNQ A;  5IER A;  4Q53 A;  3KSP A;  1OCV A;  4FMD A;  1YVB I;  3QK9 A;  3MWZ A;  2YFL B;  1JN5 A;  2YFJ B;  3MG3 A;  3JUQ A;  3B7C A;  3KSE D;  1WTH A;  4K61 A;  5AYR B;  3BLZ A;  3FH1 A;  1JB5 A;  3NBR A;  4LEH A;  1S72 3;  3V99 A;  2OCT A;  4HM1 B;  3NQY A;  5AEU B;  1FGQ A;  3S28 A;  2OQE C;  2ZL8 A;  3EN8 A;  4L8P A;  5IG0 A;  2ML6 A;  4L8O A;  4LMI A;  2P0M A;  4HKV B;  3CNM A;  4HM6 B;  1G96 A;  4FMC A;  2W03 A;  3VGN A;  2D1W A;  2O3O A;  4I4K A;  1QAK A;  3CU3 A;  4JRF A;  4EXR A;  6STD A;  5IG3 A;  3ALA A;  7STD A;  4HYZ A;  4XBX A;  1STD A;  3NBJ A;  3B4P A;  3UL5 A;  1IQY A;  4R1K A;  2CHC A;  3DGM A;  4STD A;  2OWP A;  1QAF A;  3G71 3;  3EE1 A;  1QJG A;  2XSO B;  3X40 A;  2RGQ A;  5D81 A;  1VQM 3;  2HMN B;  1ULI B;  3PCS A;  2GXF A;  5JPU A;  4WP5 A;  2CG1 A;  1EA2 A;  1LVN A;  1IV7 A;  1GD3 A;  2XEP A;  3K7C A;  5KP1 A;  3NV0 B;  1VQK 3;  4N6L A;  3G8Z A;  5FW5 A;  3EBY A;  5AEW B;  3MYT A;  2CFL A;  1OF5 A;  4FCJ A;  1O7N B;  1RKY A;  3LTB A;  1NJI 4;  5BXQ A;  4OUQ A;  1Q82 4;  3I0Y A;  4HJL B;  2E2U A;  2INX A;  1D6Z A;  1TU5 A;  1DMQ A;  3RGR A;  4TX4 A;  3LT9 A;  1K41 A;  2C10 A;  2GU3 A;  3GAX A;  5CF1 A;  1FA3 A;  2P09 A;  3GZB A;  3L0R A;  2KCD A;  4KFE A;  4MMZ B;  1SPU A;  2R4I A;  4K90 B;  1OH0 A;  1NB5 I;  2A15 A;  1QAL A;  2CIU A;  1MNL A;  1GS3 A;  4LSO A;  1KC8 4;  4HM8 B;  1K8A 4;  2RCD A;  5STD A;  1T5Y A;  1M90 4;  3PXM A;  3GRD A;  3LZA A;  3X3Y A;  1NU3 A;  2YX9 A;  2RSX A;  1JJ2 2;  1RN7 A;  4K1U A;  2MF7 A;  3JUN A;  1Q81 4;  3DMC A;  4O8S A;  3LYG A;  4G1M B;  1SII A;  4HM0 B;  1VQO 3;  4OVM A;  1LNH A;  3WDG B;  3CC7 3;  1FGM A;  1GY6 A;  3FF2 A;  2PZV A;  1KD1 4;  3TDG A;  3DUK A;  1A90 A;  4XBY A;  3DM8 A;  1NWW A;  3CCU 3;  3DGN A;  3NM2 A;  5JPP A;  3BNC A;  3J7Y d;  3CNX A;  1C7H A;  2XGN A;  3KZT A;  5EEO A;  1BUQ A;  5A0O B;  3K63 A;  3G6E 3;  3OWU A;  3KKG A;  3SOA A;  5DRV A;  3CCV 3;  5KP4 A;  2IA7 A;  1DMM A;  4H61 A;  5KP3 A;  3EHC A;  4FMB A;  1E97 A;  2XH9 A;  3T0U A;  1YIT 3;  3HI7 A;  2XGL A;  3MHE A;  3MKI A;  2UX0 A;  1N8R 4;  4NRE A;  5LC7 A;  2I9W A;  1WMO A;  4RZM A;  5I97 A;  1VZZ A;  3HII A;  1KWI A;  3EN1 B;  3DY5 A;  3F14 A;  3MG1 A;  4HBR A;  2XFT A;  1VQ7 3;  1W6C A;  3BNE A;  3CCE 3;  2XRX B;  4R80 A;  4RNY A;  3GWR A;  2OOV A;  3VSY A;  2IUJ A;  2WO0 A;  3IMA B;  3NXJ A;  2W9P A;  3NQZ A;  3WOE B;  1ASK A;  3FLJ A;  4BTY A;  2CFW A;  1F8N A;  5D82 A;  4OK0 A;  3X42 A;  1QVG 2;  4XM4 A;  1JV2 B;  1W2B 2;  1PFP A;  1M1K 4;  1QMA A;  4AEQ A;  4IPB A;  5EVH A;  2W56 A;  2KXG A;  1OF5 B;  1VQ4 3;  1WQL B;  1EKM A;  3S27 A;  3WOF B;  3CCM 3;  3EJV A;  3JUM A;  1Y4K A;  1AR0 A;  3FZW A;  1OPY A;  4BTW A;  2E2T A;  3SVA A;  3FF0 A;  2HMK B;  2BNG A;  3CCL 3;  1IDP A;  3CC2 3;  4QWT A;  1UW1 A;  3G4S 3;  1Q7Y 4;  5IF6 A;  1KQS 2;  4HM3 B;  3H51 A;  5ELJ A;  5CF2 A;  3NBB A;  1TP6 A;  1EQK A;  4N6U A;  2XFS A;  1VQN 3;  5AYS C;  4KFD A;  3D9R A;  3SXX A;  1FGT A;  1AVL A;  4KFF A;  2BMO B;  2FGT A;  2WOF A;  4XDW A;  2LQV A;  3JUP A;  4LZI A;  4XDV A;  1R4C A;  1AVK A;  1JB4 A;  3OX9 A;  3E99 A;  1Q40 A;  3S29 A;  1W6Y A;  1WMP A;  2E2V A;  1VQL 3;  1QVF 2;  5D83 A;  2QEX 3;  3PGB A;  3SLU A;  3HK4 A;  3CCQ 3;  3EX9 A;  3B8L A;  3LTC A;  1W01 A;  2W9Q A;  2Y73 A;  2K54 A;  3IPT A;  1ZX2 A;  1JRQ A;  3MG2 A;  1TUH A;  3LXU X;  3CPW 2;  4HZ9 B;  1UUW B;  3HIG A;  1ROA A;  2IMJ A;  4CCV A;  2W0Q A;  2OTJ 3;  3SX1 A;  4O02 B;  5IEN A;  1YGE A;  5IEO A;  3EB8 A;  1W2Z A;  1JB2 A;  1W5Z A;  2FXT A;  3PYJ A;  1CYV A;  4WYK A;  3D3L A;  1W6G A;  1IQ8 A;  3SOY A;  3I56 3;  1K73 4;  3WA2 X;  2HMM B;  1VQP 3;  4O2H A;  3X41 A;  1YHQ 3;  1TIJ A;  2W04 A;  3K5T A;  3N54 B;  3EBT A;  3U97 A;  4ZM8 A;  4CDL A;  1STF I;  1IU7 A;  1W7C A;  4BTX A;  1FUW A;  3FKA A;  1YI2 3;  1UI7 A;  3GZR A;  4N3V A;  4R9K A;  1YJ9 3;  2CKF B;  5ELU A;  3H3H A;  4HM5 B;  4HM7 B;  3DGO A;  3OW2 2;  2CC3 A;  2Z6B A;  2XR8 B;  1UUV B;  3M8C A;  2OQE A;  1A2V A;  4GL6 A;  1M1X B;  3IJE B;  1ISK A;  3O8Y A;  5HGR A;  2BHM A;  1JN5 B;  1UI8 A;  1A67 A;  2F86 B;  1TFO A;  2BO9 B;  1O7P B;  1OGZ A;  1NDO B;  4KZ1 A;  1CYU A;  4X2O A;  5CK6 A;  3F40 A;  3CMA 3;  1VQ9 3;  2QA4 3;  2ZDJ A;  3BND A;  3F8X A;  1N5P A;  1Q42 A;  2Z77 A;  3NHX A;  3V92 A;  1RJO A;  3OV4 A;  1OHO A;  4J8T A;  3MPH A;  2P05 A;  1KSI A;  2CFG A;  4HVN A;  2KRT A;  1VQ6 3;  2CWU A;  3G0K A;  3WA3 A;  2W56 B;  2Z76 A;  5BVB A;  3N9H A;  3PS8 A;  3S5C A;  3OWS A;  1Z1S A;  1GYB A;  1YJN 3;  1CQS A;  1WNH A;  4IIA A;  2CFK A;  1IV9 A;  1AV4 A;  3WOD G;  4AKY A;  4ORL A;  3PZW A;  5CXO A;  5IEP A;  4N6M A;  1V74 A;  3DGL A;  2IUK A;  4XB5 A;  2O9U X;  1D6Y A;  2JQ5 A;  3OXA A;  1YIJ 3;  5G2G A;  1S5A A;  3BB9 A;  3FSD A;  1NB3 I;  5AIF A;  2XSH B;  1RRL A;  1FGR A;  4JF8 A;  1E3R A;  3U1W A;  1ULJ B;  1LOX A;  2Y74 A;  2YFI B;  2W2C A;  3AMO A;  3QRD A;  3KN4 A;  5IG5 A;  1MOL A;  2GEX A;  1K28 A;  3EC9 A;  1N9E A;  2GBX B;  1IT7 A;  3Q1C A;  4J9A A;  4N6N B;  5IW9 A;  1N5H A;  4WFO A;  3UL6 A;  1JKG A;  1Q40 B;  3PCR A;  3Q2P A;  4XBT A;  2WOH A;  4FCZ A;  5TGN A;  4RNZ A;  1WMN A;  4N6O B;  3CCS 3;  2CWT A;  3CCJ 3;  2B1X B;  1YJW 3;  4R4K A;  1RRH A;  3KII A;  1IK3 A;  2CH9 A;  2CFD A;  3NX0 A;  3ER7 A;  1DVC A;  2P0X A;  1ZO2 A;  3VF1 A;  3CME 3;  1US1 A;  3NUV A;  4MEI A;  4WYK B;  1A2K A;  3A76 A;  1IVX A;  2GBW B;  4EV5 A;  1ROV A;  1W4N A;  3G16 A;  1D6U A;  3MSO A;  2GEY A;  2FNQ A;  3HX8 A;  2F99 A;  1IQX A;  4K1V A;  2WGO A;  2OOV C;  3RDE A;  2F98 A;  1IVU A;  2WGQ A;  3FCS B;  1O7G B;  2STD A;  3B4O A;  3X3Z A;  2LYX A;  2P38 A;  3JVC A;  3Q90 A;  1PU4 A;  1EG9 B;  1OAC A;  1N8Q A;  2GU1 A;  3RGA A;  2Q07 A;  3T8U A;  4IT7 A;  3V98 A;  1GY7 A;  3F7S A;  3HZP A;  1OHS A;  4PEJ A;  1GD4 A;  1SQW A;  1OGX A;  2PNC A;  2HMJ B;  5IG4 A;  2OTL 3;  3T8N A;  3NV0 A;  3LH4 A;  4HM4 B;  2CW9 A;  1O7W B;  1OHP A;  2CG0 A;  4FR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...