1VQ83

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq8300
3CD63 1VQM3 3G713 1YHQ3 1NJI4 3G4S3 2QEX3 1M1K4 3CCS3 3CC73 3CMA3 3OW22 1VQP3 1Q814 3CCM3 1QVF2 3CCR3 1KC84 1YJW3 1VQL3 1K8A4 3CCE3 1VQ73 1M904 1KQS2 1VQ83 1VQK3 1K734 1KD14 1VQO3 1Q824 1S723 3CCU3 3CC43 1W2B2 2OTJ3 3CXC2 1YJ93 3I553 3CCQ3 1YIJ3 1VQ53 3I563 1VQN3 3CC23 1K9M4 3CCV3 3CCL3 1QVG2 1VQ63 2QA43 3CPW2 1VQ43 3CCJ3 2OTL3 3CME3 1Q7Y4 1YJN3 1JJ22 1Q864 1N8R4 1YI23 1VQ93 3G6E3 1YIT3
chains in the Genus database with same CATH superfamily
1A2PA 1KSIA 2R41A 2XFTA 5DREA 3X40A 3U1WA 4DKIA 2HMKB 1B20A 1BRNL 3UJMA 1PFPA 2KCDA 3S5CA 3KSPA 1I8VA 5STDA 1UGIA 4KZ1A 1W00A 1VQK3 1TFKA 1OACA 1S5AA 1S723 1GD3A 3CC43 2GEXA 3S29A 1FA3A 3CC23 4XBTA 2OWPA 5M18A 1M9GA 3EJVA 1MWTA 2D42A 2KAAA 2W56B 4GHOA 3AMOA 4LMIA 1UUVB 1MGRA 2BIRA 2D1WA 2ZDJA 4XB5A 1IVUA 1W5ZA 5KP3A 3CME3 1YI23 3DGOA 4R1KA 3GZYB 3PXMA 2GBXB 3Q1CA 2W56A 3KSED 3S27A 3FG1A 4N6V0 2ZL8A 2CWTA 1HZ1A 3HK4A 1QJGA 2CX1A 1NWWA 1IV9A 1EEJA 2GBWB 2E2VA 3FCSB 5IERA 1SIIA 3FF2A 4OUQA 1RGCA 3WOFB 1K734 4RNZA 2IMJA 4MMXB 3K9MC 1IVWA 2C10A 3I0YA 1VQQA 3MKIA 1K9M4 1VQ63 2OQEC 3NM2A 4IT7A 1VQ43 3DY5A 3X3XA 1C7HA 5HGRA 3F7SA 3BU4A 2RBIA 3DGMA 3FSDA 1QALA 1YHQ3 3CCS3 1SPUA 2FGTA 1YVSA 4LSOA 3WR2A 5IEOA 1LNHA 1KC84 3PCRA 1W6YA 4BTWA 3GRDA 4HBRA 4EYCA 1AY7A 1LOXA 1Q824 3NBBA 1JBRA 1OHPA 4AKYA 4XM4A 3CNMA 5HOHA 3DGNA 2W2CA 4X2OA 1BNEA 1MNLA 3MSOA 1WMNA 3NQZA 3GZBA 4RZMA 3ZG0A 2XF3A 1IV7A 3N8BA 3CCL3 2CX0A 2OCTA 3HZPA 4J5GA 5G1LA 5AEUB 3CCJ3 3SEDA 4GB5A 3BB9A 2GU1A 5JBSA 2HOHA 2HMLB 3WA2X 1BRSA 4FMCA 1AV4A 2BNGA 1IQXA 3G0KA 4HYZA 5FGOA 1BSDA 1RGLA 1IYYA 5IG3A 5BVBA 2FNQA 2B1XB 2HMJB 3BNBA 3JUQA 4EV5A 1SJWA 3X41A 1RKYA 1VQ73 4BL3A 1M1XB 4WHAA 2F56A 2SBLA 2PNCA 2XEPA 3K0ZA 4WYKB 1MWSA 1B2UA 1UUGB 2B24B 2F5MA 2PZVA 1W2ZA 3TDGA 1YJN3 2XH9A 1ASKA 3NHXA 3GWRA 2RNTA 4J9AA 2E2TA 3I553 1ZS7A 1RJOA 6RNTA 3I563 1DETA 1T5YA 1RTUA 2H0IA 2KF3A 4JRFA 3N9HA 4K90B 5AIIA 3EN8A 1NDOB 2MC8A 2CK3H 3MWZA 1Q7Y4 1FGTA 4OVMA 1GD4A 1B3SA 1EUIC 1D6ZA 4EBGA 1RGHA 2K0MA 4IPBA 2ML6A 1GMPA 3KFQC 1OH0A 1TRPA 2YX9A 1JKGB 1TJDA 1I3IA 1U5OA 5EVHA 2JQ5A 3F8XA 1EKMA 1Q814 4WWUC 3CCM3 1OHOA 3O8YA 1RHLA 1I70A 1LVNA 1RGKA 2F86B 2WOHA 3H3HA 4I5QA 8CHOA 1VQL3 1FW7A 3NUVA 1L5GB 1M904 5KP1A 3BLZA 1KQS2 1BUQA 1JN5A 3DMCA 1KD14 4L7KA 1BNIA 4HM7B 2A15A 1GY6A 4HZ9B 3AHSA 1K41A 3F14A 3HIIA 3LXUX 3KN4A 3LMLA 4HM2B 4ILFA 3WOEB 1YIJ3 3Q2PA 1CEWI 2WGQA 2AADA 1BAOA 2OOVA 3VF1A 1FUWA 3FH1A 1W6CA 1AVLA 3N54B 4NPBA 3X3YA 2GEYA 1W6GA 3SXXA 3AGOA 1T2HA 1Q864 1N8R4 2RFRA 1DYUA 7STDA 1C54A 3VSYA 1T2IA 3OWUA 1OCVA 1W7CA 2QIYA 3JUNA 5AIHA 3PS8A 1UCJA 1PY3A 1BNGA 1JNQA 5IF6A 4FMBA 3ER7A 2Y73A 1CH0A 5RNTA 1B2SA 1A2KA 3F40A 5G2GA 3LYGA 1EQKA 1N9JA 2UX0A 4QWTA 5TGNA 1DVCA 3OV4A 8RNTA 3BNEA 3LT8A 3F7XA 2CWVA 3CNXA 3WHOA 4TX4A 1EG9B 1W4NA 2IYJA 3LTDA 1N5HA 1GOUA 4MMYB 1QVG2 1JB4A 1BNFA 3HIGA 1FYSA 1GYBA 4HM1B 1RN7A 1D6YA 3DZLA 1SARA 2C11A 2R4IA 3RGAA 4KFFA 3UL5A 4O02B 1LOWA 3IJEB 3G4S3 4AKZA 2QEX3 1M1K4 5LC6A 4CCVA 4N6TA 3FG3A 1LRAA 4KVHA 4LGQA 1O7PB 3NBRA 1DE3A 2GXFA 2YFIB 4IIAA 3PGBA 4FMDA 4KFEA 2BO9B 4HM5B 1OF5B 3U97A 3G16A 3WODG 1DMQA 3K63A 1IT7A 2KF6A 4HKVB 5M1AA 1X1WA 1TFOA 1UI8A 3NBJA 3HI7A 3UL6A 2C4BA 1OF5A 1WQLB 4R9LA 1HYFA 1OHSA 3LH4A 2OTJ3 3QK9A 7RNTA 2P09A 1V74A 3CMA3 1X1XA 1VQM3 1DMMA 1ROVA 3Q90A 4BTXA 1GY5A 1RGAA 3KE7A 3SOAA 1CYUA 1WNHA 3PYJA 2XSOB 2CG0A 3SYUA 1RNBA 4GL6A 3SVAA 1JB5A 3QRDA 2CWUA 2W9PA 4HZBB 5BXQA 1F8NA 1OGXA 3OX9A 4EXRA 2W04A 1JRQA 1BRJA 4N3VA 5LC7A 4WFOA 1JB2A 1I2FA 5FW5A 1W2B2 2ML5A 2Z7AA 3DH2A 3JUOA 3MHEA 5CF1A 1LOVA 4J5KA 5I97A 1PYLA 2CW9A 4KFDA 3EC9A 2QA43 2RGQA 1NU3A 2H0HA 3AGNA 4HVNA 4LYLB 1FZUA 3MG2A 4L8OA 1NB3I 1WMPA 1BGSA 3G8ZA 5ELUA 1BU4A 2BMOB 2K54A 5G1KA 5M19A 1A90A 5AEWB 1HKXA 2YFJB 5JPPA 5DRVA 1ULIB 5IENA 4BIRA 1UCKA 1BRHA 3CCR3 3D5GA 1UUWB 1A2VA 1X1UA 2RCDA 1D6UA 1X1YA 4HAAA 3BNCA 4R4KA 1MWRA 1FGRA 1Q42A 4FCMA 2CKFB 1N5PA 3LTBA 4R80A 2L1SA 2WOFA 4WP5A 3GZRA 2GSPA 4BTYA 9RNTA 1VQ53 1FGQA 1VQN3 1W01A 4EC6A 3BIRA 4WYKA 2L4VA 2KF5A 1STFI 1G0TA 3A5EA 4H61A 2OTL3 2I9WA 1JJ22 3G6E3 2STDA 4GSPA 2XGLA 5A0OB 1BNSA 1BSCA 1E3VA 4L8PA 3OWSA 2BT3A 4MMZB 1TU5A 4FCJA 1O7NB 1VQP3 1MOLA 2KXGA 3KKGA 1I3FA 3A76A 3ROBA 1BANA 3DUKA 3SOYA 2KF4A 1BIRA 1JKGA 1GOYA 1Y4KA 2W03A 1QAKA 2ZHXB 2XGNA 1FGOA 3F8HA 1YJ93 2W9QA 2P0MA 1LNIA 1RRLA 3LTAA 3NX0A 3EQQB 2LQVA 1IDPA 2RSXA 3SX1A 1ROAA 1IQ8A 3EB8A 2P0XA 5CK6A 4BU4A 3V98A 1NJI4 1YIT3 5AYRB 4RBNA 1STDA 4XDWA 1O7MB 2BU4A 5CXOA 2MF7A 1QVF2 3EX9A 3JUMA 1RN4A 5CF2A 1MGWA 1FUTA 2FXTA 3NV0B 4HM6B 6STDA 4CDLA 1RGGA 4H3UA 3RGRA 1ZGXA 2CFDA 2CFKA 3GSPA 1GSPA 4Q53A 1BRIA 1I2EA 1LQGC 2CC3A 2HMOB 2XRXB 3T0UA 1FUSA 1US1A 3F9SA 4N6MA 4MEIA 1BNJA 1I0XA 2WGOA 3MYTA 5EEOA 2LYXA 2V1LA 4N6LA 1BNRA 2ZA4A 1ISKA 1YGWA 1R4YA 2P38A 3NXJA 3MPHA 1OUNA 3OWYA 3EBYA 2K3DA 1E97A 2BMQB 4FR9A 3URPA 1PU4A 1GMRA 1ZO2A 3D79A 1ULJB 3EE1A 5AIGA 1TIJA 1OGZA 3LT9A 3CD63 2CFLA 4K61A 4MJDA 2CIUA 1OPYA 2SARA 2J8XB 2IUJA 3X3ZA 3LZAA 5ELJA 2F99A 4LZIA 4K1UA 3T8UA 1MWUA 1KWIA 1Q7HA 1UDII 1VQO3 1IVXA 2O3OA 1I0VA 1ZX2A 3AMOB 3CCU3 1Q40B 1CQSA 2AAEA 3B4OA 2BHMA 3DXOA 3MG1A 3STDA 4ORLA 3EN1B 2Q07A 3V99A 3J7Yd 3FGYA 3K7CA 1IT8A 1V57A 1YGEA 3JUPA 5KP4A 2M7OA 4XDVA 1Q40A 2O9UX 2F5WA 4I4KA 5AIFA 1EA2A 1B27A 3S67A 4OK0A 1UGHI 4N6NB 4HM4B 3G713 4N6UA 2HMMB 2Y74A 3HX8A 1RGEA 2W0QA 5D83A 1TTOA 1GS3A 1B21A 1JBSA 1SIHA 5IW9A 3OW22 4G1MB 1NB5I 3FG4A 3CCE3 2OOVC 1RMSA 1TRQA 2P05A 3MG3A 5GSPA 1Q9EA 1V58A 2IY2A 3NQYA 3CPOA 3LTCA 4PEJA 1BVIA 3RNTA 2INXA 5AYSC 2WO0A 1J2BA 4BL2A 3D3LA 4HM3B 2KRTA 3AHWA 3OXAA 3CPW2 4NHFA 1WMOA 3FKAA 1BSEA 1QAFA 6GSPA 3V92A 1HU9A 4NREA 1O7HB 2CHCA 1G02A 3B7CA 4RNYA 3M8CA 1AR0A 1BSBA 2CFGA 4AEQA 3KIIA 1Z1SA 1N8QA 2GU3A 3KZTA 1K8A4 1FGMA 1O7WB 5IG5A 1VQ83 1U8CB 1IU7A 3FLJA 1LQMB 5D81A 2CG1A 1G96A 2CFWA 4JF8A 3T8NA 2Z76A 3SLUA 1RLSA 4FMAA 1IQYA 4N6OB 2E2UA 2YFLB 3CCQ3 5IG4A 1E3RA 1UW1A 2HMNB 4O3VA 5IEPA 5JPUA 3CCV3 3D9RA 1SQWA 3CU3A 4X2HA 2XFSA 1T3BA 3PCSA 3WMDA 3EF8A 3S28A 1VQ93 3B4PA 1GMQA 3ECFA 3EBTA 3B8LA 4RNTA 3FZWA 3D5IA 2UUGC 1BRGA 1K28A 1DMNA 4CJNA 1RGFA 1LOYA 1GY7A 3DGLA 3E99A 1UCIA 1JZOA 1B2ZA 1QMAA 3UNLA 4KT3B 7GSPA 3GZXB 1RCLA 1W02A 1B2XA 2IUKA 1YJW3 1NNVA 2F4YA 2JDIH 3JVCA 4LEHA 3X42A 3FF0A 1RCKA 1RN1A 1BSAA 1IVVA 1JZDA 2CH9A 3CXC2 3ALAA 1JV2B 2XSHB 1BUJA 1YNVX 1UI7A 1I2GA 3NM7A 3ZFZA 3DGYA 1RNTA 1RSNA 3IPTA 4FCZA 4XBYA 4K1VA 4ZM8A 2H0GA 3LOYA 3EHCA 4R9KA 1YVBI 3WDGB 4STDA 1O7GB 2Z77A 3KCHA 1DVDA 1TP6A 3WA3A 3Q3FA 4O8SA 3L0RA 2Z6BA 1JN5B 4O2HA 3BNDA 2W6JH 3CC73 5CLKA 1NO3A 1BRKA 2OQEA 5BU4A 1JBTA 1RRHA 2UGIA 4J8TA 1AQZA 1TUHA 2BMRB 3GAXA 3UB1A 5BIRA 3PZWA 4CPKA 4EW5A 1N9EA 1IK3A 3H51A 1AVKA 4XBXA 5EQLA 3RDEA 3VGNA 1R4CA 3ZG5A 1WTHA 3D4AA 2XR8B 3HOHA 3IMAB 1UCLA 3DM8A 1GOVA 2QGUA 3NV0A 4U13A 5AI1A 1B2MA 4EV2A 1RDSA 2IA7A 4HJLB 1LXEA 5D82A 5IG0A 4HM8B 1VZZA 4HM0B 1BOXA 2F98A 4HOHA 1A67A 3K5TA 1CYVA
chains in the Genus database with same CATH topology
1KSIA 3X40A 2XFTA 5DREA 3U1WA 2HMKB 3UJMA 1PFPA 2KCDA 3S5CA 3KSPA 5STDA 4KZ1A 1W00A 1VQK3 1TFKA 1OACA 1S5AA 1S723 1GD3A 3CC43 2GEXA 3S29A 1FA3A 3CC23 4XBTA 2OWPA 1M9GA 3EJVA 2D42A 2W56B 3AMOA 4LMIA 1UUVB 2ZDJA 5KP3A 2D1WA 3CME3 4XB5A 1IVUA 1W5ZA 1YI23 1YJN3 3DGOA 4R1KA 3GZYB 3PXMA 2GBXB 3Q1CA 2W56A 3KSED 3S27A 3FG1A 4N6V0 2ZL8A 2CWTA 3HK4A 1QJGA 1NWWA 1IV9A 2GBWB 3FCSB 2E2VA 5IERA 1SIIA 3FF2A 4OUQA 3WOFB 1K734 4RNZA 2IMJA 4MMXB 3K9MC 1IVWA 2C10A 3I0YA 3MKIA 1K9M4 1VQ63 2OQEC 3NM2A 4IT7A 1VQ43 3DY5A 3X3XA 1C7HA 5HGRA 3F7SA 3DGMA 3FSDA 1QALA 1YHQ3 3CCS3 1SPUA 2FGTA 4LSOA 5IEOA 1LNHA 1KC84 3PCRA 1W6YA 4BTWA 3GRDA 4HBRA 4EYCA 1LOXA 1Q824 3NBBA 1OHPA 4AKYA 4XM4A 3CNMA 3DGNA 2W2CA 4X2OA 1MNLA 3MSOA 1WMNA 3NQZA 3GZBA 4RZMA 3CCL3 2XF3A 1IV7A 3N8BA 2OCTA 3HZPA 5AEUB 3CCJ3 3SEDA 4GB5A 3BB9A 2GU1A 5JBSA 2HMLB 3WA2X 4FMCA 1AV4A 2BNGA 1IQXA 3G0KA 4HYZA 5FGOA 5IG3A 5BVBA 2FNQA 2B1XB 2HMJB 3BNBA 3JUQA 4EV5A 1SJWA 3X41A 1RKYA 1VQ73 1M1XB 4WHAA 2XEPA 2SBLA 2PNCA 3K0ZA 4WYKB 2PZVA 2B24B 3TDGA 1W2ZA 2XH9A 1ASKA 3NHXA 3GWRA 4J9AA 3I553 2E2TA 3I563 1RJOA 1T5YA 4JRFA 3N9HA 4K90B 5AIIA 3EN8A 1NDOB 2MC8A 2CK3H 3MWZA 1Q7Y4 1FGTA 4OVMA 1GD4A 4EBGA 1D6ZA 2K0MA 4IPBA 2ML6A 3KFQC 1OH0A 2YX9A 1JKGB 1U5OA 5EVHA 2JQ5A 3F8XA 1EKMA 1Q814 4WWUC 3CCM3 1OHOA 3O8YA 8CHOA 2F86B 1LVNA 2WOHA 1VQL3 3H3HA 3NUVA 1L5GB 1M904 5KP1A 3BLZA 1KQS2 1BUQA 1JN5A 3DMCA 1KD14 4L7KA 4HM7B 2A15A 1GY6A 4HZ9B 1K41A 3F14A 3HIIA 3LXUX 3KN4A 3LMLA 4HM2B 3WOEB 1YIJ3 3Q2PA 1CEWI 2WGQA 2OOVA 3VF1A 1FUWA 3FH1A 1W6CA 1AVLA 3N54B 3X3YA 2GEYA 1W6GA 3SXXA 1Q864 1N8R4 2RFRA 1DYUA 7STDA 3VSYA 3OWUA 1OCVA 1W7CA 2QIYA 3JUNA 5AIHA 3PS8A 1JNQA 5IF6A 4FMBA 3ER7A 2Y73A 1A2KA 3F40A 5G2GA 3LYGA 1EQKA 1N9JA 2UX0A 4QWTA 5TGNA 1DVCA 3OV4A 3BNEA 3LT8A 3F7XA 2CWVA 3CNXA 4TX4A 1EG9B 1W4NA 3LTDA 1N5HA 4MMYB 1QVG2 1JB4A 3HIGA 1GYBA 4HM1B 1RN7A 1D6YA 3DZLA 2C11A 2R4IA 3RGAA 4KFFA 3UL5A 4O02B 3IJEB 3G4S3 4AKZA 2QEX3 1M1K4 5LC6A 4CCVA 4N6TA 3FG3A 4KVHA 4LGQA 1O7PB 3NBRA 2GXFA 2YFIB 4IIAA 3PGBA 4FMDA 4KFEA 2BO9B 4HM5B 1OF5B 3U97A 3G16A 3WODG 1DMQA 3K63A 1IT7A 4HKVB 1TFOA 1UI8A 3NBJA 3HI7A 3UL6A 1OF5A 1WQLB 4R9LA 1OHSA 3LH4A 2OTJ3 3QK9A 2P09A 1V74A 3CMA3 1VQM3 1DMMA 1ROVA 3Q90A 4BTXA 1GY5A 3KE7A 3SOAA 1CYUA 1WNHA 3PYJA 2XSOB 2CG0A 4GL6A 3SVAA 1JB5A 3QRDA 2CWUA 2W9PA 4HZBB 5BXQA 1F8NA 1OGXA 3OX9A 4EXRA 2W04A 1JRQA 5LC7A 4N3VA 4WFOA 1JB2A 5FW5A 1W2B2 2ML5A 2Z7AA 3JUOA 3MHEA 5CF1A 5I97A 2CW9A 4KFDA 3EC9A 2QA43 2RGQA 1NU3A 4HVNA 3MG2A 4L8OA 1NB3I 1WMPA 3G8ZA 5ELUA 2BMOB 2K54A 1A90A 5AEWB 1HKXA 2YFJB 5JPPA 5DRVA 1ULIB 5IENA 3CCR3 1UUWB 1A2VA 2RCDA 1D6UA 3BNCA 4R4KA 1Q42A 1FGRA 4FCMA 2CKFB 1N5PA 3LTBA 4R80A 2WOFA 4WP5A 4BTYA 3GZRA 1VQ53 1VQN3 1FGQA 1W01A 4EC6A 4WYKA 2L4VA 1STFI 4H61A 2OTL3 2I9WA 1JJ22 3G6E3 2STDA 2XGLA 5A0OB 1E3VA 4L8PA 3OWSA 2BT3A 4MMZB 1TU5A 4FCJA 1O7NB 1VQP3 1MOLA 2KXGA 3KKGA 3A76A 3ROBA 3DUKA 3SOYA 1JKGA 1Y4KA 2W03A 1QAKA 2XGNA 1FGOA 3F8HA 1YJ93 2W9QA 2P0MA 1RRLA 3LTAA 3NX0A 3EQQB 2LQVA 1IDPA 2RSXA 3SX1A 1ROAA 1IQ8A 3EB8A 2P0XA 5CK6A 3V98A 1NJI4 1YIT3 5AYRB 4RBNA 1STDA 4XDWA 1O7MB 5CXOA 2MF7A 1QVF2 3EX9A 3JUMA 5CF2A 2FXTA 3NV0B 4HM6B 6STDA 4CDLA 4H3UA 3RGRA 2CFDA 2CFKA 4Q53A 2CC3A 2HMOB 2XRXB 3T0UA 1US1A 3F9SA 4N6MA 4MEIA 2WGOA 3MYTA 5EEOA 2LYXA 2V1LA 4N6LA 1ISKA 2P38A 3NXJA 3MPHA 1OUNA 3OWYA 3EBYA 1E97A 2BMQB 4FR9A 1PU4A 1ZO2A 1ULJB 3EE1A 5AIGA 1TIJA 1OGZA 3LT9A 3CD63 2CFLA 4K61A 4MJDA 2CIUA 1OPYA 2IUJA 3X3ZA 3LZAA 5ELJA 2F99A 4LZIA 4K1UA 3T8UA 1KWIA 1VQO3 1IVXA 2O3OA 1ZX2A 3AMOB 3CCU3 1Q40B 1CQSA 3B4OA 3DXOA 2BHMA 3MG1A 3STDA 4ORLA 3EN1B 2Q07A 3V99A 3J7Yd 3FGYA 3K7CA 1IT8A 3JUPA 1YGEA 5KP4A 2M7OA 4XDVA 1Q40A 2O9UX 4I4KA 5AIFA 1EA2A 3S67A 4OK0A 4N6NB 4HM4B 3G713 4N6UA 2HMMB 2Y74A 3HX8A 2W0QA 5D83A 1GS3A 1SIHA 5IW9A 3OW22 4G1MB 1NB5I 3FG4A 3CCE3 2OOVC 2P05A 3MG3A 3NQYA 3CPOA 3LTCA 4PEJA 2INXA 5AYSC 2WO0A 1J2BA 3D3LA 4HM3B 2KRTA 3OXAA 3CPW2 4NHFA 1WMOA 3FKAA 1QAFA 3V92A 1HU9A 4NREA 1O7HB 2CHCA 3B7CA 4RNYA 3M8CA 1AR0A 2CFGA 4AEQA 3KIIA 1Z1SA 1N8QA 2GU3A 3KZTA 1K8A4 1FGMA 1O7WB 5IG5A 1VQ83 1U8CB 1IU7A 3FLJA 5D81A 2CG1A 1G96A 2CFWA 4JF8A 3T8NA 2Z76A 3SLUA 4FMAA 1IQYA 4N6OB 2E2UA 2YFLB 3CCQ3 5IG4A 1E3RA 1UW1A 2HMNB 4O3VA 5IEPA 5JPUA 3CCV3 3D9RA 1SQWA 3CU3A 4X2HA 2XFSA 3PCSA 3WMDA 3EF8A 3S28A 1VQ93 3B4PA 3ECFA 3EBTA 3B8LA 3FZWA 1K28A 1DMNA 1GY7A 3DGLA 3E99A 1QMAA 3UNLA 3GZXB 1W02A 2IUKA 1YJW3 2JDIH 3JVCA 4LEHA 3X42A 3FF0A 1IVVA 2CH9A 3CXC2 3ALAA 1JV2B 2XSHB 3NM7A 1UI7A 3IPTA 4FCZA 4XBYA 4K1VA 4ZM8A 3LOYA 3EHCA 4R9KA 1YVBI 3WDGB 4STDA 2Z77A 1O7GB 1DVDA 1TP6A 3WA3A 4O8SA 3L0RA 2Z6BA 1JN5B 4O2HA 3BNDA 2W6JH 3CC73 5CLKA 1NO3A 2OQEA 1RRHA 4J8TA 3UB1A 1TUHA 2BMRB 3GAXA 3PZWA 1N9EA 1IK3A 3H51A 1AVKA 4XBXA 5EQLA 3RDEA 3VGNA 1R4CA 1WTHA 2XR8B 3IMAB 3DM8A 2QGUA 4U13A 3NV0A 5AI1A 4EV2A 2IA7A 4HJLB 1LXEA 5D82A 5IG0A 4HM8B 1VZZA 4HM0B 2F98A 1A67A 3K5TA 1CYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 3;  1VQM 3;  3G71 3;  1YHQ 3;  1NJI 4;  3G4S 3;  2QEX 3;  1M1K 4;  3CCS 3;  3CC7 3;  3CMA 3;  3OW2 2;  1VQP 3;  1Q81 4;  3CCM 3;  1QVF 2;  3CCR 3;  1KC8 4;  1YJW 3;  1VQL 3;  1K8A 4;  3CCE 3;  1VQ7 3;  1M90 4;  1KQS 2;  1VQ8 3;  1VQK 3;  1K73 4;  1KD1 4;  1VQO 3;  1Q82 4;  1S72 3;  3CCU 3;  3CC4 3;  1W2B 2;  2OTJ 3;  3CXC 2;  1YJ9 3;  3I55 3;  3CCQ 3;  1YIJ 3;  1VQ5 3;  3I56 3;  1VQN 3;  3CC2 3;  1K9M 4;  3CCV 3;  3CCL 3;  1QVG 2;  1VQ6 3;  2QA4 3;  3CPW 2;  1VQ4 3;  3CCJ 3;  2OTL 3;  3CME 3;  1Q7Y 4;  1YJN 3;  1JJ2 2;  1Q86 4;  1N8R 4;  1YI2 3;  1VQ9 3;  3G6E 3;  1YIT 3; 
#chains in the Genus database with same CATH topology
 1A2P A;  1KSI A;  2R41 A;  2XFT A;  5DRE A;  3X40 A;  3U1W A;  4DKI A;  2HMK B;  1B20 A;  1BRN L;  3UJM A;  1PFP A;  2KCD A;  3S5C A;  3KSP A;  1I8V A;  5STD A;  1UGI A;  4KZ1 A;  1W00 A;  1VQK 3;  1TFK A;  1OAC A;  1S5A A;  1S72 3;  1GD3 A;  3CC4 3;  2GEX A;  3S29 A;  1FA3 A;  3CC2 3;  4XBT A;  2OWP A;  5M18 A;  1M9G A;  3EJV A;  1MWT A;  2D42 A;  2KAA A;  2W56 B;  4GHO A;  3AMO A;  4LMI A;  1UUV B;  1MGR A;  2BIR A;  2D1W A;  2ZDJ A;  4XB5 A;  1IVU A;  1W5Z A;  5KP3 A;  3CME 3;  1YI2 3;  3DGO A;  4R1K A;  3GZY B;  3PXM A;  2GBX B;  3Q1C A;  2W56 A;  3KSE D;  3S27 A;  3FG1 A;  4N6V 0;  2ZL8 A;  2CWT A;  1HZ1 A;  3HK4 A;  1QJG A;  2CX1 A;  1NWW A;  1IV9 A;  1EEJ A;  2GBW B;  2E2V A;  3FCS B;  5IER A;  1SII A;  3FF2 A;  4OUQ A;  1RGC A;  3WOF B;  1K73 4;  4RNZ A;  2IMJ A;  4MMX B;  3K9M C;  1IVW A;  2C10 A;  3I0Y A;  1VQQ A;  3MKI A;  1K9M 4;  1VQ6 3;  2OQE C;  3NM2 A;  4IT7 A;  1VQ4 3;  3DY5 A;  3X3X A;  1C7H A;  5HGR A;  3F7S A;  3BU4 A;  2RBI A;  3DGM A;  3FSD A;  1QAL A;  1YHQ 3;  3CCS 3;  1SPU A;  2FGT A;  1YVS A;  4LSO A;  3WR2 A;  5IEO A;  1LNH A;  1KC8 4;  3PCR A;  1W6Y A;  4BTW A;  3GRD A;  4HBR A;  4EYC A;  1AY7 A;  1LOX A;  1Q82 4;  3NBB A;  1JBR A;  1OHP A;  4AKY A;  4XM4 A;  3CNM A;  5HOH A;  3DGN A;  2W2C A;  4X2O A;  1BNE A;  1MNL A;  3MSO A;  1WMN A;  3NQZ A;  3GZB A;  4RZM A;  3ZG0 A;  2XF3 A;  1IV7 A;  3N8B A;  3CCL 3;  2CX0 A;  2OCT A;  3HZP A;  4J5G A;  5G1L A;  5AEU B;  3CCJ 3;  3SED A;  4GB5 A;  3BB9 A;  2GU1 A;  5JBS A;  2HOH A;  2HML B;  3WA2 X;  1BRS A;  4FMC A;  1AV4 A;  2BNG A;  1IQX A;  3G0K A;  4HYZ A;  5FGO A;  1BSD A;  1RGL A;  1IYY A;  5IG3 A;  5BVB A;  2FNQ A;  2B1X B;  2HMJ B;  3BNB A;  3JUQ A;  4EV5 A;  1SJW A;  3X41 A;  1RKY A;  1VQ7 3;  4BL3 A;  1M1X B;  4WHA A;  2F56 A;  2SBL A;  2PNC A;  2XEP A;  3K0Z A;  4WYK B;  1MWS A;  1B2U A;  1UUG B;  2B24 B;  2F5M A;  2PZV A;  1W2Z A;  3TDG A;  1YJN 3;  2XH9 A;  1ASK A;  3NHX A;  3GWR A;  2RNT A;  4J9A A;  2E2T A;  3I55 3;  1ZS7 A;  1RJO A;  6RNT A;  3I56 3;  1DET A;  1T5Y A;  1RTU A;  2H0I A;  2KF3 A;  4JRF A;  3N9H A;  4K90 B;  5AII A;  3EN8 A;  1NDO B;  2MC8 A;  2CK3 H;  3MWZ A;  1Q7Y 4;  1FGT A;  4OVM A;  1GD4 A;  1B3S A;  1EUI C;  1D6Z A;  4EBG A;  1RGH A;  2K0M A;  4IPB A;  2ML6 A;  1GMP A;  3KFQ C;  1OH0 A;  1TRP A;  2YX9 A;  1JKG B;  1TJD A;  1I3I A;  1U5O A;  5EVH A;  2JQ5 A;  3F8X A;  1EKM A;  1Q81 4;  4WWU C;  3CCM 3;  1OHO A;  3O8Y A;  1RHL A;  1I70 A;  1LVN A;  1RGK A;  2F86 B;  2WOH A;  3H3H A;  4I5Q A;  8CHO A;  1VQL 3;  1FW7 A;  3NUV A;  1L5G B;  1M90 4;  5KP1 A;  3BLZ A;  1KQS 2;  1BUQ A;  1JN5 A;  3DMC A;  1KD1 4;  4L7K A;  1BNI A;  4HM7 B;  2A15 A;  1GY6 A;  4HZ9 B;  3AHS A;  1K41 A;  3F14 A;  3HII A;  3LXU X;  3KN4 A;  3LML A;  4HM2 B;  4ILF A;  3WOE B;  1YIJ 3;  3Q2P A;  1CEW I;  2WGQ A;  2AAD A;  1BAO A;  2OOV A;  3VF1 A;  1FUW A;  3FH1 A;  1W6C A;  1AVL A;  3N54 B;  4NPB A;  3X3Y A;  2GEY A;  1W6G A;  3SXX A;  3AGO A;  1T2H A;  1Q86 4;  1N8R 4;  2RFR A;  1DYU A;  7STD A;  1C54 A;  3VSY A;  1T2I A;  3OWU A;  1OCV A;  1W7C A;  2QIY A;  3JUN A;  5AIH A;  3PS8 A;  1UCJ A;  1PY3 A;  1BNG A;  1JNQ A;  5IF6 A;  4FMB A;  3ER7 A;  2Y73 A;  1CH0 A;  5RNT A;  1B2S A;  1A2K A;  3F40 A;  5G2G A;  3LYG A;  1EQK A;  1N9J A;  2UX0 A;  4QWT A;  5TGN A;  1DVC A;  3OV4 A;  8RNT A;  3BNE A;  3LT8 A;  3F7X A;  2CWV A;  3CNX A;  3WHO A;  4TX4 A;  1EG9 B;  1W4N A;  2IYJ A;  3LTD A;  1N5H A;  1GOU A;  4MMY B;  1QVG 2;  1JB4 A;  1BNF A;  3HIG A;  1FYS A;  1GYB A;  4HM1 B;  1RN7 A;  1D6Y A;  3DZL A;  1SAR A;  2C11 A;  2R4I A;  3RGA A;  4KFF A;  3UL5 A;  4O02 B;  1LOW A;  3IJE B;  3G4S 3;  4AKZ A;  2QEX 3;  1M1K 4;  5LC6 A;  4CCV A;  4N6T A;  3FG3 A;  1LRA A;  4KVH A;  4LGQ A;  1O7P B;  3NBR A;  1DE3 A;  2GXF A;  2YFI B;  4IIA A;  3PGB A;  4FMD A;  4KFE A;  2BO9 B;  4HM5 B;  1OF5 B;  3U97 A;  3G16 A;  3WOD G;  1DMQ A;  3K63 A;  1IT7 A;  2KF6 A;  4HKV B;  5M1A A;  1X1W A;  1TFO A;  1UI8 A;  3NBJ A;  3HI7 A;  3UL6 A;  2C4B A;  1OF5 A;  1WQL B;  4R9L A;  1HYF A;  1OHS A;  3LH4 A;  2OTJ 3;  3QK9 A;  7RNT A;  2P09 A;  1V74 A;  3CMA 3;  1X1X A;  1VQM 3;  1DMM A;  1ROV A;  3Q90 A;  4BTX A;  1GY5 A;  1RGA A;  3KE7 A;  3SOA A;  1CYU A;  1WNH A;  3PYJ A;  2XSO B;  2CG0 A;  3SYU A;  1RNB A;  4GL6 A;  3SVA A;  1JB5 A;  3QRD A;  2CWU A;  2W9P A;  4HZB B;  5BXQ A;  1F8N A;  1OGX A;  3OX9 A;  4EXR A;  2W04 A;  1JRQ A;  1BRJ A;  4N3V A;  5LC7 A;  4WFO A;  1JB2 A;  1I2F A;  5FW5 A;  1W2B 2;  2ML5 A;  2Z7A A;  3DH2 A;  3JUO A;  3MHE A;  5CF1 A;  1LOV A;  4J5K A;  5I97 A;  1PYL A;  2CW9 A;  4KFD A;  3EC9 A;  2QA4 3;  2RGQ A;  1NU3 A;  2H0H A;  3AGN A;  4HVN A;  4LYL B;  1FZU A;  3MG2 A;  4L8O A;  1NB3 I;  1WMP A;  1BGS A;  3G8Z A;  5ELU A;  1BU4 A;  2BMO B;  2K54 A;  5G1K A;  5M19 A;  1A90 A;  5AEW B;  1HKX A;  2YFJ B;  5JPP A;  5DRV A;  1ULI B;  5IEN A;  4BIR A;  1UCK A;  1BRH A;  3CCR 3;  3D5G A;  1UUW B;  1A2V A;  1X1U A;  2RCD A;  1D6U A;  1X1Y A;  4HAA A;  3BNC A;  4R4K A;  1MWR A;  1FGR A;  1Q42 A;  4FCM A;  2CKF B;  1N5P A;  3LTB A;  4R80 A;  2L1S A;  2WOF A;  4WP5 A;  3GZR A;  2GSP A;  4BTY A;  9RNT A;  1VQ5 3;  1FGQ A;  1VQN 3;  1W01 A;  4EC6 A;  3BIR A;  4WYK A;  2L4V A;  2KF5 A;  1STF I;  1G0T A;  3A5E A;  4H61 A;  2OTL 3;  2I9W A;  1JJ2 2;  3G6E 3;  2STD A;  4GSP A;  2XGL A;  5A0O B;  1BNS A;  1BSC A;  1E3V A;  4L8P A;  3OWS A;  2BT3 A;  4MMZ B;  1TU5 A;  4FCJ A;  1O7N B;  1VQP 3;  1MOL A;  2KXG A;  3KKG A;  1I3F A;  3A76 A;  3ROB A;  1BAN A;  3DUK A;  3SOY A;  2KF4 A;  1BIR A;  1JKG A;  1GOY A;  1Y4K A;  2W03 A;  1QAK A;  2ZHX B;  2XGN A;  1FGO A;  3F8H A;  1YJ9 3;  2W9Q A;  2P0M A;  1LNI A;  1RRL A;  3LTA A;  3NX0 A;  3EQQ B;  2LQV A;  1IDP A;  2RSX A;  3SX1 A;  1ROA A;  1IQ8 A;  3EB8 A;  2P0X A;  5CK6 A;  4BU4 A;  3V98 A;  1NJI 4;  1YIT 3;  5AYR B;  4RBN A;  1STD A;  4XDW A;  1O7M B;  2BU4 A;  5CXO A;  2MF7 A;  1QVF 2;  3EX9 A;  3JUM A;  1RN4 A;  5CF2 A;  1MGW A;  1FUT A;  2FXT A;  3NV0 B;  4HM6 B;  6STD A;  4CDL A;  1RGG A;  4H3U A;  3RGR A;  1ZGX A;  2CFD A;  2CFK A;  3GSP A;  1GSP A;  4Q53 A;  1BRI A;  1I2E A;  1LQG C;  2CC3 A;  2HMO B;  2XRX B;  3T0U A;  1FUS A;  1US1 A;  3F9S A;  4N6M A;  4MEI A;  1BNJ A;  1I0X A;  2WGO A;  3MYT A;  5EEO A;  2LYX A;  2V1L A;  4N6L A;  1BNR A;  2ZA4 A;  1ISK A;  1YGW A;  1R4Y A;  2P38 A;  3NXJ A;  3MPH A;  1OUN A;  3OWY A;  3EBY A;  2K3D A;  1E97 A;  2BMQ B;  4FR9 A;  3URP A;  1PU4 A;  1GMR A;  1ZO2 A;  3D79 A;  1ULJ B;  3EE1 A;  5AIG A;  1TIJ A;  1OGZ A;  3LT9 A;  3CD6 3;  2CFL A;  4K61 A;  4MJD A;  2CIU A;  1OPY A;  2SAR A;  2J8X B;  2IUJ A;  3X3Z A;  3LZA A;  5ELJ A;  2F99 A;  4LZI A;  4K1U A;  3T8U A;  1MWU A;  1KWI A;  1Q7H A;  1UDI I;  1VQO 3;  1IVX A;  2O3O A;  1I0V A;  1ZX2 A;  3AMO B;  3CCU 3;  1Q40 B;  1CQS A;  2AAE A;  3B4O A;  2BHM A;  3DXO A;  3MG1 A;  3STD A;  4ORL A;  3EN1 B;  2Q07 A;  3V99 A;  3J7Y d;  3FGY A;  3K7C A;  1IT8 A;  1V57 A;  1YGE A;  3JUP A;  5KP4 A;  2M7O A;  4XDV A;  1Q40 A;  2O9U X;  2F5W A;  4I4K A;  5AIF A;  1EA2 A;  1B27 A;  3S67 A;  4OK0 A;  1UGH I;  4N6N B;  4HM4 B;  3G71 3;  4N6U A;  2HMM B;  2Y74 A;  3HX8 A;  1RGE A;  2W0Q A;  5D83 A;  1TTO A;  1GS3 A;  1B21 A;  1JBS A;  1SIH A;  5IW9 A;  3OW2 2;  4G1M B;  1NB5 I;  3FG4 A;  3CCE 3;  2OOV C;  1RMS A;  1TRQ A;  2P05 A;  3MG3 A;  5GSP A;  1Q9E A;  1V58 A;  2IY2 A;  3NQY A;  3CPO A;  3LTC A;  4PEJ A;  1BVI A;  3RNT A;  2INX A;  5AYS C;  2WO0 A;  1J2B A;  4BL2 A;  3D3L A;  4HM3 B;  2KRT A;  3AHW A;  3OXA A;  3CPW 2;  4NHF A;  1WMO A;  3FKA A;  1BSE A;  1QAF A;  6GSP A;  3V92 A;  1HU9 A;  4NRE A;  1O7H B;  2CHC A;  1G02 A;  3B7C A;  4RNY A;  3M8C A;  1AR0 A;  1BSB A;  2CFG A;  4AEQ A;  3KII A;  1Z1S A;  1N8Q A;  2GU3 A;  3KZT A;  1K8A 4;  1FGM A;  1O7W B;  5IG5 A;  1VQ8 3;  1U8C B;  1IU7 A;  3FLJ A;  1LQM B;  5D81 A;  2CG1 A;  1G96 A;  2CFW A;  4JF8 A;  3T8N A;  2Z76 A;  3SLU A;  1RLS A;  4FMA A;  1IQY A;  4N6O B;  2E2U A;  2YFL B;  3CCQ 3;  5IG4 A;  1E3R A;  1UW1 A;  2HMN B;  4O3V A;  5IEP A;  5JPU A;  3CCV 3;  3D9R A;  1SQW A;  3CU3 A;  4X2H A;  2XFS A;  1T3B A;  3PCS A;  3WMD A;  3EF8 A;  3S28 A;  1VQ9 3;  3B4P A;  1GMQ A;  3ECF A;  3EBT A;  3B8L A;  4RNT A;  3FZW A;  3D5I A;  2UUG C;  1BRG A;  1K28 A;  1DMN A;  4CJN A;  1RGF A;  1LOY A;  1GY7 A;  3DGL A;  3E99 A;  1UCI A;  1JZO A;  1B2Z A;  1QMA A;  3UNL A;  4KT3 B;  7GSP A;  3GZX B;  1RCL A;  1W02 A;  1B2X A;  2IUK A;  1YJW 3;  1NNV A;  2F4Y A;  2JDI H;  3JVC A;  4LEH A;  3X42 A;  3FF0 A;  1RCK A;  1RN1 A;  1BSA A;  1IVV A;  1JZD A;  2CH9 A;  3CXC 2;  3ALA A;  1JV2 B;  2XSH B;  1BUJ A;  1YNV X;  1UI7 A;  1I2G A;  3NM7 A;  3ZFZ A;  3DGY A;  1RNT A;  1RSN A;  3IPT A;  4FCZ A;  4XBY A;  4K1V A;  4ZM8 A;  2H0G A;  3LOY A;  3EHC A;  4R9K A;  1YVB I;  3WDG B;  4STD A;  1O7G B;  2Z77 A;  3KCH A;  1DVD A;  1TP6 A;  3WA3 A;  3Q3F A;  4O8S A;  3L0R A;  2Z6B A;  1JN5 B;  4O2H A;  3BND A;  2W6J H;  3CC7 3;  5CLK A;  1NO3 A;  1BRK A;  2OQE A;  5BU4 A;  1JBT A;  1RRH A;  2UGI A;  4J8T A;  1AQZ A;  1TUH A;  2BMR B;  3GAX A;  3UB1 A;  5BIR A;  3PZW A;  4CPK A;  4EW5 A;  1N9E A;  1IK3 A;  3H51 A;  1AVK A;  4XBX A;  5EQL A;  3RDE A;  3VGN A;  1R4C A;  3ZG5 A;  1WTH A;  3D4A A;  2XR8 B;  3HOH A;  3IMA B;  1UCL A;  3DM8 A;  1GOV A;  2QGU A;  3NV0 A;  4U13 A;  5AI1 A;  1B2M A;  4EV2 A;  1RDS A;  2IA7 A;  4HJL B;  1LXE A;  5D82 A;  5IG0 A;  4HM8 B;  1VZZ A;  4HM0 B;  1BOX A;  2F98 A;  4HOH A;  1A67 A;  3K5T A;  1CYV A; 
#chains in the Genus database with same CATH homology
 1KSI A;  3X40 A;  2XFT A;  5DRE A;  3U1W A;  2HMK B;  3UJM A;  1PFP A;  2KCD A;  3S5C A;  3KSP A;  5STD A;  4KZ1 A;  1W00 A;  1VQK 3;  1TFK A;  1OAC A;  1S5A A;  1S72 3;  1GD3 A;  3CC4 3;  2GEX A;  3S29 A;  1FA3 A;  3CC2 3;  4XBT A;  2OWP A;  1M9G A;  3EJV A;  2D42 A;  2W56 B;  3AMO A;  4LMI A;  1UUV B;  2ZDJ A;  5KP3 A;  2D1W A;  3CME 3;  4XB5 A;  1IVU A;  1W5Z A;  1YI2 3;  1YJN 3;  3DGO A;  4R1K A;  3GZY B;  3PXM A;  2GBX B;  3Q1C A;  2W56 A;  3KSE D;  3S27 A;  3FG1 A;  4N6V 0;  2ZL8 A;  2CWT A;  3HK4 A;  1QJG A;  1NWW A;  1IV9 A;  2GBW B;  3FCS B;  2E2V A;  5IER A;  1SII A;  3FF2 A;  4OUQ A;  3WOF B;  1K73 4;  4RNZ A;  2IMJ A;  4MMX B;  3K9M C;  1IVW A;  2C10 A;  3I0Y A;  3MKI A;  1K9M 4;  1VQ6 3;  2OQE C;  3NM2 A;  4IT7 A;  1VQ4 3;  3DY5 A;  3X3X A;  1C7H A;  5HGR A;  3F7S A;  3DGM A;  3FSD A;  1QAL A;  1YHQ 3;  3CCS 3;  1SPU A;  2FGT A;  4LSO A;  5IEO A;  1LNH A;  1KC8 4;  3PCR A;  1W6Y A;  4BTW A;  3GRD A;  4HBR A;  4EYC A;  1LOX A;  1Q82 4;  3NBB A;  1OHP A;  4AKY A;  4XM4 A;  3CNM A;  3DGN A;  2W2C A;  4X2O A;  1MNL A;  3MSO A;  1WMN A;  3NQZ A;  3GZB A;  4RZM A;  3CCL 3;  2XF3 A;  1IV7 A;  3N8B A;  2OCT A;  3HZP A;  5AEU B;  3CCJ 3;  3SED A;  4GB5 A;  3BB9 A;  2GU1 A;  5JBS A;  2HML B;  3WA2 X;  4FMC A;  1AV4 A;  2BNG A;  1IQX A;  3G0K A;  4HYZ A;  5FGO A;  5IG3 A;  5BVB A;  2FNQ A;  2B1X B;  2HMJ B;  3BNB A;  3JUQ A;  4EV5 A;  1SJW A;  3X41 A;  1RKY A;  1VQ7 3;  1M1X B;  4WHA A;  2XEP A;  2SBL A;  2PNC A;  3K0Z A;  4WYK B;  2PZV A;  2B24 B;  3TDG A;  1W2Z A;  2XH9 A;  1ASK A;  3NHX A;  3GWR A;  4J9A A;  3I55 3;  2E2T A;  3I56 3;  1RJO A;  1T5Y A;  4JRF A;  3N9H A;  4K90 B;  5AII A;  3EN8 A;  1NDO B;  2MC8 A;  2CK3 H;  3MWZ A;  1Q7Y 4;  1FGT A;  4OVM A;  1GD4 A;  4EBG A;  1D6Z A;  2K0M A;  4IPB A;  2ML6 A;  3KFQ C;  1OH0 A;  2YX9 A;  1JKG B;  1U5O A;  5EVH A;  2JQ5 A;  3F8X A;  1EKM A;  1Q81 4;  4WWU C;  3CCM 3;  1OHO A;  3O8Y A;  8CHO A;  2F86 B;  1LVN A;  2WOH A;  1VQL 3;  3H3H A;  3NUV A;  1L5G B;  1M90 4;  5KP1 A;  3BLZ A;  1KQS 2;  1BUQ A;  1JN5 A;  3DMC A;  1KD1 4;  4L7K A;  4HM7 B;  2A15 A;  1GY6 A;  4HZ9 B;  1K41 A;  3F14 A;  3HII A;  3LXU X;  3KN4 A;  3LML A;  4HM2 B;  3WOE B;  1YIJ 3;  3Q2P A;  1CEW I;  2WGQ A;  2OOV A;  3VF1 A;  1FUW A;  3FH1 A;  1W6C A;  1AVL A;  3N54 B;  3X3Y A;  2GEY A;  1W6G A;  3SXX A;  1Q86 4;  1N8R 4;  2RFR A;  1DYU A;  7STD A;  3VSY A;  3OWU A;  1OCV A;  1W7C A;  2QIY A;  3JUN A;  5AIH A;  3PS8 A;  1JNQ A;  5IF6 A;  4FMB A;  3ER7 A;  2Y73 A;  1A2K A;  3F40 A;  5G2G A;  3LYG A;  1EQK A;  1N9J A;  2UX0 A;  4QWT A;  5TGN A;  1DVC A;  3OV4 A;  3BNE A;  3LT8 A;  3F7X A;  2CWV A;  3CNX A;  4TX4 A;  1EG9 B;  1W4N A;  3LTD A;  1N5H A;  4MMY B;  1QVG 2;  1JB4 A;  3HIG A;  1GYB A;  4HM1 B;  1RN7 A;  1D6Y A;  3DZL A;  2C11 A;  2R4I A;  3RGA A;  4KFF A;  3UL5 A;  4O02 B;  3IJE B;  3G4S 3;  4AKZ A;  2QEX 3;  1M1K 4;  5LC6 A;  4CCV A;  4N6T A;  3FG3 A;  4KVH A;  4LGQ A;  1O7P B;  3NBR A;  2GXF A;  2YFI B;  4IIA A;  3PGB A;  4FMD A;  4KFE A;  2BO9 B;  4HM5 B;  1OF5 B;  3U97 A;  3G16 A;  3WOD G;  1DMQ A;  3K63 A;  1IT7 A;  4HKV B;  1TFO A;  1UI8 A;  3NBJ A;  3HI7 A;  3UL6 A;  1OF5 A;  1WQL B;  4R9L A;  1OHS A;  3LH4 A;  2OTJ 3;  3QK9 A;  2P09 A;  1V74 A;  3CMA 3;  1VQM 3;  1DMM A;  1ROV A;  3Q90 A;  4BTX A;  1GY5 A;  3KE7 A;  3SOA A;  1CYU A;  1WNH A;  3PYJ A;  2XSO B;  2CG0 A;  4GL6 A;  3SVA A;  1JB5 A;  3QRD A;  2CWU A;  2W9P A;  4HZB B;  5BXQ A;  1F8N A;  1OGX A;  3OX9 A;  4EXR A;  2W04 A;  1JRQ A;  5LC7 A;  4N3V A;  4WFO A;  1JB2 A;  5FW5 A;  1W2B 2;  2ML5 A;  2Z7A A;  3JUO A;  3MHE A;  5CF1 A;  5I97 A;  2CW9 A;  4KFD A;  3EC9 A;  2QA4 3;  2RGQ A;  1NU3 A;  4HVN A;  3MG2 A;  4L8O A;  1NB3 I;  1WMP A;  3G8Z A;  5ELU A;  2BMO B;  2K54 A;  1A90 A;  5AEW B;  1HKX A;  2YFJ B;  5JPP A;  5DRV A;  1ULI B;  5IEN A;  3CCR 3;  1UUW B;  1A2V A;  2RCD A;  1D6U A;  3BNC A;  4R4K A;  1Q42 A;  1FGR A;  4FCM A;  2CKF B;  1N5P A;  3LTB A;  4R80 A;  2WOF A;  4WP5 A;  4BTY A;  3GZR A;  1VQ5 3;  1VQN 3;  1FGQ A;  1W01 A;  4EC6 A;  4WYK A;  2L4V A;  1STF I;  4H61 A;  2OTL 3;  2I9W A;  1JJ2 2;  3G6E 3;  2STD A;  2XGL A;  5A0O B;  1E3V A;  4L8P A;  3OWS A;  2BT3 A;  4MMZ B;  1TU5 A;  4FCJ A;  1O7N B;  1VQP 3;  1MOL A;  2KXG A;  3KKG A;  3A76 A;  3ROB A;  3DUK A;  3SOY A;  1JKG A;  1Y4K A;  2W03 A;  1QAK A;  2XGN A;  1FGO A;  3F8H A;  1YJ9 3;  2W9Q A;  2P0M A;  1RRL A;  3LTA A;  3NX0 A;  3EQQ B;  2LQV A;  1IDP A;  2RSX A;  3SX1 A;  1ROA A;  1IQ8 A;  3EB8 A;  2P0X A;  5CK6 A;  3V98 A;  1NJI 4;  1YIT 3;  5AYR B;  4RBN A;  1STD A;  4XDW A;  1O7M B;  5CXO A;  2MF7 A;  1QVF 2;  3EX9 A;  3JUM A;  5CF2 A;  2FXT A;  3NV0 B;  4HM6 B;  6STD A;  4CDL A;  4H3U A;  3RGR A;  2CFD A;  2CFK A;  4Q53 A;  2CC3 A;  2HMO B;  2XRX B;  3T0U A;  1US1 A;  3F9S A;  4N6M A;  4MEI A;  2WGO A;  3MYT A;  5EEO A;  2LYX A;  2V1L A;  4N6L A;  1ISK A;  2P38 A;  3NXJ A;  3MPH A;  1OUN A;  3OWY A;  3EBY A;  1E97 A;  2BMQ B;  4FR9 A;  1PU4 A;  1ZO2 A;  1ULJ B;  3EE1 A;  5AIG A;  1TIJ A;  1OGZ A;  3LT9 A;  3CD6 3;  2CFL A;  4K61 A;  4MJD A;  2CIU A;  1OPY A;  2IUJ A;  3X3Z A;  3LZA A;  5ELJ A;  2F99 A;  4LZI A;  4K1U A;  3T8U A;  1KWI A;  1VQO 3;  1IVX A;  2O3O A;  1ZX2 A;  3AMO B;  3CCU 3;  1Q40 B;  1CQS A;  3B4O A;  3DXO A;  2BHM A;  3MG1 A;  3STD A;  4ORL A;  3EN1 B;  2Q07 A;  3V99 A;  3J7Y d;  3FGY A;  3K7C A;  1IT8 A;  3JUP A;  1YGE A;  5KP4 A;  2M7O A;  4XDV A;  1Q40 A;  2O9U X;  4I4K A;  5AIF A;  1EA2 A;  3S67 A;  4OK0 A;  4N6N B;  4HM4 B;  3G71 3;  4N6U A;  2HMM B;  2Y74 A;  3HX8 A;  2W0Q A;  5D83 A;  1GS3 A;  1SIH A;  5IW9 A;  3OW2 2;  4G1M B;  1NB5 I;  3FG4 A;  3CCE 3;  2OOV C;  2P05 A;  3MG3 A;  3NQY A;  3CPO A;  3LTC A;  4PEJ A;  2INX A;  5AYS C;  2WO0 A;  1J2B A;  3D3L A;  4HM3 B;  2KRT A;  3OXA A;  3CPW 2;  4NHF A;  1WMO A;  3FKA A;  1QAF A;  3V92 A;  1HU9 A;  4NRE A;  1O7H B;  2CHC A;  3B7C A;  4RNY A;  3M8C A;  1AR0 A;  2CFG A;  4AEQ A;  3KII A;  1Z1S A;  1N8Q A;  2GU3 A;  3KZT A;  1K8A 4;  1FGM A;  1O7W B;  5IG5 A;  1VQ8 3;  1U8C B;  1IU7 A;  3FLJ A;  5D81 A;  2CG1 A;  1G96 A;  2CFW A;  4JF8 A;  3T8N A;  2Z76 A;  3SLU A;  4FMA A;  1IQY A;  4N6O B;  2E2U A;  2YFL B;  3CCQ 3;  5IG4 A;  1E3R A;  1UW1 A;  2HMN B;  4O3V A;  5IEP A;  5JPU A;  3CCV 3;  3D9R A;  1SQW A;  3CU3 A;  4X2H A;  2XFS A;  3PCS A;  3WMD A;  3EF8 A;  3S28 A;  1VQ9 3;  3B4P A;  3ECF A;  3EBT A;  3B8L A;  3FZW A;  1K28 A;  1DMN A;  1GY7 A;  3DGL A;  3E99 A;  1QMA A;  3UNL A;  3GZX B;  1W02 A;  2IUK A;  1YJW 3;  2JDI H;  3JVC A;  4LEH A;  3X42 A;  3FF0 A;  1IVV A;  2CH9 A;  3CXC 2;  3ALA A;  1JV2 B;  2XSH B;  3NM7 A;  1UI7 A;  3IPT A;  4FCZ A;  4XBY A;  4K1V A;  4ZM8 A;  3LOY A;  3EHC A;  4R9K A;  1YVB I;  3WDG B;  4STD A;  2Z77 A;  1O7G B;  1DVD A;  1TP6 A;  3WA3 A;  4O8S A;  3L0R A;  2Z6B A;  1JN5 B;  4O2H A;  3BND A;  2W6J H;  3CC7 3;  5CLK A;  1NO3 A;  2OQE A;  1RRH A;  4J8T A;  3UB1 A;  1TUH A;  2BMR B;  3GAX A;  3PZW A;  1N9E A;  1IK3 A;  3H51 A;  1AVK A;  4XBX A;  5EQL A;  3RDE A;  3VGN A;  1R4C A;  1WTH A;  2XR8 B;  3IMA B;  3DM8 A;  2QGU A;  4U13 A;  3NV0 A;  5AI1 A;  4EV2 A;  2IA7 A;  4HJL B;  1LXE A;  5D82 A;  5IG0 A;  4HM8 B;  1VZZ A;  4HM0 B;  2F98 A;  1A67 A;  3K5T A;  1CYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...