3DGOA

A non-biological atp binding protein with a tyr-phe mutation in the ligand binding domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIFNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP Binding Protein-DX
publication title A synthetic protein selected for ligand binding affinity mediates ATP hydrolysis.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dgoA00
3LTAA 3LT9A 1UW1A 3DGMA 2P05A 3DGOA 3LT8A 2P09A 3LTCA 3LTDA 3DGLA 3DGNA 2P0XA 3LTBA
chains in the Genus database with same CATH superfamily
1JB4A 2HOHA 5BVBA 3Q1CA 3KSED 3BIRA 1QJGA 3FKAA 3NV0B 1UDII 4R4KA 5A0OB 1K41A 3T8UA 1B2UA 3DGYA 1BUQA 4GSPA 3FF2A 1D6ZA 3IPTA 2IY2A 1AY7A 4HM8B 3PS8A 3SXXA 1YGWA 1JKGB 2CIUA 3JUMA 4J8TA 2AAEA 3RGAA 1U5OA 2Y73A 3DM8A 3J7Yd 2CKFB 3WMDA 1VQ73 1G96A 1I8VA 3BB9A 3DGLA 3X41A 3GZYB 1K9M4 1T3BA 1FUWA 2MC8A 1VQL3 1W5ZA 3H3HA 2IA7A 2WOHA 1E3VA 1GMRA 3AHSA 2XGLA 5BU4A 2UX0A 3ZG5A 2BHMA 1ZS7A 3AGOA 3DZLA 3GZRA 3NM2A 2OWPA 3DY5A 3K5TA 5D83A 1LOXA 5JPPA 1VQ43 1BNEA 3LOYA 4HZBB 1JV2B 3DGMA 1B21A 4EV5A 8CHOA 3CCQ3 1RNTA 4NHFA 3I563 1V58A 1VQK3 2ZL8A 1W6CA 4K90B 3DGNA 2IUKA 1BNRA 3S67A 2H0HA 2FXTA 3MKIA 1I2FA 1OGZA 3NXJA 2GEYA 1GMPA 3X42A 4CPKA 3S5CA 1Q40A 3PCSA 5EQLA 1RLSA 5FW5A 3AMOA 2YFLB 4N6NB 5G1KA 1YVBI 2IMJA 2LYXA 1BNJA 1C7HA 4OVMA 3K9MC 4L8OA 2SBLA 4XB5A 4XM4A 4AEQA 1BVIA 1EEJA 1D6YA 1T2IA 3RDEA 4AKZA 1GD4A 1N8R4 2C4BA 4XBTA 5AIIA 1YIJ3 1J2BA 4FMDA 3EN8A 3EQQB 5CF1A 1KQS2 1RDSA 3FZWA 1BRHA 1Q824 2B1XB 1VQ93 1K28A 3KN4A 1ROAA 5IEOA 2C11A 1IVWA 3GWRA 4BTYA 1DVDA 1FGTA 2XRXB 1RSNA 3M8CA 1MGRA 4MMZB 3TDGA 3HZPA 1MNLA 5M19A 2J8XB 3UL6A 4O2HA 4CCVA 2W0QA 4WWUC 1Q40B 1ROVA 5ELUA 1HYFA 4WHAA 3AMOB 1IV9A 1QALA 1W02A 1N9EA 2LQVA 1AQZA 3F7SA 3G16A 4FR9A 2HMJB 3FG4A 2IUJA 3HIGA 1QVG2 3D9RA 1GOYA 4HM4B 1PY3A 1W6YA 5M18A 3G713 2OOVA 1YI23 3EHCA 2QA43 3HK4A 3RNTA 4BIRA 1K8A4 1BRSA 1JB2A 3HOHA 3I0YA 1IK3A 1OF5A 2CG1A 1Y4KA 1OH0A 1BSDA 1CYVA 2C10A 3CPOA 3BNCA 4FMCA 4BL2A 2B24B 4TX4A 1M1XB 1UUVB 1N9JA 2BU4A 3SYUA 6STDA 4G1MB 3STDA 4HM0B 5IG5A 1Q864 1W6GA 2F99A 1D6UA 1NWWA 1OHSA 5G1LA 3MG1A 6GSPA 4NREA 1B2MA 2PNCA 3D3LA 1FYSA 1FGOA 5M1AA 3U97A 3Q3FA 2GU1A 1BU4A 3G6E3 2E2UA 2KXGA 5ELJA 4J9AA 2QEX3 2K54A 1OF5B 1O7GB 4HM7B 4PEJA 1RJOA 1KC84 3MG3A 3OX9A 4BU4A 1UUGB 4R9KA 3WODG 2ML6A 4K1VA 1OHOA 1LQMB 2W6JH 3EX9A 3KZTA 2STDA 4HM5B 1RGAA 1S723 4Q53A 5IW9A 1T2HA 2O3OA 3BNEA 3JUQA 3KE7A 1IQXA 2CX0A 4ORLA 2Y74A 3OWUA 4HM1B 3EBYA 5JPUA 3N9HA 1IV7A 1FW7A 2CK3H 1HU9A 3B4PA 4HYZA 1IVVA 2CFKA 4LMIA 8RNTA 1A67A 3FH1A 2Q07A 3LTCA 3LXUX 1TRPA 5AI1A 1IT7A 3ER7A 3JVCA 3KCHA 1IQ8A 2OQEC 2XGNA 1MWUA 3EB8A 4I5QA 3NQZA 3GAXA 1B3SA 2RBIA 3LH4A 1UCLA 5DREA 1DE3A 1BGSA 1BSEA 1TJDA 1UI8A 1RRHA 2QIYA 4OUQA 4XBYA 3GSPA 1SARA 3Q2PA 2GBWB 3PGBA 1RCLA 1SQWA 3BU4A 2K3DA 2R4IA 2WOFA 4KFDA 5GSPA 3CME3 2CWVA 1PU4A 4FMBA 5LC6A 1FGRA 4U13A 4NPBA 5CXOA 2ML5A 1GYBA 1HKXA 2YX9A 3KFQC 5IG0A 3CXC2 1LOVA 4J5GA 1W4NA 3AHWA 2CX1A 2HMKB 2WO0A 3A5EA 1NJI4 2H0IA 3ALAA 4IT7A 4HKVB 4HAAA 5IF6A 2AADA 3X3XA 1JRQA 1UCIA 2P05A 1YJW3 3CU3A 1YHQ3 3NM7A 1VQQA 1JN5A 1BSAA 4RNTA 3CCE3 3CCR3 3CCU3 1BRNL 3CNXA 4MMXB 4IPBA 1WTHA 1M9GA 1YVSA 2KCDA 2BMQB 3DH2A 1W2B2 5AIHA 3MG2A 3D4AA 1Q42A 1CEWI 2IYJA 3BNDA 3VSYA 4J5KA 2Z77A 2XH9A 4EYCA 1OACA 1BSCA 2UGIA 4O02B 5CF2A 2F86B 1OGXA 2F56A 4N6MA 3ROBA 1AV4A 3F14A 2R41A 2CFGA 1VQN3 2CW9A 3PZWA 3HX8A 2FGTA 1JZDA 5IEPA 1VQP3 5IENA 4L7KA 1QAFA 1V74A 3JUNA 4K61A 3F8HA 2P38A 3CNMA 2CFWA 2W04A 1X1XA 2H0GA 1TUHA 1NB5I 1M1K4 1JN5B 2KAAA 2YFIB 1ASKA 3OXAA 3SOAA 2QGUA 1I70A 1DETA 2W2CA 2XSHB 2F98A 2CFDA 3S27A 4O3VA 3LMLA 2KRTA 4N6V0 3V98A 3RGRA 4MJDA 3CPW2 3IJEB 2O9UX 4FMAA 3V99A 4FCMA 3WA2X 1E3RA 1W00A 4EXRA 1FGMA 3NBRA 3PCRA 3EC9A 5G2GA 3S29A 3OW22 3MHEA 3UL5A 3WR2A 3LZAA 1KD14 2BNGA 1RN7A 1I0XA 1ZX2A 3D5GA 1BNFA 2OTL3 3B4OA 9RNTA 1KSIA 2WGQA 4OK0A 1IU7A 4MMYB 5IG4A 3I553 1I3IA 3N54B 4LGQA 3UJMA 2W03A 1ULJB 3VF1A 1TIJA 1N5PA 3O8YA 3LT8A 1M904 2XSOB 1LRAA 2W9PA 3SOYA 1TTOA 2E2TA 1Z1SA 5AYRB 2GSPA 1US1A 3SX1A 4XDVA 1Q9EA 2D1WA 1YNVX 3EN1B 2YFJB 1NB3I 1SJWA 2BO9B 4BL3A 1WQLB 7GSPA 1K734 3WHOA 4O8SA 2P0XA 4R80A 6RNTA 1NO3A 1PYLA 1RTUA 2W56A 5JBSA 3V92A 3CC23 4KT3B 3FG1A 5EEOA 2PZVA 3X3ZA 4X2OA 3HIIA 3T0UA 1OHPA 1GY7A 2OCTA 1RGGA 4HM2B 3B7CA 1G0TA 4HBRA 4LEHA 2HMLB 2HMOB 4WP5A 1STFI 2P0MA 3WOEB 3SEDA 4WYKA 1Q814 2INXA 1UCKA 1BRGA 2CWTA 4R1KA 3D5IA 5HGRA 1QVF2 1B27A 4LYLB 4FCJA 1E97A 4K1UA 2RGQA 1RGLA 1UW1A 3K0ZA 3CCM3 2WGOA 2GBXB 1VQ53 3A76A 3QK9A 2W56B 1UCJA 4ZM8A 1JJ22 1X1WA 3KIIA 3LYGA 3LT9A 3WOFB 5AIFA 2CH9A 1C54A 1O7PB 1W2ZA 1RN1A 3OV4A 1RNBA 4HM6B 3NUVA 3JUOA 1TU5A 1VQ63 2F5MA 1SIIA 5IERA 3DXOA 4N6UA 2RNTA 4GB5A 3NHXA 3NQYA 1QMAA 1RMSA 1DVCA 3ECFA 3IMAB 2KF3A 4BTXA 1FGQA 2KF6A 4N6OB 1SPUA 1MWRA 1TFKA 4KFFA 1Q7HA 1CYUA 2ZHXB 1BNIA 1LVNA 1NU3A 2E2VA 4XBXA 3EJVA 4HJLB 1DYUA 4MEIA 2P09A 1G02A 1LXEA 1B2SA 1X1UA 1DMQA 1WMNA 4ILFA 3CCJ3 3E99A 1O7WB 3WA3A 4KVHA 1W01A 1S5AA 1UI7A 3CD63 3CC43 1R4CA 5AYSC 2FNQA 3URPA 3GZXB 1Q7Y4 3NBJA 3KSPA 2GXFA 4LSOA 1CH0A 2W9QA 2V1LA 3BLZA 3T8NA 4DKIA 1JZOA 4HM3B 5TGNA 1O7HB 2GEXA 1EUIC 1MOLA 1UGIA 3EE1A 3X3YA 1IYYA 1BAOA 1MWTA 1MWSA 7STDA 1AR0A 2CFLA 2XF3A 3MPHA 4LZIA 1I3FA 2L1SA 2F4YA 3SVAA 3SLUA 5IG3A 1YJ93 2XEPA 1IDPA 2KF4A 3CC73 4EW5A 2CHCA 3DMCA 4GL6A 1WMOA 4RZMA 1BIRA 2RCDA 2KF5A 1RGEA 5CK6A 1GD3A 1OPYA 1A2PA 3X40A 1JB5A 1U8CB 3BNBA 1OUNA 2XFTA 1O7MB 3U1WA 3NBBA 4JF8A 4X2HA 1QAKA 3HI7A 1L5GB 1STDA 4RBNA 1SIHA 3LTDA 2F5WA 4WFOA 1VQO3 1YJN3 2Z6BA 1EA2A 4QWTA 1LQGC 3UNLA 2MF7A 3CCL3 5LC7A 3QRDA 1B20A 1N8QA 1EQKA 1WNHA 4H61A 5KP1A 3F8XA 3K63A 1TP6A 3L0RA 3CCV3 3LTAA 2Z76A 1FUSA 4HVNA 7RNTA 1KWIA 5HOHA 1YIT3 4N6TA 2XR8B 1BUJA 4KZ1A 1BANA 1BNGA 1DMNA 1A2VA 1LOYA 1RRLA 2CWUA 1YGEA 2HMNB 1I2GA 2BT3A 1PFPA 4KFEA 1UUWB 4RNYA 1FUTA 3CMA3 3KKGA 3F40A 2BMOB 1RCKA 3MWZA 1BRJA 3ZG0A 1RGCA 1LOWA 1RGFA 1ZO2A 2CC3A 2RFRA 3FLJA 2XFSA 5D82A 1GSPA 3N8BA 3DGOA 1OCVA 4BTWA 1EKMA 2ZA4A 3JUPA 4JRFA 1T5YA 2GU3A 5AEWB 3GRDA 1N5HA 3EF8A 1AVLA 3Q90A 1JBTA 2BIRA 1A2KA 1MGWA 1NNVA 1VZZA 3D79A 3FF0A 1BRKA 1LNIA 1B2XA 1I0VA 1AVKA 1RGHA 1RN4A 2OQEA 3FG3A 5KP4A 3UB1A 5STDA 1BNSA 1UGHI 3EBTA 2I9WA 3MYTA 1BOXA 2CG0A 2UUGC 1CQSA 1FZUA 4N3VA 2SARA 1GMQA 3G8ZA 1IVUA 1RGKA 2HMMB 3B8LA 4HOHA 1JNQA 1GOUA 5RNTA 5AIGA 4CDLA 4GHOA 2ZDJA 5I97A 2M7OA 3G4S3 4CJNA 3AGNA 3LTBA 4EV2A 1DMMA 1GS3A 1V57A 1BRIA 1VQ83 4EC6A 3OWYA 1F8NA 2OTJ3 1IT8A 1TRQA 4L8PA 1ISKA 1X1YA 2D42A 3NX0A 1BSBA 1O7NB 5DRVA 3VGNA 5EVHA 4H3UA 3CCS3 4I4KA 3G0KA 1JBSA 3S28A 1IVXA 1RKYA 1FA3A 4AKYA 1EG9B 2RSXA 3DUKA 2L4VA 3PXMA 4EBGA 5D81A 4RNZA 3NV0A 1ZGXA 5KP3A 5AEUB 5BIRA 2BMRB 4XDWA 2K0MA 3K7CA 4WYKB 2OOVC 3ZFZA 4STDA 3FCSB 1GY6A 3WDGB 1GOVA 1I2EA 1LNHA 3MSOA 1VQM3 4HZ9B 3H51A 1JKGA 1W7CA 3FSDA 4N6LA 5CLKA 1A90A 5FGOA 2JQ5A 1WMPA 2JDIH 1NDOB 4R9LA 2Z7AA 3OWSA 2A15A 1IQYA 1HZ1A 3F9SA 3F7XA 3FGYA 1GY5A 3GZBA 4FCZA 5BXQA 1JBRA 1RHLA 4IIAA 1TFOA 3PYJA 1B2ZA 1ULIB 1R4YA
chains in the Genus database with same CATH topology
1JB4A 5BVBA 3Q1CA 3KSED 1QJGA 3FKAA 3NV0B 4R4KA 5A0OB 1K41A 3T8UA 1BUQA 3FF2A 1D6ZA 3IPTA 4HM8B 3PS8A 3SXXA 2CIUA 1JKGB 3JUMA 4J8TA 3RGAA 1U5OA 2Y73A 3DM8A 3J7Yd 2CKFB 3WMDA 1VQ73 1G96A 3BB9A 3DGLA 3X41A 3GZYB 1K9M4 1FUWA 2MC8A 1VQL3 1W5ZA 3H3HA 2IA7A 2WOHA 1E3VA 2XGLA 2UX0A 2BHMA 3DZLA 3GZRA 3NM2A 2OWPA 3DY5A 3K5TA 5D83A 1LOXA 5JPPA 1VQ43 3LOYA 4HZBB 1JV2B 3DGMA 4EV5A 8CHOA 3CCQ3 4NHFA 3I563 1VQK3 2ZL8A 1W6CA 4K90B 3DGNA 2IUKA 3S67A 2FXTA 3MKIA 1OGZA 3NXJA 2GEYA 3X42A 3S5CA 1Q40A 3PCSA 5EQLA 5FW5A 3AMOA 2YFLB 4N6NB 1YVBI 2IMJA 2LYXA 1C7HA 4OVMA 4XB5A 3K9MC 4L8OA 2SBLA 4XM4A 4AEQA 1D6YA 3RDEA 4AKZA 1GD4A 1N8R4 4XBTA 5AIIA 1YIJ3 1J2BA 4FMDA 3EN8A 3EQQB 5CF1A 1KQS2 3FZWA 1Q824 2B1XB 1VQ93 1K28A 3KN4A 1ROAA 5IEOA 2C11A 1IVWA 3GWRA 4BTYA 1DVDA 1FGTA 2XRXB 3M8CA 4MMZB 3TDGA 3HZPA 1MNLA 3UL6A 4CCVA 4O2HA 2W0QA 4WWUC 1Q40B 1ROVA 5ELUA 4WHAA 3AMOB 1IV9A 2LQVA 1QALA 1N9EA 1W02A 3F7SA 3G16A 4FR9A 2IUJA 2HMJB 3FG4A 3HIGA 1QVG2 3D9RA 4HM4B 1W6YA 3G713 2OOVA 1YI23 3EHCA 2QA43 3HK4A 1K8A4 1JB2A 3I0YA 1IK3A 1OF5A 2CG1A 1Y4KA 1OH0A 1CYVA 2C10A 3CPOA 4FMCA 3BNCA 2B24B 4TX4A 1M1XB 1UUVB 1N9JA 6STDA 4G1MB 3STDA 4HM0B 5IG5A 1Q864 1W6GA 2F99A 1D6UA 1NWWA 1OHSA 3MG1A 4NREA 2PNCA 3D3LA 1FGOA 3U97A 2GU1A 3G6E3 2E2UA 2KXGA 5ELJA 4J9AA 2QEX3 2K54A 1OF5B 1O7GB 4HM7B 4PEJA 1RJOA 1KC84 3MG3A 3OX9A 4R9KA 3WODG 2ML6A 4K1VA 1OHOA 2W6JH 3EX9A 3KZTA 2STDA 4HM5B 1S723 4Q53A 5IW9A 2O3OA 3BNEA 3JUQA 3KE7A 1IQXA 4ORLA 2Y74A 3OWUA 4HM1B 3EBYA 5JPUA 3N9HA 1IV7A 2CK3H 1HU9A 3B4PA 4HYZA 1IVVA 2CFKA 4LMIA 1A67A 3FH1A 2Q07A 3LTCA 3LXUX 5AI1A 1IT7A 3ER7A 3JVCA 1IQ8A 2OQEC 2XGNA 3EB8A 3NQZA 3GAXA 3LH4A 5DREA 1UI8A 4XBYA 2QIYA 1RRHA 4OUQA 3Q2PA 2GBWB 3PGBA 1SQWA 4KFDA 2R4IA 2WOFA 3CME3 2CWVA 1PU4A 4FMBA 5LC6A 1FGRA 4U13A 5CXOA 2ML5A 1GYBA 1HKXA 2YX9A 3KFQC 5IG0A 3CXC2 1W4NA 2HMKB 2WO0A 1NJI4 3ALAA 4IT7A 4HKVB 5IF6A 3X3XA 1JRQA 2P05A 1YJW3 3CU3A 1YHQ3 3NM7A 1JN5A 3CCE3 3CCR3 3CCU3 3CNXA 4MMXB 4IPBA 1WTHA 1M9GA 2KCDA 2BMQB 1W2B2 5AIHA 3MG2A 1Q42A 1CEWI 3BNDA 3VSYA 4EYCA 2Z77A 2XH9A 1OACA 4O02B 5CF2A 2F86B 1OGXA 4N6MA 3ROBA 1AV4A 3F14A 2CFGA 1VQN3 2CW9A 3PZWA 3HX8A 2FGTA 5IEPA 1VQP3 5IENA 4L7KA 1QAFA 1V74A 4K61A 3F8HA 2P38A 3CNMA 2CFWA 2W04A 1TUHA 1NB5I 1M1K4 1JN5B 2YFIB 1ASKA 3OXAA 3SOAA 2QGUA 2W2CA 2XSHB 2F98A 2CFDA 3S27A 4O3VA 3LMLA 2KRTA 4N6V0 3V98A 3RGRA 4MJDA 3CPW2 3IJEB 2O9UX 4FMAA 3V99A 4FCMA 3WA2X 1E3RA 1W00A 4EXRA 1FGMA 3NBRA 3PCRA 3EC9A 5G2GA 3S29A 3OW22 3MHEA 3UL5A 3LZAA 1KD14 2BNGA 1RN7A 1ZX2A 2OTL3 3B4OA 1KSIA 2WGQA 4OK0A 1IU7A 4MMYB 5IG4A 3I553 3N54B 4LGQA 3UJMA 2W03A 1ULJB 3VF1A 1TIJA 1N5PA 3O8YA 3LT8A 1M904 2XSOB 2W9PA 3SOYA 2E2TA 1Z1SA 5AYRB 1US1A 3SX1A 4XDVA 2D1WA 3EN1B 2YFJB 1NB3I 1SJWA 2BO9B 1WQLB 1K734 4O8SA 2P0XA 4R80A 1NO3A 2W56A 5JBSA 3V92A 3CC23 3FG1A 5EEOA 2PZVA 3X3ZA 4X2OA 3HIIA 3T0UA 1OHPA 1GY7A 2OCTA 4HM2B 3B7CA 4LEHA 4HBRA 2HMLB 2HMOB 4WP5A 1STFI 2P0MA 3WOEB 3SEDA 4WYKA 1Q814 2INXA 2CWTA 4R1KA 1QVF2 5HGRA 4FCJA 1E97A 4K1UA 2RGQA 1UW1A 3K0ZA 3CCM3 2WGOA 2GBXB 1VQ53 3A76A 3QK9A 2W56B 4ZM8A 1JJ22 3KIIA 3LYGA 3LT9A 3WOFB 5AIFA 2CH9A 1O7PB 1W2ZA 3OV4A 4HM6B 3NUVA 3JUOA 1TU5A 1VQ63 1SIIA 5IERA 3DXOA 4N6UA 4GB5A 3NHXA 3NQYA 1QMAA 1DVCA 3ECFA 3IMAB 4BTXA 1FGQA 4N6OB 1SPUA 1TFKA 4KFFA 1CYUA 1LVNA 1NU3A 2E2VA 4XBXA 3EJVA 4HJLB 1DYUA 4MEIA 2P09A 1LXEA 1DMQA 1WMNA 3CCJ3 3E99A 1O7WB 3WA3A 4KVHA 1W01A 1S5AA 1UI7A 3CD63 3CC43 1R4CA 5AYSC 2FNQA 1Q7Y4 3GZXB 3NBJA 3KSPA 2GXFA 4LSOA 2W9QA 2V1LA 3BLZA 3T8NA 4HM3B 5TGNA 1O7HB 2GEXA 1MOLA 3EE1A 3X3YA 7STDA 1AR0A 2CFLA 2XF3A 3MPHA 4LZIA 3SVAA 3SLUA 5IG3A 1YJ93 2XEPA 1IDPA 3CC73 2CHCA 3DMCA 4GL6A 1WMOA 4RZMA 2RCDA 5CK6A 1GD3A 1OPYA 3X40A 1JB5A 1U8CB 3BNBA 1OUNA 2XFTA 1O7MB 3U1WA 3NBBA 4JF8A 4X2HA 1QAKA 3HI7A 1L5GB 1STDA 4RBNA 1SIHA 3LTDA 4WFOA 1VQO3 1YJN3 2Z6BA 1EA2A 4QWTA 3UNLA 2MF7A 3CCL3 5LC7A 3QRDA 1N8QA 1EQKA 1WNHA 4H61A 5KP1A 3F8XA 3K63A 1TP6A 3L0RA 3CCV3 3LTAA 2Z76A 4HVNA 1KWIA 1YIT3 4N6TA 2XR8B 4KZ1A 1DMNA 1A2VA 1RRLA 2CWUA 1YGEA 2HMNB 2BT3A 1PFPA 4KFEA 1UUWB 4RNYA 3CMA3 3KKGA 3F40A 2BMOB 3MWZA 2RFRA 1ZO2A 2CC3A 3FLJA 2XFSA 5D82A 3N8BA 3DGOA 1OCVA 4BTWA 1EKMA 4JRFA 3JUPA 1T5YA 2GU3A 5AEWB 3GRDA 1N5HA 3EF8A 1AVLA 3Q90A 1A2KA 1VZZA 3FF0A 3JUNA 2OQEA 5KP4A 1AVKA 3FG3A 3UB1A 5STDA 3EBTA 2I9WA 3MYTA 2CG0A 4N3VA 1CQSA 3G8ZA 1IVUA 2HMMB 3B8LA 1JNQA 5AIGA 4CDLA 2ZDJA 5I97A 2M7OA 3G4S3 3LTBA 4EV2A 1DMMA 1GS3A 1VQ83 4EC6A 3OWYA 1F8NA 2OTJ3 1IT8A 4L8PA 1ISKA 2D42A 3NX0A 1O7NB 5DRVA 3VGNA 5EVHA 4H3UA 3CCS3 4I4KA 3G0KA 3S28A 1IVXA 1RKYA 1FA3A 4AKYA 1EG9B 2RSXA 3DUKA 2L4VA 3PXMA 4EBGA 5D81A 4RNZA 3NV0A 5KP3A 5AEUB 2BMRB 4XDWA 2K0MA 3K7CA 4WYKB 2OOVC 4STDA 3FCSB 1GY6A 3WDGB 1LNHA 1VQM3 3MSOA 4HZ9B 3H51A 1JKGA 1W7CA 3FSDA 4N6LA 5CLKA 1A90A 5FGOA 2JQ5A 1WMPA 2JDIH 1NDOB 4R9LA 2Z7AA 3OWSA 2A15A 1IQYA 3F9SA 3F7XA 3FGYA 1GY5A 3GZBA 4FCZA 5BXQA 4IIAA 1TFOA 3PYJA 1ULIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTA A;  3LT9 A;  1UW1 A;  3DGM A;  2P05 A;  3DGO A;  3LT8 A;  2P09 A;  3LTC A;  3LTD A;  3DGL A;  3DGN A;  2P0X A;  3LTB A; 
#chains in the Genus database with same CATH topology
 1JB4 A;  2HOH A;  5BVB A;  3Q1C A;  3KSE D;  3BIR A;  1QJG A;  3FKA A;  3NV0 B;  1UDI I;  4R4K A;  5A0O B;  1K41 A;  3T8U A;  1B2U A;  3DGY A;  1BUQ A;  4GSP A;  3FF2 A;  1D6Z A;  3IPT A;  2IY2 A;  1AY7 A;  4HM8 B;  3PS8 A;  3SXX A;  1YGW A;  1JKG B;  2CIU A;  3JUM A;  4J8T A;  2AAE A;  3RGA A;  1U5O A;  2Y73 A;  3DM8 A;  3J7Y d;  2CKF B;  3WMD A;  1VQ7 3;  1G96 A;  1I8V A;  3BB9 A;  3DGL A;  3X41 A;  3GZY B;  1K9M 4;  1T3B A;  1FUW A;  2MC8 A;  1VQL 3;  1W5Z A;  3H3H A;  2IA7 A;  2WOH A;  1E3V A;  1GMR A;  3AHS A;  2XGL A;  5BU4 A;  2UX0 A;  3ZG5 A;  2BHM A;  1ZS7 A;  3AGO A;  3DZL A;  3GZR A;  3NM2 A;  2OWP A;  3DY5 A;  3K5T A;  5D83 A;  1LOX A;  5JPP A;  1VQ4 3;  1BNE A;  3LOY A;  4HZB B;  1JV2 B;  3DGM A;  1B21 A;  4EV5 A;  8CHO A;  3CCQ 3;  1RNT A;  4NHF A;  3I56 3;  1V58 A;  1VQK 3;  2ZL8 A;  1W6C A;  4K90 B;  3DGN A;  2IUK A;  1BNR A;  3S67 A;  2H0H A;  2FXT A;  3MKI A;  1I2F A;  1OGZ A;  3NXJ A;  2GEY A;  1GMP A;  3X42 A;  4CPK A;  3S5C A;  1Q40 A;  3PCS A;  5EQL A;  1RLS A;  5FW5 A;  3AMO A;  2YFL B;  4N6N B;  5G1K A;  1YVB I;  2IMJ A;  2LYX A;  1BNJ A;  1C7H A;  4OVM A;  3K9M C;  4L8O A;  2SBL A;  4XB5 A;  4XM4 A;  4AEQ A;  1BVI A;  1EEJ A;  1D6Y A;  1T2I A;  3RDE A;  4AKZ A;  1GD4 A;  1N8R 4;  2C4B A;  4XBT A;  5AII A;  1YIJ 3;  1J2B A;  4FMD A;  3EN8 A;  3EQQ B;  5CF1 A;  1KQS 2;  1RDS A;  3FZW A;  1BRH A;  1Q82 4;  2B1X B;  1VQ9 3;  1K28 A;  3KN4 A;  1ROA A;  5IEO A;  2C11 A;  1IVW A;  3GWR A;  4BTY A;  1DVD A;  1FGT A;  2XRX B;  1RSN A;  3M8C A;  1MGR A;  4MMZ B;  3TDG A;  3HZP A;  1MNL A;  5M19 A;  2J8X B;  3UL6 A;  4O2H A;  4CCV A;  2W0Q A;  4WWU C;  1Q40 B;  1ROV A;  5ELU A;  1HYF A;  4WHA A;  3AMO B;  1IV9 A;  1QAL A;  1W02 A;  1N9E A;  2LQV A;  1AQZ A;  3F7S A;  3G16 A;  4FR9 A;  2HMJ B;  3FG4 A;  2IUJ A;  3HIG A;  1QVG 2;  3D9R A;  1GOY A;  4HM4 B;  1PY3 A;  1W6Y A;  5M18 A;  3G71 3;  2OOV A;  1YI2 3;  3EHC A;  2QA4 3;  3HK4 A;  3RNT A;  4BIR A;  1K8A 4;  1BRS A;  1JB2 A;  3HOH A;  3I0Y A;  1IK3 A;  1OF5 A;  2CG1 A;  1Y4K A;  1OH0 A;  1BSD A;  1CYV A;  2C10 A;  3CPO A;  3BNC A;  4FMC A;  4BL2 A;  2B24 B;  4TX4 A;  1M1X B;  1UUV B;  1N9J A;  2BU4 A;  3SYU A;  6STD A;  4G1M B;  3STD A;  4HM0 B;  5IG5 A;  1Q86 4;  1W6G A;  2F99 A;  1D6U A;  1NWW A;  1OHS A;  5G1L A;  3MG1 A;  6GSP A;  4NRE A;  1B2M A;  2PNC A;  3D3L A;  1FYS A;  1FGO A;  5M1A A;  3U97 A;  3Q3F A;  2GU1 A;  1BU4 A;  3G6E 3;  2E2U A;  2KXG A;  5ELJ A;  4J9A A;  2QEX 3;  2K54 A;  1OF5 B;  1O7G B;  4HM7 B;  4PEJ A;  1RJO A;  1KC8 4;  3MG3 A;  3OX9 A;  4BU4 A;  1UUG B;  4R9K A;  3WOD G;  2ML6 A;  4K1V A;  1OHO A;  1LQM B;  2W6J H;  3EX9 A;  3KZT A;  2STD A;  4HM5 B;  1RGA A;  1S72 3;  4Q53 A;  5IW9 A;  1T2H A;  2O3O A;  3BNE A;  3JUQ A;  3KE7 A;  1IQX A;  2CX0 A;  4ORL A;  2Y74 A;  3OWU A;  4HM1 B;  3EBY A;  5JPU A;  3N9H A;  1IV7 A;  1FW7 A;  2CK3 H;  1HU9 A;  3B4P A;  4HYZ A;  1IVV A;  2CFK A;  4LMI A;  8RNT A;  1A67 A;  3FH1 A;  2Q07 A;  3LTC A;  3LXU X;  1TRP A;  5AI1 A;  1IT7 A;  3ER7 A;  3JVC A;  3KCH A;  1IQ8 A;  2OQE C;  2XGN A;  1MWU A;  3EB8 A;  4I5Q A;  3NQZ A;  3GAX A;  1B3S A;  2RBI A;  3LH4 A;  1UCL A;  5DRE A;  1DE3 A;  1BGS A;  1BSE A;  1TJD A;  1UI8 A;  1RRH A;  2QIY A;  4OUQ A;  4XBY A;  3GSP A;  1SAR A;  3Q2P A;  2GBW B;  3PGB A;  1RCL A;  1SQW A;  3BU4 A;  2K3D A;  2R4I A;  2WOF A;  4KFD A;  5GSP A;  3CME 3;  2CWV A;  1PU4 A;  4FMB A;  5LC6 A;  1FGR A;  4U13 A;  4NPB A;  5CXO A;  2ML5 A;  1GYB A;  1HKX A;  2YX9 A;  3KFQ C;  5IG0 A;  3CXC 2;  1LOV A;  4J5G A;  1W4N A;  3AHW A;  2CX1 A;  2HMK B;  2WO0 A;  3A5E A;  1NJI 4;  2H0I A;  3ALA A;  4IT7 A;  4HKV B;  4HAA A;  5IF6 A;  2AAD A;  3X3X A;  1JRQ A;  1UCI A;  2P05 A;  1YJW 3;  3CU3 A;  1YHQ 3;  3NM7 A;  1VQQ A;  1JN5 A;  1BSA A;  4RNT A;  3CCE 3;  3CCR 3;  3CCU 3;  1BRN L;  3CNX A;  4MMX B;  4IPB A;  1WTH A;  1M9G A;  1YVS A;  2KCD A;  2BMQ B;  3DH2 A;  1W2B 2;  5AIH A;  3MG2 A;  3D4A A;  1Q42 A;  1CEW I;  2IYJ A;  3BND A;  3VSY A;  4J5K A;  2Z77 A;  2XH9 A;  4EYC A;  1OAC A;  1BSC A;  2UGI A;  4O02 B;  5CF2 A;  2F86 B;  1OGX A;  2F56 A;  4N6M A;  3ROB A;  1AV4 A;  3F14 A;  2R41 A;  2CFG A;  1VQN 3;  2CW9 A;  3PZW A;  3HX8 A;  2FGT A;  1JZD A;  5IEP A;  1VQP 3;  5IEN A;  4L7K A;  1QAF A;  1V74 A;  3JUN A;  4K61 A;  3F8H A;  2P38 A;  3CNM A;  2CFW A;  2W04 A;  1X1X A;  2H0G A;  1TUH A;  1NB5 I;  1M1K 4;  1JN5 B;  2KAA A;  2YFI B;  1ASK A;  3OXA A;  3SOA A;  2QGU A;  1I70 A;  1DET A;  2W2C A;  2XSH B;  2F98 A;  2CFD A;  3S27 A;  4O3V A;  3LML A;  2KRT A;  4N6V 0;  3V98 A;  3RGR A;  4MJD A;  3CPW 2;  3IJE B;  2O9U X;  4FMA A;  3V99 A;  4FCM A;  3WA2 X;  1E3R A;  1W00 A;  4EXR A;  1FGM A;  3NBR A;  3PCR A;  3EC9 A;  5G2G A;  3S29 A;  3OW2 2;  3MHE A;  3UL5 A;  3WR2 A;  3LZA A;  1KD1 4;  2BNG A;  1RN7 A;  1I0X A;  1ZX2 A;  3D5G A;  1BNF A;  2OTL 3;  3B4O A;  9RNT A;  1KSI A;  2WGQ A;  4OK0 A;  1IU7 A;  4MMY B;  5IG4 A;  3I55 3;  1I3I A;  3N54 B;  4LGQ A;  3UJM A;  2W03 A;  1ULJ B;  3VF1 A;  1TIJ A;  1N5P A;  3O8Y A;  3LT8 A;  1M90 4;  2XSO B;  1LRA A;  2W9P A;  3SOY A;  1TTO A;  2E2T A;  1Z1S A;  5AYR B;  2GSP A;  1US1 A;  3SX1 A;  4XDV A;  1Q9E A;  2D1W A;  1YNV X;  3EN1 B;  2YFJ B;  1NB3 I;  1SJW A;  2BO9 B;  4BL3 A;  1WQL B;  7GSP A;  1K73 4;  3WHO A;  4O8S A;  2P0X A;  4R80 A;  6RNT A;  1NO3 A;  1PYL A;  1RTU A;  2W56 A;  5JBS A;  3V92 A;  3CC2 3;  4KT3 B;  3FG1 A;  5EEO A;  2PZV A;  3X3Z A;  4X2O A;  3HII A;  3T0U A;  1OHP A;  1GY7 A;  2OCT A;  1RGG A;  4HM2 B;  3B7C A;  1G0T A;  4HBR A;  4LEH A;  2HML B;  2HMO B;  4WP5 A;  1STF I;  2P0M A;  3WOE B;  3SED A;  4WYK A;  1Q81 4;  2INX A;  1UCK A;  1BRG A;  2CWT A;  4R1K A;  3D5I A;  5HGR A;  1QVF 2;  1B27 A;  4LYL B;  4FCJ A;  1E97 A;  4K1U A;  2RGQ A;  1RGL A;  1UW1 A;  3K0Z A;  3CCM 3;  2WGO A;  2GBX B;  1VQ5 3;  3A76 A;  3QK9 A;  2W56 B;  1UCJ A;  4ZM8 A;  1JJ2 2;  1X1W A;  3KII A;  3LYG A;  3LT9 A;  3WOF B;  5AIF A;  2CH9 A;  1C54 A;  1O7P B;  1W2Z A;  1RN1 A;  3OV4 A;  1RNB A;  4HM6 B;  3NUV A;  3JUO A;  1TU5 A;  1VQ6 3;  2F5M A;  1SII A;  5IER A;  3DXO A;  4N6U A;  2RNT A;  4GB5 A;  3NHX A;  3NQY A;  1QMA A;  1RMS A;  1DVC A;  3ECF A;  3IMA B;  2KF3 A;  4BTX A;  1FGQ A;  2KF6 A;  4N6O B;  1SPU A;  1MWR A;  1TFK A;  4KFF A;  1Q7H A;  1CYU A;  2ZHX B;  1BNI A;  1LVN A;  1NU3 A;  2E2V A;  4XBX A;  3EJV A;  4HJL B;  1DYU A;  4MEI A;  2P09 A;  1G02 A;  1LXE A;  1B2S A;  1X1U A;  1DMQ A;  1WMN A;  4ILF A;  3CCJ 3;  3E99 A;  1O7W B;  3WA3 A;  4KVH A;  1W01 A;  1S5A A;  1UI7 A;  3CD6 3;  3CC4 3;  1R4C A;  5AYS C;  2FNQ A;  3URP A;  3GZX B;  1Q7Y 4;  3NBJ A;  3KSP A;  2GXF A;  4LSO A;  1CH0 A;  2W9Q A;  2V1L A;  3BLZ A;  3T8N A;  4DKI A;  1JZO A;  4HM3 B;  5TGN A;  1O7H B;  2GEX A;  1EUI C;  1MOL A;  1UGI A;  3EE1 A;  3X3Y A;  1IYY A;  1BAO A;  1MWT A;  1MWS A;  7STD A;  1AR0 A;  2CFL A;  2XF3 A;  3MPH A;  4LZI A;  1I3F A;  2L1S A;  2F4Y A;  3SVA A;  3SLU A;  5IG3 A;  1YJ9 3;  2XEP A;  1IDP A;  2KF4 A;  3CC7 3;  4EW5 A;  2CHC A;  3DMC A;  4GL6 A;  1WMO A;  4RZM A;  1BIR A;  2RCD A;  2KF5 A;  1RGE A;  5CK6 A;  1GD3 A;  1OPY A;  1A2P A;  3X40 A;  1JB5 A;  1U8C B;  3BNB A;  1OUN A;  2XFT A;  1O7M B;  3U1W A;  3NBB A;  4JF8 A;  4X2H A;  1QAK A;  3HI7 A;  1L5G B;  1STD A;  4RBN A;  1SIH A;  3LTD A;  2F5W A;  4WFO A;  1VQO 3;  1YJN 3;  2Z6B A;  1EA2 A;  4QWT A;  1LQG C;  3UNL A;  2MF7 A;  3CCL 3;  5LC7 A;  3QRD A;  1B20 A;  1N8Q A;  1EQK A;  1WNH A;  4H61 A;  5KP1 A;  3F8X A;  3K63 A;  1TP6 A;  3L0R A;  3CCV 3;  3LTA A;  2Z76 A;  1FUS A;  4HVN A;  7RNT A;  1KWI A;  5HOH A;  1YIT 3;  4N6T A;  2XR8 B;  1BUJ A;  4KZ1 A;  1BAN A;  1BNG A;  1DMN A;  1A2V A;  1LOY A;  1RRL A;  2CWU A;  1YGE A;  2HMN B;  1I2G A;  2BT3 A;  1PFP A;  4KFE A;  1UUW B;  4RNY A;  1FUT A;  3CMA 3;  3KKG A;  3F40 A;  2BMO B;  1RCK A;  3MWZ A;  1BRJ A;  3ZG0 A;  1RGC A;  1LOW A;  1RGF A;  1ZO2 A;  2CC3 A;  2RFR A;  3FLJ A;  2XFS A;  5D82 A;  1GSP A;  3N8B A;  3DGO A;  1OCV A;  4BTW A;  1EKM A;  2ZA4 A;  3JUP A;  4JRF A;  1T5Y A;  2GU3 A;  5AEW B;  3GRD A;  1N5H A;  3EF8 A;  1AVL A;  3Q90 A;  1JBT A;  2BIR A;  1A2K A;  1MGW A;  1NNV A;  1VZZ A;  3D79 A;  3FF0 A;  1BRK A;  1LNI A;  1B2X A;  1I0V A;  1AVK A;  1RGH A;  1RN4 A;  2OQE A;  3FG3 A;  5KP4 A;  3UB1 A;  5STD A;  1BNS A;  1UGH I;  3EBT A;  2I9W A;  3MYT A;  1BOX A;  2CG0 A;  2UUG C;  1CQS A;  1FZU A;  4N3V A;  2SAR A;  1GMQ A;  3G8Z A;  1IVU A;  1RGK A;  2HMM B;  3B8L A;  4HOH A;  1JNQ A;  1GOU A;  5RNT A;  5AIG A;  4CDL A;  4GHO A;  2ZDJ A;  5I97 A;  2M7O A;  3G4S 3;  4CJN A;  3AGN A;  3LTB A;  4EV2 A;  1DMM A;  1GS3 A;  1V57 A;  1BRI A;  1VQ8 3;  4EC6 A;  3OWY A;  1F8N A;  2OTJ 3;  1IT8 A;  1TRQ A;  4L8P A;  1ISK A;  1X1Y A;  2D42 A;  3NX0 A;  1BSB A;  1O7N B;  5DRV A;  3VGN A;  5EVH A;  4H3U A;  3CCS 3;  4I4K A;  3G0K A;  1JBS A;  3S28 A;  1IVX A;  1RKY A;  1FA3 A;  4AKY A;  1EG9 B;  2RSX A;  3DUK A;  2L4V A;  3PXM A;  4EBG A;  5D81 A;  4RNZ A;  3NV0 A;  1ZGX A;  5KP3 A;  5AEU B;  5BIR A;  2BMR B;  4XDW A;  2K0M A;  3K7C A;  4WYK B;  2OOV C;  3ZFZ A;  4STD A;  3FCS B;  1GY6 A;  3WDG B;  1GOV A;  1I2E A;  1LNH A;  3MSO A;  1VQM 3;  4HZ9 B;  3H51 A;  1JKG A;  1W7C A;  3FSD A;  4N6L A;  5CLK A;  1A90 A;  5FGO A;  2JQ5 A;  1WMP A;  2JDI H;  1NDO B;  4R9L A;  2Z7A A;  3OWS A;  2A15 A;  1IQY A;  1HZ1 A;  3F9S A;  3F7X A;  3FGY A;  1GY5 A;  3GZB A;  4FCZ A;  5BXQ A;  1JBR A;  1RHL A;  4IIA A;  1TFO A;  3PYJ A;  1B2Z A;  1ULI B;  1R4Y A; 
#chains in the Genus database with same CATH homology
 1JB4 A;  5BVB A;  3Q1C A;  3KSE D;  1QJG A;  3FKA A;  3NV0 B;  4R4K A;  5A0O B;  1K41 A;  3T8U A;  1BUQ A;  3FF2 A;  1D6Z A;  3IPT A;  4HM8 B;  3PS8 A;  3SXX A;  2CIU A;  1JKG B;  3JUM A;  4J8T A;  3RGA A;  1U5O A;  2Y73 A;  3DM8 A;  3J7Y d;  2CKF B;  3WMD A;  1VQ7 3;  1G96 A;  3BB9 A;  3DGL A;  3X41 A;  3GZY B;  1K9M 4;  1FUW A;  2MC8 A;  1VQL 3;  1W5Z A;  3H3H A;  2IA7 A;  2WOH A;  1E3V A;  2XGL A;  2UX0 A;  2BHM A;  3DZL A;  3GZR A;  3NM2 A;  2OWP A;  3DY5 A;  3K5T A;  5D83 A;  1LOX A;  5JPP A;  1VQ4 3;  3LOY A;  4HZB B;  1JV2 B;  3DGM A;  4EV5 A;  8CHO A;  3CCQ 3;  4NHF A;  3I56 3;  1VQK 3;  2ZL8 A;  1W6C A;  4K90 B;  3DGN A;  2IUK A;  3S67 A;  2FXT A;  3MKI A;  1OGZ A;  3NXJ A;  2GEY A;  3X42 A;  3S5C A;  1Q40 A;  3PCS A;  5EQL A;  5FW5 A;  3AMO A;  2YFL B;  4N6N B;  1YVB I;  2IMJ A;  2LYX A;  1C7H A;  4OVM A;  4XB5 A;  3K9M C;  4L8O A;  2SBL A;  4XM4 A;  4AEQ A;  1D6Y A;  3RDE A;  4AKZ A;  1GD4 A;  1N8R 4;  4XBT A;  5AII A;  1YIJ 3;  1J2B A;  4FMD A;  3EN8 A;  3EQQ B;  5CF1 A;  1KQS 2;  3FZW A;  1Q82 4;  2B1X B;  1VQ9 3;  1K28 A;  3KN4 A;  1ROA A;  5IEO A;  2C11 A;  1IVW A;  3GWR A;  4BTY A;  1DVD A;  1FGT A;  2XRX B;  3M8C A;  4MMZ B;  3TDG A;  3HZP A;  1MNL A;  3UL6 A;  4CCV A;  4O2H A;  2W0Q A;  4WWU C;  1Q40 B;  1ROV A;  5ELU A;  4WHA A;  3AMO B;  1IV9 A;  2LQV A;  1QAL A;  1N9E A;  1W02 A;  3F7S A;  3G16 A;  4FR9 A;  2IUJ A;  2HMJ B;  3FG4 A;  3HIG A;  1QVG 2;  3D9R A;  4HM4 B;  1W6Y A;  3G71 3;  2OOV A;  1YI2 3;  3EHC A;  2QA4 3;  3HK4 A;  1K8A 4;  1JB2 A;  3I0Y A;  1IK3 A;  1OF5 A;  2CG1 A;  1Y4K A;  1OH0 A;  1CYV A;  2C10 A;  3CPO A;  4FMC A;  3BNC A;  2B24 B;  4TX4 A;  1M1X B;  1UUV B;  1N9J A;  6STD A;  4G1M B;  3STD A;  4HM0 B;  5IG5 A;  1Q86 4;  1W6G A;  2F99 A;  1D6U A;  1NWW A;  1OHS A;  3MG1 A;  4NRE A;  2PNC A;  3D3L A;  1FGO A;  3U97 A;  2GU1 A;  3G6E 3;  2E2U A;  2KXG A;  5ELJ A;  4J9A A;  2QEX 3;  2K54 A;  1OF5 B;  1O7G B;  4HM7 B;  4PEJ A;  1RJO A;  1KC8 4;  3MG3 A;  3OX9 A;  4R9K A;  3WOD G;  2ML6 A;  4K1V A;  1OHO A;  2W6J H;  3EX9 A;  3KZT A;  2STD A;  4HM5 B;  1S72 3;  4Q53 A;  5IW9 A;  2O3O A;  3BNE A;  3JUQ A;  3KE7 A;  1IQX A;  4ORL A;  2Y74 A;  3OWU A;  4HM1 B;  3EBY A;  5JPU A;  3N9H A;  1IV7 A;  2CK3 H;  1HU9 A;  3B4P A;  4HYZ A;  1IVV A;  2CFK A;  4LMI A;  1A67 A;  3FH1 A;  2Q07 A;  3LTC A;  3LXU X;  5AI1 A;  1IT7 A;  3ER7 A;  3JVC A;  1IQ8 A;  2OQE C;  2XGN A;  3EB8 A;  3NQZ A;  3GAX A;  3LH4 A;  5DRE A;  1UI8 A;  4XBY A;  2QIY A;  1RRH A;  4OUQ A;  3Q2P A;  2GBW B;  3PGB A;  1SQW A;  4KFD A;  2R4I A;  2WOF A;  3CME 3;  2CWV A;  1PU4 A;  4FMB A;  5LC6 A;  1FGR A;  4U13 A;  5CXO A;  2ML5 A;  1GYB A;  1HKX A;  2YX9 A;  3KFQ C;  5IG0 A;  3CXC 2;  1W4N A;  2HMK B;  2WO0 A;  1NJI 4;  3ALA A;  4IT7 A;  4HKV B;  5IF6 A;  3X3X A;  1JRQ A;  2P05 A;  1YJW 3;  3CU3 A;  1YHQ 3;  3NM7 A;  1JN5 A;  3CCE 3;  3CCR 3;  3CCU 3;  3CNX A;  4MMX B;  4IPB A;  1WTH A;  1M9G A;  2KCD A;  2BMQ B;  1W2B 2;  5AIH A;  3MG2 A;  1Q42 A;  1CEW I;  3BND A;  3VSY A;  4EYC A;  2Z77 A;  2XH9 A;  1OAC A;  4O02 B;  5CF2 A;  2F86 B;  1OGX A;  4N6M A;  3ROB A;  1AV4 A;  3F14 A;  2CFG A;  1VQN 3;  2CW9 A;  3PZW A;  3HX8 A;  2FGT A;  5IEP A;  1VQP 3;  5IEN A;  4L7K A;  1QAF A;  1V74 A;  4K61 A;  3F8H A;  2P38 A;  3CNM A;  2CFW A;  2W04 A;  1TUH A;  1NB5 I;  1M1K 4;  1JN5 B;  2YFI B;  1ASK A;  3OXA A;  3SOA A;  2QGU A;  2W2C A;  2XSH B;  2F98 A;  2CFD A;  3S27 A;  4O3V A;  3LML A;  2KRT A;  4N6V 0;  3V98 A;  3RGR A;  4MJD A;  3CPW 2;  3IJE B;  2O9U X;  4FMA A;  3V99 A;  4FCM A;  3WA2 X;  1E3R A;  1W00 A;  4EXR A;  1FGM A;  3NBR A;  3PCR A;  3EC9 A;  5G2G A;  3S29 A;  3OW2 2;  3MHE A;  3UL5 A;  3LZA A;  1KD1 4;  2BNG A;  1RN7 A;  1ZX2 A;  2OTL 3;  3B4O A;  1KSI A;  2WGQ A;  4OK0 A;  1IU7 A;  4MMY B;  5IG4 A;  3I55 3;  3N54 B;  4LGQ A;  3UJM A;  2W03 A;  1ULJ B;  3VF1 A;  1TIJ A;  1N5P A;  3O8Y A;  3LT8 A;  1M90 4;  2XSO B;  2W9P A;  3SOY A;  2E2T A;  1Z1S A;  5AYR B;  1US1 A;  3SX1 A;  4XDV A;  2D1W A;  3EN1 B;  2YFJ B;  1NB3 I;  1SJW A;  2BO9 B;  1WQL B;  1K73 4;  4O8S A;  2P0X A;  4R80 A;  1NO3 A;  2W56 A;  5JBS A;  3V92 A;  3CC2 3;  3FG1 A;  5EEO A;  2PZV A;  3X3Z A;  4X2O A;  3HII A;  3T0U A;  1OHP A;  1GY7 A;  2OCT A;  4HM2 B;  3B7C A;  4LEH A;  4HBR A;  2HML B;  2HMO B;  4WP5 A;  1STF I;  2P0M A;  3WOE B;  3SED A;  4WYK A;  1Q81 4;  2INX A;  2CWT A;  4R1K A;  1QVF 2;  5HGR A;  4FCJ A;  1E97 A;  4K1U A;  2RGQ A;  1UW1 A;  3K0Z A;  3CCM 3;  2WGO A;  2GBX B;  1VQ5 3;  3A76 A;  3QK9 A;  2W56 B;  4ZM8 A;  1JJ2 2;  3KII A;  3LYG A;  3LT9 A;  3WOF B;  5AIF A;  2CH9 A;  1O7P B;  1W2Z A;  3OV4 A;  4HM6 B;  3NUV A;  3JUO A;  1TU5 A;  1VQ6 3;  1SII A;  5IER A;  3DXO A;  4N6U A;  4GB5 A;  3NHX A;  3NQY A;  1QMA A;  1DVC A;  3ECF A;  3IMA B;  4BTX A;  1FGQ A;  4N6O B;  1SPU A;  1TFK A;  4KFF A;  1CYU A;  1LVN A;  1NU3 A;  2E2V A;  4XBX A;  3EJV A;  4HJL B;  1DYU A;  4MEI A;  2P09 A;  1LXE A;  1DMQ A;  1WMN A;  3CCJ 3;  3E99 A;  1O7W B;  3WA3 A;  4KVH A;  1W01 A;  1S5A A;  1UI7 A;  3CD6 3;  3CC4 3;  1R4C A;  5AYS C;  2FNQ A;  1Q7Y 4;  3GZX B;  3NBJ A;  3KSP A;  2GXF A;  4LSO A;  2W9Q A;  2V1L A;  3BLZ A;  3T8N A;  4HM3 B;  5TGN A;  1O7H B;  2GEX A;  1MOL A;  3EE1 A;  3X3Y A;  7STD A;  1AR0 A;  2CFL A;  2XF3 A;  3MPH A;  4LZI A;  3SVA A;  3SLU A;  5IG3 A;  1YJ9 3;  2XEP A;  1IDP A;  3CC7 3;  2CHC A;  3DMC A;  4GL6 A;  1WMO A;  4RZM A;  2RCD A;  5CK6 A;  1GD3 A;  1OPY A;  3X40 A;  1JB5 A;  1U8C B;  3BNB A;  1OUN A;  2XFT A;  1O7M B;  3U1W A;  3NBB A;  4JF8 A;  4X2H A;  1QAK A;  3HI7 A;  1L5G B;  1STD A;  4RBN A;  1SIH A;  3LTD A;  4WFO A;  1VQO 3;  1YJN 3;  2Z6B A;  1EA2 A;  4QWT A;  3UNL A;  2MF7 A;  3CCL 3;  5LC7 A;  3QRD A;  1N8Q A;  1EQK A;  1WNH A;  4H61 A;  5KP1 A;  3F8X A;  3K63 A;  1TP6 A;  3L0R A;  3CCV 3;  3LTA A;  2Z76 A;  4HVN A;  1KWI A;  1YIT 3;  4N6T A;  2XR8 B;  4KZ1 A;  1DMN A;  1A2V A;  1RRL A;  2CWU A;  1YGE A;  2HMN B;  2BT3 A;  1PFP A;  4KFE A;  1UUW B;  4RNY A;  3CMA 3;  3KKG A;  3F40 A;  2BMO B;  3MWZ A;  2RFR A;  1ZO2 A;  2CC3 A;  3FLJ A;  2XFS A;  5D82 A;  3N8B A;  3DGO A;  1OCV A;  4BTW A;  1EKM A;  4JRF A;  3JUP A;  1T5Y A;  2GU3 A;  5AEW B;  3GRD A;  1N5H A;  3EF8 A;  1AVL A;  3Q90 A;  1A2K A;  1VZZ A;  3FF0 A;  3JUN A;  2OQE A;  5KP4 A;  1AVK A;  3FG3 A;  3UB1 A;  5STD A;  3EBT A;  2I9W A;  3MYT A;  2CG0 A;  4N3V A;  1CQS A;  3G8Z A;  1IVU A;  2HMM B;  3B8L A;  1JNQ A;  5AIG A;  4CDL A;  2ZDJ A;  5I97 A;  2M7O A;  3G4S 3;  3LTB A;  4EV2 A;  1DMM A;  1GS3 A;  1VQ8 3;  4EC6 A;  3OWY A;  1F8N A;  2OTJ 3;  1IT8 A;  4L8P A;  1ISK A;  2D42 A;  3NX0 A;  1O7N B;  5DRV A;  3VGN A;  5EVH A;  4H3U A;  3CCS 3;  4I4K A;  3G0K A;  3S28 A;  1IVX A;  1RKY A;  1FA3 A;  4AKY A;  1EG9 B;  2RSX A;  3DUK A;  2L4V A;  3PXM A;  4EBG A;  5D81 A;  4RNZ A;  3NV0 A;  5KP3 A;  5AEU B;  2BMR B;  4XDW A;  2K0M A;  3K7C A;  4WYK B;  2OOV C;  4STD A;  3FCS B;  1GY6 A;  3WDG B;  1LNH A;  1VQM 3;  3MSO A;  4HZ9 B;  3H51 A;  1JKG A;  1W7C A;  3FSD A;  4N6L A;  5CLK A;  1A90 A;  5FGO A;  2JQ5 A;  1WMP A;  2JDI H;  1NDO B;  4R9L A;  2Z7A A;  3OWS A;  2A15 A;  1IQY A;  3F9S A;  3F7X A;  3FGY A;  1GY5 A;  3GZB A;  4FCZ A;  5BXQ A;  4IIA A;  1TFO A;  3PYJ A;  1ULI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...