1DVDA

Solution nmr structure of human stefin a at ph 5.5 and 308k, nmr, 17 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease inhibitor
molecule keywords STEFIN A
publication title The three-dimensional solution structure of human stefin A.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dvdA00
3KFQC 1GD4A 3GAXA 1DVDA 1G96A 1MOLA 1LXEA 1CYVA 4CCVA 3KSED 1IV9A 4N6UA 5EQLA 3PS8A 4N6LA 3UL6A 1DVCA 3PXMA 1FUWA 3IMAB 1EQKA 1FA3A 1NB5I 1PFPA 1GD3A 1ROAA 2CH9A 2O9UX 5ELJA 1WNHA 3LH4A 5ELUA 4TX4A 1YVBI 1KWIA 2W9QA 3SVAA 3Q2PA 3MWZA 3PYJA 1CEWI 2OCTA 1NB3I 1CYUA 1A90A 2KXGA 4ZM8A 2W9PA 1TIJA 1STFI 1N5PA 5LC7A 4IT7A 4N6NB 1N9JA 3QRDA 1R4CA 4LZIA 5LC6A 1RN7A 1IV7A 3K9MC 4EYCA 1A67A 1N5HA 3UL5A 2BO9B 3NX0A 5A0OB 4N6V0 3S67A 3L0RA 1M9GA 4N6OB 4N6MA 1MNLA 4N6TA
chains in the Genus database with same CATH superfamily
1DYUA 2RGQA 2I9WA 2IMJA 2Q07A 3CC23 3S28A 1BRSA 5G1KA 3SOYA 3CNMA 3OV4A 2B24B 3N54B 1NO3A 2ZDJA 2CFWA 3ZG0A 1W00A 1VQ93 1S5AA 1BUJA 3WMDA 1UCIA 4KFEA 2F56A 1JB2A 1FGRA 1RKYA 5EVHA 1TJDA 1LXEA 2GBWB 1BNJA 1TUHA 3ER7A 3DM8A 2CC3A 3G16A 2XR8B 4RZMA 1BAOA 4WWUC 1BNEA 5CXOA 3LTCA 4O3VA 3RGAA 1C54A 1EG9B 2O3OA 1JB5A 1VQK3 1UUVB 3D79A 4GHOA 3PS8A 3T8NA 2PNCA 1US1A 1ROVA 1B21A 3CMA3 1YIJ3 5CF2A 3KKGA 1RTUA 3KCHA 4L8PA 1O7GB 1TFOA 1AY7A 4FCZA 5AI1A 3V98A 3X41A 4GB5A 1I0VA 1Q40B 2E2UA 3ZFZA 3PXMA 4PEJA 1VQO3 2IUJA 1IYYA 3HIIA 1GMRA 1O7HB 2KF6A 2P38A 3F8XA 4KFDA 1T3BA 1EQKA 1FA3A 5AIHA 1W6GA 2P0XA 1Q814 1PFPA 3EN8A 2ZA4A 1VQL3 3U97A 1BRGA 1BRNL 4XBXA 3GZBA 2O9UX 5ELJA 2W56B 1WNHA 4FCJA 3DGMA 4KT3B 3BU4A 2GU1A 3BLZA 1O7NB 1ULIB 2W9QA 2CHCA 3FG4A 1FUTA 3Q1CA 1YVSA 3MG1A 1K8A4 1K734 1B27A 1GOUA 2F5WA 3BNBA 3G8ZA 3H3HA 5FGOA 1D6ZA 3B8LA 3Q90A 3FSDA 4NPBA 1RGGA 2OTJ3 2HOHA 2B1XB 3K5TA 3DGOA 3GZRA 6RNTA 3CCL3 1B2SA 5STDA 5AIFA 4K61A 2W04A 1ZGXA 3NBRA 3WHOA 1A2KA 3MPHA 9RNTA 1Q9EA 2P05A 2XF3A 4N6NB 3LOYA 1N8R4 1UGHI 1EUIC 1SPUA 1O7PB 3X3ZA 4HBRA 4WP5A 3H51A 2K3DA 2CKFB 1BNRA 1BRKA 3LTAA 6GSPA 3CC73 1VQ53 3ALAA 5GSPA 5IENA 3LTBA 3UNLA 2CFKA 3F7SA 3Q3FA 1RGFA 4I4KA 1RN7A 1W02A 1VQN3 1RSNA 2AAEA 2RFRA 3URPA 3I0YA 2IUKA 3CCE3 3HIGA 7RNTA 2RNTA 2R41A 1VQ43 1Q40A 2CFDA 1M1K4 4NREA 3V92A 2F98A 2F86B 1NU3A 5IW9A 1GOYA 2HMLB 1BGSA 1YGEA 3WR2A 3CCU3 1LNIA 4BL2A 2MC8A 2UX0A 1G02A 2PZVA 1MGWA 1TP6A 4FCMA 3V99A 4RBNA 1DMQA 1M9GA 1KQS2 1LOYA 3EC9A 5IEPA 2KCDA 2OTL3 4N6MA 4N6TA 5FW5A 3CNXA 3N9HA 1IU7A 1EA2A 4R4KA 3U1WA 2E2VA 3X42A 5BIRA 5JBSA 2IYJA 3DUKA 1RN1A 1GD4A 1J2BA 5AEUB 1K9M4 1K28A 1NJI4 1E3RA 1LOWA 4MJDA 4FR9A 3RNTA 2C11A 3B4PA 1IT8A 1C7HA 1I3IA 1ZO2A 1TU5A 5IF6A 2D1WA 2W0QA 2W6JH 1U5OA 3FZWA 1CH0A 3CXC2 3RGRA 2YFJB 1BNSA 1W4NA 3CD63 1CYVA 4EBGA 1A2VA 1MWSA 2BMQB 1I8VA 1BRJA 1Q7HA 3BIRA 3E99A 1K41A 1RNBA 5JPPA 5AYRB 3DGYA 1QALA 1I70A 4OVMA 1RRLA 1TFKA 5EQLA 1L5GB 1NDOB 1VQ83 1I2EA 1BNFA 3LYGA 4I5QA 2CX0A 1GMQA 3FGYA 3OX9A 5BU4A 6STDA 3UL6A 3HK4A 5JPUA 1QMAA 2ML6A 1B3SA 1Y4KA 1E3VA 1GMPA 3DMCA 1YGWA 1EKMA 4HM6B 1BU4A 2QGUA 3G6E3 2BHMA 4HM0B 1Q824 1JBSA 1NB5I 2MF7A 3D5GA 3D4AA 4FMAA 1GS3A 4BTYA 2WGOA 1QAKA 1GD3A 1ROAA 5RNTA 1YI23 2CH9A 1IQ8A 2RSXA 3AMOB 3KN4A 1MWRA 1HKXA 3MSOA 5ELUA 1M904 1GY7A 1JKGB 1JBRA 1YVBI 5D81A 1KWIA 4HKVB 3SVAA 4H61A 1SIHA 1OPYA 3EB8A 3WOFB 3A76A 1KSIA 1OUNA 2GBXB 2HMOB 2K54A 1NB3I 3GRDA 1CYUA 1OGXA 4FMCA 3CPOA 2W9PA 1DETA 1IVWA 2LYXA 3EE1A 5KP4A 1QAFA 3D5IA 1MGRA 4HM3B 5IG4A 2P09A 5BVBA 2CFGA 3SXXA 3AGNA 3JUQA 1FGTA 1E97A 3F8HA 1LVNA 1RGAA 2KF3A 4LSOA 3MKIA 1IQXA 4HOHA 3T8UA 3WA3A 1R4YA 3K63A 3F9SA 1BSBA 1RGLA 2KAAA 1I0XA 2GEYA 4JRFA 4R9KA 1LOVA 2QA43 1JN5B 1FW7A 4GL6A 2BT3A 4HAAA 1AVLA 1JZDA 1GOVA 3DXOA 4FMBA 4H3UA 4WHAA 3CCR3 5G1LA 1ISKA 1SARA 3DGNA 5D83A 3FG1A 4CPKA 2F99A 3F7XA 3G0KA 5HGRA 3UL5A 1V57A 4LYLB 4FMDA 3EBTA 2KRTA 1JB4A 2ZHXB 3NX0A 1IVVA 1ZS7A 1D6UA 5AEWB 2SARA 2ML5A 4N6V0 3KE7A 4RNYA 7GSPA 2CWVA 5AYSC 1W7CA 1RCLA 3WDGB 1BSCA 1WTHA 2GEXA 2XRXB 3CCV3 3AMOA 3EN1B 4R9LA 1IDPA 1B20A 2CG0A 2CFLA 1LQMB 4XDWA 1JKGA 2OQEC 4EV2A 4XB5A 2UUGC 4OK0A 2LQVA 2CWTA 3CU3A 3NUVA 1O7WB 3BNCA 3F14A 5IG5A 1RJOA 1OF5B 2CWUA 5AIGA 1JJ22 5IERA 1W6CA 3GZYB 3DH2A 4HM8B 3JUNA 1B2XA 1G96A 1TRQA 5IG3A 3SYUA 3OWUA 1LQGC 1MOLA 2OOVA 1OCVA 2AADA 3CME3 3BNEA 2WGQA 3OWSA 2K0MA 1Q42A 2W2CA 2Z7AA 5KP3A 4CCVA 5TGNA 1UDII 1T2IA 5CK6A 3HI7A 3KSED 2FNQA 8CHOA 1YJ93 1OHPA 2OQEA 2XSHB 1WMOA 1UCLA 2FXTA 2BIRA 4N6UA 1I3FA 1W01A 1VQM3 1UUWB 3NV0B 1BNGA 4KVHA 1IVXA 1AQZA 5IEOA 2Z6BA 3FH1A 3EBYA 5KP1A 1JN5A 4BL3A 4QWTA 1OHOA 2BU4A 2SBLA 1YIT3 1YJW3 4XM4A 2CIUA 1GY6A 2D42A 1BVIA 4LMIA 4KZ1A 1V58A 3JVCA 1A2PA 4STDA 2HMJB 3S5CA 5BXQA 3RDEA 1V74A 2HMKB 3X3XA 1T5YA 2H0IA 3JUMA 4HM1B 1BRIA 2L1SA 2W03A 3LMLA 4HYZA 1RNTA 1W6YA 4HVNA 3CC43 1F8NA 1NWWA 3NXJA 2YFIB 1DMNA 3LH4A 4AKYA 5M18A 3UJMA 3QK9A 1Q864 1VQ63 2QEX3 4TX4A 2H0HA 5M19A 1ASKA 3FCSB 1WMPA 3SX1A 1RCKA 1U8CB 2BMOB 3VF1A 1N8QA 2C4BA 3MWZA 7STDA 1DMMA 3PYJA 1JZOA 2OCTA 1BNIA 1A90A 4WFOA 3MG2A 4ZM8A 1OF5A 3ROBA 1YJN3 1OHSA 1STFI 1AR0A 3BNDA 3O8YA 1AVKA 1RN4A 2C10A 2JDIH 5D82A 2YX9A 3HOHA 4J5GA 3S27A 3I553 3NM2A 4J9AA 2XFSA 3I563 1BSAA 1CQSA 1B2ZA 4WYKB 3CCM3 1S723 4IT7A 1IQYA 1QJGA 2XSOB 4ORLA 3CCS3 1IVUA 3NHXA 3F40A 1R4CA 1UGIA 3NBJA 1UUGB 1IT7A 4LZIA 3OW22 1B2MA 3B4OA 1RGHA 1GY5A 1FYSA 3CCJ3 1TRPA 4K90B 2IA7A 2F4YA 5EEOA 1X1XA 2HMNB 1QVF2 4HM5B 3NV0A 1PYLA 1JV2B 2HMMB 3LT9A 4HM2B 3AHSA 4R1KA 4XBTA 1Q7Y4 4HM7B 4O2HA 3BB9A 3GWRA 1BOXA 1YNVX 3HX8A 3LXUX 3VGNA 1O7MB 2RBIA 1N9EA 3FF0A 3FF2A 3GSPA 4LGQA 2BO9B 2V1LA 4RNTA 1UCJA 4BIRA 1RDSA 3PGBA 1BSDA 3EQQB 3SLUA 3PCRA 1X1WA 5A0OB 1DE3A 3KSPA 4J5KA 5AIIA 1BUQA 3GZXB 3NM7A 3OXAA 5DRVA 3S29A 1IK3A 1EEJA 4N6OB 2INXA 5I97A 1MNLA 1BANA 2A15A 2Y73A 4JF8A 3A5EA 4CJNA 3KFQC 3K0ZA 1UW1A 4L8OA 2UGIA 3UB1A 1I2FA 4IIAA 1JBTA 4HZBB 1WQLB 3N8BA 1B2UA 3GAXA 1W2B2 1RGCA 1SQWA 2WOFA 5CLKA 1FGMA 1QVG2 1DVDA 3JUPA 3D9RA 3DY5A 4RNZA 4IPBA 1SJWA 1T2HA 4EXRA 1GYBA 4WYKA 4CDLA 3J7Yd 4R80A 3HZPA 2FGTA 1RRHA 3B7CA 3KIIA 3NQZA 2OOVC 3AGOA 2WOHA 1UI7A 4EC6A 1IV9A 2J8XB 3ZG5A 1X1YA 4HM4B 3T0UA 3EJVA 3OWYA 2KF4A 2WO0A 4K1VA 1BSEA 3CPW2 2BNGA 4N6LA 5IG0A 1M1XB 2OWPA 1PY3A 1W5ZA 4G1MB 2H0GA 3STDA 4DKIA 3IPTA 2CK3H 1RMSA 1KC84 1DVCA 1VQ73 2GU3A 4LEHA 2IY2A 4BTWA 1SIIA 1FUWA 4BTXA 1HZ1A 4J8TA 3IMAB 3MG3A 4L7KA 1FGOA 1X1UA 3EF8A 2P0MA 3VSYA 4HJLB 3LT8A 3NQYA 1BRHA 2XH9A 3K7CA 3PCSA 3G4S3 1KD14 2F5MA 2STDA 2XGNA 2Z76A 3M8CA 3DGLA 4Q53A 3CCQ3 1ZX2A 2Z77A 1OH0A 5HOHA 1TTOA 3Q2PA 3WA2X 3EHCA 4NHFA 2R4IA 1GSPA 4EV5A 4U13A 4OUQA 4K1UA 3FKAA 1UCKA 1CEWI 1Z1SA 1FZUA 2E2TA 1FGQA 2KXGA 1WMNA 3EX9A 3LZAA 3PZWA 3TDGA 1HU9A 1TIJA 2CG1A 4X2OA 4EW5A 2XGLA 1LRAA 1YHQ3 8RNTA 4KFFA 1G0TA 1N5PA 1LOXA 4N3VA 3G713 3IJEB 5LC7A 1N9JA 3FLJA 3QRDA 4AEQA 4MMZB 3SEDA 5M1AA 4GSPA 4HZ9B 5LC6A 2W56A 4XDVA 2GSPA 3AHWA 1D6YA 1RGKA 2XFTA 4O02B 4MMYB 2ZL8A 2CX1A 1HYFA 1VQP3 1JRQA 2Y74A 4X2HA 1IV7A 2M7OA 3MHEA 5G2GA 5CF1A 1OACA 2YFLB 3K9MC 3MYTA 3WODG 3FG3A 1NNVA 4EYCA 1VZZA 3NBBA 4MMXB 3WOEB 4BU4A 1A67A 1RHLA 1LNHA 1N5HA 2RCDA 3ECFA 2QIYA 1MWTA 2GXFA 2XEPA 1BIRA 2KF5A 3DZLA 1AV4A 1W2ZA 4O8SA 1MWUA 2L4VA 4XBYA 5DREA 3LTDA 1JNQA 2CW9A 3D3LA 1I2GA 3JUOA 3SOAA 1ULJB 1PU4A 2JQ5A 3S67A 1UI8A 3L0RA 1FUSA 4AKZA 3X3YA 2BMRB 1RLSA 1OGZA 3KZTA 1RGEA 4ILFA 1STDA 3X40A 1VQQA 4MEIA
chains in the Genus database with same CATH topology
1DYUA 2RGQA 2I9WA 2IMJA 2Q07A 3CC23 3S28A 3SOYA 3CNMA 3OV4A 2B24B 3N54B 1NO3A 2ZDJA 2CFWA 1W00A 1VQ93 1S5AA 3WMDA 4KFEA 1JB2A 1FGRA 1RKYA 5EVHA 2GBWB 1LXEA 1TUHA 3ER7A 3DM8A 2CC3A 3G16A 2XR8B 4RZMA 4WWUC 5CXOA 3LTCA 4O3VA 3RGAA 1EG9B 2O3OA 1JB5A 1VQK3 1UUVB 3PS8A 3T8NA 2PNCA 1US1A 1ROVA 3CMA3 1YIJ3 5CF2A 3KKGA 4L8PA 3V98A 1O7GB 1TFOA 4FCZA 5AI1A 3X41A 4GB5A 1Q40B 2E2UA 3PXMA 4PEJA 1VQO3 2IUJA 3HIIA 4KFDA 1O7HB 2P38A 3F8XA 1EQKA 1FA3A 5AIHA 1W6GA 2P0XA 1Q814 1PFPA 3EN8A 1VQL3 3U97A 4XBXA 3GZBA 2O9UX 5ELJA 2W56B 1WNHA 4FCJA 3DGMA 2GU1A 3BLZA 1O7NB 1ULIB 2W9QA 2CHCA 3FG4A 3Q1CA 3MG1A 1K8A4 1K734 3BNBA 3H3HA 3G8ZA 5FGOA 1D6ZA 3B8LA 3Q90A 3FSDA 2OTJ3 3K5TA 2B1XB 3CCL3 3DGOA 3GZRA 5STDA 5AIFA 4K61A 2W04A 3NBRA 1A2KA 3MPHA 2P05A 2XF3A 4N6NB 3LOYA 1N8R4 1SPUA 1O7PB 3X3ZA 4HBRA 4WP5A 3H51A 2CKFB 3LTAA 3CC73 1VQ53 3ALAA 5IENA 3LTBA 3UNLA 2CFKA 3F7SA 4I4KA 1RN7A 1W02A 1VQN3 2RFRA 3I0YA 2IUKA 3CCE3 3HIGA 1VQ43 1Q40A 2CFDA 1M1K4 4NREA 3V92A 2F98A 2F86B 1NU3A 5IW9A 2HMLB 1YGEA 3CCU3 2MC8A 2UX0A 2PZVA 1TP6A 4FCMA 3V99A 4RBNA 1DMQA 1M9GA 1KQS2 3EC9A 5IEPA 2KCDA 2OTL3 4N6MA 4N6TA 5FW5A 3CNXA 3N9HA 1IU7A 1EA2A 4R4KA 3U1WA 2E2VA 3X42A 5JBSA 3DUKA 1GD4A 1J2BA 5AEUB 1K9M4 1K28A 1NJI4 1E3RA 4MJDA 4FR9A 2C11A 3B4PA 1IT8A 1C7HA 1ZO2A 1TU5A 5IF6A 2D1WA 2W0QA 2W6JH 1U5OA 3FZWA 3CXC2 3RGRA 2YFJB 1W4NA 3CD63 1CYVA 4EBGA 1A2VA 2BMQB 3E99A 1K41A 5JPPA 5AYRB 1QALA 4OVMA 1RRLA 1TFKA 5EQLA 1L5GB 1NDOB 1VQ83 3LYGA 6STDA 3FGYA 3OX9A 3UL6A 3HK4A 5JPUA 1QMAA 2ML6A 1Y4KA 1E3VA 3DMCA 1EKMA 4HM6B 2QGUA 3G6E3 2BHMA 4HM0B 1Q824 1NB5I 2MF7A 4FMAA 1GS3A 4BTYA 2WGOA 1QAKA 1GD3A 1ROAA 1YI23 2CH9A 3AMOB 1IQ8A 2RSXA 3KN4A 3MSOA 1HKXA 5ELUA 1M904 1GY7A 1JKGB 1YVBI 5D81A 1KWIA 4HKVB 3SVAA 4H61A 1SIHA 1OPYA 3EB8A 3WOFB 3A76A 1KSIA 1OUNA 2GBXB 2HMOB 2K54A 1NB3I 3GRDA 1CYUA 1OGXA 4FMCA 3CPOA 2W9PA 1IVWA 2LYXA 3EE1A 5KP4A 1QAFA 4HM3B 5IG4A 2P09A 5BVBA 2CFGA 3SXXA 3JUQA 1FGTA 1E97A 3F8HA 1LVNA 4LSOA 3MKIA 1IQXA 3T8UA 3WA3A 3K63A 3F9SA 2GEYA 4JRFA 4R9KA 2QA43 1JN5B 4GL6A 2BT3A 1AVLA 3DXOA 4FMBA 4H3UA 4WHAA 3CCR3 1ISKA 3DGNA 5D83A 3FG1A 2F99A 3F7XA 3G0KA 5HGRA 3UL5A 4FMDA 3EBTA 2KRTA 1JB4A 3NX0A 1IVVA 1D6UA 5AEWB 2ML5A 4N6V0 3KE7A 4RNYA 2CWVA 5AYSC 1W7CA 3WDGB 3CCV3 1WTHA 2GEXA 2XRXB 3AMOA 3EN1B 4R9LA 1IDPA 2CG0A 2CFLA 4XDWA 1JKGA 2OQEC 4EV2A 4XB5A 4OK0A 2LQVA 2CWTA 3CU3A 3NUVA 1O7WB 3BNCA 3F14A 5IG5A 1RJOA 1OF5B 2CWUA 5AIGA 1JJ22 5IERA 1W6CA 3GZYB 4HM8B 3JUNA 1G96A 5IG3A 3OWUA 1MOLA 2OOVA 1OCVA 3CME3 3BNEA 2WGQA 3OWSA 2K0MA 1Q42A 2W2CA 2Z7AA 5KP3A 4CCVA 5TGNA 5CK6A 8CHOA 3HI7A 3KSED 2FNQA 1YJ93 1OHPA 2OQEA 2XSHB 1WMOA 2FXTA 4N6UA 1W01A 1VQM3 1UUWB 3NV0B 4KVHA 1IVXA 5IEOA 2Z6BA 3FH1A 3EBYA 5KP1A 1JN5A 4QWTA 1OHOA 2SBLA 1YIT3 1YJW3 4XM4A 2CIUA 1GY6A 2D42A 4LMIA 4KZ1A 3JVCA 4STDA 2HMJB 3S5CA 5BXQA 3RDEA 1V74A 2HMKB 3X3XA 1T5YA 3JUMA 4HM1B 2W03A 3LMLA 4HYZA 1W6YA 4HVNA 3CC43 1F8NA 1NWWA 3NXJA 2YFIB 1DMNA 3LH4A 4AKYA 1Q864 3UJMA 3QK9A 1VQ63 2QEX3 4TX4A 1ASKA 3FCSB 1WMPA 3SX1A 1U8CB 2BMOB 3VF1A 1N8QA 3MWZA 7STDA 1DMMA 3PYJA 2OCTA 1A90A 4WFOA 3MG2A 4ZM8A 1OF5A 3ROBA 1YJN3 1OHSA 1STFI 1AR0A 3BNDA 3O8YA 1AVKA 2C10A 2JDIH 5D82A 2YX9A 3S27A 3I553 3NM2A 4J9AA 2XFSA 3I563 1CQSA 4WYKB 3CCM3 1S723 1KD14 4IT7A 1IQYA 1QJGA 2XSOB 4ORLA 3CCS3 1IVUA 3NHXA 3F40A 1R4CA 3NBJA 4LZIA 3OW22 1IT7A 3B4OA 1GY5A 3CCJ3 4K90B 2IA7A 5EEOA 2HMNB 1QVF2 4HM5B 3NV0A 4HM2B 1JV2B 2HMMB 3LT9A 4R1KA 4XBTA 1Q7Y4 4HM7B 4O2HA 3BB9A 3GWRA 3HX8A 3LXUX 3VGNA 1O7MB 1N9EA 3FF0A 3FF2A 4LGQA 2BO9B 2V1LA 3PGBA 3EQQB 3SLUA 3PCRA 5A0OB 3KSPA 5AIIA 1BUQA 3GZXB 3NM7A 3OXAA 5DRVA 3S29A 1IK3A 4N6OB 2INXA 5I97A 2Y73A 1MNLA 2A15A 4JF8A 3KFQC 3K0ZA 1UW1A 4L8OA 3UB1A 4IIAA 4HZBB 1WQLB 3N8BA 3GAXA 1W2B2 1SQWA 2WOFA 5CLKA 1QVG2 1FGMA 1DVDA 3JUPA 3D9RA 3DY5A 4RNZA 4IPBA 1SJWA 4EXRA 1GYBA 4WYKA 4CDLA 3J7Yd 4R80A 3HZPA 2FGTA 1RRHA 3B7CA 3KIIA 3NQZA 2OOVC 2WOHA 1UI7A 4EC6A 1IV9A 4HM4B 3T0UA 3EJVA 3OWYA 2WO0A 4K1VA 3CPW2 2BNGA 4N6LA 5IG0A 1M1XB 2OWPA 1W5ZA 4G1MB 3STDA 3IPTA 2CK3H 1KC84 1DVCA 1VQ73 2GU3A 4LEHA 4BTWA 1SIIA 1FUWA 4BTXA 4J8TA 3IMAB 3MG3A 4L7KA 1FGOA 3EF8A 2P0MA 3VSYA 4HJLB 3LT8A 3NQYA 2XH9A 3K7CA 3PCSA 3G4S3 2XGNA 2STDA 2Z76A 3M8CA 3DGLA 4Q53A 3CCQ3 1ZX2A 2Z77A 1OH0A 3Q2PA 3WA2X 3EHCA 4NHFA 2R4IA 4EV5A 4U13A 4OUQA 4K1UA 3FKAA 1CEWI 1Z1SA 2E2TA 1FGQA 2KXGA 1WMNA 3EX9A 3LZAA 3PZWA 3TDGA 1HU9A 1TIJA 2CG1A 4X2OA 2XGLA 1YHQ3 4KFFA 1N5PA 1LOXA 4N3VA 3G713 3IJEB 5LC7A 1N9JA 3FLJA 3QRDA 4AEQA 4MMZB 3SEDA 4HZ9B 5LC6A 2W56A 4XDVA 1D6YA 2XFTA 4O02B 4MMYB 2ZL8A 1VQP3 1JRQA 2Y74A 4X2HA 1IV7A 2M7OA 3MHEA 5G2GA 5CF1A 1OACA 2YFLB 3K9MC 3MYTA 3WODG 3FG3A 4EYCA 1VZZA 3NBBA 4MMXB 3WOEB 1A67A 1LNHA 1N5HA 2RCDA 3ECFA 2QIYA 2GXFA 2XEPA 3DZLA 1AV4A 1W2ZA 4O8SA 2L4VA 4XBYA 5DREA 3LTDA 1JNQA 2CW9A 3D3LA 3JUOA 3SOAA 1PU4A 1ULJB 2JQ5A 3S67A 1UI8A 3L0RA 4AKZA 3X3YA 2BMRB 3KZTA 1OGZA 1STDA 3X40A 4MEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFQ C;  1GD4 A;  3GAX A;  1DVD A;  1G96 A;  1MOL A;  1LXE A;  1CYV A;  4CCV A;  3KSE D;  1IV9 A;  4N6U A;  5EQL A;  3PS8 A;  4N6L A;  3UL6 A;  1DVC A;  3PXM A;  1FUW A;  3IMA B;  1EQK A;  1FA3 A;  1NB5 I;  1PFP A;  1GD3 A;  1ROA A;  2CH9 A;  2O9U X;  5ELJ A;  1WNH A;  3LH4 A;  5ELU A;  4TX4 A;  1YVB I;  1KWI A;  2W9Q A;  3SVA A;  3Q2P A;  3MWZ A;  3PYJ A;  1CEW I;  2OCT A;  1NB3 I;  1CYU A;  1A90 A;  2KXG A;  4ZM8 A;  2W9P A;  1TIJ A;  1STF I;  1N5P A;  5LC7 A;  4IT7 A;  4N6N B;  1N9J A;  3QRD A;  1R4C A;  4LZI A;  5LC6 A;  1RN7 A;  1IV7 A;  3K9M C;  4EYC A;  1A67 A;  1N5H A;  3UL5 A;  2BO9 B;  3NX0 A;  5A0O B;  4N6V 0;  3S67 A;  3L0R A;  1M9G A;  4N6O B;  4N6M A;  1MNL A;  4N6T A; 
#chains in the Genus database with same CATH topology
 1DYU A;  2RGQ A;  2I9W A;  2IMJ A;  2Q07 A;  3CC2 3;  3S28 A;  1BRS A;  5G1K A;  3SOY A;  3CNM A;  3OV4 A;  2B24 B;  3N54 B;  1NO3 A;  2ZDJ A;  2CFW A;  3ZG0 A;  1W00 A;  1VQ9 3;  1S5A A;  1BUJ A;  3WMD A;  1UCI A;  4KFE A;  2F56 A;  1JB2 A;  1FGR A;  1RKY A;  5EVH A;  1TJD A;  1LXE A;  2GBW B;  1BNJ A;  1TUH A;  3ER7 A;  3DM8 A;  2CC3 A;  3G16 A;  2XR8 B;  4RZM A;  1BAO A;  4WWU C;  1BNE A;  5CXO A;  3LTC A;  4O3V A;  3RGA A;  1C54 A;  1EG9 B;  2O3O A;  1JB5 A;  1VQK 3;  1UUV B;  3D79 A;  4GHO A;  3PS8 A;  3T8N A;  2PNC A;  1US1 A;  1ROV A;  1B21 A;  3CMA 3;  1YIJ 3;  5CF2 A;  3KKG A;  1RTU A;  3KCH A;  4L8P A;  1O7G B;  1TFO A;  1AY7 A;  4FCZ A;  5AI1 A;  3V98 A;  3X41 A;  4GB5 A;  1I0V A;  1Q40 B;  2E2U A;  3ZFZ A;  3PXM A;  4PEJ A;  1VQO 3;  2IUJ A;  1IYY A;  3HII A;  1GMR A;  1O7H B;  2KF6 A;  2P38 A;  3F8X A;  4KFD A;  1T3B A;  1EQK A;  1FA3 A;  5AIH A;  1W6G A;  2P0X A;  1Q81 4;  1PFP A;  3EN8 A;  2ZA4 A;  1VQL 3;  3U97 A;  1BRG A;  1BRN L;  4XBX A;  3GZB A;  2O9U X;  5ELJ A;  2W56 B;  1WNH A;  4FCJ A;  3DGM A;  4KT3 B;  3BU4 A;  2GU1 A;  3BLZ A;  1O7N B;  1ULI B;  2W9Q A;  2CHC A;  3FG4 A;  1FUT A;  3Q1C A;  1YVS A;  3MG1 A;  1K8A 4;  1K73 4;  1B27 A;  1GOU A;  2F5W A;  3BNB A;  3G8Z A;  3H3H A;  5FGO A;  1D6Z A;  3B8L A;  3Q90 A;  3FSD A;  4NPB A;  1RGG A;  2OTJ 3;  2HOH A;  2B1X B;  3K5T A;  3DGO A;  3GZR A;  6RNT A;  3CCL 3;  1B2S A;  5STD A;  5AIF A;  4K61 A;  2W04 A;  1ZGX A;  3NBR A;  3WHO A;  1A2K A;  3MPH A;  9RNT A;  1Q9E A;  2P05 A;  2XF3 A;  4N6N B;  3LOY A;  1N8R 4;  1UGH I;  1EUI C;  1SPU A;  1O7P B;  3X3Z A;  4HBR A;  4WP5 A;  3H51 A;  2K3D A;  2CKF B;  1BNR A;  1BRK A;  3LTA A;  6GSP A;  3CC7 3;  1VQ5 3;  3ALA A;  5GSP A;  5IEN A;  3LTB A;  3UNL A;  2CFK A;  3F7S A;  3Q3F A;  1RGF A;  4I4K A;  1RN7 A;  1W02 A;  1VQN 3;  1RSN A;  2AAE A;  2RFR A;  3URP A;  3I0Y A;  2IUK A;  3CCE 3;  3HIG A;  7RNT A;  2RNT A;  2R41 A;  1VQ4 3;  1Q40 A;  2CFD A;  1M1K 4;  4NRE A;  3V92 A;  2F98 A;  2F86 B;  1NU3 A;  5IW9 A;  1GOY A;  2HML B;  1BGS A;  1YGE A;  3WR2 A;  3CCU 3;  1LNI A;  4BL2 A;  2MC8 A;  2UX0 A;  1G02 A;  2PZV A;  1MGW A;  1TP6 A;  4FCM A;  3V99 A;  4RBN A;  1DMQ A;  1M9G A;  1KQS 2;  1LOY A;  3EC9 A;  5IEP A;  2KCD A;  2OTL 3;  4N6M A;  4N6T A;  5FW5 A;  3CNX A;  3N9H A;  1IU7 A;  1EA2 A;  4R4K A;  3U1W A;  2E2V A;  3X42 A;  5BIR A;  5JBS A;  2IYJ A;  3DUK A;  1RN1 A;  1GD4 A;  1J2B A;  5AEU B;  1K9M 4;  1K28 A;  1NJI 4;  1E3R A;  1LOW A;  4MJD A;  4FR9 A;  3RNT A;  2C11 A;  3B4P A;  1IT8 A;  1C7H A;  1I3I A;  1ZO2 A;  1TU5 A;  5IF6 A;  2D1W A;  2W0Q A;  2W6J H;  1U5O A;  3FZW A;  1CH0 A;  3CXC 2;  3RGR A;  2YFJ B;  1BNS A;  1W4N A;  3CD6 3;  1CYV A;  4EBG A;  1A2V A;  1MWS A;  2BMQ B;  1I8V A;  1BRJ A;  1Q7H A;  3BIR A;  3E99 A;  1K41 A;  1RNB A;  5JPP A;  5AYR B;  3DGY A;  1QAL A;  1I70 A;  4OVM A;  1RRL A;  1TFK A;  5EQL A;  1L5G B;  1NDO B;  1VQ8 3;  1I2E A;  1BNF A;  3LYG A;  4I5Q A;  2CX0 A;  1GMQ A;  3FGY A;  3OX9 A;  5BU4 A;  6STD A;  3UL6 A;  3HK4 A;  5JPU A;  1QMA A;  2ML6 A;  1B3S A;  1Y4K A;  1E3V A;  1GMP A;  3DMC A;  1YGW A;  1EKM A;  4HM6 B;  1BU4 A;  2QGU A;  3G6E 3;  2BHM A;  4HM0 B;  1Q82 4;  1JBS A;  1NB5 I;  2MF7 A;  3D5G A;  3D4A A;  4FMA A;  1GS3 A;  4BTY A;  2WGO A;  1QAK A;  1GD3 A;  1ROA A;  5RNT A;  1YI2 3;  2CH9 A;  1IQ8 A;  2RSX A;  3AMO B;  3KN4 A;  1MWR A;  1HKX A;  3MSO A;  5ELU A;  1M90 4;  1GY7 A;  1JKG B;  1JBR A;  1YVB I;  5D81 A;  1KWI A;  4HKV B;  3SVA A;  4H61 A;  1SIH A;  1OPY A;  3EB8 A;  3WOF B;  3A76 A;  1KSI A;  1OUN A;  2GBX B;  2HMO B;  2K54 A;  1NB3 I;  3GRD A;  1CYU A;  1OGX A;  4FMC A;  3CPO A;  2W9P A;  1DET A;  1IVW A;  2LYX A;  3EE1 A;  5KP4 A;  1QAF A;  3D5I A;  1MGR A;  4HM3 B;  5IG4 A;  2P09 A;  5BVB A;  2CFG A;  3SXX A;  3AGN A;  3JUQ A;  1FGT A;  1E97 A;  3F8H A;  1LVN A;  1RGA A;  2KF3 A;  4LSO A;  3MKI A;  1IQX A;  4HOH A;  3T8U A;  3WA3 A;  1R4Y A;  3K63 A;  3F9S A;  1BSB A;  1RGL A;  2KAA A;  1I0X A;  2GEY A;  4JRF A;  4R9K A;  1LOV A;  2QA4 3;  1JN5 B;  1FW7 A;  4GL6 A;  2BT3 A;  4HAA A;  1AVL A;  1JZD A;  1GOV A;  3DXO A;  4FMB A;  4H3U A;  4WHA A;  3CCR 3;  5G1L A;  1ISK A;  1SAR A;  3DGN A;  5D83 A;  3FG1 A;  4CPK A;  2F99 A;  3F7X A;  3G0K A;  5HGR A;  3UL5 A;  1V57 A;  4LYL B;  4FMD A;  3EBT A;  2KRT A;  1JB4 A;  2ZHX B;  3NX0 A;  1IVV A;  1ZS7 A;  1D6U A;  5AEW B;  2SAR A;  2ML5 A;  4N6V 0;  3KE7 A;  4RNY A;  7GSP A;  2CWV A;  5AYS C;  1W7C A;  1RCL A;  3WDG B;  1BSC A;  1WTH A;  2GEX A;  2XRX B;  3CCV 3;  3AMO A;  3EN1 B;  4R9L A;  1IDP A;  1B20 A;  2CG0 A;  2CFL A;  1LQM B;  4XDW A;  1JKG A;  2OQE C;  4EV2 A;  4XB5 A;  2UUG C;  4OK0 A;  2LQV A;  2CWT A;  3CU3 A;  3NUV A;  1O7W B;  3BNC A;  3F14 A;  5IG5 A;  1RJO A;  1OF5 B;  2CWU A;  5AIG A;  1JJ2 2;  5IER A;  1W6C A;  3GZY B;  3DH2 A;  4HM8 B;  3JUN A;  1B2X A;  1G96 A;  1TRQ A;  5IG3 A;  3SYU A;  3OWU A;  1LQG C;  1MOL A;  2OOV A;  1OCV A;  2AAD A;  3CME 3;  3BNE A;  2WGQ A;  3OWS A;  2K0M A;  1Q42 A;  2W2C A;  2Z7A A;  5KP3 A;  4CCV A;  5TGN A;  1UDI I;  1T2I A;  5CK6 A;  3HI7 A;  3KSE D;  2FNQ A;  8CHO A;  1YJ9 3;  1OHP A;  2OQE A;  2XSH B;  1WMO A;  1UCL A;  2FXT A;  2BIR A;  4N6U A;  1I3F A;  1W01 A;  1VQM 3;  1UUW B;  3NV0 B;  1BNG A;  4KVH A;  1IVX A;  1AQZ A;  5IEO A;  2Z6B A;  3FH1 A;  3EBY A;  5KP1 A;  1JN5 A;  4BL3 A;  4QWT A;  1OHO A;  2BU4 A;  2SBL A;  1YIT 3;  1YJW 3;  4XM4 A;  2CIU A;  1GY6 A;  2D42 A;  1BVI A;  4LMI A;  4KZ1 A;  1V58 A;  3JVC A;  1A2P A;  4STD A;  2HMJ B;  3S5C A;  5BXQ A;  3RDE A;  1V74 A;  2HMK B;  3X3X A;  1T5Y A;  2H0I A;  3JUM A;  4HM1 B;  1BRI A;  2L1S A;  2W03 A;  3LML A;  4HYZ A;  1RNT A;  1W6Y A;  4HVN A;  3CC4 3;  1F8N A;  1NWW A;  3NXJ A;  2YFI B;  1DMN A;  3LH4 A;  4AKY A;  5M18 A;  3UJM A;  3QK9 A;  1Q86 4;  1VQ6 3;  2QEX 3;  4TX4 A;  2H0H A;  5M19 A;  1ASK A;  3FCS B;  1WMP A;  3SX1 A;  1RCK A;  1U8C B;  2BMO B;  3VF1 A;  1N8Q A;  2C4B A;  3MWZ A;  7STD A;  1DMM A;  3PYJ A;  1JZO A;  2OCT A;  1BNI A;  1A90 A;  4WFO A;  3MG2 A;  4ZM8 A;  1OF5 A;  3ROB A;  1YJN 3;  1OHS A;  1STF I;  1AR0 A;  3BND A;  3O8Y A;  1AVK A;  1RN4 A;  2C10 A;  2JDI H;  5D82 A;  2YX9 A;  3HOH A;  4J5G A;  3S27 A;  3I55 3;  3NM2 A;  4J9A A;  2XFS A;  3I56 3;  1BSA A;  1CQS A;  1B2Z A;  4WYK B;  3CCM 3;  1S72 3;  4IT7 A;  1IQY A;  1QJG A;  2XSO B;  4ORL A;  3CCS 3;  1IVU A;  3NHX A;  3F40 A;  1R4C A;  1UGI A;  3NBJ A;  1UUG B;  1IT7 A;  4LZI A;  3OW2 2;  1B2M A;  3B4O A;  1RGH A;  1GY5 A;  1FYS A;  3CCJ 3;  1TRP A;  4K90 B;  2IA7 A;  2F4Y A;  5EEO A;  1X1X A;  2HMN B;  1QVF 2;  4HM5 B;  3NV0 A;  1PYL A;  1JV2 B;  2HMM B;  3LT9 A;  4HM2 B;  3AHS A;  4R1K A;  4XBT A;  1Q7Y 4;  4HM7 B;  4O2H A;  3BB9 A;  3GWR A;  1BOX A;  1YNV X;  3HX8 A;  3LXU X;  3VGN A;  1O7M B;  2RBI A;  1N9E A;  3FF0 A;  3FF2 A;  3GSP A;  4LGQ A;  2BO9 B;  2V1L A;  4RNT A;  1UCJ A;  4BIR A;  1RDS A;  3PGB A;  1BSD A;  3EQQ B;  3SLU A;  3PCR A;  1X1W A;  5A0O B;  1DE3 A;  3KSP A;  4J5K A;  5AII A;  1BUQ A;  3GZX B;  3NM7 A;  3OXA A;  5DRV A;  3S29 A;  1IK3 A;  1EEJ A;  4N6O B;  2INX A;  5I97 A;  1MNL A;  1BAN A;  2A15 A;  2Y73 A;  4JF8 A;  3A5E A;  4CJN A;  3KFQ C;  3K0Z A;  1UW1 A;  4L8O A;  2UGI A;  3UB1 A;  1I2F A;  4IIA A;  1JBT A;  4HZB B;  1WQL B;  3N8B A;  1B2U A;  3GAX A;  1W2B 2;  1RGC A;  1SQW A;  2WOF A;  5CLK A;  1FGM A;  1QVG 2;  1DVD A;  3JUP A;  3D9R A;  3DY5 A;  4RNZ A;  4IPB A;  1SJW A;  1T2H A;  4EXR A;  1GYB A;  4WYK A;  4CDL A;  3J7Y d;  4R80 A;  3HZP A;  2FGT A;  1RRH A;  3B7C A;  3KII A;  3NQZ A;  2OOV C;  3AGO A;  2WOH A;  1UI7 A;  4EC6 A;  1IV9 A;  2J8X B;  3ZG5 A;  1X1Y A;  4HM4 B;  3T0U A;  3EJV A;  3OWY A;  2KF4 A;  2WO0 A;  4K1V A;  1BSE A;  3CPW 2;  2BNG A;  4N6L A;  5IG0 A;  1M1X B;  2OWP A;  1PY3 A;  1W5Z A;  4G1M B;  2H0G A;  3STD A;  4DKI A;  3IPT A;  2CK3 H;  1RMS A;  1KC8 4;  1DVC A;  1VQ7 3;  2GU3 A;  4LEH A;  2IY2 A;  4BTW A;  1SII A;  1FUW A;  4BTX A;  1HZ1 A;  4J8T A;  3IMA B;  3MG3 A;  4L7K A;  1FGO A;  1X1U A;  3EF8 A;  2P0M A;  3VSY A;  4HJL B;  3LT8 A;  3NQY A;  1BRH A;  2XH9 A;  3K7C A;  3PCS A;  3G4S 3;  1KD1 4;  2F5M A;  2STD A;  2XGN A;  2Z76 A;  3M8C A;  3DGL A;  4Q53 A;  3CCQ 3;  1ZX2 A;  2Z77 A;  1OH0 A;  5HOH A;  1TTO A;  3Q2P A;  3WA2 X;  3EHC A;  4NHF A;  2R4I A;  1GSP A;  4EV5 A;  4U13 A;  4OUQ A;  4K1U A;  3FKA A;  1UCK A;  1CEW I;  1Z1S A;  1FZU A;  2E2T A;  1FGQ A;  2KXG A;  1WMN A;  3EX9 A;  3LZA A;  3PZW A;  3TDG A;  1HU9 A;  1TIJ A;  2CG1 A;  4X2O A;  4EW5 A;  2XGL A;  1LRA A;  1YHQ 3;  8RNT A;  4KFF A;  1G0T A;  1N5P A;  1LOX A;  4N3V A;  3G71 3;  3IJE B;  5LC7 A;  1N9J A;  3FLJ A;  3QRD A;  4AEQ A;  4MMZ B;  3SED A;  5M1A A;  4GSP A;  4HZ9 B;  5LC6 A;  2W56 A;  4XDV A;  2GSP A;  3AHW A;  1D6Y A;  1RGK A;  2XFT A;  4O02 B;  4MMY B;  2ZL8 A;  2CX1 A;  1HYF A;  1VQP 3;  1JRQ A;  2Y74 A;  4X2H A;  1IV7 A;  2M7O A;  3MHE A;  5G2G A;  5CF1 A;  1OAC A;  2YFL B;  3K9M C;  3MYT A;  3WOD G;  3FG3 A;  1NNV A;  4EYC A;  1VZZ A;  3NBB A;  4MMX B;  3WOE B;  4BU4 A;  1A67 A;  1RHL A;  1LNH A;  1N5H A;  2RCD A;  3ECF A;  2QIY A;  1MWT A;  2GXF A;  2XEP A;  1BIR A;  2KF5 A;  3DZL A;  1AV4 A;  1W2Z A;  4O8S A;  1MWU A;  2L4V A;  4XBY A;  5DRE A;  3LTD A;  1JNQ A;  2CW9 A;  3D3L A;  1I2G A;  3JUO A;  3SOA A;  1ULJ B;  1PU4 A;  2JQ5 A;  3S67 A;  1UI8 A;  3L0R A;  1FUS A;  4AKZ A;  3X3Y A;  2BMR B;  1RLS A;  1OGZ A;  3KZT A;  1RGE A;  4ILF A;  1STD A;  3X40 A;  1VQQ A;  4MEI A; 
#chains in the Genus database with same CATH homology
 1DYU A;  2RGQ A;  2I9W A;  2IMJ A;  2Q07 A;  3CC2 3;  3S28 A;  3SOY A;  3CNM A;  3OV4 A;  2B24 B;  3N54 B;  1NO3 A;  2ZDJ A;  2CFW A;  1W00 A;  1VQ9 3;  1S5A A;  3WMD A;  4KFE A;  1JB2 A;  1FGR A;  1RKY A;  5EVH A;  2GBW B;  1LXE A;  1TUH A;  3ER7 A;  3DM8 A;  2CC3 A;  3G16 A;  2XR8 B;  4RZM A;  4WWU C;  5CXO A;  3LTC A;  4O3V A;  3RGA A;  1EG9 B;  2O3O A;  1JB5 A;  1VQK 3;  1UUV B;  3PS8 A;  3T8N A;  2PNC A;  1US1 A;  1ROV A;  3CMA 3;  1YIJ 3;  5CF2 A;  3KKG A;  4L8P A;  3V98 A;  1O7G B;  1TFO A;  4FCZ A;  5AI1 A;  3X41 A;  4GB5 A;  1Q40 B;  2E2U A;  3PXM A;  4PEJ A;  1VQO 3;  2IUJ A;  3HII A;  4KFD A;  1O7H B;  2P38 A;  3F8X A;  1EQK A;  1FA3 A;  5AIH A;  1W6G A;  2P0X A;  1Q81 4;  1PFP A;  3EN8 A;  1VQL 3;  3U97 A;  4XBX A;  3GZB A;  2O9U X;  5ELJ A;  2W56 B;  1WNH A;  4FCJ A;  3DGM A;  2GU1 A;  3BLZ A;  1O7N B;  1ULI B;  2W9Q A;  2CHC A;  3FG4 A;  3Q1C A;  3MG1 A;  1K8A 4;  1K73 4;  3BNB A;  3H3H A;  3G8Z A;  5FGO A;  1D6Z A;  3B8L A;  3Q90 A;  3FSD A;  2OTJ 3;  3K5T A;  2B1X B;  3CCL 3;  3DGO A;  3GZR A;  5STD A;  5AIF A;  4K61 A;  2W04 A;  3NBR A;  1A2K A;  3MPH A;  2P05 A;  2XF3 A;  4N6N B;  3LOY A;  1N8R 4;  1SPU A;  1O7P B;  3X3Z A;  4HBR A;  4WP5 A;  3H51 A;  2CKF B;  3LTA A;  3CC7 3;  1VQ5 3;  3ALA A;  5IEN A;  3LTB A;  3UNL A;  2CFK A;  3F7S A;  4I4K A;  1RN7 A;  1W02 A;  1VQN 3;  2RFR A;  3I0Y A;  2IUK A;  3CCE 3;  3HIG A;  1VQ4 3;  1Q40 A;  2CFD A;  1M1K 4;  4NRE A;  3V92 A;  2F98 A;  2F86 B;  1NU3 A;  5IW9 A;  2HML B;  1YGE A;  3CCU 3;  2MC8 A;  2UX0 A;  2PZV A;  1TP6 A;  4FCM A;  3V99 A;  4RBN A;  1DMQ A;  1M9G A;  1KQS 2;  3EC9 A;  5IEP A;  2KCD A;  2OTL 3;  4N6M A;  4N6T A;  5FW5 A;  3CNX A;  3N9H A;  1IU7 A;  1EA2 A;  4R4K A;  3U1W A;  2E2V A;  3X42 A;  5JBS A;  3DUK A;  1GD4 A;  1J2B A;  5AEU B;  1K9M 4;  1K28 A;  1NJI 4;  1E3R A;  4MJD A;  4FR9 A;  2C11 A;  3B4P A;  1IT8 A;  1C7H A;  1ZO2 A;  1TU5 A;  5IF6 A;  2D1W A;  2W0Q A;  2W6J H;  1U5O A;  3FZW A;  3CXC 2;  3RGR A;  2YFJ B;  1W4N A;  3CD6 3;  1CYV A;  4EBG A;  1A2V A;  2BMQ B;  3E99 A;  1K41 A;  5JPP A;  5AYR B;  1QAL A;  4OVM A;  1RRL A;  1TFK A;  5EQL A;  1L5G B;  1NDO B;  1VQ8 3;  3LYG A;  6STD A;  3FGY A;  3OX9 A;  3UL6 A;  3HK4 A;  5JPU A;  1QMA A;  2ML6 A;  1Y4K A;  1E3V A;  3DMC A;  1EKM A;  4HM6 B;  2QGU A;  3G6E 3;  2BHM A;  4HM0 B;  1Q82 4;  1NB5 I;  2MF7 A;  4FMA A;  1GS3 A;  4BTY A;  2WGO A;  1QAK A;  1GD3 A;  1ROA A;  1YI2 3;  2CH9 A;  3AMO B;  1IQ8 A;  2RSX A;  3KN4 A;  3MSO A;  1HKX A;  5ELU A;  1M90 4;  1GY7 A;  1JKG B;  1YVB I;  5D81 A;  1KWI A;  4HKV B;  3SVA A;  4H61 A;  1SIH A;  1OPY A;  3EB8 A;  3WOF B;  3A76 A;  1KSI A;  1OUN A;  2GBX B;  2HMO B;  2K54 A;  1NB3 I;  3GRD A;  1CYU A;  1OGX A;  4FMC A;  3CPO A;  2W9P A;  1IVW A;  2LYX A;  3EE1 A;  5KP4 A;  1QAF A;  4HM3 B;  5IG4 A;  2P09 A;  5BVB A;  2CFG A;  3SXX A;  3JUQ A;  1FGT A;  1E97 A;  3F8H A;  1LVN A;  4LSO A;  3MKI A;  1IQX A;  3T8U A;  3WA3 A;  3K63 A;  3F9S A;  2GEY A;  4JRF A;  4R9K A;  2QA4 3;  1JN5 B;  4GL6 A;  2BT3 A;  1AVL A;  3DXO A;  4FMB A;  4H3U A;  4WHA A;  3CCR 3;  1ISK A;  3DGN A;  5D83 A;  3FG1 A;  2F99 A;  3F7X A;  3G0K A;  5HGR A;  3UL5 A;  4FMD A;  3EBT A;  2KRT A;  1JB4 A;  3NX0 A;  1IVV A;  1D6U A;  5AEW B;  2ML5 A;  4N6V 0;  3KE7 A;  4RNY A;  2CWV A;  5AYS C;  1W7C A;  3WDG B;  3CCV 3;  1WTH A;  2GEX A;  2XRX B;  3AMO A;  3EN1 B;  4R9L A;  1IDP A;  2CG0 A;  2CFL A;  4XDW A;  1JKG A;  2OQE C;  4EV2 A;  4XB5 A;  4OK0 A;  2LQV A;  2CWT A;  3CU3 A;  3NUV A;  1O7W B;  3BNC A;  3F14 A;  5IG5 A;  1RJO A;  1OF5 B;  2CWU A;  5AIG A;  1JJ2 2;  5IER A;  1W6C A;  3GZY B;  4HM8 B;  3JUN A;  1G96 A;  5IG3 A;  3OWU A;  1MOL A;  2OOV A;  1OCV A;  3CME 3;  3BNE A;  2WGQ A;  3OWS A;  2K0M A;  1Q42 A;  2W2C A;  2Z7A A;  5KP3 A;  4CCV A;  5TGN A;  5CK6 A;  8CHO A;  3HI7 A;  3KSE D;  2FNQ A;  1YJ9 3;  1OHP A;  2OQE A;  2XSH B;  1WMO A;  2FXT A;  4N6U A;  1W01 A;  1VQM 3;  1UUW B;  3NV0 B;  4KVH A;  1IVX A;  5IEO A;  2Z6B A;  3FH1 A;  3EBY A;  5KP1 A;  1JN5 A;  4QWT A;  1OHO A;  2SBL A;  1YIT 3;  1YJW 3;  4XM4 A;  2CIU A;  1GY6 A;  2D42 A;  4LMI A;  4KZ1 A;  3JVC A;  4STD A;  2HMJ B;  3S5C A;  5BXQ A;  3RDE A;  1V74 A;  2HMK B;  3X3X A;  1T5Y A;  3JUM A;  4HM1 B;  2W03 A;  3LML A;  4HYZ A;  1W6Y A;  4HVN A;  3CC4 3;  1F8N A;  1NWW A;  3NXJ A;  2YFI B;  1DMN A;  3LH4 A;  4AKY A;  1Q86 4;  3UJM A;  3QK9 A;  1VQ6 3;  2QEX 3;  4TX4 A;  1ASK A;  3FCS B;  1WMP A;  3SX1 A;  1U8C B;  2BMO B;  3VF1 A;  1N8Q A;  3MWZ A;  7STD A;  1DMM A;  3PYJ A;  2OCT A;  1A90 A;  4WFO A;  3MG2 A;  4ZM8 A;  1OF5 A;  3ROB A;  1YJN 3;  1OHS A;  1STF I;  1AR0 A;  3BND A;  3O8Y A;  1AVK A;  2C10 A;  2JDI H;  5D82 A;  2YX9 A;  3S27 A;  3I55 3;  3NM2 A;  4J9A A;  2XFS A;  3I56 3;  1CQS A;  4WYK B;  3CCM 3;  1S72 3;  1KD1 4;  4IT7 A;  1IQY A;  1QJG A;  2XSO B;  4ORL A;  3CCS 3;  1IVU A;  3NHX A;  3F40 A;  1R4C A;  3NBJ A;  4LZI A;  3OW2 2;  1IT7 A;  3B4O A;  1GY5 A;  3CCJ 3;  4K90 B;  2IA7 A;  5EEO A;  2HMN B;  1QVF 2;  4HM5 B;  3NV0 A;  4HM2 B;  1JV2 B;  2HMM B;  3LT9 A;  4R1K A;  4XBT A;  1Q7Y 4;  4HM7 B;  4O2H A;  3BB9 A;  3GWR A;  3HX8 A;  3LXU X;  3VGN A;  1O7M B;  1N9E A;  3FF0 A;  3FF2 A;  4LGQ A;  2BO9 B;  2V1L A;  3PGB A;  3EQQ B;  3SLU A;  3PCR A;  5A0O B;  3KSP A;  5AII A;  1BUQ A;  3GZX B;  3NM7 A;  3OXA A;  5DRV A;  3S29 A;  1IK3 A;  4N6O B;  2INX A;  5I97 A;  2Y73 A;  1MNL A;  2A15 A;  4JF8 A;  3KFQ C;  3K0Z A;  1UW1 A;  4L8O A;  3UB1 A;  4IIA A;  4HZB B;  1WQL B;  3N8B A;  3GAX A;  1W2B 2;  1SQW A;  2WOF A;  5CLK A;  1QVG 2;  1FGM A;  1DVD A;  3JUP A;  3D9R A;  3DY5 A;  4RNZ A;  4IPB A;  1SJW A;  4EXR A;  1GYB A;  4WYK A;  4CDL A;  3J7Y d;  4R80 A;  3HZP A;  2FGT A;  1RRH A;  3B7C A;  3KII A;  3NQZ A;  2OOV C;  2WOH A;  1UI7 A;  4EC6 A;  1IV9 A;  4HM4 B;  3T0U A;  3EJV A;  3OWY A;  2WO0 A;  4K1V A;  3CPW 2;  2BNG A;  4N6L A;  5IG0 A;  1M1X B;  2OWP A;  1W5Z A;  4G1M B;  3STD A;  3IPT A;  2CK3 H;  1KC8 4;  1DVC A;  1VQ7 3;  2GU3 A;  4LEH A;  4BTW A;  1SII A;  1FUW A;  4BTX A;  4J8T A;  3IMA B;  3MG3 A;  4L7K A;  1FGO A;  3EF8 A;  2P0M A;  3VSY A;  4HJL B;  3LT8 A;  3NQY A;  2XH9 A;  3K7C A;  3PCS A;  3G4S 3;  2XGN A;  2STD A;  2Z76 A;  3M8C A;  3DGL A;  4Q53 A;  3CCQ 3;  1ZX2 A;  2Z77 A;  1OH0 A;  3Q2P A;  3WA2 X;  3EHC A;  4NHF A;  2R4I A;  4EV5 A;  4U13 A;  4OUQ A;  4K1U A;  3FKA A;  1CEW I;  1Z1S A;  2E2T A;  1FGQ A;  2KXG A;  1WMN A;  3EX9 A;  3LZA A;  3PZW A;  3TDG A;  1HU9 A;  1TIJ A;  2CG1 A;  4X2O A;  2XGL A;  1YHQ 3;  4KFF A;  1N5P A;  1LOX A;  4N3V A;  3G71 3;  3IJE B;  5LC7 A;  1N9J A;  3FLJ A;  3QRD A;  4AEQ A;  4MMZ B;  3SED A;  4HZ9 B;  5LC6 A;  2W56 A;  4XDV A;  1D6Y A;  2XFT A;  4O02 B;  4MMY B;  2ZL8 A;  1VQP 3;  1JRQ A;  2Y74 A;  4X2H A;  1IV7 A;  2M7O A;  3MHE A;  5G2G A;  5CF1 A;  1OAC A;  2YFL B;  3K9M C;  3MYT A;  3WOD G;  3FG3 A;  4EYC A;  1VZZ A;  3NBB A;  4MMX B;  3WOE B;  1A67 A;  1LNH A;  1N5H A;  2RCD A;  3ECF A;  2QIY A;  2GXF A;  2XEP A;  3DZL A;  1AV4 A;  1W2Z A;  4O8S A;  2L4V A;  4XBY A;  5DRE A;  3LTD A;  1JNQ A;  2CW9 A;  3D3L A;  3JUO A;  3SOA A;  1PU4 A;  1ULJ B;  2JQ5 A;  3S67 A;  1UI8 A;  3L0R A;  4AKZ A;  3X3Y A;  2BMR B;  3KZT A;  1OGZ A;  1STD A;  3X40 A;  4MEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...