3DGOA

A non-biological atp binding protein with a tyr-phe mutation in the ligand binding domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIFNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP Binding Protein-DX
publication title A synthetic protein selected for ligand binding affinity mediates ATP hydrolysis.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dgoA00
3LTBA 2P09A 3LT9A 2P0XA 3LTDA 3LTCA 3DGMA 3LTAA 3DGOA 3LT8A 1UW1A 3DGNA 2P05A 3DGLA
chains in the Genus database with same CATH superfamily
1UCJA 3VSYA 2UGIA 2W56A 1Q814 1T3BA 3B8LA 2OTJ3 1I3FA 1JBSA 4K1VA 3DGYA 3EE1A 3NQYA 2CFDA 1WMPA 1VQ93 4LYLB 7STDA 1RGFA 1Q9EA 1B20A 4XM4A 3CC43 2BU4A 1NB3I 3KCHA 1RGEA 1A67A 1EA2A 2BHMA 3DM8A 3NX0A 3NV0A 1RN1A 4HKVB 2FNQA 1TIJA 4HJLB 4R9LA 4EV5A 1NB5I 1AVLA 1MWTA 2INXA 1TP6A 2D42A 3B7CA 3FG3A 1GY5A 2CWTA 3GWRA 3KIIA 4N6TA 1VQ43 1VQN3 2BMQB 1YJW3 1RN7A 2IUJA 1G96A 1WMOA 2P0MA 5AIFA 1EUIC 1U5OA 2E2TA 2O3OA 3JUPA 2F4YA 5BIRA 3DGOA 3OW22 4OUQA 1G02A 5STDA 5IG3A 3WHOA 5AIIA 5BXQA 1ZGXA 1YVBI 3CPOA 4KFEA 1CYUA 3OWYA 3F40A 1FGTA 3A5EA 3MG3A 4N6MA 3UNLA 1LVNA 3FGYA 4N6NB 4XBTA 1R4YA 5IG0A 4RNTA 1N5PA 2W9QA 3H51A 1GS3A 1RRLA 1BRIA 1A90A 1BUJA 4KFDA 3S28A 1LNHA 1IDPA 1W02A 2HMJB 1OCVA 3GZBA 4U13A 3WA2X 2A15A 4BL2A 1YJ93 3PS8A 4WYKB 1RNBA 2H0GA 1QVF2 1C54A 4CPKA 1RGAA 8CHOA 4STDA 1STDA 2HMKB 3DXOA 1M904 1B2SA 1ZX2A 3ALAA 1BANA 4I4KA 1R4CA 4G1MB 4EBGA 2GBWB 2OQEA 1AV4A 1TTOA 3V92A 3AGNA 3BNCA 4FMAA 1B2MA 1X1WA 2KF3A 2IYJA 5KP1A 3HIGA 4MMYB 1UDII 4GB5A 1I70A 5I97A 1VQ53 1RCKA 1SIIA 3EN1B 1IT8A 1JN5A 3HK4A 1EQKA 3JVCA 1BRSA 2GXFA 1GY6A 3UB1A 4RNYA 3SXXA 3NM7A 3Q1CA 1BRNL 2KXGA 2OOVC 1BSDA 4HVNA 5HGRA 1DE3A 1BSBA 1JV2B 1GMQA 1FYSA 3L0RA 3EJVA 3CCV3 1US1A 2FXTA 4LZIA 4MMZB 5CLKA 5FGOA 1ROAA 1B21A 3WOEB 3X3ZA 1UCKA 1M9GA 3LOYA 4XBXA 2Y74A 2KAAA 3AMOA 5D82A 1LOXA 1OUNA 2BO9B 2C4BA 1LOVA 5G1KA 4X2HA 1YGEA 1BNIA 1SPUA 4HYZA 4ZM8A 1CQSA 2QA43 4NREA 1B27A 4CDLA 1SQWA 3J7Yd 1W6CA 1V58A 4HM0B 2YFJB 3HI7A 4BTWA 3S27A 5IF6A 1MOLA 1AY7A 3IJEB 3GSPA 2OTL3 4JRFA 2LQVA 2W03A 1VQ63 5JBSA 2CFGA 3GRDA 1EKMA 1N9JA 1NWWA 2YX9A 1E3VA 2JDIH 3EBTA 3I0YA 2GEYA 2XEPA 2ML6A 2XSHB 3EC9A 3LH4A 1K41A 6GSPA 1A2PA 4AKYA 4BL3A 5CF2A 1W2B2 1OGZA 2GEXA 3FH1A 1RNTA 3BB9A 5LC7A 1MGRA 2CWUA 4FMBA 3EX9A 1Q864 3MWZA 3S5CA 3MG2A 4AEQA 3CCQ3 1YI23 2W0QA 1O7MB 1RGHA 1YVSA 3PCRA 1AR0A 1MNLA 1FGOA 2W6JH 2WOHA 9RNTA 1VQL3 5GSPA 3CCR3 3KZTA 1VQP3 1UI7A 1GMRA 4FMCA 5CXOA 2CG1A 4N6V0 3OX9A 3CNMA 3PYJA 1QALA 3Q3FA 3LTAA 3WOFB 1KQS2 4MMXB 5HOHA 2P05A 2KRTA 1ZO2A 3RNTA 1NNVA 2BIRA 4O02B 5AIHA 4J9AA 1MWSA 3K9MC 3STDA 1ISKA 2C11A 4R80A 3PXMA 1KD14 2XR8B 1B2ZA 3G16A 1J2BA 2R4IA 4J8TA 3EN8A 4HZBB 1UUVB 2F99A 4R9KA 1VQK3 2CC3A 4XDWA 1A2KA 1HZ1A 3D9RA 1I3IA 1DYUA 1JB4A 1FUTA 2KF4A 1I0VA 3LMLA 4J5KA 2P0XA 1BNEA 1JB2A 1RDSA 3DH2A 5DRVA 3G713 1CH0A 3SX1A 4EYCA 3G6E3 2GU1A 1QAKA 3CCU3 4J5GA 1LRAA 1ZS7A 4FMDA 3RGAA 1WNHA 1BSAA 4L8OA 2M7OA 1FUSA 3K63A 2BT3A 3SOAA 1F8NA 3IMAB 2ZA4A 3ZG5A 3BNEA 2FGTA 2CFWA 3CD63 4K61A 2F5MA 3LTCA 4L7KA 1BU4A 1BRKA 2E2UA 2XFTA 4KFFA 4Q53A 1EG9B 1K28A 1UGHI 1OH0A 4EC6A 3F8XA 1OF5A 3DGNA 4OK0A 4XBYA 5AEWB 1FZUA 1Q40B 5IEPA 3CMA3 3M8CA 1X1UA 2QGUA 2XGLA 3O8YA 4N6UA 1EEJA 4RBNA 4BU4A 5CK6A 1ULIB 4HAAA 4WFOA 4GSPA 1YJN3 3U97A 4WHAA 5ELUA 3BIRA 3ECFA 3SLUA 1QVG2 3LZAA 2XF3A 1VQO3 1AVKA 4FCZA 2CG0A 2MC8A 3ZG0A 3ER7A 1QAFA 1O7PB 2WGOA 3N8BA 1GD3A 1JKGA 1Q42A 1X1XA 3F8HA 4BTYA 1VQM3 1BNFA 3FKAA 1TRQA 4BIRA 4HM1B 2JQ5A 1D6YA 1HYFA 1LNIA 1LQMB 2STDA 3FF0A 4GHOA 4KZ1A 3SEDA 1IK3A 1UCIA 2XGNA 1DMQA 1RN4A 2D1WA 5G2GA 4HM4B 4XDVA 3G8ZA 1V74A 2GSPA 1IQXA 3OXAA 1E3RA 4LMIA 1YGWA 1GYBA 3PGBA 3HIIA 1YIT3 1OHPA 1T2IA 2CX1A 3FLJA 4ILFA 4LSOA 3NV0B 3G4S3 3NBBA 2J8XB 1BGSA 1BSCA 1I0XA 4HOHA 4WWUC 1IQYA 2HOHA 1VQ73 2Z76A 3QK9A 1VQ83 3D3LA 1LXEA 8RNTA 1BOXA 4QWTA 1U8CB 3Q2PA 3B4PA 4N3VA 5D81A 3X40A 1NDOB 2YFLB 2RCDA 1BNGA 1VZZA 3CCM3 2XFSA 3F7SA 1BRGA 3T8UA 1DMMA 4IIAA 2BMOB 1PYLA 3QRDA 1GOUA 4WP5A 2W04A 1UCLA 1RMSA 1K734 1E97A 3IPTA 4KVHA 3RGRA 1MWRA 1O7WB 2MF7A 1LQGC 2ML5A 5FW5A 1TU5A 3EB8A 4RZMA 1JBTA 1BUQA 4O2HA 1SARA 1LOWA 2RGQA 3ROBA 2HMNB 1Y4KA 2BMRB 3B4OA 2O9UX 3EBYA 5TGNA 1W2ZA 4FR9A 4DKIA 4N6OB 3CCJ3 1IVWA 2SARA 2Z6BA 2RSXA 2K0MA 3NM2A 5G1LA 1BRHA 1IV7A 1V57A 3MHEA 1MGWA 3VGNA 7GSPA 2CFLA 3BNBA 3BLZA 1KSIA 1O7HB 2W9PA 1Q7Y4 1UW1A 1W5ZA 3FG1A 4HM6B 1DETA 2HMOB 1HU9A 1FUWA 3WODG 2QIYA 3D4AA 4BTXA 1I2GA 2IUKA 2ZDJA 3DMCA 4GL6A 1RGKA 4CCVA 4K1UA 1FGMA 3MG1A 1YIJ3 3LT9A 5EVHA 1BIRA 4JF8A 1JN5B 3DY5A 1HKXA 2XH9A 3CCL3 1BNJA 2B24B 1WTHA 1W00A 1M1XB 1IVXA 2HMLB 2KF6A 3LT8A 3OWSA 2KF5A 2OOVA 3BNDA 1YNVX 1GMPA 2P38A 3ZFZA 1B2XA 2F86B 4WYKA 2V1LA 1BNSA 1OACA 2PZVA 3Q90A 3I563 2R41A 5CF1A 1I2EA 3JUMA 3AMOB 3N54B 1OPYA 1O7NB 2RNTA 1RRHA 1NJI4 2YFIB 1RTUA 4IPBA 1BSEA 3CNXA 2OQEC 5EQLA 5M19A 2F5WA 3NQZA 1SIHA 1RCLA 1TRPA 1N9EA 3H3HA 3JUQA 2B1XB 2C10A 2F98A 3LTBA 1IU7A 5JPUA 2AADA 4FCJA 2L1SA 3GAXA 3NBJA 3K0ZA 1C7HA 1Q824 3FF2A 3OV4A 1PY3A 3VF1A 4ORLA 1JNQA 2IMJA 2E2VA 4HM3B 4KT3B 1K8A4 4EXRA 3KSPA 4LGQA 4HM7B 1JBRA 1AQZA 1JZDA 1RLSA 2PNCA 1I2FA 2HMMB 1Q7HA 2K3DA 2P09A 3HX8A 7RNTA 3PCSA 4HM2B 1W6YA 3CU3A 1OHOA 4K90B 4MEIA 3S29A 1W6GA 3E99A 1BRJA 3D5GA 5BVBA 1MWUA 5EEOA 1IT7A 2F56A 3F14A 1IQ8A 2CW9A 3LTDA 3CXC2 1FA3A 3CME3 1QJGA 2CHCA 3DUKA 1GY7A 4XB5A 1FGRA 5IENA 1X1YA 1GOVA 1BVIA 1K9M4 1UGIA 4HM8B 1B3SA 1T5YA 1TFKA 1NO3A 2I9WA 3D79A 4HZ9B 3CCE3 2H0IA 1PU4A 2RBIA 2UX0A 1BAOA 3KKGA 5A0OB 4MJDA 1GD4A 2W56B 3AGOA 3TDGA 2H0HA 6RNTA 2OWPA 1RGGA 1RHLA 2GU3A 3URPA 3X3YA 2SBLA 4EV2A 3G0KA 3WA3A 3WR2A 4N6LA 3CPW2 3CC73 3F9SA 2OCTA 3NBRA 3V99A 5IW9A 3GZYB 3DZLA 1OHSA 2IA7A 1D6ZA 3SYUA 3KFQC 4TX4A 3UJMA 5ELJA 2AAEA 3OWUA 1WMNA 1RKYA 1JRQA 3MSOA 3RDEA 3S67A 1UUWB 3UL5A 2CIUA 5IG4A 3CCS3 5RNTA 3MPHA 3CC23 1N8R4 4AKZA 1S723 5AIGA 3EHCA 3NHXA 1FW7A 1RSNA 1PFPA 2CX0A 3KN4A 3DGMA 2CFKA 2KCDA 1T2HA 1TUHA 1STFI 1JZOA 3JUNA 4RNZA 3SOYA 1DVDA 5M18A 3FG4A 1D6UA 1CYVA 3MKIA 5M1AA 3EF8A 4HM5B 1YHQ3 2CH9A 2WO0A 2L4VA 2RFRA 2Z77A 5IEOA 3MYTA 2ZHXB 3SVAA 3NUVA 4PEJA 5D83A 3LXUX 1FGQA 2UUGC 2XRXB 3LYGA 2LYXA 1KC84 3NXJA 3N9HA 1B2UA 1OF5B 4FCMA 1UUGB 3AHWA 3KSED 4EW5A 3I553 4X2OA 2WGQA 1TFOA 1IVUA 1KWIA 1A2VA 2GBXB 2CK3H 3FZWA 3HZPA 5KP4A 1W4NA 1IV9A 1NU3A 3X42A 3UL6A 1N5HA 1JJ22 1UI8A 2XSOB 3HOHA 1BNRA 2CWVA 4CJNA 1GSPA 1N8QA 1RJOA 3K5TA 1QMAA 1GOYA 2CKFB 1CEWI 4L8PA 1OGXA 3T8NA 6STDA 1IVVA 5IERA 3GZRA 3BU4A 1I8VA 4H61A 1JKGB 5AYSC 1ASKA 3V98A 5IG5A 3K7CA 1RGLA 4NPBA 1M1K4 4LEHA 5LC6A 3F7XA 1IYYA 4IT7A 3JUOA 1O7GB 1ULJB 3GZXB 4H3UA 1G0TA 3U1WA 3X41A 3KE7A 3DGLA 3X3XA 4I5QA 4NHFA 2Q07A 3WDGB 5JPPA 1Z1SA 1VQQA 2QEX3 4R1KA 1W01A 2BNGA 2WOFA 5BU4A 2K54A 2ZL8A 1Q40A 2Z7AA 4O8SA 2Y73A 3WMDA 1SJWA 1DVCA 4HBRA 3T0UA 1L5GB 3AHSA 5AYRB 4R4KA 3FSDA 1ROVA 1LOYA 1W7CA 2W2CA 4O3VA 1DMNA 4OVMA 5AEUB 2IY2A 1WQLB 3EQQB 1JB5A 5AI1A 3PZWA 3FCSB 5KP3A 1S5AA 3A76A 5DREA 3D5IA 1RGCA 1TJDA
chains in the Genus database with same CATH topology
3VSYA 2OTJ3 2W56A 1Q814 3B8LA 4K1VA 3EE1A 3NQYA 2CFDA 1WMPA 1VQ93 7STDA 4XM4A 3CC43 1NB3I 1A67A 1EA2A 2BHMA 3DM8A 3NX0A 3NV0A 4HKVB 2FNQA 1TIJA 4HJLB 4R9LA 4EV5A 1NB5I 1AVLA 2INXA 1TP6A 2D42A 3B7CA 3FG3A 1GY5A 2CWTA 3GWRA 3KIIA 4N6TA 1VQ43 1VQN3 2BMQB 1YJW3 1RN7A 2IUJA 1G96A 1WMOA 2P0MA 5AIFA 2O3OA 1U5OA 2E2TA 3JUPA 3DGOA 3OW22 4OUQA 5STDA 5IG3A 5BXQA 5AIIA 3CPOA 1YVBI 4KFEA 1CYUA 3OWYA 3F40A 1FGTA 3MG3A 4N6MA 3UNLA 1LVNA 3FGYA 4N6NB 4XBTA 5IG0A 1N5PA 2W9QA 3H51A 1GS3A 1RRLA 1A90A 4KFDA 3S28A 1LNHA 1IDPA 1W02A 2HMJB 1OCVA 3GZBA 4U13A 3WA2X 2A15A 1YJ93 1QVF2 3PS8A 4WYKB 8CHOA 4STDA 1STDA 2HMKB 3DXOA 1M904 1ZX2A 3ALAA 4I4KA 1R4CA 4G1MB 4EBGA 2GBWB 2OQEA 1AV4A 3V92A 3BNCA 4FMAA 5KP1A 3HIGA 4MMYB 4GB5A 5I97A 1VQ53 1SIIA 3EN1B 1IT8A 1JN5A 3HK4A 1EQKA 3JVCA 2GXFA 1GY6A 3UB1A 4RNYA 3SXXA 3NM7A 3Q1CA 2KXGA 2OOVC 4HVNA 5HGRA 1JV2B 3L0RA 3EJVA 3CCV3 1US1A 2FXTA 4LZIA 4MMZB 5CLKA 5FGOA 1ROAA 3WOEB 3X3ZA 1M9GA 3LOYA 4XBXA 2Y74A 3AMOA 5D82A 1LOXA 1OUNA 2BO9B 5IEPA 4X2HA 1YGEA 4HYZA 1SPUA 2QA43 4ZM8A 1CQSA 1JJ22 4NREA 3J7Yd 4CDLA 1SQWA 1W6CA 4HM0B 2YFJB 3HI7A 4BTWA 3S27A 5IF6A 1MOLA 3IJEB 2OTL3 4JRFA 2LQVA 2W03A 1VQ63 5JBSA 2CFGA 3GRDA 1EKMA 1N9JA 1NWWA 2YX9A 1E3VA 2JDIH 3EBTA 3I0YA 2XSHB 2XEPA 2ML6A 2GEYA 3EC9A 3LH4A 1K41A 5CF2A 4AKYA 1W2B2 1OGZA 2GEXA 3FH1A 3BB9A 5LC7A 2CWUA 4FMBA 3EX9A 1Q864 3MWZA 3S5CA 3MG2A 4AEQA 3CCQ3 1YI23 2W0QA 1O7MB 3PCRA 1AR0A 1MNLA 1FGOA 2W6JH 2WOHA 1VQL3 3CCR3 3KZTA 1VQP3 1UI7A 4FMCA 5CXOA 2CG1A 4N6V0 3OX9A 3CNMA 3PYJA 1QALA 3WOFB 3LTAA 1KQS2 4MMXB 2P05A 2KRTA 1ZO2A 4O02B 5AIHA 4J9AA 3K9MC 3STDA 1ISKA 2C11A 4R80A 3PXMA 1KD14 2XR8B 3G16A 1J2BA 2R4IA 4J8TA 3EN8A 4HZBB 1UUVB 2F99A 4R9KA 1VQK3 2CC3A 4XDWA 1A2KA 3D9RA 1DYUA 1JB4A 3LMLA 2P0XA 1JB2A 3G713 5DRVA 3SX1A 4EYCA 3G6E3 2GU1A 1QAKA 3CCU3 4FMDA 3RGAA 1WNHA 4L8OA 2M7OA 3K63A 2BT3A 3SOAA 1F8NA 3IMAB 3BNEA 2FGTA 2CFWA 3CD63 4K61A 3LTCA 4L7KA 2E2UA 2XFTA 4KFFA 4Q53A 1EG9B 1K28A 1OH0A 4EC6A 3F8XA 1OF5A 3DGNA 4OK0A 4XBYA 5AEWB 1Q40B 3CMA3 3M8CA 2QGUA 2XGLA 3O8YA 4N6UA 4RBNA 5CK6A 1ULIB 4WFOA 1YJN3 3U97A 4WHAA 5ELUA 3ECFA 3SLUA 1QVG2 3LZAA 2XF3A 1VQO3 1AVKA 4FCZA 2CG0A 2MC8A 3ER7A 1QAFA 1O7PB 2WGOA 3N8BA 1GD3A 1JKGA 1Q42A 3F8HA 4BTYA 1VQM3 3FKAA 4HM1B 2JQ5A 1D6YA 3FF0A 1IK3A 2STDA 4KZ1A 3SEDA 2XGNA 1DMQA 2D1WA 5G2GA 4HM4B 4XDVA 3G8ZA 1V74A 1IQXA 3OXAA 1E3RA 4LMIA 1GYBA 3PGBA 3HIIA 1YIT3 1OHPA 3FLJA 3G4S3 4LSOA 3NV0B 3NBBA 4WWUC 1IQYA 1VQ73 2Z76A 3QK9A 1VQ83 3D3LA 1LXEA 4QWTA 1U8CB 3Q2PA 3B4PA 4N3VA 5D81A 3X40A 1NDOB 2YFLB 2RCDA 1VZZA 3CCM3 2XFSA 3F7SA 3T8UA 1DMMA 4IIAA 2BMOB 3QRDA 4WP5A 2W04A 1K734 1E97A 3IPTA 4KVHA 3RGRA 1O7WB 2MF7A 2ML5A 5FW5A 1TU5A 3EB8A 4RZMA 1BUQA 4O2HA 2RGQA 3ROBA 2HMNB 1Y4KA 2BMRB 3B4OA 2O9UX 3EBYA 5TGNA 1W2ZA 4FR9A 3CCJ3 4N6OB 1IVWA 2Z6BA 2RSXA 2K0MA 3NM2A 1IV7A 3MHEA 3VGNA 2CFLA 3BNBA 3BLZA 1KSIA 1O7HB 2W9PA 1Q7Y4 1UW1A 1W5ZA 3FG1A 4HM6B 2HMOB 1HU9A 1FUWA 3WODG 2QIYA 4BTXA 2IUKA 2ZDJA 3DMCA 4GL6A 4CCVA 4K1UA 1FGMA 3MG1A 1YIJ3 3LT9A 5EVHA 4JF8A 1JN5B 3DY5A 1HKXA 2XH9A 3CCL3 2B24B 1WTHA 1W00A 1M1XB 1IVXA 2HMLB 3LT8A 3OWSA 2OOVA 3BNDA 2P38A 2F86B 4WYKA 2V1LA 1OACA 2PZVA 3Q90A 3I563 5CF1A 3JUMA 3AMOB 3N54B 1OPYA 1O7NB 1RRHA 1NJI4 2YFIB 4IPBA 3CNXA 2OQEC 5EQLA 3NQZA 1SIHA 3JUQA 1N9EA 3H3HA 2B1XB 2C10A 2F98A 3LTBA 1IU7A 5JPUA 4FCJA 3GAXA 3NBJA 3K0ZA 1C7HA 1Q824 3FF2A 3OV4A 3VF1A 4ORLA 1JNQA 2IMJA 2E2VA 4HM3B 1K8A4 4EXRA 3KSPA 4LGQA 4HM7B 2PNCA 2HMMB 2P09A 3HX8A 3PCSA 4HM2B 1W6YA 3CU3A 1OHOA 4K90B 4MEIA 3S29A 1W6GA 3E99A 5BVBA 5EEOA 1IT7A 3F14A 1IQ8A 2CW9A 3LTDA 3CXC2 1FA3A 3CME3 1QJGA 2CHCA 3DUKA 1GY7A 4XB5A 1FGRA 5IENA 1K9M4 4HM8B 1TFKA 1T5YA 4HZ9B 1NO3A 2I9WA 3CCE3 1PU4A 2UX0A 3KKGA 5A0OB 4MJDA 1GD4A 2W56B 3TDGA 2OWPA 3WA3A 3X3YA 2GU3A 2SBLA 4EV2A 3G0KA 4N6LA 3CPW2 3CC73 3F9SA 2OCTA 3NBRA 3V99A 5IW9A 3GZYB 3DZLA 1OHSA 2IA7A 1D6ZA 3KFQC 4TX4A 3UJMA 5ELJA 3OWUA 1WMNA 1RKYA 1JRQA 3MSOA 3RDEA 3S67A 1UUWB 3UL5A 2CIUA 5IG4A 3CCS3 3MPHA 3CC23 1N8R4 4AKZA 1S723 5AIGA 3EHCA 3NHXA 1PFPA 3KN4A 3DGMA 2CFKA 2KCDA 1TUHA 4RNZA 1STFI 3JUNA 3SOYA 1DVDA 3FG4A 1D6UA 1CYVA 3MKIA 3EF8A 4HM5B 1YHQ3 2CH9A 2WO0A 2L4VA 2RFRA 2Z77A 5IEOA 3MYTA 3SVAA 3NUVA 4PEJA 5D83A 3LXUX 1FGQA 2XRXB 3LYGA 2LYXA 1KC84 3NXJA 3N9HA 1OF5B 4FCMA 3KSED 3I553 4X2OA 1TFOA 1IVUA 1KWIA 1A2VA 2GBXB 2CK3H 3FZWA 3HZPA 5KP4A 1W4NA 1IV9A 1NU3A 3X42A 3UL6A 1N5HA 1UI8A 2XSOB 2CWVA 1N8QA 1RJOA 3K5TA 1QMAA 2CKFB 6STDA 1CEWI 4L8PA 1OGXA 3T8NA 5IERA 1IVVA 3GZRA 4H61A 1JKGB 5AYSC 1ASKA 3V98A 5IG5A 3K7CA 1M1K4 4LEHA 5LC6A 3F7XA 4IT7A 3JUOA 1O7GB 1ULJB 3GZXB 4H3UA 3U1WA 3X41A 3KE7A 3DGLA 3X3XA 4NHFA 2Q07A 3WDGB 5JPPA 1Z1SA 2QEX3 4R1KA 2WOFA 1W01A 2BNGA 2K54A 2ZL8A 1Q40A 2Z7AA 4O8SA 2Y73A 3WMDA 1SJWA 1DVCA 4HBRA 3T0UA 1L5GB 5AYRB 4R4KA 3FSDA 1ROVA 1W7CA 2W2CA 4O3VA 1DMNA 4OVMA 5AEUB 1WQLB 3EQQB 1JB5A 5AI1A 3PZWA 3FCSB 5KP3A 1S5AA 3A76A 5DREA 2WGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTB A;  2P09 A;  3LT9 A;  2P0X A;  3LTD A;  3LTC A;  3DGM A;  3LTA A;  3DGO A;  3LT8 A;  1UW1 A;  3DGN A;  2P05 A;  3DGL A; 
#chains in the Genus database with same CATH topology
 1UCJ A;  3VSY A;  2UGI A;  2W56 A;  1Q81 4;  1T3B A;  3B8L A;  2OTJ 3;  1I3F A;  1JBS A;  4K1V A;  3DGY A;  3EE1 A;  3NQY A;  2CFD A;  1WMP A;  1VQ9 3;  4LYL B;  7STD A;  1RGF A;  1Q9E A;  1B20 A;  4XM4 A;  3CC4 3;  2BU4 A;  1NB3 I;  3KCH A;  1RGE A;  1A67 A;  1EA2 A;  2BHM A;  3DM8 A;  3NX0 A;  3NV0 A;  1RN1 A;  4HKV B;  2FNQ A;  1TIJ A;  4HJL B;  4R9L A;  4EV5 A;  1NB5 I;  1AVL A;  1MWT A;  2INX A;  1TP6 A;  2D42 A;  3B7C A;  3FG3 A;  1GY5 A;  2CWT A;  3GWR A;  3KII A;  4N6T A;  1VQ4 3;  1VQN 3;  2BMQ B;  1YJW 3;  1RN7 A;  2IUJ A;  1G96 A;  1WMO A;  2P0M A;  5AIF A;  1EUI C;  1U5O A;  2E2T A;  2O3O A;  3JUP A;  2F4Y A;  5BIR A;  3DGO A;  3OW2 2;  4OUQ A;  1G02 A;  5STD A;  5IG3 A;  3WHO A;  5AII A;  5BXQ A;  1ZGX A;  1YVB I;  3CPO A;  4KFE A;  1CYU A;  3OWY A;  3F40 A;  1FGT A;  3A5E A;  3MG3 A;  4N6M A;  3UNL A;  1LVN A;  3FGY A;  4N6N B;  4XBT A;  1R4Y A;  5IG0 A;  4RNT A;  1N5P A;  2W9Q A;  3H51 A;  1GS3 A;  1RRL A;  1BRI A;  1A90 A;  1BUJ A;  4KFD A;  3S28 A;  1LNH A;  1IDP A;  1W02 A;  2HMJ B;  1OCV A;  3GZB A;  4U13 A;  3WA2 X;  2A15 A;  4BL2 A;  1YJ9 3;  3PS8 A;  4WYK B;  1RNB A;  2H0G A;  1QVF 2;  1C54 A;  4CPK A;  1RGA A;  8CHO A;  4STD A;  1STD A;  2HMK B;  3DXO A;  1M90 4;  1B2S A;  1ZX2 A;  3ALA A;  1BAN A;  4I4K A;  1R4C A;  4G1M B;  4EBG A;  2GBW B;  2OQE A;  1AV4 A;  1TTO A;  3V92 A;  3AGN A;  3BNC A;  4FMA A;  1B2M A;  1X1W A;  2KF3 A;  2IYJ A;  5KP1 A;  3HIG A;  4MMY B;  1UDI I;  4GB5 A;  1I70 A;  5I97 A;  1VQ5 3;  1RCK A;  1SII A;  3EN1 B;  1IT8 A;  1JN5 A;  3HK4 A;  1EQK A;  3JVC A;  1BRS A;  2GXF A;  1GY6 A;  3UB1 A;  4RNY A;  3SXX A;  3NM7 A;  3Q1C A;  1BRN L;  2KXG A;  2OOV C;  1BSD A;  4HVN A;  5HGR A;  1DE3 A;  1BSB A;  1JV2 B;  1GMQ A;  1FYS A;  3L0R A;  3EJV A;  3CCV 3;  1US1 A;  2FXT A;  4LZI A;  4MMZ B;  5CLK A;  5FGO A;  1ROA A;  1B21 A;  3WOE B;  3X3Z A;  1UCK A;  1M9G A;  3LOY A;  4XBX A;  2Y74 A;  2KAA A;  3AMO A;  5D82 A;  1LOX A;  1OUN A;  2BO9 B;  2C4B A;  1LOV A;  5G1K A;  4X2H A;  1YGE A;  1BNI A;  1SPU A;  4HYZ A;  4ZM8 A;  1CQS A;  2QA4 3;  4NRE A;  1B27 A;  4CDL A;  1SQW A;  3J7Y d;  1W6C A;  1V58 A;  4HM0 B;  2YFJ B;  3HI7 A;  4BTW A;  3S27 A;  5IF6 A;  1MOL A;  1AY7 A;  3IJE B;  3GSP A;  2OTL 3;  4JRF A;  2LQV A;  2W03 A;  1VQ6 3;  5JBS A;  2CFG A;  3GRD A;  1EKM A;  1N9J A;  1NWW A;  2YX9 A;  1E3V A;  2JDI H;  3EBT A;  3I0Y A;  2GEY A;  2XEP A;  2ML6 A;  2XSH B;  3EC9 A;  3LH4 A;  1K41 A;  6GSP A;  1A2P A;  4AKY A;  4BL3 A;  5CF2 A;  1W2B 2;  1OGZ A;  2GEX A;  3FH1 A;  1RNT A;  3BB9 A;  5LC7 A;  1MGR A;  2CWU A;  4FMB A;  3EX9 A;  1Q86 4;  3MWZ A;  3S5C A;  3MG2 A;  4AEQ A;  3CCQ 3;  1YI2 3;  2W0Q A;  1O7M B;  1RGH A;  1YVS A;  3PCR A;  1AR0 A;  1MNL A;  1FGO A;  2W6J H;  2WOH A;  9RNT A;  1VQL 3;  5GSP A;  3CCR 3;  3KZT A;  1VQP 3;  1UI7 A;  1GMR A;  4FMC A;  5CXO A;  2CG1 A;  4N6V 0;  3OX9 A;  3CNM A;  3PYJ A;  1QAL A;  3Q3F A;  3LTA A;  3WOF B;  1KQS 2;  4MMX B;  5HOH A;  2P05 A;  2KRT A;  1ZO2 A;  3RNT A;  1NNV A;  2BIR A;  4O02 B;  5AIH A;  4J9A A;  1MWS A;  3K9M C;  3STD A;  1ISK A;  2C11 A;  4R80 A;  3PXM A;  1KD1 4;  2XR8 B;  1B2Z A;  3G16 A;  1J2B A;  2R4I A;  4J8T A;  3EN8 A;  4HZB B;  1UUV B;  2F99 A;  4R9K A;  1VQK 3;  2CC3 A;  4XDW A;  1A2K A;  1HZ1 A;  3D9R A;  1I3I A;  1DYU A;  1JB4 A;  1FUT A;  2KF4 A;  1I0V A;  3LML A;  4J5K A;  2P0X A;  1BNE A;  1JB2 A;  1RDS A;  3DH2 A;  5DRV A;  3G71 3;  1CH0 A;  3SX1 A;  4EYC A;  3G6E 3;  2GU1 A;  1QAK A;  3CCU 3;  4J5G A;  1LRA A;  1ZS7 A;  4FMD A;  3RGA A;  1WNH A;  1BSA A;  4L8O A;  2M7O A;  1FUS A;  3K63 A;  2BT3 A;  3SOA A;  1F8N A;  3IMA B;  2ZA4 A;  3ZG5 A;  3BNE A;  2FGT A;  2CFW A;  3CD6 3;  4K61 A;  2F5M A;  3LTC A;  4L7K A;  1BU4 A;  1BRK A;  2E2U A;  2XFT A;  4KFF A;  4Q53 A;  1EG9 B;  1K28 A;  1UGH I;  1OH0 A;  4EC6 A;  3F8X A;  1OF5 A;  3DGN A;  4OK0 A;  4XBY A;  5AEW B;  1FZU A;  1Q40 B;  5IEP A;  3CMA 3;  3M8C A;  1X1U A;  2QGU A;  2XGL A;  3O8Y A;  4N6U A;  1EEJ A;  4RBN A;  4BU4 A;  5CK6 A;  1ULI B;  4HAA A;  4WFO A;  4GSP A;  1YJN 3;  3U97 A;  4WHA A;  5ELU A;  3BIR A;  3ECF A;  3SLU A;  1QVG 2;  3LZA A;  2XF3 A;  1VQO 3;  1AVK A;  4FCZ A;  2CG0 A;  2MC8 A;  3ZG0 A;  3ER7 A;  1QAF A;  1O7P B;  2WGO A;  3N8B A;  1GD3 A;  1JKG A;  1Q42 A;  1X1X A;  3F8H A;  4BTY A;  1VQM 3;  1BNF A;  3FKA A;  1TRQ A;  4BIR A;  4HM1 B;  2JQ5 A;  1D6Y A;  1HYF A;  1LNI A;  1LQM B;  2STD A;  3FF0 A;  4GHO A;  4KZ1 A;  3SED A;  1IK3 A;  1UCI A;  2XGN A;  1DMQ A;  1RN4 A;  2D1W A;  5G2G A;  4HM4 B;  4XDV A;  3G8Z A;  1V74 A;  2GSP A;  1IQX A;  3OXA A;  1E3R A;  4LMI A;  1YGW A;  1GYB A;  3PGB A;  3HII A;  1YIT 3;  1OHP A;  1T2I A;  2CX1 A;  3FLJ A;  4ILF A;  4LSO A;  3NV0 B;  3G4S 3;  3NBB A;  2J8X B;  1BGS A;  1BSC A;  1I0X A;  4HOH A;  4WWU C;  1IQY A;  2HOH A;  1VQ7 3;  2Z76 A;  3QK9 A;  1VQ8 3;  3D3L A;  1LXE A;  8RNT A;  1BOX A;  4QWT A;  1U8C B;  3Q2P A;  3B4P A;  4N3V A;  5D81 A;  3X40 A;  1NDO B;  2YFL B;  2RCD A;  1BNG A;  1VZZ A;  3CCM 3;  2XFS A;  3F7S A;  1BRG A;  3T8U A;  1DMM A;  4IIA A;  2BMO B;  1PYL A;  3QRD A;  1GOU A;  4WP5 A;  2W04 A;  1UCL A;  1RMS A;  1K73 4;  1E97 A;  3IPT A;  4KVH A;  3RGR A;  1MWR A;  1O7W B;  2MF7 A;  1LQG C;  2ML5 A;  5FW5 A;  1TU5 A;  3EB8 A;  4RZM A;  1JBT A;  1BUQ A;  4O2H A;  1SAR A;  1LOW A;  2RGQ A;  3ROB A;  2HMN B;  1Y4K A;  2BMR B;  3B4O A;  2O9U X;  3EBY A;  5TGN A;  1W2Z A;  4FR9 A;  4DKI A;  4N6O B;  3CCJ 3;  1IVW A;  2SAR A;  2Z6B A;  2RSX A;  2K0M A;  3NM2 A;  5G1L A;  1BRH A;  1IV7 A;  1V57 A;  3MHE A;  1MGW A;  3VGN A;  7GSP A;  2CFL A;  3BNB A;  3BLZ A;  1KSI A;  1O7H B;  2W9P A;  1Q7Y 4;  1UW1 A;  1W5Z A;  3FG1 A;  4HM6 B;  1DET A;  2HMO B;  1HU9 A;  1FUW A;  3WOD G;  2QIY A;  3D4A A;  4BTX A;  1I2G A;  2IUK A;  2ZDJ A;  3DMC A;  4GL6 A;  1RGK A;  4CCV A;  4K1U A;  1FGM A;  3MG1 A;  1YIJ 3;  3LT9 A;  5EVH A;  1BIR A;  4JF8 A;  1JN5 B;  3DY5 A;  1HKX A;  2XH9 A;  3CCL 3;  1BNJ A;  2B24 B;  1WTH A;  1W00 A;  1M1X B;  1IVX A;  2HML B;  2KF6 A;  3LT8 A;  3OWS A;  2KF5 A;  2OOV A;  3BND A;  1YNV X;  1GMP A;  2P38 A;  3ZFZ A;  1B2X A;  2F86 B;  4WYK A;  2V1L A;  1BNS A;  1OAC A;  2PZV A;  3Q90 A;  3I56 3;  2R41 A;  5CF1 A;  1I2E A;  3JUM A;  3AMO B;  3N54 B;  1OPY A;  1O7N B;  2RNT A;  1RRH A;  1NJI 4;  2YFI B;  1RTU A;  4IPB A;  1BSE A;  3CNX A;  2OQE C;  5EQL A;  5M19 A;  2F5W A;  3NQZ A;  1SIH A;  1RCL A;  1TRP A;  1N9E A;  3H3H A;  3JUQ A;  2B1X B;  2C10 A;  2F98 A;  3LTB A;  1IU7 A;  5JPU A;  2AAD A;  4FCJ A;  2L1S A;  3GAX A;  3NBJ A;  3K0Z A;  1C7H A;  1Q82 4;  3FF2 A;  3OV4 A;  1PY3 A;  3VF1 A;  4ORL A;  1JNQ A;  2IMJ A;  2E2V A;  4HM3 B;  4KT3 B;  1K8A 4;  4EXR A;  3KSP A;  4LGQ A;  4HM7 B;  1JBR A;  1AQZ A;  1JZD A;  1RLS A;  2PNC A;  1I2F A;  2HMM B;  1Q7H A;  2K3D A;  2P09 A;  3HX8 A;  7RNT A;  3PCS A;  4HM2 B;  1W6Y A;  3CU3 A;  1OHO A;  4K90 B;  4MEI A;  3S29 A;  1W6G A;  3E99 A;  1BRJ A;  3D5G A;  5BVB A;  1MWU A;  5EEO A;  1IT7 A;  2F56 A;  3F14 A;  1IQ8 A;  2CW9 A;  3LTD A;  3CXC 2;  1FA3 A;  3CME 3;  1QJG A;  2CHC A;  3DUK A;  1GY7 A;  4XB5 A;  1FGR A;  5IEN A;  1X1Y A;  1GOV A;  1BVI A;  1K9M 4;  1UGI A;  4HM8 B;  1B3S A;  1T5Y A;  1TFK A;  1NO3 A;  2I9W A;  3D79 A;  4HZ9 B;  3CCE 3;  2H0I A;  1PU4 A;  2RBI A;  2UX0 A;  1BAO A;  3KKG A;  5A0O B;  4MJD A;  1GD4 A;  2W56 B;  3AGO A;  3TDG A;  2H0H A;  6RNT A;  2OWP A;  1RGG A;  1RHL A;  2GU3 A;  3URP A;  3X3Y A;  2SBL A;  4EV2 A;  3G0K A;  3WA3 A;  3WR2 A;  4N6L A;  3CPW 2;  3CC7 3;  3F9S A;  2OCT A;  3NBR A;  3V99 A;  5IW9 A;  3GZY B;  3DZL A;  1OHS A;  2IA7 A;  1D6Z A;  3SYU A;  3KFQ C;  4TX4 A;  3UJM A;  5ELJ A;  2AAE A;  3OWU A;  1WMN A;  1RKY A;  1JRQ A;  3MSO A;  3RDE A;  3S67 A;  1UUW B;  3UL5 A;  2CIU A;  5IG4 A;  3CCS 3;  5RNT A;  3MPH A;  3CC2 3;  1N8R 4;  4AKZ A;  1S72 3;  5AIG A;  3EHC A;  3NHX A;  1FW7 A;  1RSN A;  1PFP A;  2CX0 A;  3KN4 A;  3DGM A;  2CFK A;  2KCD A;  1T2H A;  1TUH A;  1STF I;  1JZO A;  3JUN A;  4RNZ A;  3SOY A;  1DVD A;  5M18 A;  3FG4 A;  1D6U A;  1CYV A;  3MKI A;  5M1A A;  3EF8 A;  4HM5 B;  1YHQ 3;  2CH9 A;  2WO0 A;  2L4V A;  2RFR A;  2Z77 A;  5IEO A;  3MYT A;  2ZHX B;  3SVA A;  3NUV A;  4PEJ A;  5D83 A;  3LXU X;  1FGQ A;  2UUG C;  2XRX B;  3LYG A;  2LYX A;  1KC8 4;  3NXJ A;  3N9H A;  1B2U A;  1OF5 B;  4FCM A;  1UUG B;  3AHW A;  3KSE D;  4EW5 A;  3I55 3;  4X2O A;  2WGQ A;  1TFO A;  1IVU A;  1KWI A;  1A2V A;  2GBX B;  2CK3 H;  3FZW A;  3HZP A;  5KP4 A;  1W4N A;  1IV9 A;  1NU3 A;  3X42 A;  3UL6 A;  1N5H A;  1JJ2 2;  1UI8 A;  2XSO B;  3HOH A;  1BNR A;  2CWV A;  4CJN A;  1GSP A;  1N8Q A;  1RJO A;  3K5T A;  1QMA A;  1GOY A;  2CKF B;  1CEW I;  4L8P A;  1OGX A;  3T8N A;  6STD A;  1IVV A;  5IER A;  3GZR A;  3BU4 A;  1I8V A;  4H61 A;  1JKG B;  5AYS C;  1ASK A;  3V98 A;  5IG5 A;  3K7C A;  1RGL A;  4NPB A;  1M1K 4;  4LEH A;  5LC6 A;  3F7X A;  1IYY A;  4IT7 A;  3JUO A;  1O7G B;  1ULJ B;  3GZX B;  4H3U A;  1G0T A;  3U1W A;  3X41 A;  3KE7 A;  3DGL A;  3X3X A;  4I5Q A;  4NHF A;  2Q07 A;  3WDG B;  5JPP A;  1Z1S A;  1VQQ A;  2QEX 3;  4R1K A;  1W01 A;  2BNG A;  2WOF A;  5BU4 A;  2K54 A;  2ZL8 A;  1Q40 A;  2Z7A A;  4O8S A;  2Y73 A;  3WMD A;  1SJW A;  1DVC A;  4HBR A;  3T0U A;  1L5G B;  3AHS A;  5AYR B;  4R4K A;  3FSD A;  1ROV A;  1LOY A;  1W7C A;  2W2C A;  4O3V A;  1DMN A;  4OVM A;  5AEU B;  2IY2 A;  1WQL B;  3EQQ B;  1JB5 A;  5AI1 A;  3PZW A;  3FCS B;  5KP3 A;  1S5A A;  3A76 A;  5DRE A;  3D5I A;  1RGC A;  1TJD A; 
#chains in the Genus database with same CATH homology
 3VSY A;  2OTJ 3;  2W56 A;  1Q81 4;  3B8L A;  4K1V A;  3EE1 A;  3NQY A;  2CFD A;  1WMP A;  1VQ9 3;  7STD A;  4XM4 A;  3CC4 3;  1NB3 I;  1A67 A;  1EA2 A;  2BHM A;  3DM8 A;  3NX0 A;  3NV0 A;  4HKV B;  2FNQ A;  1TIJ A;  4HJL B;  4R9L A;  4EV5 A;  1NB5 I;  1AVL A;  2INX A;  1TP6 A;  2D42 A;  3B7C A;  3FG3 A;  1GY5 A;  2CWT A;  3GWR A;  3KII A;  4N6T A;  1VQ4 3;  1VQN 3;  2BMQ B;  1YJW 3;  1RN7 A;  2IUJ A;  1G96 A;  1WMO A;  2P0M A;  5AIF A;  2O3O A;  1U5O A;  2E2T A;  3JUP A;  3DGO A;  3OW2 2;  4OUQ A;  5STD A;  5IG3 A;  5BXQ A;  5AII A;  3CPO A;  1YVB I;  4KFE A;  1CYU A;  3OWY A;  3F40 A;  1FGT A;  3MG3 A;  4N6M A;  3UNL A;  1LVN A;  3FGY A;  4N6N B;  4XBT A;  5IG0 A;  1N5P A;  2W9Q A;  3H51 A;  1GS3 A;  1RRL A;  1A90 A;  4KFD A;  3S28 A;  1LNH A;  1IDP A;  1W02 A;  2HMJ B;  1OCV A;  3GZB A;  4U13 A;  3WA2 X;  2A15 A;  1YJ9 3;  1QVF 2;  3PS8 A;  4WYK B;  8CHO A;  4STD A;  1STD A;  2HMK B;  3DXO A;  1M90 4;  1ZX2 A;  3ALA A;  4I4K A;  1R4C A;  4G1M B;  4EBG A;  2GBW B;  2OQE A;  1AV4 A;  3V92 A;  3BNC A;  4FMA A;  5KP1 A;  3HIG A;  4MMY B;  4GB5 A;  5I97 A;  1VQ5 3;  1SII A;  3EN1 B;  1IT8 A;  1JN5 A;  3HK4 A;  1EQK A;  3JVC A;  2GXF A;  1GY6 A;  3UB1 A;  4RNY A;  3SXX A;  3NM7 A;  3Q1C A;  2KXG A;  2OOV C;  4HVN A;  5HGR A;  1JV2 B;  3L0R A;  3EJV A;  3CCV 3;  1US1 A;  2FXT A;  4LZI A;  4MMZ B;  5CLK A;  5FGO A;  1ROA A;  3WOE B;  3X3Z A;  1M9G A;  3LOY A;  4XBX A;  2Y74 A;  3AMO A;  5D82 A;  1LOX A;  1OUN A;  2BO9 B;  5IEP A;  4X2H A;  1YGE A;  4HYZ A;  1SPU A;  2QA4 3;  4ZM8 A;  1CQS A;  1JJ2 2;  4NRE A;  3J7Y d;  4CDL A;  1SQW A;  1W6C A;  4HM0 B;  2YFJ B;  3HI7 A;  4BTW A;  3S27 A;  5IF6 A;  1MOL A;  3IJE B;  2OTL 3;  4JRF A;  2LQV A;  2W03 A;  1VQ6 3;  5JBS A;  2CFG A;  3GRD A;  1EKM A;  1N9J A;  1NWW A;  2YX9 A;  1E3V A;  2JDI H;  3EBT A;  3I0Y A;  2XSH B;  2XEP A;  2ML6 A;  2GEY A;  3EC9 A;  3LH4 A;  1K41 A;  5CF2 A;  4AKY A;  1W2B 2;  1OGZ A;  2GEX A;  3FH1 A;  3BB9 A;  5LC7 A;  2CWU A;  4FMB A;  3EX9 A;  1Q86 4;  3MWZ A;  3S5C A;  3MG2 A;  4AEQ A;  3CCQ 3;  1YI2 3;  2W0Q A;  1O7M B;  3PCR A;  1AR0 A;  1MNL A;  1FGO A;  2W6J H;  2WOH A;  1VQL 3;  3CCR 3;  3KZT A;  1VQP 3;  1UI7 A;  4FMC A;  5CXO A;  2CG1 A;  4N6V 0;  3OX9 A;  3CNM A;  3PYJ A;  1QAL A;  3WOF B;  3LTA A;  1KQS 2;  4MMX B;  2P05 A;  2KRT A;  1ZO2 A;  4O02 B;  5AIH A;  4J9A A;  3K9M C;  3STD A;  1ISK A;  2C11 A;  4R80 A;  3PXM A;  1KD1 4;  2XR8 B;  3G16 A;  1J2B A;  2R4I A;  4J8T A;  3EN8 A;  4HZB B;  1UUV B;  2F99 A;  4R9K A;  1VQK 3;  2CC3 A;  4XDW A;  1A2K A;  3D9R A;  1DYU A;  1JB4 A;  3LML A;  2P0X A;  1JB2 A;  3G71 3;  5DRV A;  3SX1 A;  4EYC A;  3G6E 3;  2GU1 A;  1QAK A;  3CCU 3;  4FMD A;  3RGA A;  1WNH A;  4L8O A;  2M7O A;  3K63 A;  2BT3 A;  3SOA A;  1F8N A;  3IMA B;  3BNE A;  2FGT A;  2CFW A;  3CD6 3;  4K61 A;  3LTC A;  4L7K A;  2E2U A;  2XFT A;  4KFF A;  4Q53 A;  1EG9 B;  1K28 A;  1OH0 A;  4EC6 A;  3F8X A;  1OF5 A;  3DGN A;  4OK0 A;  4XBY A;  5AEW B;  1Q40 B;  3CMA 3;  3M8C A;  2QGU A;  2XGL A;  3O8Y A;  4N6U A;  4RBN A;  5CK6 A;  1ULI B;  4WFO A;  1YJN 3;  3U97 A;  4WHA A;  5ELU A;  3ECF A;  3SLU A;  1QVG 2;  3LZA A;  2XF3 A;  1VQO 3;  1AVK A;  4FCZ A;  2CG0 A;  2MC8 A;  3ER7 A;  1QAF A;  1O7P B;  2WGO A;  3N8B A;  1GD3 A;  1JKG A;  1Q42 A;  3F8H A;  4BTY A;  1VQM 3;  3FKA A;  4HM1 B;  2JQ5 A;  1D6Y A;  3FF0 A;  1IK3 A;  2STD A;  4KZ1 A;  3SED A;  2XGN A;  1DMQ A;  2D1W A;  5G2G A;  4HM4 B;  4XDV A;  3G8Z A;  1V74 A;  1IQX A;  3OXA A;  1E3R A;  4LMI A;  1GYB A;  3PGB A;  3HII A;  1YIT 3;  1OHP A;  3FLJ A;  3G4S 3;  4LSO A;  3NV0 B;  3NBB A;  4WWU C;  1IQY A;  1VQ7 3;  2Z76 A;  3QK9 A;  1VQ8 3;  3D3L A;  1LXE A;  4QWT A;  1U8C B;  3Q2P A;  3B4P A;  4N3V A;  5D81 A;  3X40 A;  1NDO B;  2YFL B;  2RCD A;  1VZZ A;  3CCM 3;  2XFS A;  3F7S A;  3T8U A;  1DMM A;  4IIA A;  2BMO B;  3QRD A;  4WP5 A;  2W04 A;  1K73 4;  1E97 A;  3IPT A;  4KVH A;  3RGR A;  1O7W B;  2MF7 A;  2ML5 A;  5FW5 A;  1TU5 A;  3EB8 A;  4RZM A;  1BUQ A;  4O2H A;  2RGQ A;  3ROB A;  2HMN B;  1Y4K A;  2BMR B;  3B4O A;  2O9U X;  3EBY A;  5TGN A;  1W2Z A;  4FR9 A;  3CCJ 3;  4N6O B;  1IVW A;  2Z6B A;  2RSX A;  2K0M A;  3NM2 A;  1IV7 A;  3MHE A;  3VGN A;  2CFL A;  3BNB A;  3BLZ A;  1KSI A;  1O7H B;  2W9P A;  1Q7Y 4;  1UW1 A;  1W5Z A;  3FG1 A;  4HM6 B;  2HMO B;  1HU9 A;  1FUW A;  3WOD G;  2QIY A;  4BTX A;  2IUK A;  2ZDJ A;  3DMC A;  4GL6 A;  4CCV A;  4K1U A;  1FGM A;  3MG1 A;  1YIJ 3;  3LT9 A;  5EVH A;  4JF8 A;  1JN5 B;  3DY5 A;  1HKX A;  2XH9 A;  3CCL 3;  2B24 B;  1WTH A;  1W00 A;  1M1X B;  1IVX A;  2HML B;  3LT8 A;  3OWS A;  2OOV A;  3BND A;  2P38 A;  2F86 B;  4WYK A;  2V1L A;  1OAC A;  2PZV A;  3Q90 A;  3I56 3;  5CF1 A;  3JUM A;  3AMO B;  3N54 B;  1OPY A;  1O7N B;  1RRH A;  1NJI 4;  2YFI B;  4IPB A;  3CNX A;  2OQE C;  5EQL A;  3NQZ A;  1SIH A;  3JUQ A;  1N9E A;  3H3H A;  2B1X B;  2C10 A;  2F98 A;  3LTB A;  1IU7 A;  5JPU A;  4FCJ A;  3GAX A;  3NBJ A;  3K0Z A;  1C7H A;  1Q82 4;  3FF2 A;  3OV4 A;  3VF1 A;  4ORL A;  1JNQ A;  2IMJ A;  2E2V A;  4HM3 B;  1K8A 4;  4EXR A;  3KSP A;  4LGQ A;  4HM7 B;  2PNC A;  2HMM B;  2P09 A;  3HX8 A;  3PCS A;  4HM2 B;  1W6Y A;  3CU3 A;  1OHO A;  4K90 B;  4MEI A;  3S29 A;  1W6G A;  3E99 A;  5BVB A;  5EEO A;  1IT7 A;  3F14 A;  1IQ8 A;  2CW9 A;  3LTD A;  3CXC 2;  1FA3 A;  3CME 3;  1QJG A;  2CHC A;  3DUK A;  1GY7 A;  4XB5 A;  1FGR A;  5IEN A;  1K9M 4;  4HM8 B;  1TFK A;  1T5Y A;  4HZ9 B;  1NO3 A;  2I9W A;  3CCE 3;  1PU4 A;  2UX0 A;  3KKG A;  5A0O B;  4MJD A;  1GD4 A;  2W56 B;  3TDG A;  2OWP A;  3WA3 A;  3X3Y A;  2GU3 A;  2SBL A;  4EV2 A;  3G0K A;  4N6L A;  3CPW 2;  3CC7 3;  3F9S A;  2OCT A;  3NBR A;  3V99 A;  5IW9 A;  3GZY B;  3DZL A;  1OHS A;  2IA7 A;  1D6Z A;  3KFQ C;  4TX4 A;  3UJM A;  5ELJ A;  3OWU A;  1WMN A;  1RKY A;  1JRQ A;  3MSO A;  3RDE A;  3S67 A;  1UUW B;  3UL5 A;  2CIU A;  5IG4 A;  3CCS 3;  3MPH A;  3CC2 3;  1N8R 4;  4AKZ A;  1S72 3;  5AIG A;  3EHC A;  3NHX A;  1PFP A;  3KN4 A;  3DGM A;  2CFK A;  2KCD A;  1TUH A;  4RNZ A;  1STF I;  3JUN A;  3SOY A;  1DVD A;  3FG4 A;  1D6U A;  1CYV A;  3MKI A;  3EF8 A;  4HM5 B;  1YHQ 3;  2CH9 A;  2WO0 A;  2L4V A;  2RFR A;  2Z77 A;  5IEO A;  3MYT A;  3SVA A;  3NUV A;  4PEJ A;  5D83 A;  3LXU X;  1FGQ A;  2XRX B;  3LYG A;  2LYX A;  1KC8 4;  3NXJ A;  3N9H A;  1OF5 B;  4FCM A;  3KSE D;  3I55 3;  4X2O A;  1TFO A;  1IVU A;  1KWI A;  1A2V A;  2GBX B;  2CK3 H;  3FZW A;  3HZP A;  5KP4 A;  1W4N A;  1IV9 A;  1NU3 A;  3X42 A;  3UL6 A;  1N5H A;  1UI8 A;  2XSO B;  2CWV A;  1N8Q A;  1RJO A;  3K5T A;  1QMA A;  2CKF B;  6STD A;  1CEW I;  4L8P A;  1OGX A;  3T8N A;  5IER A;  1IVV A;  3GZR A;  4H61 A;  1JKG B;  5AYS C;  1ASK A;  3V98 A;  5IG5 A;  3K7C A;  1M1K 4;  4LEH A;  5LC6 A;  3F7X A;  4IT7 A;  3JUO A;  1O7G B;  1ULJ B;  3GZX B;  4H3U A;  3U1W A;  3X41 A;  3KE7 A;  3DGL A;  3X3X A;  4NHF A;  2Q07 A;  3WDG B;  5JPP A;  1Z1S A;  2QEX 3;  4R1K A;  2WOF A;  1W01 A;  2BNG A;  2K54 A;  2ZL8 A;  1Q40 A;  2Z7A A;  4O8S A;  2Y73 A;  3WMD A;  1SJW A;  1DVC A;  4HBR A;  3T0U A;  1L5G B;  5AYR B;  4R4K A;  3FSD A;  1ROV A;  1W7C A;  2W2C A;  4O3V A;  1DMN A;  4OVM A;  5AEU B;  1WQL B;  3EQQ B;  1JB5 A;  5AI1 A;  3PZW A;  3FCS B;  5KP3 A;  1S5A A;  3A76 A;  5DRE A;  2WGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...