1C54A

Solution structure of ribonuclease sa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE SA
publication title Solution structure and dynamics of ribonuclease Sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 12
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1999-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1c54A00
1BU4A 1RDSA 2KF3A 1LOVA 2BU4A 1HYFA 1I70A 3WHOA 2KF5A 1JBRA 1FYSA 1A2PA 3KCHA 3BU4A 4BU4A 2KF6A 2KF4A 1GOVA 1RCLA 1T2IA 1RGFA 4RNTA 1TTOA 1LNIA 9RNTA 1B2UA 1BRIA 1BNRA 1BSCA 1T2HA 3GSPA 1YNVX 3SYUA 7RNTA 5RNTA 1BOXA 1RGAA 1BSDA 1RGEA 1LOYA 3DGYA 2F56A 6GSPA 3AHSA 4J5GA 1X1XA 2AADA 2AAEA 1YGWA 2HOHA 1I8VA 3A5EA 1RN1A 1RGKA 1GOUA 4BIRA 4HOHA 2GSPA 3DH2A 1MGWA 3D4AA 5BU4A 1BUJA 2F5WA 1B3SA 1DETA 1GSPA 1RGLA 6RNTA 1UCLA 1BNFA 1BRKA 1SARA 1TRQA 1UCIA 1RLSA 4HAAA 2ZA4A 1G02A 1FUTA 1BSBA 1HZ1A 3D5GA 1BSEA 1B2ZA 1ZGXA 1X1WA 1BRJA 3WR2A 1RN4A 1FZUA 1BVIA 1RNTA 1DE3A 1GOYA 1RGHA 1C54A 1MGRA 5HOHA 1I3FA 1B27A 4GHOA 1B2MA 1X1YA 1BRSA 1BGSA 2F5MA 1BIRA 1GMPA 1FUSA 1BNGA 1B2SA 1PY3A 1I2GA 3AGNA 1JBTA 1UCKA 2BIRA 1BNIA 3AGOA 1AY7A 1TRPA 2KAAA 5GSPA 1I0VA 1R4YA 1GMRA 1PYLA 7GSPA 1I2FA 1CH0A 1BAOA 3RNTA 1BNJA 1RGGA 1BRNL 4J5KA 1B20A 2F4YA 1B21A 8RNTA 1X1UA 1RHLA 1RGCA 1BNSA 1RTUA 1YVSA 3URPA 1UCJA 1BRGA 2RBIA 1Q9EA 1I0XA 1BRHA 1LOWA 2RNTA 1B2XA 4GSPA 1I3IA 1IYYA 3BIRA 3D5IA 1GMQA 1RSNA 3HOHA 1RNBA 5BIRA 1LRAA 1RMSA 1BANA 2SARA 3Q3FA 2C4BA 1BNEA 1FW7A 3AHWA 1RCKA 1AQZA 1JBSA 1I2EA 1BSAA
chains in the Genus database with same CATH superfamily
2RFRA 1V74A 1NNVA 1W6GA 2XGLA 3HK4A 1ISKA 1D6UA 2BU4A 1I70A 1ULJB 4XDWA 1FYSA 3KCHA 4KZ1A 1OH0A 3F14A 4K1VA 2KRTA 2KF4A 1T2IA 1RCLA 2LQVA 4LEHA 2HMKB 1Q864 1LNIA 1Q40A 3OWSA 5CK6A 1B2UA 2WGOA 3WODG 3CCE3 3OV4A 1BSCA 7RNTA 5RNTA 1JKGB 2YFIB 3TDGA 1NJI4 1US1A 1Q824 2F56A 6GSPA 1VQO3 3D9RA 3LT8A 1NB5I 3AHSA 2OQEC 2CFWA 1RJOA 2F99A 3S67A 4FCZA 3M8CA 4CCVA 1N5HA 1SPUA 2CC3A 1X1XA 3UL5A 4LMIA 2HMNB 1EKMA 1SQWA 1YGWA 3A5EA 4AEQA 3F40A 4HKVB 5EEOA 1OPYA 3AMOB 2Q07A 3IMAB 5BU4A 1FGTA 5AYSC 2CG0A 1TUHA 2F5WA 1GSPA 1W2B2 2GU1A 3CNMA 1BRKA 3CNXA 3GAXA 1SARA 1G0TA 1LNHA 1TRQA 1JN5A 3B7CA 1G02A 1HKXA 2Z7AA 2E2UA 1FUTA 1W6CA 1BSBA 1HZ1A 3SOAA 3K0ZA 3I553 3D5GA 4RZMA 3UL6A 3ALAA 4IT7A 5DREA 1ZGXA 3ROBA 1Q814 1X1WA 2IY2A 1JB4A 3JVCA 5CLKA 4NHFA 1U8CB 3GWRA 1OACA 1K9M4 1DE3A 3CPOA 2IUJA 2GEXA 4EV2A 2B24B 1MGRA 1OCVA 4X2OA 2H0IA 3GRDA 3LTDA 5HOHA 1VQM3 2L1SA 3KZTA 3ER7A 2W9QA 4WYKA 4BTXA 1SIIA 1N8QA 1VQL3 4LSOA 1WMPA 1JBTA 1YVBI 1W4NA 2F98A 1IV7A 2IMJA 3HX8A 4N6UA 1AV4A 1TRPA 1PFPA 4LYLB 1SIHA 4XDVA 2K3DA 2XSOB 2HMOB 1E3RA 4XM4A 4IPBA 1VQP3 5IG4A 1NU3A 1W5ZA 1CEWI 1RKYA 1GMRA 1OHPA 2HMJB 1I2FA 4CPKA 3PYJA 3LTCA 1BAOA 4O3VA 1TU5A 1VQQA 5I97A 5ELUA 1BRNL 3QRDA 4ORLA 3NX0A 1TP6A 2A15A 2CFDA 3SOYA 1B21A 1O7GB 2CWTA 1EA2A 4AKYA 3FKAA 4FMDA 1JV2B 1IQ8A 1N9JA 1BNSA 1FGOA 2FXTA 2OOVC 5EVHA 3RDEA 1UCJA 3WOFB 1BRHA 4HM3B 1LOWA 4O8SA 1B2XA 1D6ZA 5LC6A 1UGIA 3LTAA 3N9HA 3PCRA 7STDA 1I3IA 1D6YA 3BIRA 1RSNA 1A2KA 1GD3A 1LRAA 2ML6A 1BANA 3FF0A 5BXQA 3PS8A 4EBGA 1N9EA 2C11A 1FW7A 3G0KA 1WTHA 3AHWA 4HYZA 3G713 3CC23 4CDLA 3FF2A 2Y73A 2CWVA 4EXRA 4OK0A 2WOHA 3KN4A 3U97A 3F9SA 3NBRA 1LQGC 3G16A 5IEOA 3D79A 1MWRA 2KF3A 1LOVA 5D81A 1HYFA 1A2PA 2HMLB 4KFFA 4BU4A 2Y74A 2KF6A 3NHXA 1OF5B 3OWUA 2LYXA 3B4OA 3EQQB 5AIGA 1VQ53 2GEYA 1JB2A 1RGFA 2V1LA 5AIFA 9RNTA 2OWPA 4RBNA 1M904 1FUWA 3GSPA 4WHAA 2INXA 3SYUA 3KIIA 2UGIA 1YHQ3 1RGEA 3DGOA 5KP1A 1IK3A 1YJN3 3EF8A 2E2VA 4HM5B 4N6MA 3F7XA 1QVF2 5CXOA 1O7WB 3BNBA 2AAEA 1IT8A 2XEPA 2HMMB 2FNQA 2ZHXB 3IJEB 3CD63 4BIRA 1RGKA 3F8HA 4HZBB 4OUQA 3NBBA 1PU4A 2CW9A 1LXEA 1MWUA 1KQS2 4CJNA 1UI8A 3G4S3 1MGWA 2BMRB 3FG3A 4LGQA 4Q53A 3WA3A 1JNQA 2IUKA 4HZ9B 2OTL3 1IVVA 1BNFA 1W6YA 1FA3A 5FW5A 3DZLA 4HM4B 4BTYA 6STDA 1G96A 1YIJ3 4QWTA 2E2TA 1BSEA 1RRHA 1NDOB 3V92A 4HVNA 4H61A 1BRJA 3KSPA 1IQXA 3CCV3 1FGRA 1FZUA 2R41A 4R9LA 1BVIA 1M1K4 2P0XA 1GYBA 3LMLA 1RGHA 1KSIA 3JUPA 1FGMA 3STDA 1LOXA 3E99A 3UB1A 2BO9B 1B27A 3CC43 4MMZB 1CYUA 4GHOA 4R1KA 1UI7A 1X1YA 1BRSA 3ZG5A 3DUKA 4HM6B 4EV5A 2QIYA 1M1XB 1Q42A 3NV0A 1BNGA 1UW1A 2KXGA 3NQZA 2I9WA 2W56A 1V58A 4FCMA 4K61A 4KFEA 1QAKA 1VQ93 3N54B 1YI23 3N8BA 1N8R4 2W6JH 2O9UX 1GS3A 2W0QA 3SEDA 2XF3A 2CG1A 3CMA3 3EBYA 5IW9A 1IVWA 1I0VA 5GSPA 1WQLB 3J7Yd 1Q40B 3SVAA 1R4YA 2PNCA 1PYLA 2IYJA 7GSPA 5AEUB 1CH0A 1O7PB 3RNTA 1A90A 4KT3B 4BTWA 5HGRA 2BMQB 1RGGA 3NM2A 4NPBA 3VF1A 1W01A 1B20A 1DVDA 4HJLB 2D42A 4RNZA 1ROVA 1X1UA 3L0RA 1RHLA 3Q2PA 3Q90A 5AIIA 2SBLA 2YFJB 1W02A 2MF7A 2YX9A 1BRGA 1OGZA 1VQ63 3X3XA 3BNCA 4L8OA 3V98A 3WOEB 4GSPA 2C10A 4LZIA 2J8XB 1MWSA 4KFDA 3WA2X 1Z1SA 1RNBA 1EG9B 4XBYA 3Q3FA 2BMOB 2BNGA 2QGUA 2XR8B 1JN5B 4HM7B 1BNEA 5D83A 3PCSA 3S5CA 1Y4KA 1ZO2A 3WDGB 3NUVA 1K8A4 5FGOA 4HM8B 1JZDA 3ZFZA 1BUQA 3JUMA 4R9KA 1DMMA 1TFOA 2XRXB 4BL2A 1BU4A 3CCR3 1GY5A 1NO3A 4EW5A 1STDA 2CX0A 3PXMA 3CCS3 2GBWB 3BU4A 4L8PA 1QVG2 3MKIA 1NB3I 3LH4A 1GOVA 5DRVA 5IF6A 2W03A 1TTOA 1QJGA 1T2HA 2JQ5A 3A76A 1K28A 1UUWB 1BOXA 4WYKB 1LOYA 1K41A 8CHOA 1FGQA 2O3OA 3NXJA 2CHCA 4J5GA 1HU9A 1W7CA 4N6V0 2XGNA 3OXAA 2Z6BA 1KWIA 3BNEA 3CU3A 3K5TA 3LOYA 3CCQ3 3MYTA 3PGBA 4NREA 5JBSA 3FCSB 1IV9A 5IG0A 1RN1A 1GOUA 1U5OA 5JPUA 1JB5A 5JPPA 3SXXA 5M19A 3FGYA 3UNLA 2W2CA 3CXC2 1N5PA 1MWTA 3FG4A 5AEWB 1BUJA 3FZWA 3BLZA 1DETA 1ASKA 1UCLA 4GL6A 5LC7A 1UCIA 2ZA4A 3S27A 3CPW2 4K1UA 1J2BA 5IEPA 1WNHA 3H3HA 4WFOA 3SX1A 1Q7HA 1B2ZA 3KKGA 2BHMA 2MC8A 4PEJA 3T8UA 4GB5A 1RN4A 2OQEA 3FH1A 3DM8A 1RNTA 3KSED 3RGRA 3ZG0A 3MG3A 3MHEA 1GOYA 2ZDJA 3LTBA 1C54A 3GZYB 4FMCA 4JRFA 2F86B 3BNDA 3LZAA 3HIGA 4O02B 5IERA 4XB5A 1S5AA 5G2GA 1JKGA 2JDIH 1OHOA 2CH9A 2F5MA 3HZPA 5KP4A 1VQN3 3LT9A 4FMBA 1B2SA 1ULIB 1TFKA 3K63A 4EYCA 1AVLA 1BNIA 3B4PA 3DGMA 3GZXB 1L5GB 2D1WA 2CWUA 2QEX3 1O7HB 3SLUA 3EN8A 1CQSA 1OHSA 3G6E3 5IG5A 3CC73 3DMCA 1RN7A 1ROAA 1QALA 5CF2A 3D3LA 3AMOA 3NQYA 3RGAA 2WOFA 4MEIA 5AI1A 3X42A 2CIUA 3LXUX 4OVMA 5EQLA 5CF1A 4WWUC 1IT7A 3HIIA 1CYVA 4RNYA 1GY6A 1EUIC 3I0YA 8RNTA 4BL3A 3JUQA 2H0GA 3JUOA 1ZX2A 3O8YA 1RGCA 4N3VA 3DGNA 5AIHA 1YVSA 3URPA 1DVCA 2H0HA 3NBJA 1IQYA 1WMNA 5STDA 3V99A 1YIT3 2QA43 1STFI 2W04A 3KE7A 1I0XA 1VZZA 1V57A 2CFLA 3BB9A 5BVBA 2P05A 3UJMA 4N6OB 1A67A 2RGQA 4R4KA 1TJDA 1UGHI 2ZL8A 3H51A 3HOHA 1RMSA 2R4IA 5BIRA 4XBXA 4EC6A 2C4BA 1WMOA 1W00A 3Q1CA 5TGNA 3EB8A 3EE1A 1K734 4R80A 4KVHA 1DMNA 4AKZA 1I2EA 4HM1B 2XFSA 1RDSA 3B8LA 2CFGA 3EBTA 3MSOA 4FR9A 3U1WA 3CCJ3 3CCM3 3X40A 5D82A 3WHOA 2KF5A 2RSXA 1VQ83 1JBRA 5M18A 1IDPA 3DXOA 2OOVA 3HI7A 5KP3A 3DGLA 4RNTA 2PZVA 2GBXB 4HBRA 3WMDA 1BRIA 1GY7A 1BNRA 1YNVX 3T0UA 4H3UA 2CX1A 1RGAA 4N6TA 1BSDA 4TX4A 1M9GA 3DGYA 3NV0B 4ILFA 5IENA 2W56B 2STDA 4MJDA 3T8NA 2GXFA 3NM7A 1F8NA 5ELJA 1DYUA 1IVUA 2UX0A 3PZWA 4DKIA 2CFKA 3MWZA 2AADA 2HOHA 1I8VA 1BSAA 3ECFA 1SJWA 5A0OB 4FCJA 5M1AA 1GD4A 1YGEA 4HOHA 1OUNA 2GSPA 3DH2A 3FG1A 2GU3A 3K7CA 4HM0B 1O7NB 4G1MB 3D4AA 2BT3A 4U13A 1C7HA 2P0MA 2ML5A 3OX9A 1B3SA 4IIAA 1RGLA 2Z76A 1O7MB 6RNTA 4I5QA 1OGXA 1YJ93 1KD14 4HAAA 1RLSA 5IG3A 1E97A 4N6NB 1LQMB 2XH9A 4HM2B 1IU7A 3MPHA 4X2HA 1VQ73 4I4KA 1UUGB 3WR2A 3X3ZA 3K9MC 2CK3H 3X3YA 1JRQA 2OTJ3 3EX9A 1S723 3QK9A 1OF5A 2IA7A 1KC84 1IVXA 1T3BA 1I3FA 3DY5A 1Q7Y4 2OCTA 1DMQA 2B1XB 1RRLA 2RCDA 1B2MA 2UUGC 2KCDA 5G1LA 1BGSA 1BIRA 1GMPA 1FUSA 2K54A 4WP5A 1PY3A 1I2GA 1TIJA 2M7OA 3AGNA 1UCKA 4STDA 2BIRA 2FGTA 4L7KA 3VGNA 3AGOA 1AY7A 1JJ22 1VQ43 2KAAA 3S28A 2WO0A 3OW22 2W9PA 2CKFB 1YJW3 2XSHB 2Z77A 4J8TA 1MOLA 1T5YA 1MNLA 1R4CA 3VSYA 1QAFA 3MG2A 1VQK3 3OWYA 5G1KA 1BNJA 3X41A 1QMAA 4MMXB 3KFQC 4J5KA 3FSDA 2F4YA 2YFLB 1NWWA 3EC9A 3GZRA 3IPTA 2L4VA 4MMYB 3EHCA 4JF8A 3EJVA 4ZM8A 1RTUA 3I563 1UDII 2WGQA 3CCU3 1EEJA 1Q9EA 1AVKA 2RBIA 3F7SA 1AR0A 1ZS7A 1E3VA 2P09A 3JUNA 3LYGA 2RNTA 3G8ZA 3MG1A 4N6LA 4O2HA 4J9AA 4FMAA 3F8XA 3S29A 1A2VA 3CCL3 3FLJA 2P38A 1IYYA 1EQKA 3D5IA 1GMQA 3EN1B 2SARA 3GZBA 4K90B 2K0MA 2XFTA 3CME3 1W2ZA 1UUVB 5AYRB 4XBTA 1RCKA 1AQZA 1LVNA 1JBSA 1JZOA
chains in the Genus database with same CATH topology
1BU4A 1RDSA 2KF3A 1LOVA 2BU4A 1HYFA 1I70A 3WHOA 2KF5A 1JBRA 1FYSA 1A2PA 3KCHA 3BU4A 4BU4A 2KF6A 2KF4A 1GOVA 1RCLA 1T2IA 1RGFA 4RNTA 1TTOA 1LNIA 9RNTA 1B2UA 1BRIA 1BNRA 1BSCA 1T2HA 3GSPA 1YNVX 3SYUA 7RNTA 5RNTA 1BOXA 1RGAA 1BSDA 1RGEA 1LOYA 3DGYA 2F56A 6GSPA 3AHSA 4J5GA 1X1XA 2AADA 2AAEA 1YGWA 2HOHA 1I8VA 3A5EA 1RN1A 1RGKA 1GOUA 4BIRA 4HOHA 2GSPA 3DH2A 1MGWA 3D4AA 5BU4A 1BUJA 2F5WA 1B3SA 1DETA 1GSPA 1RGLA 6RNTA 1UCLA 1BNFA 1BRKA 1SARA 1TRQA 1UCIA 1RLSA 4HAAA 2ZA4A 1G02A 1FUTA 1BSBA 1HZ1A 3D5GA 1BSEA 1B2ZA 1ZGXA 1X1WA 1BRJA 3WR2A 1RN4A 1FZUA 1BVIA 1RNTA 1DE3A 1GOYA 1RGHA 1C54A 1MGRA 5HOHA 1I3FA 1B27A 4GHOA 1B2MA 1X1YA 1BRSA 1BGSA 2F5MA 1BIRA 1GMPA 1FUSA 1BNGA 1B2SA 1PY3A 1I2GA 3AGNA 1JBTA 1UCKA 2BIRA 1BNIA 3AGOA 1AY7A 1TRPA 2KAAA 5GSPA 1I0VA 1R4YA 1GMRA 1PYLA 7GSPA 1I2FA 1CH0A 1BAOA 3RNTA 1BNJA 1RGGA 1BRNL 4J5KA 1B20A 2F4YA 1B21A 8RNTA 1X1UA 1RHLA 1RGCA 1BNSA 1RTUA 1YVSA 3URPA 1UCJA 1BRGA 2RBIA 1Q9EA 1I0XA 1BRHA 1LOWA 2RNTA 1B2XA 4GSPA 1I3IA 1IYYA 3BIRA 3D5IA 1GMQA 1RSNA 3HOHA 1RNBA 5BIRA 1LRAA 1RMSA 1BANA 2SARA 3Q3FA 2C4BA 1BNEA 1FW7A 3AHWA 1RCKA 1AQZA 1JBSA 1I2EA 1BSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU4 A;  1RDS A;  2KF3 A;  1LOV A;  2BU4 A;  1HYF A;  1I70 A;  3WHO A;  2KF5 A;  1JBR A;  1FYS A;  1A2P A;  3KCH A;  3BU4 A;  4BU4 A;  2KF6 A;  2KF4 A;  1GOV A;  1RCL A;  1T2I A;  1RGF A;  4RNT A;  1TTO A;  1LNI A;  9RNT A;  1B2U A;  1BRI A;  1BNR A;  1BSC A;  1T2H A;  3GSP A;  1YNV X;  3SYU A;  7RNT A;  5RNT A;  1BOX A;  1RGA A;  1BSD A;  1RGE A;  1LOY A;  3DGY A;  2F56 A;  6GSP A;  3AHS A;  4J5G A;  1X1X A;  2AAD A;  2AAE A;  1YGW A;  2HOH A;  1I8V A;  3A5E A;  1RN1 A;  1RGK A;  1GOU A;  4BIR A;  4HOH A;  2GSP A;  3DH2 A;  1MGW A;  3D4A A;  5BU4 A;  1BUJ A;  2F5W A;  1B3S A;  1DET A;  1GSP A;  1RGL A;  6RNT A;  1UCL A;  1BNF A;  1BRK A;  1SAR A;  1TRQ A;  1UCI A;  1RLS A;  4HAA A;  2ZA4 A;  1G02 A;  1FUT A;  1BSB A;  1HZ1 A;  3D5G A;  1BSE A;  1B2Z A;  1ZGX A;  1X1W A;  1BRJ A;  3WR2 A;  1RN4 A;  1FZU A;  1BVI A;  1RNT A;  1DE3 A;  1GOY A;  1RGH A;  1C54 A;  1MGR A;  5HOH A;  1I3F A;  1B27 A;  4GHO A;  1B2M A;  1X1Y A;  1BRS A;  1BGS A;  2F5M A;  1BIR A;  1GMP A;  1FUS A;  1BNG A;  1B2S A;  1PY3 A;  1I2G A;  3AGN A;  1JBT A;  1UCK A;  2BIR A;  1BNI A;  3AGO A;  1AY7 A;  1TRP A;  2KAA A;  5GSP A;  1I0V A;  1R4Y A;  1GMR A;  1PYL A;  7GSP A;  1I2F A;  1CH0 A;  1BAO A;  3RNT A;  1BNJ A;  1RGG A;  1BRN L;  4J5K A;  1B20 A;  2F4Y A;  1B21 A;  8RNT A;  1X1U A;  1RHL A;  1RGC A;  1BNS A;  1RTU A;  1YVS A;  3URP A;  1UCJ A;  1BRG A;  2RBI A;  1Q9E A;  1I0X A;  1BRH A;  1LOW A;  2RNT A;  1B2X A;  4GSP A;  1I3I A;  1IYY A;  3BIR A;  3D5I A;  1GMQ A;  1RSN A;  3HOH A;  1RNB A;  5BIR A;  1LRA A;  1RMS A;  1BAN A;  2SAR A;  3Q3F A;  2C4B A;  1BNE A;  1FW7 A;  3AHW A;  1RCK A;  1AQZ A;  1JBS A;  1I2E A;  1BSA A; 
#chains in the Genus database with same CATH topology
 2RFR A;  1V74 A;  1NNV A;  1W6G A;  2XGL A;  3HK4 A;  1ISK A;  1D6U A;  2BU4 A;  1I70 A;  1ULJ B;  4XDW A;  1FYS A;  3KCH A;  4KZ1 A;  1OH0 A;  3F14 A;  4K1V A;  2KRT A;  2KF4 A;  1T2I A;  1RCL A;  2LQV A;  4LEH A;  2HMK B;  1Q86 4;  1LNI A;  1Q40 A;  3OWS A;  5CK6 A;  1B2U A;  2WGO A;  3WOD G;  3CCE 3;  3OV4 A;  1BSC A;  7RNT A;  5RNT A;  1JKG B;  2YFI B;  3TDG A;  1NJI 4;  1US1 A;  1Q82 4;  2F56 A;  6GSP A;  1VQO 3;  3D9R A;  3LT8 A;  1NB5 I;  3AHS A;  2OQE C;  2CFW A;  1RJO A;  2F99 A;  3S67 A;  4FCZ A;  3M8C A;  4CCV A;  1N5H A;  1SPU A;  2CC3 A;  1X1X A;  3UL5 A;  4LMI A;  2HMN B;  1EKM A;  1SQW A;  1YGW A;  3A5E A;  4AEQ A;  3F40 A;  4HKV B;  5EEO A;  1OPY A;  3AMO B;  2Q07 A;  3IMA B;  5BU4 A;  1FGT A;  5AYS C;  2CG0 A;  1TUH A;  2F5W A;  1GSP A;  1W2B 2;  2GU1 A;  3CNM A;  1BRK A;  3CNX A;  3GAX A;  1SAR A;  1G0T A;  1LNH A;  1TRQ A;  1JN5 A;  3B7C A;  1G02 A;  1HKX A;  2Z7A A;  2E2U A;  1FUT A;  1W6C A;  1BSB A;  1HZ1 A;  3SOA A;  3K0Z A;  3I55 3;  3D5G A;  4RZM A;  3UL6 A;  3ALA A;  4IT7 A;  5DRE A;  1ZGX A;  3ROB A;  1Q81 4;  1X1W A;  2IY2 A;  1JB4 A;  3JVC A;  5CLK A;  4NHF A;  1U8C B;  3GWR A;  1OAC A;  1K9M 4;  1DE3 A;  3CPO A;  2IUJ A;  2GEX A;  4EV2 A;  2B24 B;  1MGR A;  1OCV A;  4X2O A;  2H0I A;  3GRD A;  3LTD A;  5HOH A;  1VQM 3;  2L1S A;  3KZT A;  3ER7 A;  2W9Q A;  4WYK A;  4BTX A;  1SII A;  1N8Q A;  1VQL 3;  4LSO A;  1WMP A;  1JBT A;  1YVB I;  1W4N A;  2F98 A;  1IV7 A;  2IMJ A;  3HX8 A;  4N6U A;  1AV4 A;  1TRP A;  1PFP A;  4LYL B;  1SIH A;  4XDV A;  2K3D A;  2XSO B;  2HMO B;  1E3R A;  4XM4 A;  4IPB A;  1VQP 3;  5IG4 A;  1NU3 A;  1W5Z A;  1CEW I;  1RKY A;  1GMR A;  1OHP A;  2HMJ B;  1I2F A;  4CPK A;  3PYJ A;  3LTC A;  1BAO A;  4O3V A;  1TU5 A;  1VQQ A;  5I97 A;  5ELU A;  1BRN L;  3QRD A;  4ORL A;  3NX0 A;  1TP6 A;  2A15 A;  2CFD A;  3SOY A;  1B21 A;  1O7G B;  2CWT A;  1EA2 A;  4AKY A;  3FKA A;  4FMD A;  1JV2 B;  1IQ8 A;  1N9J A;  1BNS A;  1FGO A;  2FXT A;  2OOV C;  5EVH A;  3RDE A;  1UCJ A;  3WOF B;  1BRH A;  4HM3 B;  1LOW A;  4O8S A;  1B2X A;  1D6Z A;  5LC6 A;  1UGI A;  3LTA A;  3N9H A;  3PCR A;  7STD A;  1I3I A;  1D6Y A;  3BIR A;  1RSN A;  1A2K A;  1GD3 A;  1LRA A;  2ML6 A;  1BAN A;  3FF0 A;  5BXQ A;  3PS8 A;  4EBG A;  1N9E A;  2C11 A;  1FW7 A;  3G0K A;  1WTH A;  3AHW A;  4HYZ A;  3G71 3;  3CC2 3;  4CDL A;  3FF2 A;  2Y73 A;  2CWV A;  4EXR A;  4OK0 A;  2WOH A;  3KN4 A;  3U97 A;  3F9S A;  3NBR A;  1LQG C;  3G16 A;  5IEO A;  3D79 A;  1MWR A;  2KF3 A;  1LOV A;  5D81 A;  1HYF A;  1A2P A;  2HML B;  4KFF A;  4BU4 A;  2Y74 A;  2KF6 A;  3NHX A;  1OF5 B;  3OWU A;  2LYX A;  3B4O A;  3EQQ B;  5AIG A;  1VQ5 3;  2GEY A;  1JB2 A;  1RGF A;  2V1L A;  5AIF A;  9RNT A;  2OWP A;  4RBN A;  1M90 4;  1FUW A;  3GSP A;  4WHA A;  2INX A;  3SYU A;  3KII A;  2UGI A;  1YHQ 3;  1RGE A;  3DGO A;  5KP1 A;  1IK3 A;  1YJN 3;  3EF8 A;  2E2V A;  4HM5 B;  4N6M A;  3F7X A;  1QVF 2;  5CXO A;  1O7W B;  3BNB A;  2AAE A;  1IT8 A;  2XEP A;  2HMM B;  2FNQ A;  2ZHX B;  3IJE B;  3CD6 3;  4BIR A;  1RGK A;  3F8H A;  4HZB B;  4OUQ A;  3NBB A;  1PU4 A;  2CW9 A;  1LXE A;  1MWU A;  1KQS 2;  4CJN A;  1UI8 A;  3G4S 3;  1MGW A;  2BMR B;  3FG3 A;  4LGQ A;  4Q53 A;  3WA3 A;  1JNQ A;  2IUK A;  4HZ9 B;  2OTL 3;  1IVV A;  1BNF A;  1W6Y A;  1FA3 A;  5FW5 A;  3DZL A;  4HM4 B;  4BTY A;  6STD A;  1G96 A;  1YIJ 3;  4QWT A;  2E2T A;  1BSE A;  1RRH A;  1NDO B;  3V92 A;  4HVN A;  4H61 A;  1BRJ A;  3KSP A;  1IQX A;  3CCV 3;  1FGR A;  1FZU A;  2R41 A;  4R9L A;  1BVI A;  1M1K 4;  2P0X A;  1GYB A;  3LML A;  1RGH A;  1KSI A;  3JUP A;  1FGM A;  3STD A;  1LOX A;  3E99 A;  3UB1 A;  2BO9 B;  1B27 A;  3CC4 3;  4MMZ B;  1CYU A;  4GHO A;  4R1K A;  1UI7 A;  1X1Y A;  1BRS A;  3ZG5 A;  3DUK A;  4HM6 B;  4EV5 A;  2QIY A;  1M1X B;  1Q42 A;  3NV0 A;  1BNG A;  1UW1 A;  2KXG A;  3NQZ A;  2I9W A;  2W56 A;  1V58 A;  4FCM A;  4K61 A;  4KFE A;  1QAK A;  1VQ9 3;  3N54 B;  1YI2 3;  3N8B A;  1N8R 4;  2W6J H;  2O9U X;  1GS3 A;  2W0Q A;  3SED A;  2XF3 A;  2CG1 A;  3CMA 3;  3EBY A;  5IW9 A;  1IVW A;  1I0V A;  5GSP A;  1WQL B;  3J7Y d;  1Q40 B;  3SVA A;  1R4Y A;  2PNC A;  1PYL A;  2IYJ A;  7GSP A;  5AEU B;  1CH0 A;  1O7P B;  3RNT A;  1A90 A;  4KT3 B;  4BTW A;  5HGR A;  2BMQ B;  1RGG A;  3NM2 A;  4NPB A;  3VF1 A;  1W01 A;  1B20 A;  1DVD A;  4HJL B;  2D42 A;  4RNZ A;  1ROV A;  1X1U A;  3L0R A;  1RHL A;  3Q2P A;  3Q90 A;  5AII A;  2SBL A;  2YFJ B;  1W02 A;  2MF7 A;  2YX9 A;  1BRG A;  1OGZ A;  1VQ6 3;  3X3X A;  3BNC A;  4L8O A;  3V98 A;  3WOE B;  4GSP A;  2C10 A;  4LZI A;  2J8X B;  1MWS A;  4KFD A;  3WA2 X;  1Z1S A;  1RNB A;  1EG9 B;  4XBY A;  3Q3F A;  2BMO B;  2BNG A;  2QGU A;  2XR8 B;  1JN5 B;  4HM7 B;  1BNE A;  5D83 A;  3PCS A;  3S5C A;  1Y4K A;  1ZO2 A;  3WDG B;  3NUV A;  1K8A 4;  5FGO A;  4HM8 B;  1JZD A;  3ZFZ A;  1BUQ A;  3JUM A;  4R9K A;  1DMM A;  1TFO A;  2XRX B;  4BL2 A;  1BU4 A;  3CCR 3;  1GY5 A;  1NO3 A;  4EW5 A;  1STD A;  2CX0 A;  3PXM A;  3CCS 3;  2GBW B;  3BU4 A;  4L8P A;  1QVG 2;  3MKI A;  1NB3 I;  3LH4 A;  1GOV A;  5DRV A;  5IF6 A;  2W03 A;  1TTO A;  1QJG A;  1T2H A;  2JQ5 A;  3A76 A;  1K28 A;  1UUW B;  1BOX A;  4WYK B;  1LOY A;  1K41 A;  8CHO A;  1FGQ A;  2O3O A;  3NXJ A;  2CHC A;  4J5G A;  1HU9 A;  1W7C A;  4N6V 0;  2XGN A;  3OXA A;  2Z6B A;  1KWI A;  3BNE A;  3CU3 A;  3K5T A;  3LOY A;  3CCQ 3;  3MYT A;  3PGB A;  4NRE A;  5JBS A;  3FCS B;  1IV9 A;  5IG0 A;  1RN1 A;  1GOU A;  1U5O A;  5JPU A;  1JB5 A;  5JPP A;  3SXX A;  5M19 A;  3FGY A;  3UNL A;  2W2C A;  3CXC 2;  1N5P A;  1MWT A;  3FG4 A;  5AEW B;  1BUJ A;  3FZW A;  3BLZ A;  1DET A;  1ASK A;  1UCL A;  4GL6 A;  5LC7 A;  1UCI A;  2ZA4 A;  3S27 A;  3CPW 2;  4K1U A;  1J2B A;  5IEP A;  1WNH A;  3H3H A;  4WFO A;  3SX1 A;  1Q7H A;  1B2Z A;  3KKG A;  2BHM A;  2MC8 A;  4PEJ A;  3T8U A;  4GB5 A;  1RN4 A;  2OQE A;  3FH1 A;  3DM8 A;  1RNT A;  3KSE D;  3RGR A;  3ZG0 A;  3MG3 A;  3MHE A;  1GOY A;  2ZDJ A;  3LTB A;  1C54 A;  3GZY B;  4FMC A;  4JRF A;  2F86 B;  3BND A;  3LZA A;  3HIG A;  4O02 B;  5IER A;  4XB5 A;  1S5A A;  5G2G A;  1JKG A;  2JDI H;  1OHO A;  2CH9 A;  2F5M A;  3HZP A;  5KP4 A;  1VQN 3;  3LT9 A;  4FMB A;  1B2S A;  1ULI B;  1TFK A;  3K63 A;  4EYC A;  1AVL A;  1BNI A;  3B4P A;  3DGM A;  3GZX B;  1L5G B;  2D1W A;  2CWU A;  2QEX 3;  1O7H B;  3SLU A;  3EN8 A;  1CQS A;  1OHS A;  3G6E 3;  5IG5 A;  3CC7 3;  3DMC A;  1RN7 A;  1ROA A;  1QAL A;  5CF2 A;  3D3L A;  3AMO A;  3NQY A;  3RGA A;  2WOF A;  4MEI A;  5AI1 A;  3X42 A;  2CIU A;  3LXU X;  4OVM A;  5EQL A;  5CF1 A;  4WWU C;  1IT7 A;  3HII A;  1CYV A;  4RNY A;  1GY6 A;  1EUI C;  3I0Y A;  8RNT A;  4BL3 A;  3JUQ A;  2H0G A;  3JUO A;  1ZX2 A;  3O8Y A;  1RGC A;  4N3V A;  3DGN A;  5AIH A;  1YVS A;  3URP A;  1DVC A;  2H0H A;  3NBJ A;  1IQY A;  1WMN A;  5STD A;  3V99 A;  1YIT 3;  2QA4 3;  1STF I;  2W04 A;  3KE7 A;  1I0X A;  1VZZ A;  1V57 A;  2CFL A;  3BB9 A;  5BVB A;  2P05 A;  3UJM A;  4N6O B;  1A67 A;  2RGQ A;  4R4K A;  1TJD A;  1UGH I;  2ZL8 A;  3H51 A;  3HOH A;  1RMS A;  2R4I A;  5BIR A;  4XBX A;  4EC6 A;  2C4B A;  1WMO A;  1W00 A;  3Q1C A;  5TGN A;  3EB8 A;  3EE1 A;  1K73 4;  4R80 A;  4KVH A;  1DMN A;  4AKZ A;  1I2E A;  4HM1 B;  2XFS A;  1RDS A;  3B8L A;  2CFG A;  3EBT A;  3MSO A;  4FR9 A;  3U1W A;  3CCJ 3;  3CCM 3;  3X40 A;  5D82 A;  3WHO A;  2KF5 A;  2RSX A;  1VQ8 3;  1JBR A;  5M18 A;  1IDP A;  3DXO A;  2OOV A;  3HI7 A;  5KP3 A;  3DGL A;  4RNT A;  2PZV A;  2GBX B;  4HBR A;  3WMD A;  1BRI A;  1GY7 A;  1BNR A;  1YNV X;  3T0U A;  4H3U A;  2CX1 A;  1RGA A;  4N6T A;  1BSD A;  4TX4 A;  1M9G A;  3DGY A;  3NV0 B;  4ILF A;  5IEN A;  2W56 B;  2STD A;  4MJD A;  3T8N A;  2GXF A;  3NM7 A;  1F8N A;  5ELJ A;  1DYU A;  1IVU A;  2UX0 A;  3PZW A;  4DKI A;  2CFK A;  3MWZ A;  2AAD A;  2HOH A;  1I8V A;  1BSA A;  3ECF A;  1SJW A;  5A0O B;  4FCJ A;  5M1A A;  1GD4 A;  1YGE A;  4HOH A;  1OUN A;  2GSP A;  3DH2 A;  3FG1 A;  2GU3 A;  3K7C A;  4HM0 B;  1O7N B;  4G1M B;  3D4A A;  2BT3 A;  4U13 A;  1C7H A;  2P0M A;  2ML5 A;  3OX9 A;  1B3S A;  4IIA A;  1RGL A;  2Z76 A;  1O7M B;  6RNT A;  4I5Q A;  1OGX A;  1YJ9 3;  1KD1 4;  4HAA A;  1RLS A;  5IG3 A;  1E97 A;  4N6N B;  1LQM B;  2XH9 A;  4HM2 B;  1IU7 A;  3MPH A;  4X2H A;  1VQ7 3;  4I4K A;  1UUG B;  3WR2 A;  3X3Z A;  3K9M C;  2CK3 H;  3X3Y A;  1JRQ A;  2OTJ 3;  3EX9 A;  1S72 3;  3QK9 A;  1OF5 A;  2IA7 A;  1KC8 4;  1IVX A;  1T3B A;  1I3F A;  3DY5 A;  1Q7Y 4;  2OCT A;  1DMQ A;  2B1X B;  1RRL A;  2RCD A;  1B2M A;  2UUG C;  2KCD A;  5G1L A;  1BGS A;  1BIR A;  1GMP A;  1FUS A;  2K54 A;  4WP5 A;  1PY3 A;  1I2G A;  1TIJ A;  2M7O A;  3AGN A;  1UCK A;  4STD A;  2BIR A;  2FGT A;  4L7K A;  3VGN A;  3AGO A;  1AY7 A;  1JJ2 2;  1VQ4 3;  2KAA A;  3S28 A;  2WO0 A;  3OW2 2;  2W9P A;  2CKF B;  1YJW 3;  2XSH B;  2Z77 A;  4J8T A;  1MOL A;  1T5Y A;  1MNL A;  1R4C A;  3VSY A;  1QAF A;  3MG2 A;  1VQK 3;  3OWY A;  5G1K A;  1BNJ A;  3X41 A;  1QMA A;  4MMX B;  3KFQ C;  4J5K A;  3FSD A;  2F4Y A;  2YFL B;  1NWW A;  3EC9 A;  3GZR A;  3IPT A;  2L4V A;  4MMY B;  3EHC A;  4JF8 A;  3EJV A;  4ZM8 A;  1RTU A;  3I56 3;  1UDI I;  2WGQ A;  3CCU 3;  1EEJ A;  1Q9E A;  1AVK A;  2RBI A;  3F7S A;  1AR0 A;  1ZS7 A;  1E3V A;  2P09 A;  3JUN A;  3LYG A;  2RNT A;  3G8Z A;  3MG1 A;  4N6L A;  4O2H A;  4J9A A;  4FMA A;  3F8X A;  3S29 A;  1A2V A;  3CCL 3;  3FLJ A;  2P38 A;  1IYY A;  1EQK A;  3D5I A;  1GMQ A;  3EN1 B;  2SAR A;  3GZB A;  4K90 B;  2K0M A;  2XFT A;  3CME 3;  1W2Z A;  1UUV B;  5AYR B;  4XBT A;  1RCK A;  1AQZ A;  1LVN A;  1JBS A;  1JZO A; 
#chains in the Genus database with same CATH homology
 1BU4 A;  1RDS A;  2KF3 A;  1LOV A;  2BU4 A;  1HYF A;  1I70 A;  3WHO A;  2KF5 A;  1JBR A;  1FYS A;  1A2P A;  3KCH A;  3BU4 A;  4BU4 A;  2KF6 A;  2KF4 A;  1GOV A;  1RCL A;  1T2I A;  1RGF A;  4RNT A;  1TTO A;  1LNI A;  9RNT A;  1B2U A;  1BRI A;  1BNR A;  1BSC A;  1T2H A;  3GSP A;  1YNV X;  3SYU A;  7RNT A;  5RNT A;  1BOX A;  1RGA A;  1BSD A;  1RGE A;  1LOY A;  3DGY A;  2F56 A;  6GSP A;  3AHS A;  4J5G A;  1X1X A;  2AAD A;  2AAE A;  1YGW A;  2HOH A;  1I8V A;  3A5E A;  1RN1 A;  1RGK A;  1GOU A;  4BIR A;  4HOH A;  2GSP A;  3DH2 A;  1MGW A;  3D4A A;  5BU4 A;  1BUJ A;  2F5W A;  1B3S A;  1DET A;  1GSP A;  1RGL A;  6RNT A;  1UCL A;  1BNF A;  1BRK A;  1SAR A;  1TRQ A;  1UCI A;  1RLS A;  4HAA A;  2ZA4 A;  1G02 A;  1FUT A;  1BSB A;  1HZ1 A;  3D5G A;  1BSE A;  1B2Z A;  1ZGX A;  1X1W A;  1BRJ A;  3WR2 A;  1RN4 A;  1FZU A;  1BVI A;  1RNT A;  1DE3 A;  1GOY A;  1RGH A;  1C54 A;  1MGR A;  5HOH A;  1I3F A;  1B27 A;  4GHO A;  1B2M A;  1X1Y A;  1BRS A;  1BGS A;  2F5M A;  1BIR A;  1GMP A;  1FUS A;  1BNG A;  1B2S A;  1PY3 A;  1I2G A;  3AGN A;  1JBT A;  1UCK A;  2BIR A;  1BNI A;  3AGO A;  1AY7 A;  1TRP A;  2KAA A;  5GSP A;  1I0V A;  1R4Y A;  1GMR A;  1PYL A;  7GSP A;  1I2F A;  1CH0 A;  1BAO A;  3RNT A;  1BNJ A;  1RGG A;  1BRN L;  4J5K A;  1B20 A;  2F4Y A;  1B21 A;  8RNT A;  1X1U A;  1RHL A;  1RGC A;  1BNS A;  1RTU A;  1YVS A;  3URP A;  1UCJ A;  1BRG A;  2RBI A;  1Q9E A;  1I0X A;  1BRH A;  1LOW A;  2RNT A;  1B2X A;  4GSP A;  1I3I A;  1IYY A;  3BIR A;  3D5I A;  1GMQ A;  1RSN A;  3HOH A;  1RNB A;  5BIR A;  1LRA A;  1RMS A;  1BAN A;  2SAR A;  3Q3F A;  2C4B A;  1BNE A;  1FW7 A;  3AHW A;  1RCK A;  1AQZ A;  1JBS A;  1I2E A;  1BSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...