1VQ83

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq8300
1YIJ3 3CCM3 1JJ22 3CCL3 1YJ93 3CCJ3 3CCS3 1W2B2 1VQ73 1S723 1Q814 3CMA3 3G6E3 1KC84 1Q824 3CCQ3 1VQK3 1VQP3 1YHQ3 1N8R4 2OTL3 3CXC2 3CC43 1KQS2 1VQ43 1Q864 1K8A4 1M904 3CC23 1VQ63 1VQO3 3CPW2 1VQM3 1NJI4 3G4S3 3CCV3 3CD63 2QA43 3CC73 3CCE3 1YJW3 1K9M4 3CCR3 1K734 3CCU3 1QVG2 1VQL3 1Q7Y4 1VQ93 2QEX3 3I563 2OTJ3 1QVF2 1YIT3 1VQN3 1YJN3 3OW22 3CME3 3I553 1M1K4 1VQ53 1YI23 1KD14 1VQ83 3G713
chains in the Genus database with same CATH superfamily
1RN7A 2H0HA 1TU5A 2B1XB 1VQ73 2GXFA 1RGHA 4FCJA 1V58A 2CHCA 3B8LA 5GSPA 4EW5A 2FNQA 1HYFA 1BU4A 1KWIA 2CK3H 1RGGA 3CPOA 5DRVA 1GD3A 1A2VA 2LYXA 1B20A 1UW1A 1WNHA 2A15A 2BT3A 1O7MB 1OF5A 2F56A 1BRNL 3LOYA 2E2TA 1QAKA 3BU4A 3D9RA 1OHSA 2FXTA 2KAAA 1RHLA 1UUGB 4EBGA 1N9JA 4IIAA 1PY3A 1YGEA 4LZIA 3WOFB 2BO9B 5HOHA 1D6UA 1JKGB 4G1MB 2P09A 3LTAA 1BSDA 1W6YA 4OK0A 1T2IA 2FGTA 3S27A 1RDSA 3EB8A 1PU4A 2WO0A 1JJ22 2F99A 4J8TA 4WP5A 3PS8A 3F7SA 2XH9A 1B2UA 1JZDA 5G2GA 1AV4A 1U8CB 1JKGA 2B24B 3KSPA 3CXC2 2OQEC 3FGYA 5I97A 3DZLA 2OOVA 4BU4A 2M7OA 3CC73 1K9M4 4OUQA 2E2UA 2W6JH 3HZPA 1GYBA 4K1UA 1I2FA 3PGBA 2KF6A 3OW22 5AEWB 3CME3 1RRLA 4HKVB 1I8VA 4O02B 3CNXA 2GEXA 2W04A 3X3ZA 5IENA 1IQ8A 3URPA 1ASKA 3HOHA 1STFI 3BIRA 3DMCA 2YFJB 3LTCA 3SLUA 4HZBB 4BTYA 3HIIA 3KCHA 3DY5A 4HM3B 4EC6A 1KC84 3AHSA 4KVHA 1VQP3 2F5WA 1GOYA 4LEHA 1UI8A 1LVNA 4KFEA 3JUPA 3D5IA 4J5KA 3GZXB 5IEPA 1FUTA 1JV2B 2KCDA 4XBTA 1TTOA 3G8ZA 1OACA 4WHAA 3WA3A 1BNIA 4IPBA 1YJW3 3F40A 8CHOA 1Q40B 2QEX3 4RNZA 1JB5A 1ROAA 7GSPA 2GU3A 1EKMA 1B2XA 2ZA4A 5DREA 2MF7A 2W2CA 5IG0A 1NU3A 1IV9A 3K7CA 2IYJA 1HU9A 3I0YA 2CFKA 3WHOA 1YI23 3N54B 5G1LA 5KP3A 2Z76A 3QK9A 3F9SA 1YJ93 3MG3A 3DGNA 3DGOA 1TUHA 2UX0A 3KKGA 2CFWA 4TX4A 1Q40A 1IT8A 3WA2X 1MNLA 2RBIA 1DMNA 1GS3A 1T5YA 2Z77A 3BLZA 3Q90A 1IVUA 2ML6A 4MMZB 5LC7A 3RGAA 3EJVA 3S5CA 1KSIA 1QMAA 4Q53A 1G96A 5JBSA 1M904 1UGHI 1IQXA 5EQLA 3D3LA 1VQ63 5HGRA 2IY2A 1CQSA 1WQLB 1X1YA 3NM2A 1ISKA 1RGCA 2Q07A 1LQGC 5FW5A 1MWUA 3QRDA 5JPPA 4N6NB 1NNVA 3L0RA 3X3XA 5CF2A 1YJN3 2IA7A 3EHCA 3NQYA 5CK6A 3V99A 2BU4A 1BRSA 3LH4A 1N9EA 1O7HB 1GY7A 3DH2A 3PCRA 4FMDA 1J2BA 4HM0B 3NBJA 1WMOA 1BNFA 1R4CA 1UCKA 3LT8A 1W2B2 1E97A 2GSPA 1FGOA 3VSYA 1OH0A 1O7PB 1WMPA 1WTHA 4K1VA 1CYUA 2XR8B 1UCIA 1QAFA 1WMNA 1B21A 1TIJA 1ZO2A 2F4YA 1BRJA 9RNTA 3FH1A 7RNTA 1TJDA 2I9WA 4EV2A 1MGRA 2IUJA 3JUMA 1OPYA 3D4AA 3EC9A 3I563 2D42A 2P38A 3EE1A 5D81A 1FUSA 3FKAA 1BGSA 1M9GA 4FR9A 3T8NA 4WWUC 1U5OA 3H3HA 1W5ZA 3FF0A 1QALA 5AYRB 3I553 1GY5A 1IVWA 3BNDA 2F5MA 3HIGA 4LGQA 3CCM3 2K0MA 2PZVA 1AQZA 4HOHA 2JDIH 3FCSB 1HKXA 3WOEB 4CJNA 3MYTA 1Q824 2OTL3 4QWTA 3A5EA 4BL3A 3SEDA 3U97A 5STDA 1D6YA 1JBTA 1YVBI 2H0GA 3U1WA 3IMAB 3CC23 2OOVC 1JZOA 1Z1SA 1VQQA 4O2HA 1IVXA 4N6TA 1LNHA 1O7GB 1RLSA 3LT9A 3OWYA 3F7XA 4JF8A 1B27A 3SX1A 2CFLA 2YFLB 3VGNA 1RRHA 2JQ5A 4FCZA 3UNLA 3V92A 2WGQA 1BSCA 1KD14 2XRXB 1X1UA 3WODG 2R4IA 5AIIA 3X41A 4AKZA 3GZBA 3NX0A 5G1KA 1GOUA 1TFKA 5ELUA 1JB2A 3GAXA 5AIFA 3UL6A 1Q864 1Y4KA 2R41A 2KF3A 5D83A 1SIHA 1VQO3 2GBWB 2V1LA 4L8PA 3PCSA 1C54A 1BIRA 4RZMA 1PYLA 1W6CA 1NB5I 2OTJ3 1VQ93 1K734 3TDGA 1VZZA 3LTBA 3T8UA 1O7NB 3WDGB 5AI1A 1RN1A 1IDPA 4XBYA 1GY6A 1IYYA 5AEUB 1Q9EA 1BRIA 1T3BA 4FMAA 5KP1A 1IV7A 4K90B 2BMRB 2IUKA 1RNBA 1FA3A 3FSDA 1FYSA 1RCLA 2AAEA 1BSEA 1DMMA 1I70A 3N8BA 5AIGA 1X1WA 3OV4A 3KFQC 2CC3A 2C4BA 1RJOA 5EEOA 4EYCA 2QGUA 5LC6A 1SARA 3T0UA 3MWZA 3GZRA 2H0IA 1W01A 4EV5A 2F86B 2RFRA 3OXAA 3M8CA 3ZFZA 5M1AA 5JPUA 3LXUX 3PZWA 1IT7A 1Q7Y4 3KZTA 1IQYA 2KXGA 4R9KA 3GRDA 3DGMA 2GBXB 4L7KA 1GSPA 2BNGA 3Q3FA 5M19A 3F14A 4N6LA 1MWRA 3WMDA 2Y73A 3OX9A 4HM2B 1RGEA 2CFGA 2HMNB 4RBNA 1N5HA 1LQMB 3B7CA 3DGLA 4R80A 1Q42A 4NPBA 2RNTA 3MSOA 5AIHA 3ZG0A 1W7CA 3NV0B 2XSHB 2BMQB 3ROBA 1EEJA 3F8HA 3FG4A 5CLKA 1RGLA 1GOVA 4IT7A 1BNGA 1X1XA 2KF5A 3B4PA 5IERA 5KP4A 3EF8A 1W00A 3PYJA 4GHOA 5CXOA 1O7WB 3MKIA 1UGIA 1TRQA 4LMIA 3SXXA 1JRQA 4KT3B 1YGWA 3NV0A 4DKIA 1QVF2 2GU1A 1ULIB 1GMRA 3X40A 4RNYA 1FGTA 3OWSA 2P05A 1OUNA 1DVCA 2XGLA 3KSED 3EX9A 2STDA 1M1K4 1VQ83 2HMMB 1QJGA 3EN8A 1BNSA 4OVMA 1G02A 4XM4A 2CX1A 3CCS3 1JNQA 4CCVA 2RSXA 1S723 4N6MA 1E3VA 1JN5B 3EN1B 3NBRA 3Q1CA 1CEWI 4O3VA 3CC43 3AMOB 3CNMA 3DGYA 4MMXB 1EG9B 3MG2A 4K61A 2MC8A 4O8SA 3SYUA 1CH0A 3IPTA 1BUQA 4GB5A 5CF1A 1JBSA 2CX0A 2XF3A 3GZYB 3NM7A 2BMOB 1AR0A 2K54A 2HMKB 1BOXA 1NO3A 1US1A 2HOHA 1ZX2A 6GSPA 1JN5A 2SBLA 5IG3A 1A90A 1CYVA 3G16A 3AMOA 2BIRA 3OWUA 2IMJA 3SOYA 2KRTA 3K5TA 4HVNA 1LXEA 1C7HA 4CDLA 7STDA 1RGAA 1EUIC 5IEOA 2CW9A 2F98A 2CIUA 3CCL3 4RNTA 3JUNA 2O3OA 2D1WA 1FGMA 2L1SA 1STDA 2WOHA 4GL6A 3ECFA 5IF6A 3CCQ3 1DVDA 1DYUA 1I0XA 1ZGXA 1KQS2 3G0KA 3X3YA 3STDA 2KF4A 4HM5B 1RTUA 3D5GA 2XGNA 1B2MA 1W4NA 1PFPA 1GMQA 1QVG2 3ZG5A 2WOFA 4HM6B 1FGRA 3EQQB 1OHOA 1M1XB 1B2SA 2P0XA 3DXOA 4GSPA 2W9PA 1UUWB 5BIRA 2YX9A 1OGXA 1AY7A 4N3VA 1DMQA 3DM8A 4KFFA 2YFIB 3G713 1YIJ3 3FG3A 1FW7A 1R4YA 3K9MC 1MWSA 3AGOA 1Q814 1BUJA 1LNIA 5EVHA 1UI7A 4I4KA 1N8R4 1BRHA 3KIIA 3FZWA 1A2KA 4HM8B 3LTDA 4I5QA 4FMCA 1JB4A 1K8A4 1RN4A 1RGFA 3JUQA 3HK4A 3MPHA 2Z6BA 3V98A 1A67A 4LSOA 1EA2A 3AHWA 2C11A 4H3UA 2LQVA 3SOAA 1BANA 1UCLA 4BL2A 3G4S3 5BVBA 3CCR3 1E3RA 3CCU3 1W2ZA 3H51A 1JBRA 4ORLA 2RCDA 3F8XA 1AVLA 1DETA 4BTWA 2O9UX 3NHXA 1RGKA 2CWUA 2PNCA 3GSPA 4HAAA 1I3IA 3RDEA 3LYGA 3BB9A 3BNEA 1BSAA 1T2HA 3GWRA 1I0VA 3HX8A 1FGQA 2SARA 3JUOA 2CH9A 5IW9A 4WFOA 1SIIA 4BTXA 2W03A 2W56B 2CG0A 1RKYA 1K28A 3CMA3 1N8QA 1A2PA 1B3SA 6STDA 1VQK3 3UL5A 1VQ43 1V74A 1BNJA 4X2OA 1IVVA 2W9QA 4N6V0 4BIRA 4AKYA 2ZL8A 3FG1A 1LOXA 1IU7A 1VQM3 3O8YA 4J5GA 3D79A 8RNTA 5IG5A 2L4VA 2W56A 1UCJA 1VQL3 3PXMA 2AADA 3NXJA 2XFTA 5BU4A 4MJDA 5TGNA 5BXQA 3J7Yd 6RNTA 2UGIA 1LOVA 5A0OB 3WR2A 1K41A 2RGQA 1GMPA 4N6OB 4H61A 4J9AA 5D82A 1NWWA 4NREA 1BVIA 3VF1A 1BNEA 1TFOA 1S5AA 1HZ1A 2HMOB 4PEJA 2ML5A 2ZHXB 2GEYA 1YHQ3 4HZ9B 1OCVA 2K3DA 5IG4A 3A76A 3SVAA 1MOLA 3KN4A 1I2EA 4JRFA 2W0QA 1F8NA 1I3FA 5FGOA 3S29A 2CFDA 3BNCA 1TRPA 2C10A 2OQEA 3CCV3 4L8OA 1OHPA 1I2GA 3EBTA 4NHFA 1IK3A 1VQN3 4AEQA 1EQKA 1BRGA 4STDA 3S67A 1UUVB 2XSOB 4HM1B 1YIT3 1ULJB 3DUKA 3EBYA 1Q7HA 3ALAA 3FLJA 4MMYB 3K0ZA 4R1KA 3K63A 3G6E3 3HI7A 2QIYA 3MG1A 2UUGC 3LZAA 4N6UA 1NDOB 2E2VA 3AGNA 3FF2A 1G0TA 3LMLA 1D6ZA 2XFSA 3MHEA 4HM7B 1YVSA 3B4OA 3KE7A 3NUVA 1AVKA 2BHMA 3Q2PA 1B2ZA 4WYKB 1L5GB 2CKFB 2OCTA 1RMSA 1W02A 1YNVX 2WGOA 4MEIA 2Y74A 4U13A 4XDVA 3UJMA 4CPKA 1GD4A 4ZM8A 3NQZA 4R4KA 1FZUA 3S28A 3BNBA 4KFDA 1LRAA 4HBRA 4LYLB 3RGRA 2INXA 1VQ53 3X42A 4HYZA 2CG1A 4KZ1A 2CWTA 3CU3A 2HMLB 1MGWA 3CCJ3 1UDII 2OWPA 4WYKA 5M18A 1N5PA 1OGZA 1LOWA 2HMJB 3NBBA 2ZDJA 1LOYA 4HM4B 4FCMA 2J8XB 4ILFA 2P0MA 4EXRA 4XBXA 1BNRA 1SQWA 3IJEB 1V57A 3N9HA 5RNTA 1RSNA 1FUWA 4FMBA 2XEPA 3CPW2 1NJI4 1SJWA 4XDWA 1NB3I 3CD63 1W6GA 5ELJA 2QA43 3CCE3 1DE3A 1TP6A 4HJLB 3ER7A 1ZS7A 4R9LA 4X2HA 3RNTA 1ROVA 3JVCA 1SPUA 2CWVA 1RCKA 4XB5A 2Z7AA 1RNTA 3UB1A 1BAOA 1BSBA 1BRKA 1MWTA 5AYSC 3E99A 1OF5B
chains in the Genus database with same CATH topology
1RN7A 1TU5A 2B1XB 1VQ73 2GXFA 4FCJA 2CHCA 3B8LA 2FNQA 1KWIA 2CK3H 3CPOA 5DRVA 1GD3A 1A2VA 2LYXA 1UW1A 1WNHA 2A15A 2BT3A 1O7MB 1OF5A 3LOYA 2E2TA 1QAKA 3D9RA 1OHSA 2FXTA 4EBGA 1N9JA 4IIAA 1YGEA 4LZIA 3WOFB 2BO9B 1D6UA 1JKGB 4G1MB 2P09A 3LTAA 4OK0A 1W6YA 3S27A 2FGTA 1PU4A 3EB8A 2WO0A 1JJ22 2F99A 4J8TA 4WP5A 3PS8A 3F7SA 2XH9A 5G2GA 1AV4A 1U8CB 1JKGA 2B24B 3KSPA 3CXC2 2OQEC 3FGYA 5I97A 3DZLA 2OOVA 2M7OA 3CC73 1K9M4 4OUQA 2E2UA 2W6JH 3HZPA 1GYBA 4K1UA 3PGBA 3OW22 5AEWB 3CME3 1RRLA 4HKVB 4O02B 3CNXA 2GEXA 2W04A 3X3ZA 5IENA 1IQ8A 1ASKA 1STFI 3DMCA 2YFJB 3LTCA 3SLUA 4HZBB 4BTYA 3HIIA 4EC6A 3DY5A 4HM3B 1KC84 4KVHA 1VQP3 4LEHA 1UI8A 1LVNA 4KFEA 3JUPA 3GZXB 5IEPA 1JV2B 2KCDA 4XBTA 3G8ZA 1OACA 4WHAA 3WA3A 4IPBA 1YJW3 3F40A 8CHOA 1Q40B 2QEX3 4RNZA 1JB5A 1ROAA 2GU3A 1EKMA 5DREA 2MF7A 2W2CA 5IG0A 1NU3A 1IV9A 3K7CA 1HU9A 3I0YA 2CFKA 1YI23 3N54B 5KP3A 2Z76A 3QK9A 3F9SA 1YJ93 3MG3A 3DGNA 3DGOA 1TUHA 2UX0A 3KKGA 2CFWA 4TX4A 1Q40A 1IT8A 3WA2X 1MNLA 1DMNA 1GS3A 1T5YA 2Z77A 3BLZA 3Q90A 1IVUA 2ML6A 4MMZB 5LC7A 3RGAA 3EJVA 3S5CA 1KSIA 1QMAA 4Q53A 1G96A 5JBSA 1M904 1IQXA 5EQLA 3D3LA 1VQ63 5HGRA 1CQSA 1WQLB 3NM2A 1ISKA 5FW5A 2Q07A 3QRDA 5JPPA 4N6NB 3L0RA 3X3XA 5CF2A 1YJN3 2IA7A 3EHCA 3NQYA 5CK6A 3V99A 3LH4A 1N9EA 1O7HB 1GY7A 3PCRA 4FMDA 1J2BA 4HM0B 3NBJA 1WMOA 1R4CA 3LT8A 1W2B2 1E97A 1FGOA 3VSYA 1OH0A 1O7PB 1WMPA 1WTHA 4K1VA 1CYUA 2XR8B 1QAFA 1WMNA 1TIJA 1ZO2A 3FH1A 2I9WA 4EV2A 2IUJA 3JUMA 1OPYA 3EC9A 3I563 2D42A 2P38A 3EE1A 5D81A 3FKAA 4FR9A 1M9GA 3T8NA 4WWUC 1U5OA 3H3HA 1W5ZA 3FF0A 1QALA 5AYRB 3I553 1GY5A 1IVWA 3BNDA 3HIGA 4LGQA 3CCM3 2K0MA 2PZVA 2JDIH 3FCSB 1HKXA 3WOEB 3MYTA 1Q824 2OTL3 4QWTA 3SEDA 3U97A 5STDA 1D6YA 1YVBI 3U1WA 3IMAB 3CC23 2OOVC 1Z1SA 4O2HA 1IVXA 4N6TA 1LNHA 1O7GB 3LT9A 3OWYA 3F7XA 4JF8A 3SX1A 2CFLA 2YFLB 3VGNA 1RRHA 2JQ5A 4FCZA 3UNLA 3V92A 2WGQA 1KD14 2XRXB 3WODG 2R4IA 5AIIA 3X41A 3GZBA 3NX0A 1TFKA 5ELUA 1JB2A 3GAXA 5AIFA 3UL6A 1Q864 1Y4KA 5D83A 1SIHA 1VQO3 2GBWB 2V1LA 4L8PA 3PCSA 4RZMA 1W6CA 1NB5I 2OTJ3 1VQ93 1K734 3TDGA 1VZZA 3LTBA 3T8UA 1O7NB 3WDGB 5AI1A 1IDPA 4XBYA 1GY6A 5AEUB 4FMAA 5KP1A 1IV7A 4K90B 2BMRB 2IUKA 1FA3A 3FSDA 1DMMA 3N8BA 5AIGA 3OV4A 3KFQC 2CC3A 1RJOA 5EEOA 4EYCA 2QGUA 5LC6A 3T0UA 3MWZA 3GZRA 4EV5A 1W01A 2F86B 2RFRA 3OXAA 3M8CA 5JPUA 3LXUX 3PZWA 1IT7A 1Q7Y4 3KZTA 1IQYA 2KXGA 4R9KA 3GRDA 3DGMA 2GBXB 4L7KA 2BNGA 3F14A 4N6LA 3WMDA 2Y73A 3OX9A 4HM2B 2CFGA 4RBNA 2HMNB 1N5HA 3DGLA 3B7CA 4R80A 1Q42A 3MSOA 5AIHA 1W7CA 3NV0B 2XSHB 2BMQB 3ROBA 3F8HA 3FG4A 5CLKA 4IT7A 5KP4A 3B4PA 5IERA 3EF8A 1W00A 3PYJA 5CXOA 1O7WB 3MKIA 4LMIA 3SXXA 1JRQA 3NV0A 1QVF2 2GU1A 1ULIB 3X40A 4RNYA 1FGTA 3OWSA 2P05A 1OUNA 1DVCA 2XGLA 3KSED 3EX9A 2STDA 1M1K4 1VQ83 2HMMB 1QJGA 3EN8A 4OVMA 4XM4A 3CCS3 1JNQA 4CCVA 2RSXA 1S723 4N6MA 1E3VA 1JN5B 3EN1B 3NBRA 3Q1CA 1CEWI 4O3VA 3CC43 3AMOB 3CNMA 4MMXB 1EG9B 3MG2A 4K61A 2MC8A 4O8SA 3IPTA 1BUQA 4GB5A 5CF1A 2XF3A 3GZYB 3NM7A 2BMOB 1AR0A 2K54A 2HMKB 1US1A 1NO3A 1ZX2A 1JN5A 2SBLA 5IG3A 1A90A 1CYVA 3G16A 3AMOA 3OWUA 2IMJA 3SOYA 2KRTA 3K5TA 4HVNA 1LXEA 1C7HA 4CDLA 7STDA 5IEOA 2CW9A 2F98A 2CIUA 3CCL3 3JUNA 2O3OA 2D1WA 1FGMA 1STDA 2WOHA 4GL6A 3ECFA 5IF6A 3CCQ3 1DVDA 1DYUA 1KQS2 3G0KA 3X3YA 3STDA 4HM5B 2XGNA 1W4NA 1PFPA 1QVG2 2WOFA 4HM6B 1FGRA 3EQQB 1OHOA 1M1XB 2P0XA 3DXOA 2W9PA 1UUWB 2YX9A 1OGXA 4N3VA 1DMQA 3DM8A 4KFFA 2YFIB 3G713 1YIJ3 3FG3A 3K9MC 1Q814 5EVHA 1UI7A 4I4KA 1N8R4 3KIIA 3FZWA 1A2KA 4HM8B 3LTDA 4FMCA 1JB4A 1K8A4 3JUQA 3HK4A 3MPHA 2Z6BA 3V98A 1A67A 4LSOA 1EA2A 4H3UA 2C11A 3SOAA 2LQVA 3G4S3 5BVBA 3CCR3 1E3RA 3CCU3 1W2ZA 3H51A 4ORLA 2RCDA 3F8XA 1AVLA 4BTWA 2O9UX 3NHXA 2CWUA 2PNCA 3RDEA 3LYGA 3BB9A 3BNEA 3GWRA 3HX8A 1FGQA 3JUOA 5IW9A 2CH9A 4WFOA 1SIIA 4BTXA 2W03A 2W56B 2CG0A 1RKYA 1K28A 3CMA3 1N8QA 6STDA 1VQK3 3UL5A 1VQ43 1V74A 4X2OA 1IVVA 2W9QA 4N6V0 4AKYA 2ZL8A 3FG1A 1LOXA 1IU7A 1VQM3 3O8YA 5IG5A 2L4VA 2W56A 1VQL3 3PXMA 3NXJA 2XFTA 4MJDA 5TGNA 5BXQA 3J7Yd 5A0OB 1K41A 2RGQA 4N6OB 4H61A 4J9AA 5D82A 1NWWA 4NREA 3VF1A 1TFOA 1S5AA 2HMOB 4PEJA 2ML5A 2GEYA 1YHQ3 4HZ9B 1OCVA 5IG4A 3A76A 3SVAA 1MOLA 3KN4A 4JRFA 2W0QA 1F8NA 3S29A 5FGOA 2CFDA 3BNCA 2C10A 2OQEA 3CCV3 4L8OA 1OHPA 4NHFA 3EBTA 1IK3A 1VQN3 4AEQA 1EQKA 4STDA 3S67A 1UUVB 2XSOB 4HM1B 1YIT3 1ULJB 3DUKA 3EBYA 3ALAA 3FLJA 4MMYB 3K0ZA 4R1KA 3K63A 3G6E3 3HI7A 2QIYA 3MG1A 3LZAA 4N6UA 1NDOB 2E2VA 3FF2A 3LMLA 1D6ZA 2XFSA 3MHEA 4HM7B 3B4OA 3NUVA 3KE7A 3Q2PA 1AVKA 2BHMA 4WYKB 1L5GB 2CKFB 2OCTA 1W02A 2WGOA 4U13A 4MEIA 2Y74A 4XDVA 3UJMA 4ZM8A 1GD4A 3NQZA 4R4KA 3S28A 3BNBA 4KFDA 4HBRA 3RGRA 2INXA 1VQ53 3X42A 4HYZA 2CG1A 4KZ1A 2CWTA 3CU3A 2HMLB 3CCJ3 2OWPA 4WYKA 1N5PA 1OGZA 2HMJB 3NBBA 2ZDJA 4HM4B 4FCMA 2P0MA 4EXRA 4XBXA 1SQWA 3IJEB 3N9HA 1FUWA 4FMBA 2XEPA 3CPW2 1NJI4 1SJWA 4XDWA 1NB3I 3CD63 1W6GA 5ELJA 2QA43 3CCE3 1TP6A 4HJLB 3ER7A 4R9LA 4X2HA 1ROVA 3JVCA 1SPUA 2CWVA 4XB5A 2Z7AA 3UB1A 4AKZA 5AYSC 3E99A 1OF5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 3;  3CCM 3;  1JJ2 2;  3CCL 3;  1YJ9 3;  3CCJ 3;  3CCS 3;  1W2B 2;  1VQ7 3;  1S72 3;  1Q81 4;  3CMA 3;  3G6E 3;  1KC8 4;  1Q82 4;  3CCQ 3;  1VQK 3;  1VQP 3;  1YHQ 3;  1N8R 4;  2OTL 3;  3CXC 2;  3CC4 3;  1KQS 2;  1VQ4 3;  1Q86 4;  1K8A 4;  1M90 4;  3CC2 3;  1VQ6 3;  1VQO 3;  3CPW 2;  1VQM 3;  1NJI 4;  3G4S 3;  3CCV 3;  3CD6 3;  2QA4 3;  3CC7 3;  3CCE 3;  1YJW 3;  1K9M 4;  3CCR 3;  1K73 4;  3CCU 3;  1QVG 2;  1VQL 3;  1Q7Y 4;  1VQ9 3;  2QEX 3;  3I56 3;  2OTJ 3;  1QVF 2;  1YIT 3;  1VQN 3;  1YJN 3;  3OW2 2;  3CME 3;  3I55 3;  1M1K 4;  1VQ5 3;  1YI2 3;  1KD1 4;  1VQ8 3;  3G71 3; 
#chains in the Genus database with same CATH topology
 1RN7 A;  2H0H A;  1TU5 A;  2B1X B;  1VQ7 3;  2GXF A;  1RGH A;  4FCJ A;  1V58 A;  2CHC A;  3B8L A;  5GSP A;  4EW5 A;  2FNQ A;  1HYF A;  1BU4 A;  1KWI A;  2CK3 H;  1RGG A;  3CPO A;  5DRV A;  1GD3 A;  1A2V A;  2LYX A;  1B20 A;  1UW1 A;  1WNH A;  2A15 A;  2BT3 A;  1O7M B;  1OF5 A;  2F56 A;  1BRN L;  3LOY A;  2E2T A;  1QAK A;  3BU4 A;  3D9R A;  1OHS A;  2FXT A;  2KAA A;  1RHL A;  1UUG B;  4EBG A;  1N9J A;  4IIA A;  1PY3 A;  1YGE A;  4LZI A;  3WOF B;  2BO9 B;  5HOH A;  1D6U A;  1JKG B;  4G1M B;  2P09 A;  3LTA A;  1BSD A;  1W6Y A;  4OK0 A;  1T2I A;  2FGT A;  3S27 A;  1RDS A;  3EB8 A;  1PU4 A;  2WO0 A;  1JJ2 2;  2F99 A;  4J8T A;  4WP5 A;  3PS8 A;  3F7S A;  2XH9 A;  1B2U A;  1JZD A;  5G2G A;  1AV4 A;  1U8C B;  1JKG A;  2B24 B;  3KSP A;  3CXC 2;  2OQE C;  3FGY A;  5I97 A;  3DZL A;  2OOV A;  4BU4 A;  2M7O A;  3CC7 3;  1K9M 4;  4OUQ A;  2E2U A;  2W6J H;  3HZP A;  1GYB A;  4K1U A;  1I2F A;  3PGB A;  2KF6 A;  3OW2 2;  5AEW B;  3CME 3;  1RRL A;  4HKV B;  1I8V A;  4O02 B;  3CNX A;  2GEX A;  2W04 A;  3X3Z A;  5IEN A;  1IQ8 A;  3URP A;  1ASK A;  3HOH A;  1STF I;  3BIR A;  3DMC A;  2YFJ B;  3LTC A;  3SLU A;  4HZB B;  4BTY A;  3HII A;  3KCH A;  3DY5 A;  4HM3 B;  4EC6 A;  1KC8 4;  3AHS A;  4KVH A;  1VQP 3;  2F5W A;  1GOY A;  4LEH A;  1UI8 A;  1LVN A;  4KFE A;  3JUP A;  3D5I A;  4J5K A;  3GZX B;  5IEP A;  1FUT A;  1JV2 B;  2KCD A;  4XBT A;  1TTO A;  3G8Z A;  1OAC A;  4WHA A;  3WA3 A;  1BNI A;  4IPB A;  1YJW 3;  3F40 A;  8CHO A;  1Q40 B;  2QEX 3;  4RNZ A;  1JB5 A;  1ROA A;  7GSP A;  2GU3 A;  1EKM A;  1B2X A;  2ZA4 A;  5DRE A;  2MF7 A;  2W2C A;  5IG0 A;  1NU3 A;  1IV9 A;  3K7C A;  2IYJ A;  1HU9 A;  3I0Y A;  2CFK A;  3WHO A;  1YI2 3;  3N54 B;  5G1L A;  5KP3 A;  2Z76 A;  3QK9 A;  3F9S A;  1YJ9 3;  3MG3 A;  3DGN A;  3DGO A;  1TUH A;  2UX0 A;  3KKG A;  2CFW A;  4TX4 A;  1Q40 A;  1IT8 A;  3WA2 X;  1MNL A;  2RBI A;  1DMN A;  1GS3 A;  1T5Y A;  2Z77 A;  3BLZ A;  3Q90 A;  1IVU A;  2ML6 A;  4MMZ B;  5LC7 A;  3RGA A;  3EJV A;  3S5C A;  1KSI A;  1QMA A;  4Q53 A;  1G96 A;  5JBS A;  1M90 4;  1UGH I;  1IQX A;  5EQL A;  3D3L A;  1VQ6 3;  5HGR A;  2IY2 A;  1CQS A;  1WQL B;  1X1Y A;  3NM2 A;  1ISK A;  1RGC A;  2Q07 A;  1LQG C;  5FW5 A;  1MWU A;  3QRD A;  5JPP A;  4N6N B;  1NNV A;  3L0R A;  3X3X A;  5CF2 A;  1YJN 3;  2IA7 A;  3EHC A;  3NQY A;  5CK6 A;  3V99 A;  2BU4 A;  1BRS A;  3LH4 A;  1N9E A;  1O7H B;  1GY7 A;  3DH2 A;  3PCR A;  4FMD A;  1J2B A;  4HM0 B;  3NBJ A;  1WMO A;  1BNF A;  1R4C A;  1UCK A;  3LT8 A;  1W2B 2;  1E97 A;  2GSP A;  1FGO A;  3VSY A;  1OH0 A;  1O7P B;  1WMP A;  1WTH A;  4K1V A;  1CYU A;  2XR8 B;  1UCI A;  1QAF A;  1WMN A;  1B21 A;  1TIJ A;  1ZO2 A;  2F4Y A;  1BRJ A;  9RNT A;  3FH1 A;  7RNT A;  1TJD A;  2I9W A;  4EV2 A;  1MGR A;  2IUJ A;  3JUM A;  1OPY A;  3D4A A;  3EC9 A;  3I56 3;  2D42 A;  2P38 A;  3EE1 A;  5D81 A;  1FUS A;  3FKA A;  1BGS A;  1M9G A;  4FR9 A;  3T8N A;  4WWU C;  1U5O A;  3H3H A;  1W5Z A;  3FF0 A;  1QAL A;  5AYR B;  3I55 3;  1GY5 A;  1IVW A;  3BND A;  2F5M A;  3HIG A;  4LGQ A;  3CCM 3;  2K0M A;  2PZV A;  1AQZ A;  4HOH A;  2JDI H;  3FCS B;  1HKX A;  3WOE B;  4CJN A;  3MYT A;  1Q82 4;  2OTL 3;  4QWT A;  3A5E A;  4BL3 A;  3SED A;  3U97 A;  5STD A;  1D6Y A;  1JBT A;  1YVB I;  2H0G A;  3U1W A;  3IMA B;  3CC2 3;  2OOV C;  1JZO A;  1Z1S A;  1VQQ A;  4O2H A;  1IVX A;  4N6T A;  1LNH A;  1O7G B;  1RLS A;  3LT9 A;  3OWY A;  3F7X A;  4JF8 A;  1B27 A;  3SX1 A;  2CFL A;  2YFL B;  3VGN A;  1RRH A;  2JQ5 A;  4FCZ A;  3UNL A;  3V92 A;  2WGQ A;  1BSC A;  1KD1 4;  2XRX B;  1X1U A;  3WOD G;  2R4I A;  5AII A;  3X41 A;  4AKZ A;  3GZB A;  3NX0 A;  5G1K A;  1GOU A;  1TFK A;  5ELU A;  1JB2 A;  3GAX A;  5AIF A;  3UL6 A;  1Q86 4;  1Y4K A;  2R41 A;  2KF3 A;  5D83 A;  1SIH A;  1VQO 3;  2GBW B;  2V1L A;  4L8P A;  3PCS A;  1C54 A;  1BIR A;  4RZM A;  1PYL A;  1W6C A;  1NB5 I;  2OTJ 3;  1VQ9 3;  1K73 4;  3TDG A;  1VZZ A;  3LTB A;  3T8U A;  1O7N B;  3WDG B;  5AI1 A;  1RN1 A;  1IDP A;  4XBY A;  1GY6 A;  1IYY A;  5AEU B;  1Q9E A;  1BRI A;  1T3B A;  4FMA A;  5KP1 A;  1IV7 A;  4K90 B;  2BMR B;  2IUK A;  1RNB A;  1FA3 A;  3FSD A;  1FYS A;  1RCL A;  2AAE A;  1BSE A;  1DMM A;  1I70 A;  3N8B A;  5AIG A;  1X1W A;  3OV4 A;  3KFQ C;  2CC3 A;  2C4B A;  1RJO A;  5EEO A;  4EYC A;  2QGU A;  5LC6 A;  1SAR A;  3T0U A;  3MWZ A;  3GZR A;  2H0I A;  1W01 A;  4EV5 A;  2F86 B;  2RFR A;  3OXA A;  3M8C A;  3ZFZ A;  5M1A A;  5JPU A;  3LXU X;  3PZW A;  1IT7 A;  1Q7Y 4;  3KZT A;  1IQY A;  2KXG A;  4R9K A;  3GRD A;  3DGM A;  2GBX B;  4L7K A;  1GSP A;  2BNG A;  3Q3F A;  5M19 A;  3F14 A;  4N6L A;  1MWR A;  3WMD A;  2Y73 A;  3OX9 A;  4HM2 B;  1RGE A;  2CFG A;  2HMN B;  4RBN A;  1N5H A;  1LQM B;  3B7C A;  3DGL A;  4R80 A;  1Q42 A;  4NPB A;  2RNT A;  3MSO A;  5AIH A;  3ZG0 A;  1W7C A;  3NV0 B;  2XSH B;  2BMQ B;  3ROB A;  1EEJ A;  3F8H A;  3FG4 A;  5CLK A;  1RGL A;  1GOV A;  4IT7 A;  1BNG A;  1X1X A;  2KF5 A;  3B4P A;  5IER A;  5KP4 A;  3EF8 A;  1W00 A;  3PYJ A;  4GHO A;  5CXO A;  1O7W B;  3MKI A;  1UGI A;  1TRQ A;  4LMI A;  3SXX A;  1JRQ A;  4KT3 B;  1YGW A;  3NV0 A;  4DKI A;  1QVF 2;  2GU1 A;  1ULI B;  1GMR A;  3X40 A;  4RNY A;  1FGT A;  3OWS A;  2P05 A;  1OUN A;  1DVC A;  2XGL A;  3KSE D;  3EX9 A;  2STD A;  1M1K 4;  1VQ8 3;  2HMM B;  1QJG A;  3EN8 A;  1BNS A;  4OVM A;  1G02 A;  4XM4 A;  2CX1 A;  3CCS 3;  1JNQ A;  4CCV A;  2RSX A;  1S72 3;  4N6M A;  1E3V A;  1JN5 B;  3EN1 B;  3NBR A;  3Q1C A;  1CEW I;  4O3V A;  3CC4 3;  3AMO B;  3CNM A;  3DGY A;  4MMX B;  1EG9 B;  3MG2 A;  4K61 A;  2MC8 A;  4O8S A;  3SYU A;  1CH0 A;  3IPT A;  1BUQ A;  4GB5 A;  5CF1 A;  1JBS A;  2CX0 A;  2XF3 A;  3GZY B;  3NM7 A;  2BMO B;  1AR0 A;  2K54 A;  2HMK B;  1BOX A;  1NO3 A;  1US1 A;  2HOH A;  1ZX2 A;  6GSP A;  1JN5 A;  2SBL A;  5IG3 A;  1A90 A;  1CYV A;  3G16 A;  3AMO A;  2BIR A;  3OWU A;  2IMJ A;  3SOY A;  2KRT A;  3K5T A;  4HVN A;  1LXE A;  1C7H A;  4CDL A;  7STD A;  1RGA A;  1EUI C;  5IEO A;  2CW9 A;  2F98 A;  2CIU A;  3CCL 3;  4RNT A;  3JUN A;  2O3O A;  2D1W A;  1FGM A;  2L1S A;  1STD A;  2WOH A;  4GL6 A;  3ECF A;  5IF6 A;  3CCQ 3;  1DVD A;  1DYU A;  1I0X A;  1ZGX A;  1KQS 2;  3G0K A;  3X3Y A;  3STD A;  2KF4 A;  4HM5 B;  1RTU A;  3D5G A;  2XGN A;  1B2M A;  1W4N A;  1PFP A;  1GMQ A;  1QVG 2;  3ZG5 A;  2WOF A;  4HM6 B;  1FGR A;  3EQQ B;  1OHO A;  1M1X B;  1B2S A;  2P0X A;  3DXO A;  4GSP A;  2W9P A;  1UUW B;  5BIR A;  2YX9 A;  1OGX A;  1AY7 A;  4N3V A;  1DMQ A;  3DM8 A;  4KFF A;  2YFI B;  3G71 3;  1YIJ 3;  3FG3 A;  1FW7 A;  1R4Y A;  3K9M C;  1MWS A;  3AGO A;  1Q81 4;  1BUJ A;  1LNI A;  5EVH A;  1UI7 A;  4I4K A;  1N8R 4;  1BRH A;  3KII A;  3FZW A;  1A2K A;  4HM8 B;  3LTD A;  4I5Q A;  4FMC A;  1JB4 A;  1K8A 4;  1RN4 A;  1RGF A;  3JUQ A;  3HK4 A;  3MPH A;  2Z6B A;  3V98 A;  1A67 A;  4LSO A;  1EA2 A;  3AHW A;  2C11 A;  4H3U A;  2LQV A;  3SOA A;  1BAN A;  1UCL A;  4BL2 A;  3G4S 3;  5BVB A;  3CCR 3;  1E3R A;  3CCU 3;  1W2Z A;  3H51 A;  1JBR A;  4ORL A;  2RCD A;  3F8X A;  1AVL A;  1DET A;  4BTW A;  2O9U X;  3NHX A;  1RGK A;  2CWU A;  2PNC A;  3GSP A;  4HAA A;  1I3I A;  3RDE A;  3LYG A;  3BB9 A;  3BNE A;  1BSA A;  1T2H A;  3GWR A;  1I0V A;  3HX8 A;  1FGQ A;  2SAR A;  3JUO A;  2CH9 A;  5IW9 A;  4WFO A;  1SII A;  4BTX A;  2W03 A;  2W56 B;  2CG0 A;  1RKY A;  1K28 A;  3CMA 3;  1N8Q A;  1A2P A;  1B3S A;  6STD A;  1VQK 3;  3UL5 A;  1VQ4 3;  1V74 A;  1BNJ A;  4X2O A;  1IVV A;  2W9Q A;  4N6V 0;  4BIR A;  4AKY A;  2ZL8 A;  3FG1 A;  1LOX A;  1IU7 A;  1VQM 3;  3O8Y A;  4J5G A;  3D79 A;  8RNT A;  5IG5 A;  2L4V A;  2W56 A;  1UCJ A;  1VQL 3;  3PXM A;  2AAD A;  3NXJ A;  2XFT A;  5BU4 A;  4MJD A;  5TGN A;  5BXQ A;  3J7Y d;  6RNT A;  2UGI A;  1LOV A;  5A0O B;  3WR2 A;  1K41 A;  2RGQ A;  1GMP A;  4N6O B;  4H61 A;  4J9A A;  5D82 A;  1NWW A;  4NRE A;  1BVI A;  3VF1 A;  1BNE A;  1TFO A;  1S5A A;  1HZ1 A;  2HMO B;  4PEJ A;  2ML5 A;  2ZHX B;  2GEY A;  1YHQ 3;  4HZ9 B;  1OCV A;  2K3D A;  5IG4 A;  3A76 A;  3SVA A;  1MOL A;  3KN4 A;  1I2E A;  4JRF A;  2W0Q A;  1F8N A;  1I3F A;  5FGO A;  3S29 A;  2CFD A;  3BNC A;  1TRP A;  2C10 A;  2OQE A;  3CCV 3;  4L8O A;  1OHP A;  1I2G A;  3EBT A;  4NHF A;  1IK3 A;  1VQN 3;  4AEQ A;  1EQK A;  1BRG A;  4STD A;  3S67 A;  1UUV B;  2XSO B;  4HM1 B;  1YIT 3;  1ULJ B;  3DUK A;  3EBY A;  1Q7H A;  3ALA A;  3FLJ A;  4MMY B;  3K0Z A;  4R1K A;  3K63 A;  3G6E 3;  3HI7 A;  2QIY A;  3MG1 A;  2UUG C;  3LZA A;  4N6U A;  1NDO B;  2E2V A;  3AGN A;  3FF2 A;  1G0T A;  3LML A;  1D6Z A;  2XFS A;  3MHE A;  4HM7 B;  1YVS A;  3B4O A;  3KE7 A;  3NUV A;  1AVK A;  2BHM A;  3Q2P A;  1B2Z A;  4WYK B;  1L5G B;  2CKF B;  2OCT A;  1RMS A;  1W02 A;  1YNV X;  2WGO A;  4MEI A;  2Y74 A;  4U13 A;  4XDV A;  3UJM A;  4CPK A;  1GD4 A;  4ZM8 A;  3NQZ A;  4R4K A;  1FZU A;  3S28 A;  3BNB A;  4KFD A;  1LRA A;  4HBR A;  4LYL B;  3RGR A;  2INX A;  1VQ5 3;  3X42 A;  4HYZ A;  2CG1 A;  4KZ1 A;  2CWT A;  3CU3 A;  2HML B;  1MGW A;  3CCJ 3;  1UDI I;  2OWP A;  4WYK A;  5M18 A;  1N5P A;  1OGZ A;  1LOW A;  2HMJ B;  3NBB A;  2ZDJ A;  1LOY A;  4HM4 B;  4FCM A;  2J8X B;  4ILF A;  2P0M A;  4EXR A;  4XBX A;  1BNR A;  1SQW A;  3IJE B;  1V57 A;  3N9H A;  5RNT A;  1RSN A;  1FUW A;  4FMB A;  2XEP A;  3CPW 2;  1NJI 4;  1SJW A;  4XDW A;  1NB3 I;  3CD6 3;  1W6G A;  5ELJ A;  2QA4 3;  3CCE 3;  1DE3 A;  1TP6 A;  4HJL B;  3ER7 A;  1ZS7 A;  4R9L A;  4X2H A;  3RNT A;  1ROV A;  3JVC A;  1SPU A;  2CWV A;  1RCK A;  4XB5 A;  2Z7A A;  1RNT A;  3UB1 A;  1BAO A;  1BSB A;  1BRK A;  1MWT A;  5AYS C;  3E99 A;  1OF5 B; 
#chains in the Genus database with same CATH homology
 1RN7 A;  1TU5 A;  2B1X B;  1VQ7 3;  2GXF A;  4FCJ A;  2CHC A;  3B8L A;  2FNQ A;  1KWI A;  2CK3 H;  3CPO A;  5DRV A;  1GD3 A;  1A2V A;  2LYX A;  1UW1 A;  1WNH A;  2A15 A;  2BT3 A;  1O7M B;  1OF5 A;  3LOY A;  2E2T A;  1QAK A;  3D9R A;  1OHS A;  2FXT A;  4EBG A;  1N9J A;  4IIA A;  1YGE A;  4LZI A;  3WOF B;  2BO9 B;  1D6U A;  1JKG B;  4G1M B;  2P09 A;  3LTA A;  4OK0 A;  1W6Y A;  3S27 A;  2FGT A;  1PU4 A;  3EB8 A;  2WO0 A;  1JJ2 2;  2F99 A;  4J8T A;  4WP5 A;  3PS8 A;  3F7S A;  2XH9 A;  5G2G A;  1AV4 A;  1U8C B;  1JKG A;  2B24 B;  3KSP A;  3CXC 2;  2OQE C;  3FGY A;  5I97 A;  3DZL A;  2OOV A;  2M7O A;  3CC7 3;  1K9M 4;  4OUQ A;  2E2U A;  2W6J H;  3HZP A;  1GYB A;  4K1U A;  3PGB A;  3OW2 2;  5AEW B;  3CME 3;  1RRL A;  4HKV B;  4O02 B;  3CNX A;  2GEX A;  2W04 A;  3X3Z A;  5IEN A;  1IQ8 A;  1ASK A;  1STF I;  3DMC A;  2YFJ B;  3LTC A;  3SLU A;  4HZB B;  4BTY A;  3HII A;  4EC6 A;  3DY5 A;  4HM3 B;  1KC8 4;  4KVH A;  1VQP 3;  4LEH A;  1UI8 A;  1LVN A;  4KFE A;  3JUP A;  3GZX B;  5IEP A;  1JV2 B;  2KCD A;  4XBT A;  3G8Z A;  1OAC A;  4WHA A;  3WA3 A;  4IPB A;  1YJW 3;  3F40 A;  8CHO A;  1Q40 B;  2QEX 3;  4RNZ A;  1JB5 A;  1ROA A;  2GU3 A;  1EKM A;  5DRE A;  2MF7 A;  2W2C A;  5IG0 A;  1NU3 A;  1IV9 A;  3K7C A;  1HU9 A;  3I0Y A;  2CFK A;  1YI2 3;  3N54 B;  5KP3 A;  2Z76 A;  3QK9 A;  3F9S A;  1YJ9 3;  3MG3 A;  3DGN A;  3DGO A;  1TUH A;  2UX0 A;  3KKG A;  2CFW A;  4TX4 A;  1Q40 A;  1IT8 A;  3WA2 X;  1MNL A;  1DMN A;  1GS3 A;  1T5Y A;  2Z77 A;  3BLZ A;  3Q90 A;  1IVU A;  2ML6 A;  4MMZ B;  5LC7 A;  3RGA A;  3EJV A;  3S5C A;  1KSI A;  1QMA A;  4Q53 A;  1G96 A;  5JBS A;  1M90 4;  1IQX A;  5EQL A;  3D3L A;  1VQ6 3;  5HGR A;  1CQS A;  1WQL B;  3NM2 A;  1ISK A;  5FW5 A;  2Q07 A;  3QRD A;  5JPP A;  4N6N B;  3L0R A;  3X3X A;  5CF2 A;  1YJN 3;  2IA7 A;  3EHC A;  3NQY A;  5CK6 A;  3V99 A;  3LH4 A;  1N9E A;  1O7H B;  1GY7 A;  3PCR A;  4FMD A;  1J2B A;  4HM0 B;  3NBJ A;  1WMO A;  1R4C A;  3LT8 A;  1W2B 2;  1E97 A;  1FGO A;  3VSY A;  1OH0 A;  1O7P B;  1WMP A;  1WTH A;  4K1V A;  1CYU A;  2XR8 B;  1QAF A;  1WMN A;  1TIJ A;  1ZO2 A;  3FH1 A;  2I9W A;  4EV2 A;  2IUJ A;  3JUM A;  1OPY A;  3EC9 A;  3I56 3;  2D42 A;  2P38 A;  3EE1 A;  5D81 A;  3FKA A;  4FR9 A;  1M9G A;  3T8N A;  4WWU C;  1U5O A;  3H3H A;  1W5Z A;  3FF0 A;  1QAL A;  5AYR B;  3I55 3;  1GY5 A;  1IVW A;  3BND A;  3HIG A;  4LGQ A;  3CCM 3;  2K0M A;  2PZV A;  2JDI H;  3FCS B;  1HKX A;  3WOE B;  3MYT A;  1Q82 4;  2OTL 3;  4QWT A;  3SED A;  3U97 A;  5STD A;  1D6Y A;  1YVB I;  3U1W A;  3IMA B;  3CC2 3;  2OOV C;  1Z1S A;  4O2H A;  1IVX A;  4N6T A;  1LNH A;  1O7G B;  3LT9 A;  3OWY A;  3F7X A;  4JF8 A;  3SX1 A;  2CFL A;  2YFL B;  3VGN A;  1RRH A;  2JQ5 A;  4FCZ A;  3UNL A;  3V92 A;  2WGQ A;  1KD1 4;  2XRX B;  3WOD G;  2R4I A;  5AII A;  3X41 A;  3GZB A;  3NX0 A;  1TFK A;  5ELU A;  1JB2 A;  3GAX A;  5AIF A;  3UL6 A;  1Q86 4;  1Y4K A;  5D83 A;  1SIH A;  1VQO 3;  2GBW B;  2V1L A;  4L8P A;  3PCS A;  4RZM A;  1W6C A;  1NB5 I;  2OTJ 3;  1VQ9 3;  1K73 4;  3TDG A;  1VZZ A;  3LTB A;  3T8U A;  1O7N B;  3WDG B;  5AI1 A;  1IDP A;  4XBY A;  1GY6 A;  5AEU B;  4FMA A;  5KP1 A;  1IV7 A;  4K90 B;  2BMR B;  2IUK A;  1FA3 A;  3FSD A;  1DMM A;  3N8B A;  5AIG A;  3OV4 A;  3KFQ C;  2CC3 A;  1RJO A;  5EEO A;  4EYC A;  2QGU A;  5LC6 A;  3T0U A;  3MWZ A;  3GZR A;  4EV5 A;  1W01 A;  2F86 B;  2RFR A;  3OXA A;  3M8C A;  5JPU A;  3LXU X;  3PZW A;  1IT7 A;  1Q7Y 4;  3KZT A;  1IQY A;  2KXG A;  4R9K A;  3GRD A;  3DGM A;  2GBX B;  4L7K A;  2BNG A;  3F14 A;  4N6L A;  3WMD A;  2Y73 A;  3OX9 A;  4HM2 B;  2CFG A;  4RBN A;  2HMN B;  1N5H A;  3DGL A;  3B7C A;  4R80 A;  1Q42 A;  3MSO A;  5AIH A;  1W7C A;  3NV0 B;  2XSH B;  2BMQ B;  3ROB A;  3F8H A;  3FG4 A;  5CLK A;  4IT7 A;  5KP4 A;  3B4P A;  5IER A;  3EF8 A;  1W00 A;  3PYJ A;  5CXO A;  1O7W B;  3MKI A;  4LMI A;  3SXX A;  1JRQ A;  3NV0 A;  1QVF 2;  2GU1 A;  1ULI B;  3X40 A;  4RNY A;  1FGT A;  3OWS A;  2P05 A;  1OUN A;  1DVC A;  2XGL A;  3KSE D;  3EX9 A;  2STD A;  1M1K 4;  1VQ8 3;  2HMM B;  1QJG A;  3EN8 A;  4OVM A;  4XM4 A;  3CCS 3;  1JNQ A;  4CCV A;  2RSX A;  1S72 3;  4N6M A;  1E3V A;  1JN5 B;  3EN1 B;  3NBR A;  3Q1C A;  1CEW I;  4O3V A;  3CC4 3;  3AMO B;  3CNM A;  4MMX B;  1EG9 B;  3MG2 A;  4K61 A;  2MC8 A;  4O8S A;  3IPT A;  1BUQ A;  4GB5 A;  5CF1 A;  2XF3 A;  3GZY B;  3NM7 A;  2BMO B;  1AR0 A;  2K54 A;  2HMK B;  1US1 A;  1NO3 A;  1ZX2 A;  1JN5 A;  2SBL A;  5IG3 A;  1A90 A;  1CYV A;  3G16 A;  3AMO A;  3OWU A;  2IMJ A;  3SOY A;  2KRT A;  3K5T A;  4HVN A;  1LXE A;  1C7H A;  4CDL A;  7STD A;  5IEO A;  2CW9 A;  2F98 A;  2CIU A;  3CCL 3;  3JUN A;  2O3O A;  2D1W A;  1FGM A;  1STD A;  2WOH A;  4GL6 A;  3ECF A;  5IF6 A;  3CCQ 3;  1DVD A;  1DYU A;  1KQS 2;  3G0K A;  3X3Y A;  3STD A;  4HM5 B;  2XGN A;  1W4N A;  1PFP A;  1QVG 2;  2WOF A;  4HM6 B;  1FGR A;  3EQQ B;  1OHO A;  1M1X B;  2P0X A;  3DXO A;  2W9P A;  1UUW B;  2YX9 A;  1OGX A;  4N3V A;  1DMQ A;  3DM8 A;  4KFF A;  2YFI B;  3G71 3;  1YIJ 3;  3FG3 A;  3K9M C;  1Q81 4;  5EVH A;  1UI7 A;  4I4K A;  1N8R 4;  3KII A;  3FZW A;  1A2K A;  4HM8 B;  3LTD A;  4FMC A;  1JB4 A;  1K8A 4;  3JUQ A;  3HK4 A;  3MPH A;  2Z6B A;  3V98 A;  1A67 A;  4LSO A;  1EA2 A;  4H3U A;  2C11 A;  3SOA A;  2LQV A;  3G4S 3;  5BVB A;  3CCR 3;  1E3R A;  3CCU 3;  1W2Z A;  3H51 A;  4ORL A;  2RCD A;  3F8X A;  1AVL A;  4BTW A;  2O9U X;  3NHX A;  2CWU A;  2PNC A;  3RDE A;  3LYG A;  3BB9 A;  3BNE A;  3GWR A;  3HX8 A;  1FGQ A;  3JUO A;  5IW9 A;  2CH9 A;  4WFO A;  1SII A;  4BTX A;  2W03 A;  2W56 B;  2CG0 A;  1RKY A;  1K28 A;  3CMA 3;  1N8Q A;  6STD A;  1VQK 3;  3UL5 A;  1VQ4 3;  1V74 A;  4X2O A;  1IVV A;  2W9Q A;  4N6V 0;  4AKY A;  2ZL8 A;  3FG1 A;  1LOX A;  1IU7 A;  1VQM 3;  3O8Y A;  5IG5 A;  2L4V A;  2W56 A;  1VQL 3;  3PXM A;  3NXJ A;  2XFT A;  4MJD A;  5TGN A;  5BXQ A;  3J7Y d;  5A0O B;  1K41 A;  2RGQ A;  4N6O B;  4H61 A;  4J9A A;  5D82 A;  1NWW A;  4NRE A;  3VF1 A;  1TFO A;  1S5A A;  2HMO B;  4PEJ A;  2ML5 A;  2GEY A;  1YHQ 3;  4HZ9 B;  1OCV A;  5IG4 A;  3A76 A;  3SVA A;  1MOL A;  3KN4 A;  4JRF A;  2W0Q A;  1F8N A;  3S29 A;  5FGO A;  2CFD A;  3BNC A;  2C10 A;  2OQE A;  3CCV 3;  4L8O A;  1OHP A;  4NHF A;  3EBT A;  1IK3 A;  1VQN 3;  4AEQ A;  1EQK A;  4STD A;  3S67 A;  1UUV B;  2XSO B;  4HM1 B;  1YIT 3;  1ULJ B;  3DUK A;  3EBY A;  3ALA A;  3FLJ A;  4MMY B;  3K0Z A;  4R1K A;  3K63 A;  3G6E 3;  3HI7 A;  2QIY A;  3MG1 A;  3LZA A;  4N6U A;  1NDO B;  2E2V A;  3FF2 A;  3LML A;  1D6Z A;  2XFS A;  3MHE A;  4HM7 B;  3B4O A;  3NUV A;  3KE7 A;  3Q2P A;  1AVK A;  2BHM A;  4WYK B;  1L5G B;  2CKF B;  2OCT A;  1W02 A;  2WGO A;  4U13 A;  4MEI A;  2Y74 A;  4XDV A;  3UJM A;  4ZM8 A;  1GD4 A;  3NQZ A;  4R4K A;  3S28 A;  3BNB A;  4KFD A;  4HBR A;  3RGR A;  2INX A;  1VQ5 3;  3X42 A;  4HYZ A;  2CG1 A;  4KZ1 A;  2CWT A;  3CU3 A;  2HML B;  3CCJ 3;  2OWP A;  4WYK A;  1N5P A;  1OGZ A;  2HMJ B;  3NBB A;  2ZDJ A;  4HM4 B;  4FCM A;  2P0M A;  4EXR A;  4XBX A;  1SQW A;  3IJE B;  3N9H A;  1FUW A;  4FMB A;  2XEP A;  3CPW 2;  1NJI 4;  1SJW A;  4XDW A;  1NB3 I;  3CD6 3;  1W6G A;  5ELJ A;  2QA4 3;  3CCE 3;  1TP6 A;  4HJL B;  3ER7 A;  4R9L A;  4X2H A;  1ROV A;  3JVC A;  1SPU A;  2CWV A;  4XB5 A;  2Z7A A;  3UB1 A;  4AKZ A;  5AYS C;  3E99 A;  1OF5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...