1C54A

Solution structure of ribonuclease sa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE SA
publication title Solution structure and dynamics of ribonuclease Sa.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 12
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1999-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1c54A00
1FYSA 1AY7A 4RNTA 4HAAA 2HOHA 7RNTA 1PY3A 1IYYA 1A2PA 9RNTA 5GSPA 1JBRA 3WHOA 2BU4A 1X1WA 1RCLA 4BU4A 1BRJA 1RGHA 1B2XA 1YNVX 3AHSA 3DGYA 1X1YA 3A5EA 4GHOA 1RSNA 1RCKA 1I0VA 1LOWA 1RGFA 1GOVA 5BIRA 1FW7A 1B27A 2SARA 1BNJA 1AQZA 1SARA 2KF6A 1RN4A 1FUSA 2F5WA 1R4YA 4J5KA 1UCJA 2AADA 1YVSA 1I8VA 5HOHA 1RDSA 2KF3A 1B3SA 1BIRA 1RGGA 1BRGA 1PYLA 1RGKA 1TTOA 8RNTA 1FUTA 1GSPA 1RLSA 1GMQA 7GSPA 1BNGA 1BRHA 1I70A 3BIRA 1LOYA 1GMRA 1BSBA 3RNTA 2BIRA 2KF4A 1BSDA 1I3FA 1X1UA 1BOXA 1LOVA 1TRPA 2RBIA 6GSPA 1B2MA 1DE3A 1RGAA 1B2SA 1BNIA 1I3IA 1JBSA 1X1XA 1MGRA 1RNTA 1BSEA 4BIRA 1BVIA 3AGNA 1RGEA 1TRQA 3URPA 1T2IA 2C4BA 1BU4A 3GSPA 1B2ZA 1YGWA 1RTUA 1RNBA 3D4AA 1I0XA 1G02A 1B2UA 1BRKA 3HOHA 2GSPA 1GOYA 1JBTA 2RNTA 1RGLA 1RMSA 1GOUA 4GSPA 3BU4A 6RNTA 1BGSA 3KCHA 2KAAA 1RN1A 1UCKA 3AGOA 1FZUA 1T2HA 1GMPA 3AHWA 1BANA 2F5MA 2AAEA 1RGCA 3D5GA 1BRIA 1B21A 1BUJA 1BNSA 4HOHA 3SYUA 1Q9EA 2KF5A 1HYFA 1C54A 1BSAA 5BU4A 1LRAA 1I2EA 3D5IA 1HZ1A 1BNRA 3Q3FA 1LNIA 1B20A 1DETA 1BSCA 1I2GA 5RNTA 3DH2A 1BRSA 1I2FA 2F56A 1MGWA 1CH0A 3WR2A 1BNFA 1BNEA 1RHLA 1ZGXA 1UCLA 2F4YA 2ZA4A 1BAOA 4J5GA 1BRNL 1UCIA
chains in the Genus database with same CATH superfamily
3CCU3 1FYSA 3JUPA 7RNTA 1PY3A 1ZO2A 2UX0A 2OOVC 1CEWI 2IUJA 1EQKA 3CCE3 3WHOA 4MJDA 8CHOA 4BL3A 3JUMA 4BU4A 3KSED 5CXOA 4N6LA 3NHXA 1YNVX 3AHSA 3DGYA 4R1KA 4R80A 1OPYA 1YVBI 5I97A 1KQS2 4HYZA 4GHOA 2CX0A 1DMMA 1RSNA 3EN8A 2W03A 4ORLA 3BLZA 5ELJA 1JZDA 1LOWA 2WO0A 3LH4A 1IT7A 3N8BA 3NM2A 4O3VA 1T3BA 1ISKA 1B27A 1OH0A 2HMOB 1JB5A 1SARA 4CDLA 3LTDA 1FUSA 5FGOA 1R4YA 3CNMA 1JRQA 4RZMA 2XGLA 3NBJA 4STDA 3B4PA 3IJEB 4KFDA 3H3HA 4LYLB 1PYLA 1RGKA 1LNHA 1N9EA 2RGQA 3FG3A 1W4NA 1FUTA 3V99A 1W2B2 4MEIA 1BUQA 2OWPA 3EF8A 3N54B 1GMQA 2GBWB 4GB5A 3H51A 4WP5A 2BMQB 1I70A 3OV4A 3FF0A 1LOYA 2BHMA 5LC7A 1NU3A 1GMRA 5STDA 3NV0B 3K0ZA 2BIRA 4XDVA 1BSDA 1IVVA 1I3FA 1IV9A 1EEJA 3WA3A 1X1UA 1YIJ3 1TUHA 1BOXA 3QK9A 3HX8A 2RCDA 2CW9A 2L1SA 1QJGA 1EA2A 1KSIA 2V1LA 2RBIA 3JVCA 4NREA 1B2MA 1GY6A 2CX1A 2CFWA 1W7CA 4BTWA 1RRLA 3WDGB 3IPTA 4RNZA 2XF3A 1MGRA 3LTAA 5IG4A 4BIRA 4L8OA 1SJWA 5AIHA 5IENA 3DXOA 2GBXB 5CLKA 3E99A 3U1WA 1UUVB 4MMXB 3FZWA 1VQO3 1AV4A 2A15A 3DY5A 1QMAA 2WGQA 2P05A 3D4AA 1G02A 4JRFA 3HOHA 3CCS3 1GOYA 1IQ8A 1RGLA 2Z6BA 1RMSA 2XR8B 1GOUA 5EVHA 2IA7A 5JBSA 2FXTA 2ML5A 3KSPA 4XB5A 3GAXA 3AGOA 3S29A 1FZUA 3DGNA 3QRDA 2XFTA 3DGOA 3LTCA 2L4VA 1RGCA 2OQEC 1BRIA 2H0HA 1W02A 1VQ93 1O7HB 4O8SA 3CCJ3 1DVDA 1KC84 2KF5A 1HYFA 5G2GA 4AKYA 2R41A 1FGQA 1YI23 1I2EA 1VQ43 3D5IA 3DZLA 1E97A 3FF2A 3GZXB 1BNRA 4IT7A 3Q3FA 3FLJA 4TX4A 1B20A 4XDWA 1I2GA 4CCVA 3UB1A 1BRSA 3CC23 1JB4A 3WR2A 2B24B 4FCJA 1LQMB 4HBRA 1ZGXA 5KP1A 1VQ53 1KWIA 2C11A 3J7Yd 1MOLA 5KP4A 2O9UX 5IERA 3G6E3 1JNQA 3S28A 1IYYA 2O3OA 4RNTA 3K9MC 2HOHA 4MMZB 5D83A 2Q07A 2W9QA 1M9GA 4HM0B 4ILFA 1Q40A 5CK6A 5GSPA 1NB5I 2Y74A 4K61A 1RCLA 4I5QA 1BRJA 1E3RA 1RGHA 3CXC2 4N3VA 3BB9A 1ZX2A 4H3UA 4FMDA 1W5ZA 3HZPA 3I0YA 1JKGB 1UI8A 1RGFA 1VZZA 4N6V0 2MC8A 1NNVA 1AVLA 1A90A 1UI7A 1AQZA 1BNJA 2KF6A 1FA3A 1ULIB 2BT3A 3SEDA 3AMOA 3VF1A 1YHQ3 2AADA 2P0XA 5CF1A 4J8TA 4HM1B 3CC43 1RDSA 3OX9A 3NQZA 4HM2B 3SOYA 1RGGA 4KZ1A 2P0MA 1OUNA 2XGNA 4LZIA 3ALAA 2PNCA 1RLSA 3NQYA 1F8NA 4MMYB 1ROAA 1TFOA 3JUOA 7GSPA 1BNGA 2HMNB 3K63A 3UL6A 1MWUA 4QWTA 2F86B 3AMOB 2I9WA 1BSBA 3RGRA 2BO9B 1VQN3 5IG5A 2KF4A 3BNEA 1EKMA 1K28A 2F98A 4KFFA 5IF6A 4IPBA 1RRHA 2BMOB 5D81A 2WOHA 3PZWA 3GRDA 3OW22 1W00A 4BTXA 4WFOA 1JN5B 1RKYA 2IYJA 1GY5A 1B2SA 1Q7Y4 3NV0A 4LGQA 1RNTA 3X3YA 5JPUA 3ZFZA 3RDEA 3A76A 3AGNA 5M19A 2E2TA 4HZBB 1RJOA 1NWWA 3Q1CA 4HZ9B 3EHCA 1O7PB 1WQLB 1BU4A 1ULJB 2K0MA 4OK0A 1RTUA 1KD14 1RNBA 1I0XA 1UDII 3KN4A 1BRKA 2GSPA 5EQLA 3MG3A 1HKXA 1YIT3 2W2CA 4EC6A 2ZDJA 3G713 2JQ5A 4XBYA 1CYUA 4WWUC 3MG2A 3T8NA 4KFEA 1RN1A 4NHFA 1CQSA 2HMMB 1T2HA 3B4OA 3LT9A 2LQVA 2F5MA 1YJW3 1US1A 5DREA 3EC9A 5M1AA 1HU9A 1LOXA 1BNSA 5DRVA 4HOHA 5AYSC 5BU4A 3GZRA 2OTL3 2GU1A 3MSOA 4KVHA 4FR9A 3I563 1Q42A 4EW5A 1JB2A 1LNIA 1DETA 1D6YA 5BVBA 2ZL8A 4IIAA 5RNTA 4BL2A 4R9LA 1I2FA 2CFLA 2F56A 2K54A 3FKAA 3SLUA 1VQ83 1MGWA 1CH0A 3PXMA 1IQXA 3F9SA 3I553 1NO3A 2BNGA 3TDGA 3BNBA 1R4CA 4N6TA 4AEQA 1IVXA 1UGIA 2IUKA 4AKZA 1BRNL 4FMBA 1DMQA 4R9KA 6STDA 1VQP3 1UCIA 1DVCA 4EYCA 1W2ZA 3IMAB 1AY7A 1TIJA 3G8ZA 4HAAA 5IW9A 1O7WB 1W6YA 9RNTA 3F14A 5AI1A 2BU4A 3GZYB 4K1UA 2M7OA 3ROBA 3SX1A 1Q864 3DMCA 3O8YA 3S5CA 1N8QA 2B1XB 1T5YA 3NXJA 4EXRA 1X1YA 1N5HA 1FGRA 3LXUX 1AR0A 3WMDA 1N5PA 4OUQA 1GYBA 1I0VA 2CWVA 3EE1A 4FCZA 3CCL3 1FW7A 1OACA 3UJMA 3MG1A 3G16A 3D3LA 1TFKA 1O7NB 2J8XB 4JF8A 4N6OB 2F5WA 2XEPA 3DGLA 4J5KA 1O7MB 1D6UA 2Z77A 3D9RA 1AVKA 3EQQB 1FGTA 4KT3B 3CCM3 1YVSA 3OXAA 1I8VA 3EB8A 5AIIA 2KF3A 1JKGA 1BRGA 2CFGA 3CME3 1LQGC 1TP6A 3VSYA 3D79A 5AEWB 4HKVB 3KE7A 2OQEA 2CHCA 1VQL3 2KCDA 2CK3H 4R4KA 2E2UA 2YFIB 2XSOB 4LMIA 2MF7A 1GD4A 3BIRA 5D82A 2FGTA 1K9M4 2W6JH 3B8LA 4Q53A 1YGEA 3K5TA 1LOVA 3GWRA 1U8CB 3DM8A 4N6MA 1A67A 5IEPA 2CIUA 4HM5B 3CNXA 3EX9A 3LTBA 3ZG5A 1RGAA 2C10A 2JDIH 1NDOB 1BNIA 1PFPA 1I3IA 2OCTA 2P38A 4J9AA 4EV5A 4HM7B 1OHSA 2FNQA 7STDA 1JBSA 1OGXA 1BSEA 1G0TA 1QVG2 3JUNA 1CYVA 3CCV3 2R4IA 2XH9A 3MPHA 1BVIA 3X40A 4HM6B 3U97A 3KKGA 1T2IA 3PGBA 1IT8A 1VQQA 1JN5A 2C4BA 3BNCA 3M8CA 3GSPA 1B2ZA 4H61A 4K90B 3V92A 1NJI4 3EJVA 3N9HA 1FGMA 4WYKA 5ELUA 4BTYA 1PU4A 1VQK3 1B2UA 5M18A 2W56B 3LOYA 3VGNA 1DMNA 1IU7A 2UUGC 2RNTA 3OWSA 4GSPA 1L5GB 2IMJA 4FMAA 2E2VA 1QALA 1NB3I 3BU4A 6RNTA 4FCMA 3KCHA 1N9JA 3CMA3 2ZHXB 4K1VA 5KP3A 3LT8A 2CFKA 3MWZA 1GMPA 1YJN3 2SBLA 1BANA 3AHWA 1IQYA 4WYKB 2CWUA 3X42A 3D5GA 1YJ93 3JUQA 1B21A 1BUJA 1IK3A 4X2HA 1W6CA 4OVMA 3SYUA 4ZM8A 4PEJA 4O02B 2BMRB 1HZ1A 1SIIA 3SVAA 4G1MB 5AYRB 1MWTA 1EUIC 4I4KA 3MYTA 3LZAA 2IY2A 3LYGA 4XBXA 2OOVA 3DH2A 2OTJ3 1SQWA 5IG0A 1JZOA 3KZTA 2H0IA 1C7HA 1DYUA 2GXFA 1Q7HA 1GD3A 3HIIA 3NBRA 1IV7A 1UW1A 4WHAA 1WMPA 3SOAA 5HGRA 1J2BA 2WGOA 3PCSA 3FG4A 3MHEA 3WOFB 1OGZA 1STDA 1VQ73 1Y4KA 4N6NB 1A2PA 2Z76A 3G0KA 3CCQ3 2W04A 1JBRA 1A2KA 3K7CA 2W9PA 1X1WA 3WODG 4RNYA 3WA2X 1B2XA 1LVNA 1V57A 1O7GB 1MNLA 1SIHA 2W0QA 3KIIA 3G4S3 2YFLB 4HM3B 3A5EA 1OHPA 1QAKA 1FGOA 1QAFA 2D42A 2GU3A 1RCKA 2PZVA 3ER7A 5BIRA 1GOVA 3NUVA 2ML6A 4EV2A 4GL6A 2WOFA 3Q90A 2SARA 3CU3A 5EEOA 1N8R4 3EBTA 5CF2A 1RN4A 1UUWB 3NM7A 3FH1A 1D6ZA 1IVWA 3T0UA 1ZS7A 1UCJA 1MWSA 4U13A 2QEX3 3BNDA 1JJ22 5HOHA 1LXEA 3V98A 1B3SA 1BIRA 3UL5A 1TTOA 1OHOA 8RNTA 1OCVA 4LSOA 5AIGA 3FGYA 3FCSB 1GSPA 2CH9A 3KFQC 1WMNA 2KXGA 1K41A 1Z1SA 1M904 1V58A 3F8HA 1BRHA 3F8XA 1W01A 2QA43 1K734 1OF5A 3X3ZA 5BXQA 3X41A 3RNTA 3X3XA 3S27A 3DGMA 4HVNA 1RN7A 1M1K4 4HM8B 1TRPA 4N6UA 3F40A 2HMJB 3PCRA 3ZG0A 6GSPA 3CC73 1STFI 3HIGA 1SPUA 1TJDA 2RSXA 4FMCA 4HM4B 5LC6A 5JPPA 1K8A4 1VQ63 1DE3A 2Z7AA 2Y73A 1UGHI 1X1XA 1V74A 1M1XB 1Q814 1OF5B 1EG9B 1W6GA 1IDPA 1G96A 3F7XA 3Q2PA 5IEOA 3SXXA 1RGEA 1TRQA 1JV2B 3URPA 4RBNA 3HI7A 1QVF2 5G1KA 3CPOA 5A0OB 1TU5A 1YGWA 5FW5A 2CFDA 4CPKA 1MWRA 3T8UA 1U5OA 2XRXB 3MKIA 4L7KA 4EBGA 2KRTA 3NX0A 3GZBA 1JBTA 2CG0A 3RGAA 4NPBA 4O2HA 5AIFA 2XSHB 2YX9A 3WOEB 3F7SA 1BGSA 2XFSA 2GEXA 2KAAA 3ECFA 3FG1A 1UCKA 3EBYA 4LEHA 2YFJB 3LMLA 3OWYA 2AAEA 2LYXA 2W56A 2CWTA 2P09A 5AEUB 5IG3A 3OWUA 3CPW2 1S723 3UNLA 2F99A 1FUWA 2H0GA 2STDA 4DKIA 1ROVA 2HMLB 1Q9EA 1C54A 3CD63 1BSAA 1WNHA 1LRAA 3PYJA 3CCR3 1WTHA 2INXA 3FSDA 1GS3A 3PS8A 4X2OA 5TGNA 1BSCA 5G1LA 2QIYA 2GEYA 4HJLB 1IVUA 1A2VA 4L8PA 3STDA 3EN1B 1BNFA 1E3VA 2HMKB 2UGIA 4XM4A 3NBBA 4CJNA 3S67A 1GY7A 1BNEA 1Q40B 1RHLA 1ASKA 4XBTA 2D1WA 2CKFB 3L0RA 1UCLA 3DUKA 2QGUA 2RFRA 3B7CA 3HK4A 2F4YA 2ZA4A 1BAOA 4J5GA 2CG1A 1UUGB 1Q824 1S5AA 1WMOA 2CC3A 1VQM3 2K3DA
chains in the Genus database with same CATH topology
1FYSA 1AY7A 4RNTA 4HAAA 2HOHA 7RNTA 1PY3A 1IYYA 1A2PA 9RNTA 5GSPA 1JBRA 3WHOA 2BU4A 1X1WA 1RCLA 4BU4A 1BRJA 1RGHA 1B2XA 1YNVX 3AHSA 3DGYA 1X1YA 3A5EA 4GHOA 1RSNA 1RCKA 1I0VA 1LOWA 1RGFA 1GOVA 5BIRA 1FW7A 1B27A 2SARA 1BNJA 1AQZA 1SARA 2KF6A 1RN4A 1FUSA 2F5WA 1R4YA 4J5KA 1UCJA 2AADA 1YVSA 1I8VA 5HOHA 1RDSA 2KF3A 1B3SA 1BIRA 1RGGA 1BRGA 1PYLA 1RGKA 1TTOA 8RNTA 1FUTA 1GSPA 1RLSA 1GMQA 7GSPA 1BNGA 1BRHA 1I70A 3BIRA 1LOYA 1GMRA 1BSBA 3RNTA 2BIRA 2KF4A 1BSDA 1I3FA 1X1UA 1BOXA 1LOVA 1TRPA 2RBIA 6GSPA 1B2MA 1DE3A 1RGAA 1B2SA 1BNIA 1I3IA 1JBSA 1X1XA 1MGRA 1RNTA 1BSEA 4BIRA 1BVIA 3AGNA 1RGEA 1TRQA 3URPA 1T2IA 2C4BA 1BU4A 3GSPA 1B2ZA 1YGWA 1RTUA 1RNBA 3D4AA 1I0XA 1G02A 1B2UA 1BRKA 3HOHA 2GSPA 1GOYA 1JBTA 2RNTA 1RGLA 1RMSA 1GOUA 4GSPA 3BU4A 6RNTA 1BGSA 3KCHA 2KAAA 1RN1A 1UCKA 3AGOA 1FZUA 1T2HA 1GMPA 3AHWA 1BANA 2F5MA 2AAEA 1RGCA 3D5GA 1BRIA 1B21A 1BUJA 1BNSA 4HOHA 3SYUA 1Q9EA 2KF5A 1HYFA 1C54A 1BSAA 5BU4A 1LRAA 1I2EA 3D5IA 1HZ1A 1BNRA 3Q3FA 1LNIA 1B20A 1DETA 1BSCA 1I2GA 5RNTA 3DH2A 1BRSA 1I2FA 2F56A 1MGWA 1CH0A 3WR2A 1BNFA 1BNEA 1RHLA 1ZGXA 1UCLA 2F4YA 2ZA4A 1BAOA 4J5GA 1BRNL 1UCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYS A;  1AY7 A;  4RNT A;  4HAA A;  2HOH A;  7RNT A;  1PY3 A;  1IYY A;  1A2P A;  9RNT A;  5GSP A;  1JBR A;  3WHO A;  2BU4 A;  1X1W A;  1RCL A;  4BU4 A;  1BRJ A;  1RGH A;  1B2X A;  1YNV X;  3AHS A;  3DGY A;  1X1Y A;  3A5E A;  4GHO A;  1RSN A;  1RCK A;  1I0V A;  1LOW A;  1RGF A;  1GOV A;  5BIR A;  1FW7 A;  1B27 A;  2SAR A;  1BNJ A;  1AQZ A;  1SAR A;  2KF6 A;  1RN4 A;  1FUS A;  2F5W A;  1R4Y A;  4J5K A;  1UCJ A;  2AAD A;  1YVS A;  1I8V A;  5HOH A;  1RDS A;  2KF3 A;  1B3S A;  1BIR A;  1RGG A;  1BRG A;  1PYL A;  1RGK A;  1TTO A;  8RNT A;  1FUT A;  1GSP A;  1RLS A;  1GMQ A;  7GSP A;  1BNG A;  1BRH A;  1I70 A;  3BIR A;  1LOY A;  1GMR A;  1BSB A;  3RNT A;  2BIR A;  2KF4 A;  1BSD A;  1I3F A;  1X1U A;  1BOX A;  1LOV A;  1TRP A;  2RBI A;  6GSP A;  1B2M A;  1DE3 A;  1RGA A;  1B2S A;  1BNI A;  1I3I A;  1JBS A;  1X1X A;  1MGR A;  1RNT A;  1BSE A;  4BIR A;  1BVI A;  3AGN A;  1RGE A;  1TRQ A;  3URP A;  1T2I A;  2C4B A;  1BU4 A;  3GSP A;  1B2Z A;  1YGW A;  1RTU A;  1RNB A;  3D4A A;  1I0X A;  1G02 A;  1B2U A;  1BRK A;  3HOH A;  2GSP A;  1GOY A;  1JBT A;  2RNT A;  1RGL A;  1RMS A;  1GOU A;  4GSP A;  3BU4 A;  6RNT A;  1BGS A;  3KCH A;  2KAA A;  1RN1 A;  1UCK A;  3AGO A;  1FZU A;  1T2H A;  1GMP A;  3AHW A;  1BAN A;  2F5M A;  2AAE A;  1RGC A;  3D5G A;  1BRI A;  1B21 A;  1BUJ A;  1BNS A;  4HOH A;  3SYU A;  1Q9E A;  2KF5 A;  1HYF A;  1C54 A;  1BSA A;  5BU4 A;  1LRA A;  1I2E A;  3D5I A;  1HZ1 A;  1BNR A;  3Q3F A;  1LNI A;  1B20 A;  1DET A;  1BSC A;  1I2G A;  5RNT A;  3DH2 A;  1BRS A;  1I2F A;  2F56 A;  1MGW A;  1CH0 A;  3WR2 A;  1BNF A;  1BNE A;  1RHL A;  1ZGX A;  1UCL A;  2F4Y A;  2ZA4 A;  1BAO A;  4J5G A;  1BRN L;  1UCI A; 
#chains in the Genus database with same CATH topology
 3CCU 3;  1FYS A;  3JUP A;  7RNT A;  1PY3 A;  1ZO2 A;  2UX0 A;  2OOV C;  1CEW I;  2IUJ A;  1EQK A;  3CCE 3;  3WHO A;  4MJD A;  8CHO A;  4BL3 A;  3JUM A;  4BU4 A;  3KSE D;  5CXO A;  4N6L A;  3NHX A;  1YNV X;  3AHS A;  3DGY A;  4R1K A;  4R80 A;  1OPY A;  1YVB I;  5I97 A;  1KQS 2;  4HYZ A;  4GHO A;  2CX0 A;  1DMM A;  1RSN A;  3EN8 A;  2W03 A;  4ORL A;  3BLZ A;  5ELJ A;  1JZD A;  1LOW A;  2WO0 A;  3LH4 A;  1IT7 A;  3N8B A;  3NM2 A;  4O3V A;  1T3B A;  1ISK A;  1B27 A;  1OH0 A;  2HMO B;  1JB5 A;  1SAR A;  4CDL A;  3LTD A;  1FUS A;  5FGO A;  1R4Y A;  3CNM A;  1JRQ A;  4RZM A;  2XGL A;  3NBJ A;  4STD A;  3B4P A;  3IJE B;  4KFD A;  3H3H A;  4LYL B;  1PYL A;  1RGK A;  1LNH A;  1N9E A;  2RGQ A;  3FG3 A;  1W4N A;  1FUT A;  3V99 A;  1W2B 2;  4MEI A;  1BUQ A;  2OWP A;  3EF8 A;  3N54 B;  1GMQ A;  2GBW B;  4GB5 A;  3H51 A;  4WP5 A;  2BMQ B;  1I70 A;  3OV4 A;  3FF0 A;  1LOY A;  2BHM A;  5LC7 A;  1NU3 A;  1GMR A;  5STD A;  3NV0 B;  3K0Z A;  2BIR A;  4XDV A;  1BSD A;  1IVV A;  1I3F A;  1IV9 A;  1EEJ A;  3WA3 A;  1X1U A;  1YIJ 3;  1TUH A;  1BOX A;  3QK9 A;  3HX8 A;  2RCD A;  2CW9 A;  2L1S A;  1QJG A;  1EA2 A;  1KSI A;  2V1L A;  2RBI A;  3JVC A;  4NRE A;  1B2M A;  1GY6 A;  2CX1 A;  2CFW A;  1W7C A;  4BTW A;  1RRL A;  3WDG B;  3IPT A;  4RNZ A;  2XF3 A;  1MGR A;  3LTA A;  5IG4 A;  4BIR A;  4L8O A;  1SJW A;  5AIH A;  5IEN A;  3DXO A;  2GBX B;  5CLK A;  3E99 A;  3U1W A;  1UUV B;  4MMX B;  3FZW A;  1VQO 3;  1AV4 A;  2A15 A;  3DY5 A;  1QMA A;  2WGQ A;  2P05 A;  3D4A A;  1G02 A;  4JRF A;  3HOH A;  3CCS 3;  1GOY A;  1IQ8 A;  1RGL A;  2Z6B A;  1RMS A;  2XR8 B;  1GOU A;  5EVH A;  2IA7 A;  5JBS A;  2FXT A;  2ML5 A;  3KSP A;  4XB5 A;  3GAX A;  3AGO A;  3S29 A;  1FZU A;  3DGN A;  3QRD A;  2XFT A;  3DGO A;  3LTC A;  2L4V A;  1RGC A;  2OQE C;  1BRI A;  2H0H A;  1W02 A;  1VQ9 3;  1O7H B;  4O8S A;  3CCJ 3;  1DVD A;  1KC8 4;  2KF5 A;  1HYF A;  5G2G A;  4AKY A;  2R41 A;  1FGQ A;  1YI2 3;  1I2E A;  1VQ4 3;  3D5I A;  3DZL A;  1E97 A;  3FF2 A;  3GZX B;  1BNR A;  4IT7 A;  3Q3F A;  3FLJ A;  4TX4 A;  1B20 A;  4XDW A;  1I2G A;  4CCV A;  3UB1 A;  1BRS A;  3CC2 3;  1JB4 A;  3WR2 A;  2B24 B;  4FCJ A;  1LQM B;  4HBR A;  1ZGX A;  5KP1 A;  1VQ5 3;  1KWI A;  2C11 A;  3J7Y d;  1MOL A;  5KP4 A;  2O9U X;  5IER A;  3G6E 3;  1JNQ A;  3S28 A;  1IYY A;  2O3O A;  4RNT A;  3K9M C;  2HOH A;  4MMZ B;  5D83 A;  2Q07 A;  2W9Q A;  1M9G A;  4HM0 B;  4ILF A;  1Q40 A;  5CK6 A;  5GSP A;  1NB5 I;  2Y74 A;  4K61 A;  1RCL A;  4I5Q A;  1BRJ A;  1E3R A;  1RGH A;  3CXC 2;  4N3V A;  3BB9 A;  1ZX2 A;  4H3U A;  4FMD A;  1W5Z A;  3HZP A;  3I0Y A;  1JKG B;  1UI8 A;  1RGF A;  1VZZ A;  4N6V 0;  2MC8 A;  1NNV A;  1AVL A;  1A90 A;  1UI7 A;  1AQZ A;  1BNJ A;  2KF6 A;  1FA3 A;  1ULI B;  2BT3 A;  3SED A;  3AMO A;  3VF1 A;  1YHQ 3;  2AAD A;  2P0X A;  5CF1 A;  4J8T A;  4HM1 B;  3CC4 3;  1RDS A;  3OX9 A;  3NQZ A;  4HM2 B;  3SOY A;  1RGG A;  4KZ1 A;  2P0M A;  1OUN A;  2XGN A;  4LZI A;  3ALA A;  2PNC A;  1RLS A;  3NQY A;  1F8N A;  4MMY B;  1ROA A;  1TFO A;  3JUO A;  7GSP A;  1BNG A;  2HMN B;  3K63 A;  3UL6 A;  1MWU A;  4QWT A;  2F86 B;  3AMO B;  2I9W A;  1BSB A;  3RGR A;  2BO9 B;  1VQN 3;  5IG5 A;  2KF4 A;  3BNE A;  1EKM A;  1K28 A;  2F98 A;  4KFF A;  5IF6 A;  4IPB A;  1RRH A;  2BMO B;  5D81 A;  2WOH A;  3PZW A;  3GRD A;  3OW2 2;  1W00 A;  4BTX A;  4WFO A;  1JN5 B;  1RKY A;  2IYJ A;  1GY5 A;  1B2S A;  1Q7Y 4;  3NV0 A;  4LGQ A;  1RNT A;  3X3Y A;  5JPU A;  3ZFZ A;  3RDE A;  3A76 A;  3AGN A;  5M19 A;  2E2T A;  4HZB B;  1RJO A;  1NWW A;  3Q1C A;  4HZ9 B;  3EHC A;  1O7P B;  1WQL B;  1BU4 A;  1ULJ B;  2K0M A;  4OK0 A;  1RTU A;  1KD1 4;  1RNB A;  1I0X A;  1UDI I;  3KN4 A;  1BRK A;  2GSP A;  5EQL A;  3MG3 A;  1HKX A;  1YIT 3;  2W2C A;  4EC6 A;  2ZDJ A;  3G71 3;  2JQ5 A;  4XBY A;  1CYU A;  4WWU C;  3MG2 A;  3T8N A;  4KFE A;  1RN1 A;  4NHF A;  1CQS A;  2HMM B;  1T2H A;  3B4O A;  3LT9 A;  2LQV A;  2F5M A;  1YJW 3;  1US1 A;  5DRE A;  3EC9 A;  5M1A A;  1HU9 A;  1LOX A;  1BNS A;  5DRV A;  4HOH A;  5AYS C;  5BU4 A;  3GZR A;  2OTL 3;  2GU1 A;  3MSO A;  4KVH A;  4FR9 A;  3I56 3;  1Q42 A;  4EW5 A;  1JB2 A;  1LNI A;  1DET A;  1D6Y A;  5BVB A;  2ZL8 A;  4IIA A;  5RNT A;  4BL2 A;  4R9L A;  1I2F A;  2CFL A;  2F56 A;  2K54 A;  3FKA A;  3SLU A;  1VQ8 3;  1MGW A;  1CH0 A;  3PXM A;  1IQX A;  3F9S A;  3I55 3;  1NO3 A;  2BNG A;  3TDG A;  3BNB A;  1R4C A;  4N6T A;  4AEQ A;  1IVX A;  1UGI A;  2IUK A;  4AKZ A;  1BRN L;  4FMB A;  1DMQ A;  4R9K A;  6STD A;  1VQP 3;  1UCI A;  1DVC A;  4EYC A;  1W2Z A;  3IMA B;  1AY7 A;  1TIJ A;  3G8Z A;  4HAA A;  5IW9 A;  1O7W B;  1W6Y A;  9RNT A;  3F14 A;  5AI1 A;  2BU4 A;  3GZY B;  4K1U A;  2M7O A;  3ROB A;  3SX1 A;  1Q86 4;  3DMC A;  3O8Y A;  3S5C A;  1N8Q A;  2B1X B;  1T5Y A;  3NXJ A;  4EXR A;  1X1Y A;  1N5H A;  1FGR A;  3LXU X;  1AR0 A;  3WMD A;  1N5P A;  4OUQ A;  1GYB A;  1I0V A;  2CWV A;  3EE1 A;  4FCZ A;  3CCL 3;  1FW7 A;  1OAC A;  3UJM A;  3MG1 A;  3G16 A;  3D3L A;  1TFK A;  1O7N B;  2J8X B;  4JF8 A;  4N6O B;  2F5W A;  2XEP A;  3DGL A;  4J5K A;  1O7M B;  1D6U A;  2Z77 A;  3D9R A;  1AVK A;  3EQQ B;  1FGT A;  4KT3 B;  3CCM 3;  1YVS A;  3OXA A;  1I8V A;  3EB8 A;  5AII A;  2KF3 A;  1JKG A;  1BRG A;  2CFG A;  3CME 3;  1LQG C;  1TP6 A;  3VSY A;  3D79 A;  5AEW B;  4HKV B;  3KE7 A;  2OQE A;  2CHC A;  1VQL 3;  2KCD A;  2CK3 H;  4R4K A;  2E2U A;  2YFI B;  2XSO B;  4LMI A;  2MF7 A;  1GD4 A;  3BIR A;  5D82 A;  2FGT A;  1K9M 4;  2W6J H;  3B8L A;  4Q53 A;  1YGE A;  3K5T A;  1LOV A;  3GWR A;  1U8C B;  3DM8 A;  4N6M A;  1A67 A;  5IEP A;  2CIU A;  4HM5 B;  3CNX A;  3EX9 A;  3LTB A;  3ZG5 A;  1RGA A;  2C10 A;  2JDI H;  1NDO B;  1BNI A;  1PFP A;  1I3I A;  2OCT A;  2P38 A;  4J9A A;  4EV5 A;  4HM7 B;  1OHS A;  2FNQ A;  7STD A;  1JBS A;  1OGX A;  1BSE A;  1G0T A;  1QVG 2;  3JUN A;  1CYV A;  3CCV 3;  2R4I A;  2XH9 A;  3MPH A;  1BVI A;  3X40 A;  4HM6 B;  3U97 A;  3KKG A;  1T2I A;  3PGB A;  1IT8 A;  1VQQ A;  1JN5 A;  2C4B A;  3BNC A;  3M8C A;  3GSP A;  1B2Z A;  4H61 A;  4K90 B;  3V92 A;  1NJI 4;  3EJV A;  3N9H A;  1FGM A;  4WYK A;  5ELU A;  4BTY A;  1PU4 A;  1VQK 3;  1B2U A;  5M18 A;  2W56 B;  3LOY A;  3VGN A;  1DMN A;  1IU7 A;  2UUG C;  2RNT A;  3OWS A;  4GSP A;  1L5G B;  2IMJ A;  4FMA A;  2E2V A;  1QAL A;  1NB3 I;  3BU4 A;  6RNT A;  4FCM A;  3KCH A;  1N9J A;  3CMA 3;  2ZHX B;  4K1V A;  5KP3 A;  3LT8 A;  2CFK A;  3MWZ A;  1GMP A;  1YJN 3;  2SBL A;  1BAN A;  3AHW A;  1IQY A;  4WYK B;  2CWU A;  3X42 A;  3D5G A;  1YJ9 3;  3JUQ A;  1B21 A;  1BUJ A;  1IK3 A;  4X2H A;  1W6C A;  4OVM A;  3SYU A;  4ZM8 A;  4PEJ A;  4O02 B;  2BMR B;  1HZ1 A;  1SII A;  3SVA A;  4G1M B;  5AYR B;  1MWT A;  1EUI C;  4I4K A;  3MYT A;  3LZA A;  2IY2 A;  3LYG A;  4XBX A;  2OOV A;  3DH2 A;  2OTJ 3;  1SQW A;  5IG0 A;  1JZO A;  3KZT A;  2H0I A;  1C7H A;  1DYU A;  2GXF A;  1Q7H A;  1GD3 A;  3HII A;  3NBR A;  1IV7 A;  1UW1 A;  4WHA A;  1WMP A;  3SOA A;  5HGR A;  1J2B A;  2WGO A;  3PCS A;  3FG4 A;  3MHE A;  3WOF B;  1OGZ A;  1STD A;  1VQ7 3;  1Y4K A;  4N6N B;  1A2P A;  2Z76 A;  3G0K A;  3CCQ 3;  2W04 A;  1JBR A;  1A2K A;  3K7C A;  2W9P A;  1X1W A;  3WOD G;  4RNY A;  3WA2 X;  1B2X A;  1LVN A;  1V57 A;  1O7G B;  1MNL A;  1SIH A;  2W0Q A;  3KII A;  3G4S 3;  2YFL B;  4HM3 B;  3A5E A;  1OHP A;  1QAK A;  1FGO A;  1QAF A;  2D42 A;  2GU3 A;  1RCK A;  2PZV A;  3ER7 A;  5BIR A;  1GOV A;  3NUV A;  2ML6 A;  4EV2 A;  4GL6 A;  2WOF A;  3Q90 A;  2SAR A;  3CU3 A;  5EEO A;  1N8R 4;  3EBT A;  5CF2 A;  1RN4 A;  1UUW B;  3NM7 A;  3FH1 A;  1D6Z A;  1IVW A;  3T0U A;  1ZS7 A;  1UCJ A;  1MWS A;  4U13 A;  2QEX 3;  3BND A;  1JJ2 2;  5HOH A;  1LXE A;  3V98 A;  1B3S A;  1BIR A;  3UL5 A;  1TTO A;  1OHO A;  8RNT A;  1OCV A;  4LSO A;  5AIG A;  3FGY A;  3FCS B;  1GSP A;  2CH9 A;  3KFQ C;  1WMN A;  2KXG A;  1K41 A;  1Z1S A;  1M90 4;  1V58 A;  3F8H A;  1BRH A;  3F8X A;  1W01 A;  2QA4 3;  1K73 4;  1OF5 A;  3X3Z A;  5BXQ A;  3X41 A;  3RNT A;  3X3X A;  3S27 A;  3DGM A;  4HVN A;  1RN7 A;  1M1K 4;  4HM8 B;  1TRP A;  4N6U A;  3F40 A;  2HMJ B;  3PCR A;  3ZG0 A;  6GSP A;  3CC7 3;  1STF I;  3HIG A;  1SPU A;  1TJD A;  2RSX A;  4FMC A;  4HM4 B;  5LC6 A;  5JPP A;  1K8A 4;  1VQ6 3;  1DE3 A;  2Z7A A;  2Y73 A;  1UGH I;  1X1X A;  1V74 A;  1M1X B;  1Q81 4;  1OF5 B;  1EG9 B;  1W6G A;  1IDP A;  1G96 A;  3F7X A;  3Q2P A;  5IEO A;  3SXX A;  1RGE A;  1TRQ A;  1JV2 B;  3URP A;  4RBN A;  3HI7 A;  1QVF 2;  5G1K A;  3CPO A;  5A0O B;  1TU5 A;  1YGW A;  5FW5 A;  2CFD A;  4CPK A;  1MWR A;  3T8U A;  1U5O A;  2XRX B;  3MKI A;  4L7K A;  4EBG A;  2KRT A;  3NX0 A;  3GZB A;  1JBT A;  2CG0 A;  3RGA A;  4NPB A;  4O2H A;  5AIF A;  2XSH B;  2YX9 A;  3WOE B;  3F7S A;  1BGS A;  2XFS A;  2GEX A;  2KAA A;  3ECF A;  3FG1 A;  1UCK A;  3EBY A;  4LEH A;  2YFJ B;  3LML A;  3OWY A;  2AAE A;  2LYX A;  2W56 A;  2CWT A;  2P09 A;  5AEU B;  5IG3 A;  3OWU A;  3CPW 2;  1S72 3;  3UNL A;  2F99 A;  1FUW A;  2H0G A;  2STD A;  4DKI A;  1ROV A;  2HML B;  1Q9E A;  1C54 A;  3CD6 3;  1BSA A;  1WNH A;  1LRA A;  3PYJ A;  3CCR 3;  1WTH A;  2INX A;  3FSD A;  1GS3 A;  3PS8 A;  4X2O A;  5TGN A;  1BSC A;  5G1L A;  2QIY A;  2GEY A;  4HJL B;  1IVU A;  1A2V A;  4L8P A;  3STD A;  3EN1 B;  1BNF A;  1E3V A;  2HMK B;  2UGI A;  4XM4 A;  3NBB A;  4CJN A;  3S67 A;  1GY7 A;  1BNE A;  1Q40 B;  1RHL A;  1ASK A;  4XBT A;  2D1W A;  2CKF B;  3L0R A;  1UCL A;  3DUK A;  2QGU A;  2RFR A;  3B7C A;  3HK4 A;  2F4Y A;  2ZA4 A;  1BAO A;  4J5G A;  2CG1 A;  1UUG B;  1Q82 4;  1S5A A;  1WMO A;  2CC3 A;  1VQM 3;  2K3D A; 
#chains in the Genus database with same CATH homology
 1FYS A;  1AY7 A;  4RNT A;  4HAA A;  2HOH A;  7RNT A;  1PY3 A;  1IYY A;  1A2P A;  9RNT A;  5GSP A;  1JBR A;  3WHO A;  2BU4 A;  1X1W A;  1RCL A;  4BU4 A;  1BRJ A;  1RGH A;  1B2X A;  1YNV X;  3AHS A;  3DGY A;  1X1Y A;  3A5E A;  4GHO A;  1RSN A;  1RCK A;  1I0V A;  1LOW A;  1RGF A;  1GOV A;  5BIR A;  1FW7 A;  1B27 A;  2SAR A;  1BNJ A;  1AQZ A;  1SAR A;  2KF6 A;  1RN4 A;  1FUS A;  2F5W A;  1R4Y A;  4J5K A;  1UCJ A;  2AAD A;  1YVS A;  1I8V A;  5HOH A;  1RDS A;  2KF3 A;  1B3S A;  1BIR A;  1RGG A;  1BRG A;  1PYL A;  1RGK A;  1TTO A;  8RNT A;  1FUT A;  1GSP A;  1RLS A;  1GMQ A;  7GSP A;  1BNG A;  1BRH A;  1I70 A;  3BIR A;  1LOY A;  1GMR A;  1BSB A;  3RNT A;  2BIR A;  2KF4 A;  1BSD A;  1I3F A;  1X1U A;  1BOX A;  1LOV A;  1TRP A;  2RBI A;  6GSP A;  1B2M A;  1DE3 A;  1RGA A;  1B2S A;  1BNI A;  1I3I A;  1JBS A;  1X1X A;  1MGR A;  1RNT A;  1BSE A;  4BIR A;  1BVI A;  3AGN A;  1RGE A;  1TRQ A;  3URP A;  1T2I A;  2C4B A;  1BU4 A;  3GSP A;  1B2Z A;  1YGW A;  1RTU A;  1RNB A;  3D4A A;  1I0X A;  1G02 A;  1B2U A;  1BRK A;  3HOH A;  2GSP A;  1GOY A;  1JBT A;  2RNT A;  1RGL A;  1RMS A;  1GOU A;  4GSP A;  3BU4 A;  6RNT A;  1BGS A;  3KCH A;  2KAA A;  1RN1 A;  1UCK A;  3AGO A;  1FZU A;  1T2H A;  1GMP A;  3AHW A;  1BAN A;  2F5M A;  2AAE A;  1RGC A;  3D5G A;  1BRI A;  1B21 A;  1BUJ A;  1BNS A;  4HOH A;  3SYU A;  1Q9E A;  2KF5 A;  1HYF A;  1C54 A;  1BSA A;  5BU4 A;  1LRA A;  1I2E A;  3D5I A;  1HZ1 A;  1BNR A;  3Q3F A;  1LNI A;  1B20 A;  1DET A;  1BSC A;  1I2G A;  5RNT A;  3DH2 A;  1BRS A;  1I2F A;  2F56 A;  1MGW A;  1CH0 A;  3WR2 A;  1BNF A;  1BNE A;  1RHL A;  1ZGX A;  1UCL A;  2F4Y A;  2ZA4 A;  1BAO A;  4J5G A;  1BRN L;  1UCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...