1DVDA

Solution nmr structure of human stefin a at ph 5.5 and 308k, nmr, 17 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEFIN A
publication title The three-dimensional solution structure of human stefin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Thiol protease inhibitor
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dvdA00
2W9PA 1WNHA 3Q2PA 3LH4A 5LC7A 5ELJA 4N6UA 1N9JA 5LC6A 1A90A 1CYUA 4LZIA 3UL6A 3PXMA 4N6TA 3SVAA 4EYCA 3PYJA 1RN7A 1LXEA 2KXGA 4CCVA 2OCTA 1IV7A 1EQKA 5EQLA 1CEWI 1NB3I 4ZM8A 1M9GA 1DVDA 1N5PA 4N6LA 1N5HA 4N6MA 1GD3A 1TIJA 3MWZA 2W9QA 3KSED 4N6OB 1MNLA 3KFQC 1DVCA 1ROAA 3NX0A 3GAXA 1CYVA 4TX4A 1YVBI 1KWIA 2CH9A 2BO9B 1G96A 4N6V0 4N6NB 5A0OB 3PS8A 1FA3A 3IMAB 1STFI 3S67A 1FUWA 3QRDA 1MOLA 3UL5A 1GD4A 1NB5I 1PFPA 1A67A 4IT7A 1R4CA 3L0RA 3K9MC 1IV9A 5ELUA 2O9UX
chains in the Genus database with same CATH superfamily
1RGCA 3WA3A 3I553 5IG5A 3I0YA 1LQMB 3G8ZA 1OHOA 2XGNA 5CXOA 3FG4A 2HMLB 4BTXA 4RNYA 3LH4A 1AVLA 1BRIA 3BIRA 2AAEA 5D81A 2RBIA 3NQYA 1D6UA 1X1UA 1W00A 3ZFZA 1GYBA 1E3VA 1OHSA 3LXUX 4IIAA 1TU5A 1X1XA 1OGXA 1DE3A 1Q814 1ROVA 1BRGA 3N9HA 3RGAA 1BSEA 1U8CB 4HZ9B 4EW5A 5IEOA 1AVKA 1GMRA 2P38A 4FMDA 1N9JA 1YGEA 1BSCA 3CPOA 1Q7HA 5KP3A 5LC6A 1D6YA 1BU4A 2OOVA 1BVIA 1DETA 3PXMA 1X1YA 3WR2A 3GZXB 2Z6BA 4HVNA 5FGOA 2O3OA 3X3XA 1MWTA 2SBLA 2KF4A 3AGNA 1NO3A 4N3VA 3NUVA 3BB9A 3DGMA 2Z76A 1EUIC 5M19A 1IQYA 3Q3FA 1BNEA 2RNTA 3EE1A 1LQGC 2A15A 3NXJA 4XDVA 5EQLA 3ZG0A 3SLUA 2L4VA 1VQ93 2QEX3 4LEHA 3K0ZA 3DXOA 4ZM8A 3MG3A 1YI23 4FR9A 3ZG5A 1E3RA 2Q07A 1VQK3 2BNGA 1M9GA 1O7WB 4XM4A 4HM1B 4I5QA 3LTCA 3EJVA 2CWVA 3FLJA 4HKVB 1W2B2 3NBRA 2XF3A 1RKYA 2KRTA 3GSPA 4LSOA 2GXFA 1GOYA 1JZDA 3SEDA 3OV4A 1FGOA 4FCJA 5AIHA 3FG1A 4AEQA 1RLSA 1RGHA 2GBWB 1W4NA 2E2UA 4K90B 4DKIA 3MHEA 1S723 1WMPA 2XSHB 1IT8A 3F14A 1ASKA 1NDOB 3D3LA 3F40A 3F8HA 4GHOA 4JRFA 4O2HA 1WMNA 3I563 2CG0A 1JB5A 1Q40A 1MGWA 4AKYA 4RBNA 1UGHI 1RGAA 2FXTA 3GAXA 3CCU3 1IVUA 1PY3A 2F86B 4KFFA 3D5IA 4X2HA 1T2IA 4J5GA 1I0XA 1B27A 1CH0A 1RRHA 1R4YA 2GU1A 2Z77A 5A0OB 1HYFA 3WDGB 2INXA 4OVMA 4K1UA 1AR0A 2FGTA 3DGOA 2CC3A 4J5KA 3IMAB 3X42A 1BUJA 1RGEA 1STFI 1RRLA 3RGRA 3S67A 1OH0A 3GWRA 1GD4A 2OTL3 1V57A 1DYUA 1RN1A 2CK3H 2CFWA 3HIGA 4LYLB 4QWTA 1C7HA 1A67A 3X3YA 2KAAA 4HM7B 6STDA 5AIGA 5DRVA 5G1LA 3DM8A 1UI7A 5IG4A 2OQEA 2FNQA 3L0RA 3DH2A 1QAFA 4LGQA 4BTWA 1GSPA 1YIT3 1IV9A 2E2VA 1WQLB 1KD14 3ER7A 1KC84 2BIRA 8CHOA 3G4S3 1GS3A 2SARA 3G713 1Q864 4BU4A 5TGNA 5D83A 3CMA3 2QIYA 5JPUA 4FMAA 1WNHA 1K734 1O7HB 1JBTA 1GMQA 4OUQA 2IMJA 3U1WA 1G02A 3LT8A 3RNTA 8RNTA 1BRKA 3S29A 5LC7A 2ZHXB 5JBSA 1BRJA 1JV2B 1W6GA 1Q824 2WGQA 2Z7AA 4KVHA 5ELJA 1BNSA 3DGYA 3CXC2 3WOFB 2I9WA 1LOVA 5AIFA 1B2MA 1I8VA 4L8OA 1BANA 1NJI4 3CPW2 1RHLA 3OWYA 3ROBA 4LZIA 4EXRA 2MF7A 1JBRA 1VQ83 4MMYB 1LOYA 3SOAA 1GY7A 4EYCA 4CJNA 1RN7A 3ALAA 1B3SA 1LXEA 1ZX2A 1VQN3 4GB5A 3T8NA 4U13A 3AGOA 5CLKA 3B4OA 3URPA 3MYTA 6GSPA 2BMRB 2OCTA 1US1A 3MPHA 1SPUA 5KP4A 1I2GA 1A2KA 1BNJA 2P09A 4MMZB 1E97A 3LT9A 4R9KA 3CCQ3 1CEWI 1DMNA 4WYKB 1QJGA 1AV4A 1RTUA 3KKGA 2W6JH 5IG0A 3JUMA 4L8PA 1MWRA 2HMKB 5D82A 5EEOA 4LMIA 3GZRA 3LZAA 2RGQA 1SIIA 1A2VA 1UCIA 3D5GA 4HBRA 4N6LA 1VQQA 3EN8A 3LTAA 2CG1A 3CCJ3 1BRHA 4CDLA 2WOFA 1VQM3 1I2EA 3HIIA 3NQZA 3VGNA 2ZA4A 1OHPA 3D9RA 1FUSA 1EKMA 1W6YA 4O02B 3G6E3 3LMLA 4N6OB 2CFDA 2YX9A 3QK9A 3BLZA 1NU3A 5I97A 1MNLA 3KFQC 4JF8A 3D79A 4R9LA 5M1AA 3GZYB 3NX0A 1J2BA 1UW1A 4RZMA 1RMSA 3F9SA 4TX4A 5FW5A 3HOHA 3J7Yd 2BO9B 1BNFA 1O7PB 1FZUA 1W02A 3MG2A 2BHMA 4RNTA 1ZO2A 3K63A 1YHQ3 4H3UA 1BRNL 1V74A 4N6NB 2CIUA 4KT3B 4HJLB 1B2SA 2C10A 2R4IA 2W0QA 2WOHA 3FH1A 1V58A 5EVHA 2RCDA 2HOHA 2UGIA 1FYSA 4STDA 2YFLB 1IVVA 3DY5A 1VQP3 1VQL3 1YVSA 1UCLA 3OWSA 1W5ZA 3OW22 1DMQA 4J8TA 3CC23 3GZBA 1B2ZA 2KF6A 2PNCA 2CFKA 4BIRA 9RNTA 3CD63 1K8A4 3UJMA 3UNLA 2BMOB 3T8UA 4MMXB 2H0GA 1Q9EA 3NV0B 1O7GB 3CME3 1CQSA 3A5EA 5AYRB 1EA2A 3EHCA 3SOYA 1U5OA 1YJW3 1LVNA 1BSAA 3SXXA 1JJ22 3BNEA 2IUJA 2KCDA 3H51A 2OWPA 2STDA 1JN5B 2O9UX 1JZOA 2JDIH 1G0TA 1FUTA 1W01A 4HM6B 2W9PA 3NM2A 4EBGA 1OF5B 2B24B 4HM2B 1JRQA 3LOYA 1IQ8A 3FZWA 2F4YA 1B2UA 2B1XB 1I3FA 2UX0A 4MJDA 7STDA 1UCKA 2IA7A 2GEXA 4FMCA 2XRXB 3N8BA 3Q1CA 3NM7A 2OOVC 4HM5B 3LTBA 4HM4B 1L5GB 6RNTA 3CCR3 1SJWA 2GSPA 4IPBA 2ZDJA 1PYLA 2W56B 1TUHA 4BL2A 1RNBA 1D6ZA 3HX8A 1LNIA 1YNVX 4XB5A 1MWUA 1TRPA 1A90A 3MG1A 4FCMA 3DZLA 3WODG 1N8R4 2CFGA 2F98A 1RGFA 3PCRA 4K1VA 4WFOA 2GU3A 5AYSC 3X3ZA 3FF2A 4KFEA 1B21A 5HOHA 3E99A 2LYXA 5GSPA 3WA2X 2LQVA 1BSDA 4L7KA 1VQ53 2H0HA 3WOEB 4KFDA 2XSOB 1GOUA 1QAKA 1T3BA 2W2CA 4ILFA 1HKXA 1JKGB 3JUOA 3V92A 1IV7A 7RNTA 1VQ73 4HOHA 1EQKA 2RSXA 3DGNA 3N54B 2BT3A 4WYKA 2YFJB 4PEJA 3S28A 3WHOA 3U97A 4O8SA 2PZVA 3IPTA 4RNZA 1M904 3EQQB 5BXQA 1DVDA 4KZ1A 3V99A 2HMNB 1UCJA 3PCSA 4H61A 3FF0A 3CCM3 2F5MA 3H3HA 5BU4A 3V98A 1N5HA 1GD3A 5BVBA 1RDSA 1MGRA 1BGSA 1RJOA 2CHCA 2CKFB 2P05A 1M1K4 2W03A 4HM0B 2W9QA 3UB1A 3O8YA 2F5WA 2HMJB 1TFOA 2F99A 4FMBA 1PU4A 2H0IA 1RGKA 2K3DA 1JBSA 2M7OA 1DVCA 1ROAA 4WP5A 1X1WA 3BU4A 4EC6A 1O7NB 3CCL3 2K54A 3Q90A 1G96A 1BOXA 1N8QA 3EX9A 3K5TA 1BIRA 4G1MB 2E2TA 1AY7A 3B7CA 3S27A 1UUWB 1VQ63 1FGMA 4N6V0 5AEWB 5IERA 3EBYA 4R80A 4CPKA 3G16A 5HGRA 1BNIA 3FCSB 4X2OA 3AMOB 1IVXA 2K0MA 2ML6A 3EN1B 2XR8B 1JB4A 2OQEC 3GRDA 1BSBA 1T2HA 1GY6A 1K9M4 1HU9A 5DREA 1UGIA 2WO0A 1B20A 1I3IA 1M1XB 1RN4A 2KF3A 2P0XA 4R4KA 1RNTA 3JUNA 3KE7A 3NV0A 3EF8A 1IQXA 2Y74A 5AIIA 3D4AA 3VSYA 4GSPA 3KZTA 3TDGA 1JN5A 2D1WA 1RGGA 2WGOA 4I4KA 2CW9A 3PZWA 1YJN3 3OWUA 5IEPA 1OPYA 2XFTA 4NPBA 4AKZA 1KQS2 3FKAA 1F8NA 1IT7A 1KSIA 1N9EA 2XFSA 2ZL8A 1OF5A 5AI1A 5BIRA 1JB2A 1I70A 2XH9A 1OACA 3SX1A 4NHFA 3CCS3 1BRSA 1DMMA 3Q2PA 4MEIA 2W04A 4HM8B 1EG9B 1GMPA 3AHWA 4Q53A 5IF6A 3BNCA 5AEUB 1IVWA 2QGUA 1Q7Y4 3EB8A 2CX1A 1LNHA 1SIHA 3CC73 2QA43 3BNBA 4OK0A 1RCKA 1NWWA 2W56A 1Q42A 2F56A 4J9AA 3VF1A 4N6UA 1FW7A 2V1LA 2BU4A 2XEPA 3K7CA 1C54A 1W6CA 3F7SA 3X40A 7GSPA 1CYUA 3UL6A 2CFLA 2L1SA 2YFIB 2UUGC 2XGLA 3ECFA 3EBTA 3JUQA 4XDWA 4N6TA 3JVCA 3SVAA 1Z1SA 1TFKA 4ORLA 3PYJA 3HI7A 5G2GA 1Y4KA 1UUVB 4XBTA 2AADA 5JPPA 2RFRA 1TJDA 3KN4A 2KXGA 4HAAA 5RNTA 1ISKA 3DMCA 4CCVA 1YGWA 3NBJA 4XBXA 1JKGA 2IUKA 1WTHA 1YIJ3 1FGTA 1ZS7A 3EC9A 4FCZA 1K41A 3G0KA 1W2ZA 1B2XA 3KIIA 3WMDA 1QVG2 5STDA 1BAOA 2MC8A 1NB3I 1MWSA 1LOWA 3FSDA 1LRAA 1AQZA 1GOVA 1N5PA 2GBXB 3MKIA 1QVF2 5G1KA 2D42A 1VQO3 1FGRA 2IYJA 3A76A 3HZPA 1RSNA 3S5CA 3F8XA 4N6MA 1TIJA 3MWZA 2HMOB 1EEJA 3SYUA 1LOXA 2OTJ3 3CU3A 4HM3B 1IDPA 4HYZA 3STDA 1STDA 3B4PA 1YJ93 1VQ43 3KSED 4HZBB 1WMOA 5IW9A 2CWTA 1NNVA 1QALA 1QMAA 3CCV3 4NREA 4EV5A 1Q40B 4R1KA 3FGYA 1IK3A 5IENA 1OGZA 1ULIB 2CWUA 2J8XB 1SQWA 1CYVA 1TTOA 3CNXA 2GEYA 1YVBI 4K61A 3DGLA 1KWIA 1ULJB 1JNQA 1I2FA 2C11A 2CH9A 3IJEB 3KCHA 4BL3A 1UDII 2Y73A 3NHXA 5CF2A 1GY5A 1RGLA 3OX9A 2KF5A 3DUKA 3BNDA 2CX0A 3NBBA 1T5YA 3RDEA 4BTYA 4O3VA 3PS8A 1S5AA 4XBYA 3AHSA 3FG3A 4WWUC 1TRQA 1BNRA 1W7CA 4GL6A 1FA3A 3CC43 3X41A 1BUQA 3AMOA 1IYYA 1FUWA 3QRDA 5CK6A 1MOLA 3KSPA 1VZZA 3UL5A 3M8CA 1NB5I 3LTDA 1I0VA 1O7MB 5CF1A 1UUGB 3JUPA 1K28A 3CNMA 5M18A 2C4BA 1PFPA 1RCLA 3F7XA 1A2PA 1UI8A 1FGQA 3OXAA 5KP1A 2IY2A 4IT7A 3PGBA 1HZ1A 1R4CA 3MSOA 3K9MC 1SARA 2ML5A 4EV2A 3CCE3 1TP6A 5IG3A 2R41A 3HK4A 2HMMB 2JQ5A 1IU7A 2P0MA 3T0UA 1OCVA 1OUNA 4WHAA 1ZGXA 2BMQB 1BNGA 3B8LA 3LYGA 5ELUA
chains in the Genus database with same CATH topology
3WA3A 3I553 5IG5A 3I0YA 3G8ZA 1OHOA 2XGNA 5CXOA 3FG4A 2HMLB 4BTXA 4RNYA 3LH4A 1AVLA 5D81A 3NQYA 1D6UA 1W00A 1GYBA 1E3VA 1OHSA 3LXUX 4IIAA 1TU5A 1OGXA 1Q814 1ROVA 3N9HA 3RGAA 1U8CB 4HZ9B 5IEOA 1AVKA 2P38A 5KP3A 4FMDA 1N9JA 1YGEA 5LC6A 3CPOA 1D6YA 2OOVA 3PXMA 3GZXB 2Z6BA 4HVNA 5FGOA 2O3OA 3X3XA 2SBLA 4N3VA 1NO3A 3NUVA 3BB9A 3DGMA 2Z76A 1IQYA 3EE1A 2A15A 3NXJA 4XDVA 5EQLA 3SLUA 2L4VA 1VQ93 2QEX3 4LEHA 3K0ZA 3DXOA 4ZM8A 3MG3A 1YI23 4FR9A 1E3RA 2Q07A 1VQK3 2BNGA 1M9GA 1O7WB 4XM4A 4HM1B 3LTCA 3EJVA 2CWVA 3FLJA 4HKVB 1W2B2 3NBRA 2XF3A 1RKYA 2KRTA 4LSOA 2GXFA 3SEDA 3OV4A 1FGOA 4FCJA 5AIHA 3FG1A 4AEQA 2GBWB 1W4NA 2E2UA 4K90B 3MHEA 1S723 1WMPA 2XSHB 1IT8A 3F14A 1ASKA 1NDOB 3D3LA 3F40A 3F8HA 4JRFA 4O2HA 1WMNA 3I563 2CG0A 1JB5A 1Q40A 4AKYA 4RBNA 3GAXA 2FXTA 3CCU3 1IVUA 2F86B 4KFFA 4X2HA 1RRHA 2GU1A 2Z77A 5A0OB 3WDGB 2INXA 4OVMA 4K1UA 1AR0A 2FGTA 3DGOA 2CC3A 3X42A 3IMAB 1STFI 1RRLA 3RGRA 3S67A 1OH0A 3GWRA 1GD4A 2OTL3 1DYUA 2CK3H 2CFWA 3HIGA 4QWTA 1C7HA 1A67A 3X3YA 6STDA 4HM7B 5IG4A 5AIGA 5DRVA 3DM8A 1UI7A 2OQEA 2FNQA 3L0RA 1QAFA 4LGQA 4BTWA 1YIT3 1IV9A 2E2VA 1WQLB 1KD14 3ER7A 1KC84 8CHOA 3G4S3 1GS3A 3G713 1Q864 5TGNA 5D83A 3CMA3 2QIYA 5JPUA 4FMAA 1WNHA 1K734 1O7HB 4OUQA 2IMJA 3U1WA 3LT8A 3S29A 5LC7A 5JBSA 1JV2B 1W6GA 1Q824 2WGQA 2Z7AA 4KVHA 5ELJA 3CXC2 3WOFB 2I9WA 5AIFA 4L8OA 1NJI4 3CPW2 3OWYA 3ROBA 4LZIA 4EXRA 2MF7A 1VQ83 4MMYB 3SOAA 1GY7A 4EYCA 1RN7A 3ALAA 1LXEA 1ZX2A 1VQN3 4GB5A 3T8NA 4U13A 5CLKA 3B4OA 3MYTA 2BMRB 2OCTA 1US1A 3MPHA 1SPUA 5KP4A 1A2KA 2P09A 4MMZB 1E97A 3LT9A 4R9KA 3CCQ3 1CEWI 1DMNA 4WYKB 1QJGA 1AV4A 3KKGA 2W6JH 5IG0A 3JUMA 4L8PA 2HMKB 5D82A 5EEOA 4LMIA 3GZRA 3LZAA 2RGQA 1SIIA 1A2VA 4HBRA 4N6LA 3LTAA 3EN8A 2CG1A 3CCJ3 4CDLA 2WOFA 1VQM3 3HIIA 3NQZA 3VGNA 1OHPA 3D9RA 4O02B 1EKMA 1W6YA 3G6E3 3LMLA 4N6OB 2CFDA 2YX9A 3QK9A 3BLZA 1NU3A 5I97A 1MNLA 3KFQC 4JF8A 4R9LA 3GZYB 3NX0A 1J2BA 1UW1A 4RZMA 3F9SA 4TX4A 5FW5A 3J7Yd 2BO9B 1O7PB 1W02A 1YHQ3 3MG2A 2BHMA 1ZO2A 3K63A 4H3UA 1V74A 4N6NB 2CIUA 4HJLB 2C10A 2R4IA 2W0QA 2WOHA 3FH1A 5EVHA 2RCDA 4STDA 2YFLB 1IVVA 3DY5A 1VQP3 1VQL3 3OWSA 1W5ZA 3OW22 1DMQA 4J8TA 3CC23 3GZBA 2PNCA 2CFKA 3CD63 1K8A4 3UJMA 3UNLA 2BMOB 3T8UA 4MMXB 3NV0B 1O7GB 3CME3 1CQSA 5AYRB 3SOYA 1EA2A 3EHCA 1YJW3 1U5OA 1LVNA 3SXXA 1JJ22 3BNEA 2IUJA 2KCDA 3H51A 2OWPA 2STDA 1JN5B 2O9UX 2JDIH 1W01A 4HM6B 2W9PA 3NM2A 4EBGA 1OF5B 2B24B 4HM2B 1JRQA 3LOYA 1IQ8A 3FZWA 2B1XB 4MJDA 2UX0A 7STDA 2IA7A 2GEXA 4FMCA 2XRXB 3N8BA 3Q1CA 3NM7A 2OOVC 4HM5B 3LTBA 4HM4B 1L5GB 3CCR3 1SJWA 4IPBA 2ZDJA 2W56B 1TUHA 1D6ZA 3HX8A 4XB5A 1A90A 3MG1A 4FCMA 3DZLA 3WODG 1N8R4 2CFGA 2F98A 3PCRA 4K1VA 4WFOA 2GU3A 5AYSC 3X3ZA 3FF2A 4KFEA 3E99A 2LYXA 3WA2X 2LQVA 1VQ53 4L7KA 3WOEB 4KFDA 2XSOB 1QAKA 2W2CA 3V92A 1HKXA 1JKGB 3JUOA 1VQ73 1IV7A 1EQKA 2RSXA 3DGNA 3N54B 2BT3A 4WYKA 2YFJB 4PEJA 3S28A 3U97A 4O8SA 2PZVA 3IPTA 4RNZA 1M904 3EQQB 5BXQA 1DVDA 4KZ1A 3V99A 2HMNB 3PCSA 4H61A 3FF0A 3CCM3 3H3HA 3V98A 1N5HA 1GD3A 5BVBA 2P05A 2CHCA 1RJOA 2CKFB 1M1K4 2W03A 4HM0B 2W9QA 3UB1A 3O8YA 2HMJB 1TFOA 2F99A 4FMBA 1PU4A 2M7OA 1DVCA 1ROAA 4WP5A 4EC6A 1O7NB 3CCL3 2K54A 3Q90A 1G96A 1N8QA 3S27A 3EX9A 3K5TA 4G1MB 2E2TA 3B7CA 1UUWB 1VQ63 1FGMA 4N6V0 5AEWB 5IERA 3EBYA 4R80A 3G16A 5HGRA 3FCSB 4X2OA 3AMOB 1IVXA 2K0MA 2ML6A 3EN1B 2XR8B 1JB4A 2OQEC 3GRDA 1GY6A 1K9M4 1HU9A 5DREA 2WO0A 1M1XB 2P0XA 4R4KA 3JUNA 3KE7A 3NV0A 3EF8A 1IQXA 2Y74A 5AIIA 3VSYA 3KZTA 3TDGA 1JN5A 2D1WA 2WGOA 4I4KA 2CW9A 3PZWA 1YJN3 3OWUA 5IEPA 2XFTA 1OPYA 4AKZA 1KQS2 3FKAA 1F8NA 1IT7A 1KSIA 1N9EA 2XFSA 2ZL8A 1OF5A 5AI1A 1JB2A 2XH9A 1OACA 3SX1A 4NHFA 3CCS3 1DMMA 4MEIA 3Q2PA 2W04A 4HM8B 1EG9B 4Q53A 5IF6A 3BNCA 5AEUB 1IVWA 2QGUA 1Q7Y4 3EB8A 1LNHA 1SIHA 3CC73 2QA43 3BNBA 4OK0A 1NWWA 2W56A 1Q42A 4J9AA 3VF1A 4N6UA 2V1LA 2XEPA 3K7CA 1W6CA 3F7SA 3X40A 1CYUA 3UL6A 2CFLA 2YFIB 2XGLA 3ECFA 3EBTA 3JUQA 4XDWA 4N6TA 3JVCA 3SVAA 1Z1SA 1TFKA 4ORLA 3PYJA 3HI7A 5G2GA 1Y4KA 1UUVB 4XBTA 5JPPA 2RFRA 3KN4A 2KXGA 1ISKA 3DMCA 4CCVA 3NBJA 4XBXA 1JKGA 2IUKA 1WTHA 1YIJ3 1FGTA 3EC9A 4FCZA 1K41A 3G0KA 1W2ZA 3KIIA 3WMDA 1QVG2 5STDA 2MC8A 1NB3I 3FSDA 2GBXB 1N5PA 3MKIA 1QVF2 1VQO3 2D42A 1FGRA 3A76A 3HZPA 3S5CA 3F8XA 4N6MA 1TIJA 3MWZA 2HMOB 1LOXA 2OTJ3 3CU3A 4HM3B 1IDPA 4HYZA 3STDA 1STDA 3B4PA 1YJ93 1VQ43 3KSED 4HZBB 1WMOA 5IW9A 2CWTA 1QALA 1QMAA 3CCV3 4NREA 4EV5A 1Q40B 4R1KA 3FGYA 1IK3A 5IENA 1OGZA 1ULIB 2CWUA 1SQWA 1CYVA 3CNXA 2GEYA 1YVBI 4K61A 3DGLA 1KWIA 1ULJB 1JNQA 2C11A 2CH9A 3IJEB 2Y73A 3NHXA 5CF2A 1GY5A 3OX9A 3DUKA 3BNDA 3NBBA 3RDEA 1T5YA 4BTYA 4O3VA 3PS8A 1S5AA 4XBYA 1FA3A 3FG3A 4WWUC 1W7CA 4GL6A 3CC43 3X41A 1BUQA 3AMOA 1FUWA 3QRDA 5CK6A 1MOLA 3KSPA 1VZZA 3UL5A 3M8CA 1NB5I 3LTDA 1O7MB 5CF1A 3JUPA 1K28A 3CNMA 1PFPA 3F7XA 1UI8A 1FGQA 3OXAA 5KP1A 4IT7A 3PGBA 1R4CA 3MSOA 3K9MC 2ML5A 4EV2A 3CCE3 1TP6A 5IG3A 3HK4A 2HMMB 2JQ5A 1IU7A 2P0MA 3T0UA 1OCVA 1OUNA 4WHAA 2BMQB 3B8LA 5ELUA 3LYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9P A;  1WNH A;  3Q2P A;  3LH4 A;  5LC7 A;  5ELJ A;  4N6U A;  1N9J A;  5LC6 A;  1A90 A;  1CYU A;  4LZI A;  3UL6 A;  3PXM A;  4N6T A;  3SVA A;  4EYC A;  3PYJ A;  1RN7 A;  1LXE A;  2KXG A;  4CCV A;  2OCT A;  1IV7 A;  1EQK A;  5EQL A;  1CEW I;  1NB3 I;  4ZM8 A;  1M9G A;  1DVD A;  1N5P A;  4N6L A;  1N5H A;  4N6M A;  1GD3 A;  1TIJ A;  3MWZ A;  2W9Q A;  3KSE D;  4N6O B;  1MNL A;  3KFQ C;  1DVC A;  1ROA A;  3NX0 A;  3GAX A;  1CYV A;  4TX4 A;  1YVB I;  1KWI A;  2CH9 A;  2BO9 B;  1G96 A;  4N6V 0;  4N6N B;  5A0O B;  3PS8 A;  1FA3 A;  3IMA B;  1STF I;  3S67 A;  1FUW A;  3QRD A;  1MOL A;  3UL5 A;  1GD4 A;  1NB5 I;  1PFP A;  1A67 A;  4IT7 A;  1R4C A;  3L0R A;  3K9M C;  1IV9 A;  5ELU A;  2O9U X; 
#chains in the Genus database with same CATH topology
 1RGC A;  3WA3 A;  3I55 3;  5IG5 A;  3I0Y A;  1LQM B;  3G8Z A;  1OHO A;  2XGN A;  5CXO A;  3FG4 A;  2HML B;  4BTX A;  4RNY A;  3LH4 A;  1AVL A;  1BRI A;  3BIR A;  2AAE A;  5D81 A;  2RBI A;  3NQY A;  1D6U A;  1X1U A;  1W00 A;  3ZFZ A;  1GYB A;  1E3V A;  1OHS A;  3LXU X;  4IIA A;  1TU5 A;  1X1X A;  1OGX A;  1DE3 A;  1Q81 4;  1ROV A;  1BRG A;  3N9H A;  3RGA A;  1BSE A;  1U8C B;  4HZ9 B;  4EW5 A;  5IEO A;  1AVK A;  1GMR A;  2P38 A;  4FMD A;  1N9J A;  1YGE A;  1BSC A;  3CPO A;  1Q7H A;  5KP3 A;  5LC6 A;  1D6Y A;  1BU4 A;  2OOV A;  1BVI A;  1DET A;  3PXM A;  1X1Y A;  3WR2 A;  3GZX B;  2Z6B A;  4HVN A;  5FGO A;  2O3O A;  3X3X A;  1MWT A;  2SBL A;  2KF4 A;  3AGN A;  1NO3 A;  4N3V A;  3NUV A;  3BB9 A;  3DGM A;  2Z76 A;  1EUI C;  5M19 A;  1IQY A;  3Q3F A;  1BNE A;  2RNT A;  3EE1 A;  1LQG C;  2A15 A;  3NXJ A;  4XDV A;  5EQL A;  3ZG0 A;  3SLU A;  2L4V A;  1VQ9 3;  2QEX 3;  4LEH A;  3K0Z A;  3DXO A;  4ZM8 A;  3MG3 A;  1YI2 3;  4FR9 A;  3ZG5 A;  1E3R A;  2Q07 A;  1VQK 3;  2BNG A;  1M9G A;  1O7W B;  4XM4 A;  4HM1 B;  4I5Q A;  3LTC A;  3EJV A;  2CWV A;  3FLJ A;  4HKV B;  1W2B 2;  3NBR A;  2XF3 A;  1RKY A;  2KRT A;  3GSP A;  4LSO A;  2GXF A;  1GOY A;  1JZD A;  3SED A;  3OV4 A;  1FGO A;  4FCJ A;  5AIH A;  3FG1 A;  4AEQ A;  1RLS A;  1RGH A;  2GBW B;  1W4N A;  2E2U A;  4K90 B;  4DKI A;  3MHE A;  1S72 3;  1WMP A;  2XSH B;  1IT8 A;  3F14 A;  1ASK A;  1NDO B;  3D3L A;  3F40 A;  3F8H A;  4GHO A;  4JRF A;  4O2H A;  1WMN A;  3I56 3;  2CG0 A;  1JB5 A;  1Q40 A;  1MGW A;  4AKY A;  4RBN A;  1UGH I;  1RGA A;  2FXT A;  3GAX A;  3CCU 3;  1IVU A;  1PY3 A;  2F86 B;  4KFF A;  3D5I A;  4X2H A;  1T2I A;  4J5G A;  1I0X A;  1B27 A;  1CH0 A;  1RRH A;  1R4Y A;  2GU1 A;  2Z77 A;  5A0O B;  1HYF A;  3WDG B;  2INX A;  4OVM A;  4K1U A;  1AR0 A;  2FGT A;  3DGO A;  2CC3 A;  4J5K A;  3IMA B;  3X42 A;  1BUJ A;  1RGE A;  1STF I;  1RRL A;  3RGR A;  3S67 A;  1OH0 A;  3GWR A;  1GD4 A;  2OTL 3;  1V57 A;  1DYU A;  1RN1 A;  2CK3 H;  2CFW A;  3HIG A;  4LYL B;  4QWT A;  1C7H A;  1A67 A;  3X3Y A;  2KAA A;  4HM7 B;  6STD A;  5AIG A;  5DRV A;  5G1L A;  3DM8 A;  1UI7 A;  5IG4 A;  2OQE A;  2FNQ A;  3L0R A;  3DH2 A;  1QAF A;  4LGQ A;  4BTW A;  1GSP A;  1YIT 3;  1IV9 A;  2E2V A;  1WQL B;  1KD1 4;  3ER7 A;  1KC8 4;  2BIR A;  8CHO A;  3G4S 3;  1GS3 A;  2SAR A;  3G71 3;  1Q86 4;  4BU4 A;  5TGN A;  5D83 A;  3CMA 3;  2QIY A;  5JPU A;  4FMA A;  1WNH A;  1K73 4;  1O7H B;  1JBT A;  1GMQ A;  4OUQ A;  2IMJ A;  3U1W A;  1G02 A;  3LT8 A;  3RNT A;  8RNT A;  1BRK A;  3S29 A;  5LC7 A;  2ZHX B;  5JBS A;  1BRJ A;  1JV2 B;  1W6G A;  1Q82 4;  2WGQ A;  2Z7A A;  4KVH A;  5ELJ A;  1BNS A;  3DGY A;  3CXC 2;  3WOF B;  2I9W A;  1LOV A;  5AIF A;  1B2M A;  1I8V A;  4L8O A;  1BAN A;  1NJI 4;  3CPW 2;  1RHL A;  3OWY A;  3ROB A;  4LZI A;  4EXR A;  2MF7 A;  1JBR A;  1VQ8 3;  4MMY B;  1LOY A;  3SOA A;  1GY7 A;  4EYC A;  4CJN A;  1RN7 A;  3ALA A;  1B3S A;  1LXE A;  1ZX2 A;  1VQN 3;  4GB5 A;  3T8N A;  4U13 A;  3AGO A;  5CLK A;  3B4O A;  3URP A;  3MYT A;  6GSP A;  2BMR B;  2OCT A;  1US1 A;  3MPH A;  1SPU A;  5KP4 A;  1I2G A;  1A2K A;  1BNJ A;  2P09 A;  4MMZ B;  1E97 A;  3LT9 A;  4R9K A;  3CCQ 3;  1CEW I;  1DMN A;  4WYK B;  1QJG A;  1AV4 A;  1RTU A;  3KKG A;  2W6J H;  5IG0 A;  3JUM A;  4L8P A;  1MWR A;  2HMK B;  5D82 A;  5EEO A;  4LMI A;  3GZR A;  3LZA A;  2RGQ A;  1SII A;  1A2V A;  1UCI A;  3D5G A;  4HBR A;  4N6L A;  1VQQ A;  3EN8 A;  3LTA A;  2CG1 A;  3CCJ 3;  1BRH A;  4CDL A;  2WOF A;  1VQM 3;  1I2E A;  3HII A;  3NQZ A;  3VGN A;  2ZA4 A;  1OHP A;  3D9R A;  1FUS A;  1EKM A;  1W6Y A;  4O02 B;  3G6E 3;  3LML A;  4N6O B;  2CFD A;  2YX9 A;  3QK9 A;  3BLZ A;  1NU3 A;  5I97 A;  1MNL A;  3KFQ C;  4JF8 A;  3D79 A;  4R9L A;  5M1A A;  3GZY B;  3NX0 A;  1J2B A;  1UW1 A;  4RZM A;  1RMS A;  3F9S A;  4TX4 A;  5FW5 A;  3HOH A;  3J7Y d;  2BO9 B;  1BNF A;  1O7P B;  1FZU A;  1W02 A;  3MG2 A;  2BHM A;  4RNT A;  1ZO2 A;  3K63 A;  1YHQ 3;  4H3U A;  1BRN L;  1V74 A;  4N6N B;  2CIU A;  4KT3 B;  4HJL B;  1B2S A;  2C10 A;  2R4I A;  2W0Q A;  2WOH A;  3FH1 A;  1V58 A;  5EVH A;  2RCD A;  2HOH A;  2UGI A;  1FYS A;  4STD A;  2YFL B;  1IVV A;  3DY5 A;  1VQP 3;  1VQL 3;  1YVS A;  1UCL A;  3OWS A;  1W5Z A;  3OW2 2;  1DMQ A;  4J8T A;  3CC2 3;  3GZB A;  1B2Z A;  2KF6 A;  2PNC A;  2CFK A;  4BIR A;  9RNT A;  3CD6 3;  1K8A 4;  3UJM A;  3UNL A;  2BMO B;  3T8U A;  4MMX B;  2H0G A;  1Q9E A;  3NV0 B;  1O7G B;  3CME 3;  1CQS A;  3A5E A;  5AYR B;  1EA2 A;  3EHC A;  3SOY A;  1U5O A;  1YJW 3;  1LVN A;  1BSA A;  3SXX A;  1JJ2 2;  3BNE A;  2IUJ A;  2KCD A;  3H51 A;  2OWP A;  2STD A;  1JN5 B;  2O9U X;  1JZO A;  2JDI H;  1G0T A;  1FUT A;  1W01 A;  4HM6 B;  2W9P A;  3NM2 A;  4EBG A;  1OF5 B;  2B24 B;  4HM2 B;  1JRQ A;  3LOY A;  1IQ8 A;  3FZW A;  2F4Y A;  1B2U A;  2B1X B;  1I3F A;  2UX0 A;  4MJD A;  7STD A;  1UCK A;  2IA7 A;  2GEX A;  4FMC A;  2XRX B;  3N8B A;  3Q1C A;  3NM7 A;  2OOV C;  4HM5 B;  3LTB A;  4HM4 B;  1L5G B;  6RNT A;  3CCR 3;  1SJW A;  2GSP A;  4IPB A;  2ZDJ A;  1PYL A;  2W56 B;  1TUH A;  4BL2 A;  1RNB A;  1D6Z A;  3HX8 A;  1LNI A;  1YNV X;  4XB5 A;  1MWU A;  1TRP A;  1A90 A;  3MG1 A;  4FCM A;  3DZL A;  3WOD G;  1N8R 4;  2CFG A;  2F98 A;  1RGF A;  3PCR A;  4K1V A;  4WFO A;  2GU3 A;  5AYS C;  3X3Z A;  3FF2 A;  4KFE A;  1B21 A;  5HOH A;  3E99 A;  2LYX A;  5GSP A;  3WA2 X;  2LQV A;  1BSD A;  4L7K A;  1VQ5 3;  2H0H A;  3WOE B;  4KFD A;  2XSO B;  1GOU A;  1QAK A;  1T3B A;  2W2C A;  4ILF A;  1HKX A;  1JKG B;  3JUO A;  3V92 A;  1IV7 A;  7RNT A;  1VQ7 3;  4HOH A;  1EQK A;  2RSX A;  3DGN A;  3N54 B;  2BT3 A;  4WYK A;  2YFJ B;  4PEJ A;  3S28 A;  3WHO A;  3U97 A;  4O8S A;  2PZV A;  3IPT A;  4RNZ A;  1M90 4;  3EQQ B;  5BXQ A;  1DVD A;  4KZ1 A;  3V99 A;  2HMN B;  1UCJ A;  3PCS A;  4H61 A;  3FF0 A;  3CCM 3;  2F5M A;  3H3H A;  5BU4 A;  3V98 A;  1N5H A;  1GD3 A;  5BVB A;  1RDS A;  1MGR A;  1BGS A;  1RJO A;  2CHC A;  2CKF B;  2P05 A;  1M1K 4;  2W03 A;  4HM0 B;  2W9Q A;  3UB1 A;  3O8Y A;  2F5W A;  2HMJ B;  1TFO A;  2F99 A;  4FMB A;  1PU4 A;  2H0I A;  1RGK A;  2K3D A;  1JBS A;  2M7O A;  1DVC A;  1ROA A;  4WP5 A;  1X1W A;  3BU4 A;  4EC6 A;  1O7N B;  3CCL 3;  2K54 A;  3Q90 A;  1G96 A;  1BOX A;  1N8Q A;  3EX9 A;  3K5T A;  1BIR A;  4G1M B;  2E2T A;  1AY7 A;  3B7C A;  3S27 A;  1UUW B;  1VQ6 3;  1FGM A;  4N6V 0;  5AEW B;  5IER A;  3EBY A;  4R80 A;  4CPK A;  3G16 A;  5HGR A;  1BNI A;  3FCS B;  4X2O A;  3AMO B;  1IVX A;  2K0M A;  2ML6 A;  3EN1 B;  2XR8 B;  1JB4 A;  2OQE C;  3GRD A;  1BSB A;  1T2H A;  1GY6 A;  1K9M 4;  1HU9 A;  5DRE A;  1UGI A;  2WO0 A;  1B20 A;  1I3I A;  1M1X B;  1RN4 A;  2KF3 A;  2P0X A;  4R4K A;  1RNT A;  3JUN A;  3KE7 A;  3NV0 A;  3EF8 A;  1IQX A;  2Y74 A;  5AII A;  3D4A A;  3VSY A;  4GSP A;  3KZT A;  3TDG A;  1JN5 A;  2D1W A;  1RGG A;  2WGO A;  4I4K A;  2CW9 A;  3PZW A;  1YJN 3;  3OWU A;  5IEP A;  1OPY A;  2XFT A;  4NPB A;  4AKZ A;  1KQS 2;  3FKA A;  1F8N A;  1IT7 A;  1KSI A;  1N9E A;  2XFS A;  2ZL8 A;  1OF5 A;  5AI1 A;  5BIR A;  1JB2 A;  1I70 A;  2XH9 A;  1OAC A;  3SX1 A;  4NHF A;  3CCS 3;  1BRS A;  1DMM A;  3Q2P A;  4MEI A;  2W04 A;  4HM8 B;  1EG9 B;  1GMP A;  3AHW A;  4Q53 A;  5IF6 A;  3BNC A;  5AEU B;  1IVW A;  2QGU A;  1Q7Y 4;  3EB8 A;  2CX1 A;  1LNH A;  1SIH A;  3CC7 3;  2QA4 3;  3BNB A;  4OK0 A;  1RCK A;  1NWW A;  2W56 A;  1Q42 A;  2F56 A;  4J9A A;  3VF1 A;  4N6U A;  1FW7 A;  2V1L A;  2BU4 A;  2XEP A;  3K7C A;  1C54 A;  1W6C A;  3F7S A;  3X40 A;  7GSP A;  1CYU A;  3UL6 A;  2CFL A;  2L1S A;  2YFI B;  2UUG C;  2XGL A;  3ECF A;  3EBT A;  3JUQ A;  4XDW A;  4N6T A;  3JVC A;  3SVA A;  1Z1S A;  1TFK A;  4ORL A;  3PYJ A;  3HI7 A;  5G2G A;  1Y4K A;  1UUV B;  4XBT A;  2AAD A;  5JPP A;  2RFR A;  1TJD A;  3KN4 A;  2KXG A;  4HAA A;  5RNT A;  1ISK A;  3DMC A;  4CCV A;  1YGW A;  3NBJ A;  4XBX A;  1JKG A;  2IUK A;  1WTH A;  1YIJ 3;  1FGT A;  1ZS7 A;  3EC9 A;  4FCZ A;  1K41 A;  3G0K A;  1W2Z A;  1B2X A;  3KII A;  3WMD A;  1QVG 2;  5STD A;  1BAO A;  2MC8 A;  1NB3 I;  1MWS A;  1LOW A;  3FSD A;  1LRA A;  1AQZ A;  1GOV A;  1N5P A;  2GBX B;  3MKI A;  1QVF 2;  5G1K A;  2D42 A;  1VQO 3;  1FGR A;  2IYJ A;  3A76 A;  3HZP A;  1RSN A;  3S5C A;  3F8X A;  4N6M A;  1TIJ A;  3MWZ A;  2HMO B;  1EEJ A;  3SYU A;  1LOX A;  2OTJ 3;  3CU3 A;  4HM3 B;  1IDP A;  4HYZ A;  3STD A;  1STD A;  3B4P A;  1YJ9 3;  1VQ4 3;  3KSE D;  4HZB B;  1WMO A;  5IW9 A;  2CWT A;  1NNV A;  1QAL A;  1QMA A;  3CCV 3;  4NRE A;  4EV5 A;  1Q40 B;  4R1K A;  3FGY A;  1IK3 A;  5IEN A;  1OGZ A;  1ULI B;  2CWU A;  2J8X B;  1SQW A;  1CYV A;  1TTO A;  3CNX A;  2GEY A;  1YVB I;  4K61 A;  3DGL A;  1KWI A;  1ULJ B;  1JNQ A;  1I2F A;  2C11 A;  2CH9 A;  3IJE B;  3KCH A;  4BL3 A;  1UDI I;  2Y73 A;  3NHX A;  5CF2 A;  1GY5 A;  1RGL A;  3OX9 A;  2KF5 A;  3DUK A;  3BND A;  2CX0 A;  3NBB A;  1T5Y A;  3RDE A;  4BTY A;  4O3V A;  3PS8 A;  1S5A A;  4XBY A;  3AHS A;  3FG3 A;  4WWU C;  1TRQ A;  1BNR A;  1W7C A;  4GL6 A;  1FA3 A;  3CC4 3;  3X41 A;  1BUQ A;  3AMO A;  1IYY A;  1FUW A;  3QRD A;  5CK6 A;  1MOL A;  3KSP A;  1VZZ A;  3UL5 A;  3M8C A;  1NB5 I;  3LTD A;  1I0V A;  1O7M B;  5CF1 A;  1UUG B;  3JUP A;  1K28 A;  3CNM A;  5M18 A;  2C4B A;  1PFP A;  1RCL A;  3F7X A;  1A2P A;  1UI8 A;  1FGQ A;  3OXA A;  5KP1 A;  2IY2 A;  4IT7 A;  3PGB A;  1HZ1 A;  1R4C A;  3MSO A;  3K9M C;  1SAR A;  2ML5 A;  4EV2 A;  3CCE 3;  1TP6 A;  5IG3 A;  2R41 A;  3HK4 A;  2HMM B;  2JQ5 A;  1IU7 A;  2P0M A;  3T0U A;  1OCV A;  1OUN A;  4WHA A;  1ZGX A;  2BMQ B;  1BNG A;  3B8L A;  3LYG A;  5ELU A; 
#chains in the Genus database with same CATH homology
 3WA3 A;  3I55 3;  5IG5 A;  3I0Y A;  3G8Z A;  1OHO A;  2XGN A;  5CXO A;  3FG4 A;  2HML B;  4BTX A;  4RNY A;  3LH4 A;  1AVL A;  5D81 A;  3NQY A;  1D6U A;  1W00 A;  1GYB A;  1E3V A;  1OHS A;  3LXU X;  4IIA A;  1TU5 A;  1OGX A;  1Q81 4;  1ROV A;  3N9H A;  3RGA A;  1U8C B;  4HZ9 B;  5IEO A;  1AVK A;  2P38 A;  5KP3 A;  4FMD A;  1N9J A;  1YGE A;  5LC6 A;  3CPO A;  1D6Y A;  2OOV A;  3PXM A;  3GZX B;  2Z6B A;  4HVN A;  5FGO A;  2O3O A;  3X3X A;  2SBL A;  4N3V A;  1NO3 A;  3NUV A;  3BB9 A;  3DGM A;  2Z76 A;  1IQY A;  3EE1 A;  2A15 A;  3NXJ A;  4XDV A;  5EQL A;  3SLU A;  2L4V A;  1VQ9 3;  2QEX 3;  4LEH A;  3K0Z A;  3DXO A;  4ZM8 A;  3MG3 A;  1YI2 3;  4FR9 A;  1E3R A;  2Q07 A;  1VQK 3;  2BNG A;  1M9G A;  1O7W B;  4XM4 A;  4HM1 B;  3LTC A;  3EJV A;  2CWV A;  3FLJ A;  4HKV B;  1W2B 2;  3NBR A;  2XF3 A;  1RKY A;  2KRT A;  4LSO A;  2GXF A;  3SED A;  3OV4 A;  1FGO A;  4FCJ A;  5AIH A;  3FG1 A;  4AEQ A;  2GBW B;  1W4N A;  2E2U A;  4K90 B;  3MHE A;  1S72 3;  1WMP A;  2XSH B;  1IT8 A;  3F14 A;  1ASK A;  1NDO B;  3D3L A;  3F40 A;  3F8H A;  4JRF A;  4O2H A;  1WMN A;  3I56 3;  2CG0 A;  1JB5 A;  1Q40 A;  4AKY A;  4RBN A;  3GAX A;  2FXT A;  3CCU 3;  1IVU A;  2F86 B;  4KFF A;  4X2H A;  1RRH A;  2GU1 A;  2Z77 A;  5A0O B;  3WDG B;  2INX A;  4OVM A;  4K1U A;  1AR0 A;  2FGT A;  3DGO A;  2CC3 A;  3X42 A;  3IMA B;  1STF I;  1RRL A;  3RGR A;  3S67 A;  1OH0 A;  3GWR A;  1GD4 A;  2OTL 3;  1DYU A;  2CK3 H;  2CFW A;  3HIG A;  4QWT A;  1C7H A;  1A67 A;  3X3Y A;  6STD A;  4HM7 B;  5IG4 A;  5AIG A;  5DRV A;  3DM8 A;  1UI7 A;  2OQE A;  2FNQ A;  3L0R A;  1QAF A;  4LGQ A;  4BTW A;  1YIT 3;  1IV9 A;  2E2V A;  1WQL B;  1KD1 4;  3ER7 A;  1KC8 4;  8CHO A;  3G4S 3;  1GS3 A;  3G71 3;  1Q86 4;  5TGN A;  5D83 A;  3CMA 3;  2QIY A;  5JPU A;  4FMA A;  1WNH A;  1K73 4;  1O7H B;  4OUQ A;  2IMJ A;  3U1W A;  3LT8 A;  3S29 A;  5LC7 A;  5JBS A;  1JV2 B;  1W6G A;  1Q82 4;  2WGQ A;  2Z7A A;  4KVH A;  5ELJ A;  3CXC 2;  3WOF B;  2I9W A;  5AIF A;  4L8O A;  1NJI 4;  3CPW 2;  3OWY A;  3ROB A;  4LZI A;  4EXR A;  2MF7 A;  1VQ8 3;  4MMY B;  3SOA A;  1GY7 A;  4EYC A;  1RN7 A;  3ALA A;  1LXE A;  1ZX2 A;  1VQN 3;  4GB5 A;  3T8N A;  4U13 A;  5CLK A;  3B4O A;  3MYT A;  2BMR B;  2OCT A;  1US1 A;  3MPH A;  1SPU A;  5KP4 A;  1A2K A;  2P09 A;  4MMZ B;  1E97 A;  3LT9 A;  4R9K A;  3CCQ 3;  1CEW I;  1DMN A;  4WYK B;  1QJG A;  1AV4 A;  3KKG A;  2W6J H;  5IG0 A;  3JUM A;  4L8P A;  2HMK B;  5D82 A;  5EEO A;  4LMI A;  3GZR A;  3LZA A;  2RGQ A;  1SII A;  1A2V A;  4HBR A;  4N6L A;  3LTA A;  3EN8 A;  2CG1 A;  3CCJ 3;  4CDL A;  2WOF A;  1VQM 3;  3HII A;  3NQZ A;  3VGN A;  1OHP A;  3D9R A;  4O02 B;  1EKM A;  1W6Y A;  3G6E 3;  3LML A;  4N6O B;  2CFD A;  2YX9 A;  3QK9 A;  3BLZ A;  1NU3 A;  5I97 A;  1MNL A;  3KFQ C;  4JF8 A;  4R9L A;  3GZY B;  3NX0 A;  1J2B A;  1UW1 A;  4RZM A;  3F9S A;  4TX4 A;  5FW5 A;  3J7Y d;  2BO9 B;  1O7P B;  1W02 A;  1YHQ 3;  3MG2 A;  2BHM A;  1ZO2 A;  3K63 A;  4H3U A;  1V74 A;  4N6N B;  2CIU A;  4HJL B;  2C10 A;  2R4I A;  2W0Q A;  2WOH A;  3FH1 A;  5EVH A;  2RCD A;  4STD A;  2YFL B;  1IVV A;  3DY5 A;  1VQP 3;  1VQL 3;  3OWS A;  1W5Z A;  3OW2 2;  1DMQ A;  4J8T A;  3CC2 3;  3GZB A;  2PNC A;  2CFK A;  3CD6 3;  1K8A 4;  3UJM A;  3UNL A;  2BMO B;  3T8U A;  4MMX B;  3NV0 B;  1O7G B;  3CME 3;  1CQS A;  5AYR B;  3SOY A;  1EA2 A;  3EHC A;  1YJW 3;  1U5O A;  1LVN A;  3SXX A;  1JJ2 2;  3BNE A;  2IUJ A;  2KCD A;  3H51 A;  2OWP A;  2STD A;  1JN5 B;  2O9U X;  2JDI H;  1W01 A;  4HM6 B;  2W9P A;  3NM2 A;  4EBG A;  1OF5 B;  2B24 B;  4HM2 B;  1JRQ A;  3LOY A;  1IQ8 A;  3FZW A;  2B1X B;  4MJD A;  2UX0 A;  7STD A;  2IA7 A;  2GEX A;  4FMC A;  2XRX B;  3N8B A;  3Q1C A;  3NM7 A;  2OOV C;  4HM5 B;  3LTB A;  4HM4 B;  1L5G B;  3CCR 3;  1SJW A;  4IPB A;  2ZDJ A;  2W56 B;  1TUH A;  1D6Z A;  3HX8 A;  4XB5 A;  1A90 A;  3MG1 A;  4FCM A;  3DZL A;  3WOD G;  1N8R 4;  2CFG A;  2F98 A;  3PCR A;  4K1V A;  4WFO A;  2GU3 A;  5AYS C;  3X3Z A;  3FF2 A;  4KFE A;  3E99 A;  2LYX A;  3WA2 X;  2LQV A;  1VQ5 3;  4L7K A;  3WOE B;  4KFD A;  2XSO B;  1QAK A;  2W2C A;  3V92 A;  1HKX A;  1JKG B;  3JUO A;  1VQ7 3;  1IV7 A;  1EQK A;  2RSX A;  3DGN A;  3N54 B;  2BT3 A;  4WYK A;  2YFJ B;  4PEJ A;  3S28 A;  3U97 A;  4O8S A;  2PZV A;  3IPT A;  4RNZ A;  1M90 4;  3EQQ B;  5BXQ A;  1DVD A;  4KZ1 A;  3V99 A;  2HMN B;  3PCS A;  4H61 A;  3FF0 A;  3CCM 3;  3H3H A;  3V98 A;  1N5H A;  1GD3 A;  5BVB A;  2P05 A;  2CHC A;  1RJO A;  2CKF B;  1M1K 4;  2W03 A;  4HM0 B;  2W9Q A;  3UB1 A;  3O8Y A;  2HMJ B;  1TFO A;  2F99 A;  4FMB A;  1PU4 A;  2M7O A;  1DVC A;  1ROA A;  4WP5 A;  4EC6 A;  1O7N B;  3CCL 3;  2K54 A;  3Q90 A;  1G96 A;  1N8Q A;  3S27 A;  3EX9 A;  3K5T A;  4G1M B;  2E2T A;  3B7C A;  1UUW B;  1VQ6 3;  1FGM A;  4N6V 0;  5AEW B;  5IER A;  3EBY A;  4R80 A;  3G16 A;  5HGR A;  3FCS B;  4X2O A;  3AMO B;  1IVX A;  2K0M A;  2ML6 A;  3EN1 B;  2XR8 B;  1JB4 A;  2OQE C;  3GRD A;  1GY6 A;  1K9M 4;  1HU9 A;  5DRE A;  2WO0 A;  1M1X B;  2P0X A;  4R4K A;  3JUN A;  3KE7 A;  3NV0 A;  3EF8 A;  1IQX A;  2Y74 A;  5AII A;  3VSY A;  3KZT A;  3TDG A;  1JN5 A;  2D1W A;  2WGO A;  4I4K A;  2CW9 A;  3PZW A;  1YJN 3;  3OWU A;  5IEP A;  2XFT A;  1OPY A;  4AKZ A;  1KQS 2;  3FKA A;  1F8N A;  1IT7 A;  1KSI A;  1N9E A;  2XFS A;  2ZL8 A;  1OF5 A;  5AI1 A;  1JB2 A;  2XH9 A;  1OAC A;  3SX1 A;  4NHF A;  3CCS 3;  1DMM A;  4MEI A;  3Q2P A;  2W04 A;  4HM8 B;  1EG9 B;  4Q53 A;  5IF6 A;  3BNC A;  5AEU B;  1IVW A;  2QGU A;  1Q7Y 4;  3EB8 A;  1LNH A;  1SIH A;  3CC7 3;  2QA4 3;  3BNB A;  4OK0 A;  1NWW A;  2W56 A;  1Q42 A;  4J9A A;  3VF1 A;  4N6U A;  2V1L A;  2XEP A;  3K7C A;  1W6C A;  3F7S A;  3X40 A;  1CYU A;  3UL6 A;  2CFL A;  2YFI B;  2XGL A;  3ECF A;  3EBT A;  3JUQ A;  4XDW A;  4N6T A;  3JVC A;  3SVA A;  1Z1S A;  1TFK A;  4ORL A;  3PYJ A;  3HI7 A;  5G2G A;  1Y4K A;  1UUV B;  4XBT A;  5JPP A;  2RFR A;  3KN4 A;  2KXG A;  1ISK A;  3DMC A;  4CCV A;  3NBJ A;  4XBX A;  1JKG A;  2IUK A;  1WTH A;  1YIJ 3;  1FGT A;  3EC9 A;  4FCZ A;  1K41 A;  3G0K A;  1W2Z A;  3KII A;  3WMD A;  1QVG 2;  5STD A;  2MC8 A;  1NB3 I;  3FSD A;  2GBX B;  1N5P A;  3MKI A;  1QVF 2;  1VQO 3;  2D42 A;  1FGR A;  3A76 A;  3HZP A;  3S5C A;  3F8X A;  4N6M A;  1TIJ A;  3MWZ A;  2HMO B;  1LOX A;  2OTJ 3;  3CU3 A;  4HM3 B;  1IDP A;  4HYZ A;  3STD A;  1STD A;  3B4P A;  1YJ9 3;  1VQ4 3;  3KSE D;  4HZB B;  1WMO A;  5IW9 A;  2CWT A;  1QAL A;  1QMA A;  3CCV 3;  4NRE A;  4EV5 A;  1Q40 B;  4R1K A;  3FGY A;  1IK3 A;  5IEN A;  1OGZ A;  1ULI B;  2CWU A;  1SQW A;  1CYV A;  3CNX A;  2GEY A;  1YVB I;  4K61 A;  3DGL A;  1KWI A;  1ULJ B;  1JNQ A;  2C11 A;  2CH9 A;  3IJE B;  2Y73 A;  3NHX A;  5CF2 A;  1GY5 A;  3OX9 A;  3DUK A;  3BND A;  3NBB A;  3RDE A;  1T5Y A;  4BTY A;  4O3V A;  3PS8 A;  1S5A A;  4XBY A;  1FA3 A;  3FG3 A;  4WWU C;  1W7C A;  4GL6 A;  3CC4 3;  3X41 A;  1BUQ A;  3AMO A;  1FUW A;  3QRD A;  5CK6 A;  1MOL A;  3KSP A;  1VZZ A;  3UL5 A;  3M8C A;  1NB5 I;  3LTD A;  1O7M B;  5CF1 A;  3JUP A;  1K28 A;  3CNM A;  1PFP A;  3F7X A;  1UI8 A;  1FGQ A;  3OXA A;  5KP1 A;  4IT7 A;  3PGB A;  1R4C A;  3MSO A;  3K9M C;  2ML5 A;  4EV2 A;  3CCE 3;  1TP6 A;  5IG3 A;  3HK4 A;  2HMM B;  2JQ5 A;  1IU7 A;  2P0M A;  3T0U A;  1OCV A;  1OUN A;  4WHA A;  2BMQ B;  3B8L A;  5ELU A;  3LYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...