1VQ83

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq8300
1Q7Y4 1YJ93 1VQP3 1YJW3 1QVG2 1VQ53 3CC23 1VQ83 3CCR3 1Q814 1YIT3 1VQ93 3CC43 2OTJ3 3G4S3 1YIJ3 2QA43 1VQ73 1YHQ3 1M1K4 3CXC2 1VQK3 1QVF2 3CME3 1N8R4 1KD14 1S723 3I563 3CMA3 1KC84 1Q824 1K734 1JJ22 1VQ63 2QEX3 1YI23 1M904 3I553 3CCS3 3G713 3CCV3 1YJN3 1K9M4 1W2B2 3CCM3 2OTL3 3CCU3 3CCL3 1VQO3 3G6E3 3OW22 3CD63 3CC73 1K8A4 3CCE3 3CCQ3 1KQS2 3CPW2 1NJI4 1VQ43 1VQM3 1Q864 1VQL3 1VQN3 3CCJ3
chains in the Genus database with same CATH superfamily
1OCVA 3RGRA 5AEWB 4ORLA 1ZX2A 3LT8A 4MMXB 5IG4A 2BNGA 3EBYA 2FGTA 2GEXA 1EA2A 1QALA 2QA43 2A15A 1RGLA 3OV4A 4WFOA 4KFFA 4IIAA 1KD14 5BIRA 1LQGC 3MHEA 1YNVX 4EBGA 1IVVA 2D42A 8CHOA 5IERA 7STDA 1MWUA 3HI7A 1GMPA 4BTWA 1RMSA 2GBXB 1LOYA 3PZWA 2KCDA 3S67A 1TJDA 3IPTA 1A2PA 1RN4A 1RNTA 4R9KA 5EEOA 1YJN3 2CWUA 3B4OA 3BNBA 3K0ZA 2CIUA 2W0QA 3K7CA 3PCSA 3T8UA 3EN1B 4WYKB 3NBJA 3CC73 1WMPA 4R1KA 1W7CA 3DUKA 1W5ZA 1MWTA 3N54B 3SOAA 2W56B 3FG3A 1ZS7A 3CC23 4HM4B 1VQ83 1UCLA 3QRDA 3D4AA 3D9RA 4HJLB 3WA3A 3K63A 1OGZA 1UGHI 4ILFA 5IEPA 3ALAA 2KAAA 1N9JA 5JBSA 4XDVA 2ZHXB 1OF5A 3LXUX 3MYTA 3B8LA 2XH9A 3VF1A 1YI23 1BNJA 1AVKA 1G96A 1ROAA 1D6UA 4R9LA 3D5GA 3X3ZA 3DGNA 4MJDA 3CNXA 1IQ8A 1LOWA 4EYCA 3CCM3 4KFDA 1W01A 3LTDA 1OHSA 4KZ1A 3D5IA 2B1XB 1VQM3 1NB5I 5M19A 5IF6A 1X1WA 1B20A 4AKYA 1ULJB 2KXGA 4NPBA 2C11A 2P0XA 2W03A 2ZA4A 3NHXA 1N5PA 3LMLA 1RGKA 3NQZA 3FLJA 1I2EA 3S5CA 3DGYA 3MG1A 1GD3A 2UUGC 4TX4A 1NU3A 3NM7A 1TFOA 1WMNA 5G1LA 2P09A 3BNCA 4BL3A 2CX0A 1VZZA 3F7SA 5CXOA 4CJNA 1OPYA 3JUPA 2HMNB 1M904 3A5EA 1UUVB 1D6ZA 2OTL3 3JUQA 1HZ1A 2JQ5A 2KF3A 4STDA 2CFWA 1UCKA 2KF6A 3AGOA 3KE7A 1RRHA 1US1A 3LH4A 3MG3A 1NJI4 4HM3B 1EKMA 4NREA 2YFLB 5IG5A 3DXOA 1FGTA 1MWSA 3S29A 4XBXA 4RNTA 3DGOA 4LZIA 1V57A 4XB5A 1N8QA 1RSNA 1SPUA 1JRQA 3L0RA 4FMCA 2MC8A 2IY2A 3DM8A 3CNMA 2BT3A 2CKFB 5FW5A 8RNTA 3CME3 3V92A 4J9AA 2UX0A 4L7KA 1X1XA 2WGQA 4HOHA 2K54A 1HYFA 3MWZA 3KIIA 4N6V0 2BHMA 3K5TA 3ZG5A 1Q824 3UB1A 1ROVA 2E2UA 3JUOA 4HM0B 2QIYA 5M1AA 1U8CB 1OGXA 1RLSA 2F5MA 2SBLA 1JB4A 3NUVA 2Z76A 2ZL8A 4CPKA 1UUGB 1KSIA 3BB9A 1TTOA 3IMAB 4LYLB 2OWPA 3GAXA 1FUSA 2W9PA 1JB5A 3G8ZA 4MMZB 4N3VA 1RNBA 4HVNA 1KWIA 1EG9B 1AVLA 3G16A 4IPBA 3ECFA 1Q7Y4 4LMIA 1IV9A 1B21A 1AV4A 5IG0A 1V74A 2KF5A 3HIGA 2XR8B 3FZWA 5AI1A 3WMDA 1IV7A 1BVIA 4AKZA 3F8XA 3NV0A 1M1XB 1T2HA 1W6YA 1BSAA 4R4KA 5GSPA 1O7WB 2Z7AA 1B2MA 3AMOA 2K0MA 1GY5A 1GY7A 3F9SA 4CCVA 4MMYB 1RGCA 2Y73A 1YJW3 1VQ63 5KP3A 4K1VA 4BTXA 2CWVA 1T3BA 4AEQA 4HM7B 4EV5A 1B27A 1SIIA 3MG2A 3DGLA 2W04A 1W4NA 3WHOA 4EV2A 1RN7A 5A0OB 1K8A4 3LTAA 3NBBA 4H3UA 3AHWA 4WHAA 2CHCA 9RNTA 3SXXA 1WMOA 4LEHA 5CF2A 1C7HA 3SX1A 2D1WA 2P0MA 4R80A 5D83A 4CDLA 1JBTA 3FSDA 2IUJA 3FCSB 3GZRA 2ML5A 2OCTA 4OK0A 2FNQA 1BNGA 1LRAA 1Q40B 2IUKA 2YX9A 1RRLA 4FCMA 1IT7A 5AIIA 1PFPA 4J8TA 1BANA 4XM4A 3HK4A 4XDWA 3RDEA 4RNZA 2C4BA 3AGNA 2Q07A 3DY5A 1YGEA 5BVBA 1JB2A 1PYLA 1FUWA 3I0YA 4K61A 1I2GA 7GSPA 2CG0A 3G6E3 2O3OA 2CC3A 4N6MA 1RGGA 3SVAA 3LZAA 1NB3I 3B7CA 3EQQB 4WYKA 1TIJA 2XSOB 1LNHA 3SLUA 1ASKA 3NM2A 2XFSA 1K41A 4FCJA 1FGOA 4J5KA 2W56A 4GL6A 4HM6B 3S27A 2XSHB 5IW9A 1I70A 2YFJB 3MPHA 3CC43 3G4S3 3LYGA 1DETA 1QVF2 2SARA 2HMLB 2PNCA 2M7OA 1RCLA 1DYUA 3X40A 1O7PB 1O7GB 3VSYA 1BNFA 3UL6A 2PZVA 3AHSA 1QMAA 3CCS3 4ZM8A 2GU3A 1I8VA 6GSPA 2H0IA 4DKIA 3EJVA 1KQS2 4L8PA 3CPW2 1W6CA 1JBSA 3FF2A 5AEUB 3BNDA 1JKGB 4HM1B 1YJ93 1DMQA 1O7HB 5KP4A 1TUHA 6STDA 1VQP3 3LTCA 1UW1A 5TGNA 4FMAA 1RGAA 3QK9A 1IK3A 2LYXA 1W2ZA 3TDGA 3WOFB 1LVNA 2CFKA 3KN4A 2IMJA 5G1KA 3V99A 1VQ73 2RCDA 1YHQ3 2HMKB 5AIHA 3EF8A 1NO3A 4QWTA 3EHCA 4FCZA 2GBWB 1BSDA 3B4PA 1JN5B 1ZGXA 4GSPA 1NNVA 1QJGA 5BXQA 3CCV3 1J2BA 1BNRA 1AY7A 1BNSA 1R4CA 3CPOA 1W2B2 3T8NA 4FMBA 1BNEA 1TFKA 3CD63 1Q7HA 2KRTA 3NBRA 4RZMA 1GYBA 3J7Yd 3OWUA 3SYUA 3FG1A 1IDPA 1RGFA 1IQYA 1VQ53 1DVCA 1ULIB 1EUIC 3LT9A 1X1UA 3NQYA 5JPUA 1DMMA 4X2HA 1MWRA 4HAAA 1BRJA 4N6TA 3GZBA 3SEDA 1K28A 5BU4A 1LOXA 3X3XA 5EQLA 2P38A 1I2FA 1E97A 3Q1CA 4K1UA 1K734 4GB5A 5IEOA 1G0TA 1MGWA 1YVBI 5CK6A 3DMCA 3O8YA 1L5GB 4HYZA 1BGSA 1FGRA 5CLKA 1U5OA 3JVCA 1RJOA 2BMRB 4HBRA 3CCQ3 1VQQA 3N9HA 1BIRA 1W02A 3RNTA 1A2VA 3KCHA 1UCIA 2KF4A 1IT8A 1LNIA 1GMRA 3F7XA 3BNEA 1JZOA 2AAEA 3UNLA 4O02B 2H0GA 2F86B 3PGBA 1GOUA 1O7NB 3MSOA 3GZYB 5AIFA 4IT7A 1JBRA 2XFTA 2CX1A 2W9QA 1S723 4EXRA 2BMOB 2HOHA 2XGLA 3OXAA 4NHFA 1RGHA 1GY6A 4I4KA 4HM2B 1JNQA 1R4YA 1RDSA 1W00A 1CQSA 1SARA 3EX9A 1N5HA 4N6UA 4WWUC 5LC7A 1FGMA 1QAFA 1IQXA 3WR2A 5ELJA 1BOXA 1GMQA 1QAKA 1TRPA 3CCL3 1NDOB 2OQEA 1AQZA 3FKAA 2RNTA 1VQ43 5DRVA 4X2OA 3A76A 3KZTA 5D82A 2XEPA 3KKGA 1GOYA 1IVUA 1E3VA 1O7MB 5KP1A 1B2ZA 3F14A 3U97A 5EVHA 3WOEB 3GWRA 4EC6A 1YGWA 3GRDA 2RBIA 4I5QA 1OACA 2W6JH 4LGQA 3FH1A 1M1K4 2V1LA 3H3HA 3EE1A 1Q40A 3I563 1LXEA 2HMMB 3JUMA 3K9MC 2P05A 3X3YA 1T5YA 2BIRA 3UL5A 1F8NA 1BRHA 1SJWA 2INXA 2STDA 3LOYA 2R4IA 4O8SA 1YVSA 2CFDA 2F99A 1BSEA 1VQO3 2C10A 1EEJA 3GSPA 4H61A 2FXTA 4OVMA 4RBNA 1BRIA 3ZFZA 1FYSA 3UJMA 4BTYA 1MOLA 3U1WA 3Q2PA 1X1YA 4GHOA 1QVG2 2L1SA 2XGNA 1OHPA 1HU9A 2GU1A 1W6GA 2GXFA 2ML6A 3G0KA 4HM5B 1BUQA 1WNHA 1FA3A 1BAOA 1BRKA 3FGYA 2OOVA 1TU5A 3NXJA 5DREA 1UGIA 2Z6BA 3CXC2 3Q90A 3EN8A 4BU4A 3CMA3 1C54A 1MGRA 1GSPA 3GZXB 3BU4A 5HGRA 3T0UA 1STDA 3M8CA 4KT3B 1I0XA 1D6YA 3Q3FA 3JUNA 1A2KA 2GSPA 3KSPA 2K3DA 3HX8A 3PCRA 1ISKA 2E2TA 1JKGA 1FZUA 7RNTA 2BMQB 1Y4KA 4WP5A 1UI8A 2WO0A 1HKXA 3FG4A 1I3IA 3KFQC 5LC6A 4K90B 3PXMA 3WA2X 1DE3A 2OQEC 1YIT3 3KSED 5ELUA 2Y74A 4FMDA 4MEIA 2WOFA 1YIJ3 4U13A 4BL2A 3VGNA 1OF5B 2XRXB 3F40A 3WODG 5HOHA 1AR0A 2B24B 1KC84 3EB8A 5STDA 2L4VA 3I553 4G1MB 1JN5A 3URPA 5CF1A 2JDIH 3HIIA 4HZ9B 1B2UA 1UI7A 2HMOB 2J8XB 3D3LA 1BRSA 2W2CA 2CH9A 5IG3A 1BSCA 3LTBA 2CWTA 1OUNA 4J5GA 1Q42A 4N6OB 1MNLA 1GOVA 1I3FA 1PY3A 2QGUA 3MKIA 3WDGB 4LSOA 1CYUA 2WGOA 3E99A 1VQ93 2CK3H 1V58A 4KFEA 3V98A 4L8OA 4XBYA 1RCKA 1T2IA 1WQLB 3OWYA 4BIRA 2O9UX 4N6NB 1Z1SA 3PYJA 4PEJA 1JZDA 1BUJA 2OOVC 4HM8B 1SQWA 3ZG0A 2AADA 1CEWI 3RGAA 1K9M4 2BO9B 3IJEB 4O2HA 1IVXA 1BRNL 3STDA 3HZPA 3EC9A 1CYVA 1Q864 1BRGA 2H0HA 1DMNA 3HOHA 4KVHA 1B2SA 2UGIA 2F56A 3ROBA 2F4YA 3D79A 2CW9A 2RSXA 1E3RA 3CCR3 1Q814 5AIGA 3DH2A 6RNTA 3N8BA 4HZBB 3CU3A 3BIRA 2GEYA 5FGOA 1VQK3 4FR9A 4N6LA 4XBTA 2IA7A 1GS3A 5G2GA 1B3SA 1TP6A 1RN1A 3BLZA 2MF7A 1BU4A 1RKYA 1RHLA 1I0VA 4RNYA 3G713 1RTUA 2RFRA 1WTHA 3FF0A 3X42A 3F8HA 1TRQA 2R41A 4Q53A 3CCU3 1A67A 1CH0A 2CFLA 5IENA 3OW22 3CCE3 1LQMB 1IU7A 5I97A 1VQL3 2XF3A 1FUTA 1VQN3 2WOHA 3PS8A 1OH0A 1SIHA 4OUQA 2CG1A 1LOVA 1Q9EA 2BU4A 2YFIB 3NV0B 4JF8A 4HKVB 1DVDA 2OTJ3 2F98A 2I9WA 3X41A 3NX0A 3DZLA 1FGQA 3AMOB 3SOYA 1BNIA 1UDII 1IYYA 1N8R4 3ER7A 1JV2B 5D81A 5M18A 1IVWA 2F5WA 5RNTA 2Z77A 1GD4A 2IYJA 3H51A 5AYSC 1RGEA 3OWSA 1EQKA 1JJ22 4JRFA 2QEX3 1NWWA 2CFGA 3S28A 1BSBA 1ZO2A 2E2VA 2ZDJA 3DGMA 4O3VA 3OX9A 2RGQA 5JPPA 2LQVA 1OHOA 1G02A 1UCJA 1FW7A 2HMJB 5AYRB 1N9EA 1UUWB 1B2XA 1PU4A 4EW5A 1M9GA 3EBTA 1S5AA 1STFI 3CCJ3 1A90A
chains in the Genus database with same CATH topology
1OCVA 3RGRA 5AEWB 4ORLA 1ZX2A 3LT8A 4MMXB 5IG4A 2BNGA 3EBYA 2FGTA 2GEXA 1EA2A 1QALA 2QA43 2A15A 3OV4A 4WFOA 4KFFA 4IIAA 1KD14 3MHEA 4EBGA 1IVVA 2D42A 8CHOA 5IERA 7STDA 3HI7A 4BTWA 2GBXB 3PZWA 2KCDA 3S67A 3IPTA 4R9KA 1YJN3 5EEOA 2CWUA 3B4OA 3BNBA 3K0ZA 2CIUA 2W0QA 3K7CA 3PCSA 3T8UA 3EN1B 4WYKB 3NBJA 3CC73 1WMPA 4R1KA 1W7CA 3DUKA 1W5ZA 3N54B 3SOAA 2W56B 3FG3A 3CC23 4HM4B 1VQ83 3QRDA 3D9RA 4HJLB 3WA3A 3K63A 1OGZA 5IEPA 3ALAA 1N9JA 5JBSA 4XDVA 1OF5A 3LXUX 3MYTA 3B8LA 2XH9A 3VF1A 1YI23 1AVKA 1G96A 1ROAA 1D6UA 4R9LA 3X3ZA 3DGNA 4MJDA 3CNXA 1IQ8A 4EYCA 3CCM3 4KFDA 1W01A 3LTDA 1OHSA 4KZ1A 2B1XB 1VQM3 1NB5I 5IF6A 4AKYA 1ULJB 2KXGA 2C11A 2P0XA 2W03A 3NHXA 1N5PA 3LMLA 3NQZA 3FLJA 3S5CA 3MG1A 4TX4A 1GD3A 1NU3A 3NM7A 1TFOA 1WMNA 2P09A 3BNCA 1VZZA 3F7SA 5CXOA 1OPYA 3JUPA 2HMNB 1M904 1UUVB 1D6ZA 2OTL3 3JUQA 2JQ5A 4STDA 1FA3A 2CFWA 3KE7A 1RRHA 1US1A 3LH4A 3MG3A 1NJI4 4HM3B 1EKMA 4NREA 2YFLB 5IG5A 3DXOA 1FGTA 3S29A 4XBXA 3DGOA 4LZIA 4XB5A 1N8QA 1SPUA 1JRQA 3L0RA 4FMCA 2MC8A 3DM8A 3CNMA 2BT3A 2CKFB 5FW5A 3CME3 3V92A 4J9AA 2UX0A 4L7KA 2WGQA 4N6V0 2K54A 3MWZA 3KIIA 1Q824 2BHMA 3K5TA 3UB1A 1ROVA 2E2UA 3JUOA 4HM0B 2QIYA 1U8CB 1OGXA 2SBLA 3NUVA 1JB4A 2Z76A 2ZL8A 3BB9A 1KSIA 3IMAB 2OWPA 3GAXA 2W9PA 1JB5A 3G8ZA 4MMZB 4N3VA 4HVNA 1KWIA 1EG9B 1AVLA 3G16A 4IPBA 3ECFA 1Q7Y4 4LMIA 1IV9A 1AV4A 5IG0A 1V74A 3HIGA 2XR8B 3FZWA 5AI1A 3WMDA 1IV7A 4AKZA 3F8XA 3NV0A 1M1XB 1W6YA 4R4KA 1O7WB 2Z7AA 3AMOA 2K0MA 1GY5A 1GY7A 3F9SA 4CCVA 4MMYB 2Y73A 1YJW3 1VQ63 5KP3A 4K1VA 4BTXA 2CWVA 4AEQA 4HM7B 4EV5A 1SIIA 3MG2A 3DGLA 2W04A 1W4NA 4EV2A 5A0OB 1RN7A 1K8A4 3LTAA 3NBBA 4H3UA 4WHAA 2CHCA 3SXXA 1WMOA 4LEHA 5CF2A 1C7HA 3SX1A 2D1WA 2P0MA 4R80A 5D83A 4CDLA 3FSDA 2IUJA 3FCSB 3GZRA 2ML5A 2OCTA 4OK0A 2FNQA 1Q40B 2IUKA 2YX9A 1RRLA 4FCMA 1IT7A 5AIIA 1PFPA 4J8TA 4XM4A 3HK4A 4XDWA 3RDEA 4RNZA 2Q07A 3DY5A 1YGEA 5BVBA 1JB2A 1FUWA 3I0YA 4K61A 2CG0A 3G6E3 2O3OA 2CC3A 4N6MA 3SVAA 3LZAA 1NB3I 3B7CA 3EQQB 4WYKA 1TIJA 2XSOB 1LNHA 3SLUA 1ASKA 3NM2A 2XFSA 1K41A 4FCJA 1FGOA 2W56A 4GL6A 4HM6B 3S27A 2XSHB 5IW9A 2YFJB 3MPHA 3CC43 3G4S3 3LYGA 1QVF2 2HMLB 2PNCA 2M7OA 1DYUA 3X40A 1O7PB 1O7GB 3VSYA 3UL6A 2PZVA 1QMAA 3CCS3 4ZM8A 2GU3A 3EJVA 1KQS2 4L8PA 3CPW2 1W6CA 3FF2A 5AEUB 3BNDA 1JKGB 4HM1B 1YJ93 1DMQA 1O7HB 5KP4A 1TUHA 6STDA 1VQP3 3LTCA 1UW1A 5TGNA 4FMAA 3QK9A 1IK3A 2LYXA 1W2ZA 3TDGA 3WOFB 1LVNA 2CFKA 3KN4A 2IMJA 3V99A 1VQ73 1YHQ3 2RCDA 2HMKB 5AIHA 3EF8A 1NO3A 4QWTA 3EHCA 4FCZA 2GBWB 3B4PA 1JN5B 5BXQA 1QJGA 3CCV3 1J2BA 1W2B2 1R4CA 3CPOA 3T8NA 4FMBA 1TFKA 3CD63 2KRTA 3NBRA 4RZMA 1GYBA 3J7Yd 3OWUA 3FG1A 1IDPA 1IQYA 1VQ53 1DVCA 1ULIB 3LT9A 3NQYA 5JPUA 1DMMA 4X2HA 4N6TA 3GZBA 3SEDA 1K28A 1LOXA 3X3XA 5EQLA 2P38A 1E97A 3Q1CA 4K1UA 1K734 4GB5A 5IEOA 1YVBI 5CK6A 3DMCA 3O8YA 1L5GB 4HYZA 1FGRA 5CLKA 1U5OA 3JVCA 1RJOA 2BMRB 4HBRA 3CCQ3 3N9HA 1W02A 1A2VA 1IT8A 3F7XA 3BNEA 3UNLA 4O02B 2F86B 3PGBA 1O7NB 3MSOA 3GZYB 5AIFA 4IT7A 2XFTA 2W9QA 1S723 4EXRA 2BMOB 2XGLA 3OXAA 4NHFA 1GY6A 4I4KA 4HM2B 1JNQA 1W00A 1CQSA 3EX9A 4N6UA 1N5HA 4WWUC 5LC7A 1FGMA 1QAFA 1IQXA 5ELJA 1QAKA 3CCL3 1NDOB 2OQEA 3FKAA 1VQ43 5DRVA 4X2OA 3A76A 3KZTA 5D82A 2XEPA 3KKGA 1IVUA 1E3VA 1O7MB 5KP1A 3F14A 3U97A 5EVHA 3WOEB 3GWRA 4EC6A 3GRDA 1OACA 2W6JH 4LGQA 3FH1A 1M1K4 2V1LA 3H3HA 3EE1A 1Q40A 3I563 1LXEA 2HMMB 3JUMA 3K9MC 2P05A 3X3YA 1T5YA 3UL5A 1F8NA 1SJWA 2INXA 3LOYA 2STDA 2R4IA 4O8SA 2CFDA 2F99A 1VQO3 2C10A 4H61A 2FXTA 4OVMA 4RBNA 3UJMA 4BTYA 1MOLA 3U1WA 3Q2PA 1QVG2 2XGNA 1OHPA 1HU9A 2GU1A 1W6GA 2GXFA 2ML6A 3G0KA 4HM5B 1BUQA 1WNHA 3FGYA 2OOVA 1TU5A 3NXJA 5DREA 3CXC2 2Z6BA 3Q90A 3EN8A 3CMA3 3GZXB 5HGRA 3T0UA 1STDA 3M8CA 1D6YA 3JUNA 1A2KA 3KSPA 3HX8A 3PCRA 1ISKA 2E2TA 1JKGA 2BMQB 1Y4KA 4WP5A 1UI8A 2WO0A 1HKXA 3FG4A 3KFQC 5LC6A 3WA2X 4K90B 3PXMA 2OQEC 1YIT3 3KSED 5ELUA 2Y74A 4FMDA 4MEIA 2WOFA 1YIJ3 4U13A 3VGNA 1OF5B 2XRXB 3F40A 3WODG 1AR0A 2B24B 1KC84 3EB8A 5STDA 2L4VA 3I553 4G1MB 1JN5A 5CF1A 2JDIH 3HIIA 4HZ9B 2HMOB 1UI7A 3D3LA 2W2CA 2CH9A 5IG3A 3LTBA 2CWTA 1OUNA 1Q42A 4N6OB 1MNLA 2QGUA 1CYUA 3MKIA 3WDGB 4LSOA 2WGOA 3E99A 1VQ93 2CK3H 4KFEA 3V98A 4L8OA 4XBYA 1WQLB 3OWYA 2O9UX 4N6NB 1Z1SA 3PYJA 4PEJA 2OOVC 4HM8B 1SQWA 1CEWI 3RGAA 1K9M4 2BO9B 3IJEB 4O2HA 1IVXA 3STDA 3HZPA 3EC9A 1CYVA 1Q864 1DMNA 4KVHA 3ROBA 2CW9A 2RSXA 1E3RA 3CCR3 1Q814 5AIGA 3N8BA 4HZBB 3CU3A 2GEYA 5FGOA 1VQK3 4FR9A 4N6LA 4XBTA 2IA7A 1GS3A 5G2GA 1TP6A 3BLZA 2MF7A 1RKYA 4RNYA 3G713 2RFRA 3FF0A 1WTHA 3X42A 3F8HA 4Q53A 3CCU3 1A67A 2CFLA 5IENA 3OW22 3CCE3 1IU7A 5I97A 1VQL3 2XF3A 1VQN3 2WOHA 3PS8A 1OH0A 1SIHA 4OUQA 2CG1A 3NV0B 2YFIB 4JF8A 4HKVB 1DVDA 2OTJ3 2F98A 2I9WA 3X41A 3NX0A 3DZLA 1FGQA 3AMOB 3SOYA 1N8R4 3ER7A 1JV2B 5D81A 1IVWA 2Z77A 1GD4A 3H51A 5AYSC 1EQKA 3OWSA 1JJ22 4JRFA 2QEX3 1NWWA 2CFGA 3S28A 1ZO2A 2E2VA 2ZDJA 3DGMA 4O3VA 3OX9A 2RGQA 5JPPA 2LQVA 1OHOA 2HMJB 5AYRB 1N9EA 1UUWB 1PU4A 1M9GA 3EBTA 1S5AA 1STFI 3CCJ3 1A90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 4;  1YJ9 3;  1VQP 3;  1YJW 3;  1QVG 2;  1VQ5 3;  3CC2 3;  1VQ8 3;  3CCR 3;  1Q81 4;  1YIT 3;  1VQ9 3;  3CC4 3;  2OTJ 3;  3G4S 3;  1YIJ 3;  2QA4 3;  1VQ7 3;  1YHQ 3;  1M1K 4;  3CXC 2;  1VQK 3;  1QVF 2;  3CME 3;  1N8R 4;  1KD1 4;  1S72 3;  3I56 3;  3CMA 3;  1KC8 4;  1Q82 4;  1K73 4;  1JJ2 2;  1VQ6 3;  2QEX 3;  1YI2 3;  1M90 4;  3I55 3;  3CCS 3;  3G71 3;  3CCV 3;  1YJN 3;  1K9M 4;  1W2B 2;  3CCM 3;  2OTL 3;  3CCU 3;  3CCL 3;  1VQO 3;  3G6E 3;  3OW2 2;  3CD6 3;  3CC7 3;  1K8A 4;  3CCE 3;  3CCQ 3;  1KQS 2;  3CPW 2;  1NJI 4;  1VQ4 3;  1VQM 3;  1Q86 4;  1VQL 3;  1VQN 3;  3CCJ 3; 
#chains in the Genus database with same CATH topology
 1OCV A;  3RGR A;  5AEW B;  4ORL A;  1ZX2 A;  3LT8 A;  4MMX B;  5IG4 A;  2BNG A;  3EBY A;  2FGT A;  2GEX A;  1EA2 A;  1QAL A;  2QA4 3;  2A15 A;  1RGL A;  3OV4 A;  4WFO A;  4KFF A;  4IIA A;  1KD1 4;  5BIR A;  1LQG C;  3MHE A;  1YNV X;  4EBG A;  1IVV A;  2D42 A;  8CHO A;  5IER A;  7STD A;  1MWU A;  3HI7 A;  1GMP A;  4BTW A;  1RMS A;  2GBX B;  1LOY A;  3PZW A;  2KCD A;  3S67 A;  1TJD A;  3IPT A;  1A2P A;  1RN4 A;  1RNT A;  4R9K A;  5EEO A;  1YJN 3;  2CWU A;  3B4O A;  3BNB A;  3K0Z A;  2CIU A;  2W0Q A;  3K7C A;  3PCS A;  3T8U A;  3EN1 B;  4WYK B;  3NBJ A;  3CC7 3;  1WMP A;  4R1K A;  1W7C A;  3DUK A;  1W5Z A;  1MWT A;  3N54 B;  3SOA A;  2W56 B;  3FG3 A;  1ZS7 A;  3CC2 3;  4HM4 B;  1VQ8 3;  1UCL A;  3QRD A;  3D4A A;  3D9R A;  4HJL B;  3WA3 A;  3K63 A;  1OGZ A;  1UGH I;  4ILF A;  5IEP A;  3ALA A;  2KAA A;  1N9J A;  5JBS A;  4XDV A;  2ZHX B;  1OF5 A;  3LXU X;  3MYT A;  3B8L A;  2XH9 A;  3VF1 A;  1YI2 3;  1BNJ A;  1AVK A;  1G96 A;  1ROA A;  1D6U A;  4R9L A;  3D5G A;  3X3Z A;  3DGN A;  4MJD A;  3CNX A;  1IQ8 A;  1LOW A;  4EYC A;  3CCM 3;  4KFD A;  1W01 A;  3LTD A;  1OHS A;  4KZ1 A;  3D5I A;  2B1X B;  1VQM 3;  1NB5 I;  5M19 A;  5IF6 A;  1X1W A;  1B20 A;  4AKY A;  1ULJ B;  2KXG A;  4NPB A;  2C11 A;  2P0X A;  2W03 A;  2ZA4 A;  3NHX A;  1N5P A;  3LML A;  1RGK A;  3NQZ A;  3FLJ A;  1I2E A;  3S5C A;  3DGY A;  3MG1 A;  1GD3 A;  2UUG C;  4TX4 A;  1NU3 A;  3NM7 A;  1TFO A;  1WMN A;  5G1L A;  2P09 A;  3BNC A;  4BL3 A;  2CX0 A;  1VZZ A;  3F7S A;  5CXO A;  4CJN A;  1OPY A;  3JUP A;  2HMN B;  1M90 4;  3A5E A;  1UUV B;  1D6Z A;  2OTL 3;  3JUQ A;  1HZ1 A;  2JQ5 A;  2KF3 A;  4STD A;  2CFW A;  1UCK A;  2KF6 A;  3AGO A;  3KE7 A;  1RRH A;  1US1 A;  3LH4 A;  3MG3 A;  1NJI 4;  4HM3 B;  1EKM A;  4NRE A;  2YFL B;  5IG5 A;  3DXO A;  1FGT A;  1MWS A;  3S29 A;  4XBX A;  4RNT A;  3DGO A;  4LZI A;  1V57 A;  4XB5 A;  1N8Q A;  1RSN A;  1SPU A;  1JRQ A;  3L0R A;  4FMC A;  2MC8 A;  2IY2 A;  3DM8 A;  3CNM A;  2BT3 A;  2CKF B;  5FW5 A;  8RNT A;  3CME 3;  3V92 A;  4J9A A;  2UX0 A;  4L7K A;  1X1X A;  2WGQ A;  4HOH A;  2K54 A;  1HYF A;  3MWZ A;  3KII A;  4N6V 0;  2BHM A;  3K5T A;  3ZG5 A;  1Q82 4;  3UB1 A;  1ROV A;  2E2U A;  3JUO A;  4HM0 B;  2QIY A;  5M1A A;  1U8C B;  1OGX A;  1RLS A;  2F5M A;  2SBL A;  1JB4 A;  3NUV A;  2Z76 A;  2ZL8 A;  4CPK A;  1UUG B;  1KSI A;  3BB9 A;  1TTO A;  3IMA B;  4LYL B;  2OWP A;  3GAX A;  1FUS A;  2W9P A;  1JB5 A;  3G8Z A;  4MMZ B;  4N3V A;  1RNB A;  4HVN A;  1KWI A;  1EG9 B;  1AVL A;  3G16 A;  4IPB A;  3ECF A;  1Q7Y 4;  4LMI A;  1IV9 A;  1B21 A;  1AV4 A;  5IG0 A;  1V74 A;  2KF5 A;  3HIG A;  2XR8 B;  3FZW A;  5AI1 A;  3WMD A;  1IV7 A;  1BVI A;  4AKZ A;  3F8X A;  3NV0 A;  1M1X B;  1T2H A;  1W6Y A;  1BSA A;  4R4K A;  5GSP A;  1O7W B;  2Z7A A;  1B2M A;  3AMO A;  2K0M A;  1GY5 A;  1GY7 A;  3F9S A;  4CCV A;  4MMY B;  1RGC A;  2Y73 A;  1YJW 3;  1VQ6 3;  5KP3 A;  4K1V A;  4BTX A;  2CWV A;  1T3B A;  4AEQ A;  4HM7 B;  4EV5 A;  1B27 A;  1SII A;  3MG2 A;  3DGL A;  2W04 A;  1W4N A;  3WHO A;  4EV2 A;  1RN7 A;  5A0O B;  1K8A 4;  3LTA A;  3NBB A;  4H3U A;  3AHW A;  4WHA A;  2CHC A;  9RNT A;  3SXX A;  1WMO A;  4LEH A;  5CF2 A;  1C7H A;  3SX1 A;  2D1W A;  2P0M A;  4R80 A;  5D83 A;  4CDL A;  1JBT A;  3FSD A;  2IUJ A;  3FCS B;  3GZR A;  2ML5 A;  2OCT A;  4OK0 A;  2FNQ A;  1BNG A;  1LRA A;  1Q40 B;  2IUK A;  2YX9 A;  1RRL A;  4FCM A;  1IT7 A;  5AII A;  1PFP A;  4J8T A;  1BAN A;  4XM4 A;  3HK4 A;  4XDW A;  3RDE A;  4RNZ A;  2C4B A;  3AGN A;  2Q07 A;  3DY5 A;  1YGE A;  5BVB A;  1JB2 A;  1PYL A;  1FUW A;  3I0Y A;  4K61 A;  1I2G A;  7GSP A;  2CG0 A;  3G6E 3;  2O3O A;  2CC3 A;  4N6M A;  1RGG A;  3SVA A;  3LZA A;  1NB3 I;  3B7C A;  3EQQ B;  4WYK A;  1TIJ A;  2XSO B;  1LNH A;  3SLU A;  1ASK A;  3NM2 A;  2XFS A;  1K41 A;  4FCJ A;  1FGO A;  4J5K A;  2W56 A;  4GL6 A;  4HM6 B;  3S27 A;  2XSH B;  5IW9 A;  1I70 A;  2YFJ B;  3MPH A;  3CC4 3;  3G4S 3;  3LYG A;  1DET A;  1QVF 2;  2SAR A;  2HML B;  2PNC A;  2M7O A;  1RCL A;  1DYU A;  3X40 A;  1O7P B;  1O7G B;  3VSY A;  1BNF A;  3UL6 A;  2PZV A;  3AHS A;  1QMA A;  3CCS 3;  4ZM8 A;  2GU3 A;  1I8V A;  6GSP A;  2H0I A;  4DKI A;  3EJV A;  1KQS 2;  4L8P A;  3CPW 2;  1W6C A;  1JBS A;  3FF2 A;  5AEU B;  3BND A;  1JKG B;  4HM1 B;  1YJ9 3;  1DMQ A;  1O7H B;  5KP4 A;  1TUH A;  6STD A;  1VQP 3;  3LTC A;  1UW1 A;  5TGN A;  4FMA A;  1RGA A;  3QK9 A;  1IK3 A;  2LYX A;  1W2Z A;  3TDG A;  3WOF B;  1LVN A;  2CFK A;  3KN4 A;  2IMJ A;  5G1K A;  3V99 A;  1VQ7 3;  2RCD A;  1YHQ 3;  2HMK B;  5AIH A;  3EF8 A;  1NO3 A;  4QWT A;  3EHC A;  4FCZ A;  2GBW B;  1BSD A;  3B4P A;  1JN5 B;  1ZGX A;  4GSP A;  1NNV A;  1QJG A;  5BXQ A;  3CCV 3;  1J2B A;  1BNR A;  1AY7 A;  1BNS A;  1R4C A;  3CPO A;  1W2B 2;  3T8N A;  4FMB A;  1BNE A;  1TFK A;  3CD6 3;  1Q7H A;  2KRT A;  3NBR A;  4RZM A;  1GYB A;  3J7Y d;  3OWU A;  3SYU A;  3FG1 A;  1IDP A;  1RGF A;  1IQY A;  1VQ5 3;  1DVC A;  1ULI B;  1EUI C;  3LT9 A;  1X1U A;  3NQY A;  5JPU A;  1DMM A;  4X2H A;  1MWR A;  4HAA A;  1BRJ A;  4N6T A;  3GZB A;  3SED A;  1K28 A;  5BU4 A;  1LOX A;  3X3X A;  5EQL A;  2P38 A;  1I2F A;  1E97 A;  3Q1C A;  4K1U A;  1K73 4;  4GB5 A;  5IEO A;  1G0T A;  1MGW A;  1YVB I;  5CK6 A;  3DMC A;  3O8Y A;  1L5G B;  4HYZ A;  1BGS A;  1FGR A;  5CLK A;  1U5O A;  3JVC A;  1RJO A;  2BMR B;  4HBR A;  3CCQ 3;  1VQQ A;  3N9H A;  1BIR A;  1W02 A;  3RNT A;  1A2V A;  3KCH A;  1UCI A;  2KF4 A;  1IT8 A;  1LNI A;  1GMR A;  3F7X A;  3BNE A;  1JZO A;  2AAE A;  3UNL A;  4O02 B;  2H0G A;  2F86 B;  3PGB A;  1GOU A;  1O7N B;  3MSO A;  3GZY B;  5AIF A;  4IT7 A;  1JBR A;  2XFT A;  2CX1 A;  2W9Q A;  1S72 3;  4EXR A;  2BMO B;  2HOH A;  2XGL A;  3OXA A;  4NHF A;  1RGH A;  1GY6 A;  4I4K A;  4HM2 B;  1JNQ A;  1R4Y A;  1RDS A;  1W00 A;  1CQS A;  1SAR A;  3EX9 A;  1N5H A;  4N6U A;  4WWU C;  5LC7 A;  1FGM A;  1QAF A;  1IQX A;  3WR2 A;  5ELJ A;  1BOX A;  1GMQ A;  1QAK A;  1TRP A;  3CCL 3;  1NDO B;  2OQE A;  1AQZ A;  3FKA A;  2RNT A;  1VQ4 3;  5DRV A;  4X2O A;  3A76 A;  3KZT A;  5D82 A;  2XEP A;  3KKG A;  1GOY A;  1IVU A;  1E3V A;  1O7M B;  5KP1 A;  1B2Z A;  3F14 A;  3U97 A;  5EVH A;  3WOE B;  3GWR A;  4EC6 A;  1YGW A;  3GRD A;  2RBI A;  4I5Q A;  1OAC A;  2W6J H;  4LGQ A;  3FH1 A;  1M1K 4;  2V1L A;  3H3H A;  3EE1 A;  1Q40 A;  3I56 3;  1LXE A;  2HMM B;  3JUM A;  3K9M C;  2P05 A;  3X3Y A;  1T5Y A;  2BIR A;  3UL5 A;  1F8N A;  1BRH A;  1SJW A;  2INX A;  2STD A;  3LOY A;  2R4I A;  4O8S A;  1YVS A;  2CFD A;  2F99 A;  1BSE A;  1VQO 3;  2C10 A;  1EEJ A;  3GSP A;  4H61 A;  2FXT A;  4OVM A;  4RBN A;  1BRI A;  3ZFZ A;  1FYS A;  3UJM A;  4BTY A;  1MOL A;  3U1W A;  3Q2P A;  1X1Y A;  4GHO A;  1QVG 2;  2L1S A;  2XGN A;  1OHP A;  1HU9 A;  2GU1 A;  1W6G A;  2GXF A;  2ML6 A;  3G0K A;  4HM5 B;  1BUQ A;  1WNH A;  1FA3 A;  1BAO A;  1BRK A;  3FGY A;  2OOV A;  1TU5 A;  3NXJ A;  5DRE A;  1UGI A;  2Z6B A;  3CXC 2;  3Q90 A;  3EN8 A;  4BU4 A;  3CMA 3;  1C54 A;  1MGR A;  1GSP A;  3GZX B;  3BU4 A;  5HGR A;  3T0U A;  1STD A;  3M8C A;  4KT3 B;  1I0X A;  1D6Y A;  3Q3F A;  3JUN A;  1A2K A;  2GSP A;  3KSP A;  2K3D A;  3HX8 A;  3PCR A;  1ISK A;  2E2T A;  1JKG A;  1FZU A;  7RNT A;  2BMQ B;  1Y4K A;  4WP5 A;  1UI8 A;  2WO0 A;  1HKX A;  3FG4 A;  1I3I A;  3KFQ C;  5LC6 A;  4K90 B;  3PXM A;  3WA2 X;  1DE3 A;  2OQE C;  1YIT 3;  3KSE D;  5ELU A;  2Y74 A;  4FMD A;  4MEI A;  2WOF A;  1YIJ 3;  4U13 A;  4BL2 A;  3VGN A;  1OF5 B;  2XRX B;  3F40 A;  3WOD G;  5HOH A;  1AR0 A;  2B24 B;  1KC8 4;  3EB8 A;  5STD A;  2L4V A;  3I55 3;  4G1M B;  1JN5 A;  3URP A;  5CF1 A;  2JDI H;  3HII A;  4HZ9 B;  1B2U A;  1UI7 A;  2HMO B;  2J8X B;  3D3L A;  1BRS A;  2W2C A;  2CH9 A;  5IG3 A;  1BSC A;  3LTB A;  2CWT A;  1OUN A;  4J5G A;  1Q42 A;  4N6O B;  1MNL A;  1GOV A;  1I3F A;  1PY3 A;  2QGU A;  3MKI A;  3WDG B;  4LSO A;  1CYU A;  2WGO A;  3E99 A;  1VQ9 3;  2CK3 H;  1V58 A;  4KFE A;  3V98 A;  4L8O A;  4XBY A;  1RCK A;  1T2I A;  1WQL B;  3OWY A;  4BIR A;  2O9U X;  4N6N B;  1Z1S A;  3PYJ A;  4PEJ A;  1JZD A;  1BUJ A;  2OOV C;  4HM8 B;  1SQW A;  3ZG0 A;  2AAD A;  1CEW I;  3RGA A;  1K9M 4;  2BO9 B;  3IJE B;  4O2H A;  1IVX A;  1BRN L;  3STD A;  3HZP A;  3EC9 A;  1CYV A;  1Q86 4;  1BRG A;  2H0H A;  1DMN A;  3HOH A;  4KVH A;  1B2S A;  2UGI A;  2F56 A;  3ROB A;  2F4Y A;  3D79 A;  2CW9 A;  2RSX A;  1E3R A;  3CCR 3;  1Q81 4;  5AIG A;  3DH2 A;  6RNT A;  3N8B A;  4HZB B;  3CU3 A;  3BIR A;  2GEY A;  5FGO A;  1VQK 3;  4FR9 A;  4N6L A;  4XBT A;  2IA7 A;  1GS3 A;  5G2G A;  1B3S A;  1TP6 A;  1RN1 A;  3BLZ A;  2MF7 A;  1BU4 A;  1RKY A;  1RHL A;  1I0V A;  4RNY A;  3G71 3;  1RTU A;  2RFR A;  1WTH A;  3FF0 A;  3X42 A;  3F8H A;  1TRQ A;  2R41 A;  4Q53 A;  3CCU 3;  1A67 A;  1CH0 A;  2CFL A;  5IEN A;  3OW2 2;  3CCE 3;  1LQM B;  1IU7 A;  5I97 A;  1VQL 3;  2XF3 A;  1FUT A;  1VQN 3;  2WOH A;  3PS8 A;  1OH0 A;  1SIH A;  4OUQ A;  2CG1 A;  1LOV A;  1Q9E A;  2BU4 A;  2YFI B;  3NV0 B;  4JF8 A;  4HKV B;  1DVD A;  2OTJ 3;  2F98 A;  2I9W A;  3X41 A;  3NX0 A;  3DZL A;  1FGQ A;  3AMO B;  3SOY A;  1BNI A;  1UDI I;  1IYY A;  1N8R 4;  3ER7 A;  1JV2 B;  5D81 A;  5M18 A;  1IVW A;  2F5W A;  5RNT A;  2Z77 A;  1GD4 A;  2IYJ A;  3H51 A;  5AYS C;  1RGE A;  3OWS A;  1EQK A;  1JJ2 2;  4JRF A;  2QEX 3;  1NWW A;  2CFG A;  3S28 A;  1BSB A;  1ZO2 A;  2E2V A;  2ZDJ A;  3DGM A;  4O3V A;  3OX9 A;  2RGQ A;  5JPP A;  2LQV A;  1OHO A;  1G02 A;  1UCJ A;  1FW7 A;  2HMJ B;  5AYR B;  1N9E A;  1UUW B;  1B2X A;  1PU4 A;  4EW5 A;  1M9G A;  3EBT A;  1S5A A;  1STF I;  3CCJ 3;  1A90 A; 
#chains in the Genus database with same CATH homology
 1OCV A;  3RGR A;  5AEW B;  4ORL A;  1ZX2 A;  3LT8 A;  4MMX B;  5IG4 A;  2BNG A;  3EBY A;  2FGT A;  2GEX A;  1EA2 A;  1QAL A;  2QA4 3;  2A15 A;  3OV4 A;  4WFO A;  4KFF A;  4IIA A;  1KD1 4;  3MHE A;  4EBG A;  1IVV A;  2D42 A;  8CHO A;  5IER A;  7STD A;  3HI7 A;  4BTW A;  2GBX B;  3PZW A;  2KCD A;  3S67 A;  3IPT A;  4R9K A;  1YJN 3;  5EEO A;  2CWU A;  3B4O A;  3BNB A;  3K0Z A;  2CIU A;  2W0Q A;  3K7C A;  3PCS A;  3T8U A;  3EN1 B;  4WYK B;  3NBJ A;  3CC7 3;  1WMP A;  4R1K A;  1W7C A;  3DUK A;  1W5Z A;  3N54 B;  3SOA A;  2W56 B;  3FG3 A;  3CC2 3;  4HM4 B;  1VQ8 3;  3QRD A;  3D9R A;  4HJL B;  3WA3 A;  3K63 A;  1OGZ A;  5IEP A;  3ALA A;  1N9J A;  5JBS A;  4XDV A;  1OF5 A;  3LXU X;  3MYT A;  3B8L A;  2XH9 A;  3VF1 A;  1YI2 3;  1AVK A;  1G96 A;  1ROA A;  1D6U A;  4R9L A;  3X3Z A;  3DGN A;  4MJD A;  3CNX A;  1IQ8 A;  4EYC A;  3CCM 3;  4KFD A;  1W01 A;  3LTD A;  1OHS A;  4KZ1 A;  2B1X B;  1VQM 3;  1NB5 I;  5IF6 A;  4AKY A;  1ULJ B;  2KXG A;  2C11 A;  2P0X A;  2W03 A;  3NHX A;  1N5P A;  3LML A;  3NQZ A;  3FLJ A;  3S5C A;  3MG1 A;  4TX4 A;  1GD3 A;  1NU3 A;  3NM7 A;  1TFO A;  1WMN A;  2P09 A;  3BNC A;  1VZZ A;  3F7S A;  5CXO A;  1OPY A;  3JUP A;  2HMN B;  1M90 4;  1UUV B;  1D6Z A;  2OTL 3;  3JUQ A;  2JQ5 A;  4STD A;  1FA3 A;  2CFW A;  3KE7 A;  1RRH A;  1US1 A;  3LH4 A;  3MG3 A;  1NJI 4;  4HM3 B;  1EKM A;  4NRE A;  2YFL B;  5IG5 A;  3DXO A;  1FGT A;  3S29 A;  4XBX A;  3DGO A;  4LZI A;  4XB5 A;  1N8Q A;  1SPU A;  1JRQ A;  3L0R A;  4FMC A;  2MC8 A;  3DM8 A;  3CNM A;  2BT3 A;  2CKF B;  5FW5 A;  3CME 3;  3V92 A;  4J9A A;  2UX0 A;  4L7K A;  2WGQ A;  4N6V 0;  2K54 A;  3MWZ A;  3KII A;  1Q82 4;  2BHM A;  3K5T A;  3UB1 A;  1ROV A;  2E2U A;  3JUO A;  4HM0 B;  2QIY A;  1U8C B;  1OGX A;  2SBL A;  3NUV A;  1JB4 A;  2Z76 A;  2ZL8 A;  3BB9 A;  1KSI A;  3IMA B;  2OWP A;  3GAX A;  2W9P A;  1JB5 A;  3G8Z A;  4MMZ B;  4N3V A;  4HVN A;  1KWI A;  1EG9 B;  1AVL A;  3G16 A;  4IPB A;  3ECF A;  1Q7Y 4;  4LMI A;  1IV9 A;  1AV4 A;  5IG0 A;  1V74 A;  3HIG A;  2XR8 B;  3FZW A;  5AI1 A;  3WMD A;  1IV7 A;  4AKZ A;  3F8X A;  3NV0 A;  1M1X B;  1W6Y A;  4R4K A;  1O7W B;  2Z7A A;  3AMO A;  2K0M A;  1GY5 A;  1GY7 A;  3F9S A;  4CCV A;  4MMY B;  2Y73 A;  1YJW 3;  1VQ6 3;  5KP3 A;  4K1V A;  4BTX A;  2CWV A;  4AEQ A;  4HM7 B;  4EV5 A;  1SII A;  3MG2 A;  3DGL A;  2W04 A;  1W4N A;  4EV2 A;  5A0O B;  1RN7 A;  1K8A 4;  3LTA A;  3NBB A;  4H3U A;  4WHA A;  2CHC A;  3SXX A;  1WMO A;  4LEH A;  5CF2 A;  1C7H A;  3SX1 A;  2D1W A;  2P0M A;  4R80 A;  5D83 A;  4CDL A;  3FSD A;  2IUJ A;  3FCS B;  3GZR A;  2ML5 A;  2OCT A;  4OK0 A;  2FNQ A;  1Q40 B;  2IUK A;  2YX9 A;  1RRL A;  4FCM A;  1IT7 A;  5AII A;  1PFP A;  4J8T A;  4XM4 A;  3HK4 A;  4XDW A;  3RDE A;  4RNZ A;  2Q07 A;  3DY5 A;  1YGE A;  5BVB A;  1JB2 A;  1FUW A;  3I0Y A;  4K61 A;  2CG0 A;  3G6E 3;  2O3O A;  2CC3 A;  4N6M A;  3SVA A;  3LZA A;  1NB3 I;  3B7C A;  3EQQ B;  4WYK A;  1TIJ A;  2XSO B;  1LNH A;  3SLU A;  1ASK A;  3NM2 A;  2XFS A;  1K41 A;  4FCJ A;  1FGO A;  2W56 A;  4GL6 A;  4HM6 B;  3S27 A;  2XSH B;  5IW9 A;  2YFJ B;  3MPH A;  3CC4 3;  3G4S 3;  3LYG A;  1QVF 2;  2HML B;  2PNC A;  2M7O A;  1DYU A;  3X40 A;  1O7P B;  1O7G B;  3VSY A;  3UL6 A;  2PZV A;  1QMA A;  3CCS 3;  4ZM8 A;  2GU3 A;  3EJV A;  1KQS 2;  4L8P A;  3CPW 2;  1W6C A;  3FF2 A;  5AEU B;  3BND A;  1JKG B;  4HM1 B;  1YJ9 3;  1DMQ A;  1O7H B;  5KP4 A;  1TUH A;  6STD A;  1VQP 3;  3LTC A;  1UW1 A;  5TGN A;  4FMA A;  3QK9 A;  1IK3 A;  2LYX A;  1W2Z A;  3TDG A;  3WOF B;  1LVN A;  2CFK A;  3KN4 A;  2IMJ A;  3V99 A;  1VQ7 3;  1YHQ 3;  2RCD A;  2HMK B;  5AIH A;  3EF8 A;  1NO3 A;  4QWT A;  3EHC A;  4FCZ A;  2GBW B;  3B4P A;  1JN5 B;  5BXQ A;  1QJG A;  3CCV 3;  1J2B A;  1W2B 2;  1R4C A;  3CPO A;  3T8N A;  4FMB A;  1TFK A;  3CD6 3;  2KRT A;  3NBR A;  4RZM A;  1GYB A;  3J7Y d;  3OWU A;  3FG1 A;  1IDP A;  1IQY A;  1VQ5 3;  1DVC A;  1ULI B;  3LT9 A;  3NQY A;  5JPU A;  1DMM A;  4X2H A;  4N6T A;  3GZB A;  3SED A;  1K28 A;  1LOX A;  3X3X A;  5EQL A;  2P38 A;  1E97 A;  3Q1C A;  4K1U A;  1K73 4;  4GB5 A;  5IEO A;  1YVB I;  5CK6 A;  3DMC A;  3O8Y A;  1L5G B;  4HYZ A;  1FGR A;  5CLK A;  1U5O A;  3JVC A;  1RJO A;  2BMR B;  4HBR A;  3CCQ 3;  3N9H A;  1W02 A;  1A2V A;  1IT8 A;  3F7X A;  3BNE A;  3UNL A;  4O02 B;  2F86 B;  3PGB A;  1O7N B;  3MSO A;  3GZY B;  5AIF A;  4IT7 A;  2XFT A;  2W9Q A;  1S72 3;  4EXR A;  2BMO B;  2XGL A;  3OXA A;  4NHF A;  1GY6 A;  4I4K A;  4HM2 B;  1JNQ A;  1W00 A;  1CQS A;  3EX9 A;  4N6U A;  1N5H A;  4WWU C;  5LC7 A;  1FGM A;  1QAF A;  1IQX A;  5ELJ A;  1QAK A;  3CCL 3;  1NDO B;  2OQE A;  3FKA A;  1VQ4 3;  5DRV A;  4X2O A;  3A76 A;  3KZT A;  5D82 A;  2XEP A;  3KKG A;  1IVU A;  1E3V A;  1O7M B;  5KP1 A;  3F14 A;  3U97 A;  5EVH A;  3WOE B;  3GWR A;  4EC6 A;  3GRD A;  1OAC A;  2W6J H;  4LGQ A;  3FH1 A;  1M1K 4;  2V1L A;  3H3H A;  3EE1 A;  1Q40 A;  3I56 3;  1LXE A;  2HMM B;  3JUM A;  3K9M C;  2P05 A;  3X3Y A;  1T5Y A;  3UL5 A;  1F8N A;  1SJW A;  2INX A;  3LOY A;  2STD A;  2R4I A;  4O8S A;  2CFD A;  2F99 A;  1VQO 3;  2C10 A;  4H61 A;  2FXT A;  4OVM A;  4RBN A;  3UJM A;  4BTY A;  1MOL A;  3U1W A;  3Q2P A;  1QVG 2;  2XGN A;  1OHP A;  1HU9 A;  2GU1 A;  1W6G A;  2GXF A;  2ML6 A;  3G0K A;  4HM5 B;  1BUQ A;  1WNH A;  3FGY A;  2OOV A;  1TU5 A;  3NXJ A;  5DRE A;  3CXC 2;  2Z6B A;  3Q90 A;  3EN8 A;  3CMA 3;  3GZX B;  5HGR A;  3T0U A;  1STD A;  3M8C A;  1D6Y A;  3JUN A;  1A2K A;  3KSP A;  3HX8 A;  3PCR A;  1ISK A;  2E2T A;  1JKG A;  2BMQ B;  1Y4K A;  4WP5 A;  1UI8 A;  2WO0 A;  1HKX A;  3FG4 A;  3KFQ C;  5LC6 A;  3WA2 X;  4K90 B;  3PXM A;  2OQE C;  1YIT 3;  3KSE D;  5ELU A;  2Y74 A;  4FMD A;  4MEI A;  2WOF A;  1YIJ 3;  4U13 A;  3VGN A;  1OF5 B;  2XRX B;  3F40 A;  3WOD G;  1AR0 A;  2B24 B;  1KC8 4;  3EB8 A;  5STD A;  2L4V A;  3I55 3;  4G1M B;  1JN5 A;  5CF1 A;  2JDI H;  3HII A;  4HZ9 B;  2HMO B;  1UI7 A;  3D3L A;  2W2C A;  2CH9 A;  5IG3 A;  3LTB A;  2CWT A;  1OUN A;  1Q42 A;  4N6O B;  1MNL A;  2QGU A;  1CYU A;  3MKI A;  3WDG B;  4LSO A;  2WGO A;  3E99 A;  1VQ9 3;  2CK3 H;  4KFE A;  3V98 A;  4L8O A;  4XBY A;  1WQL B;  3OWY A;  2O9U X;  4N6N B;  1Z1S A;  3PYJ A;  4PEJ A;  2OOV C;  4HM8 B;  1SQW A;  1CEW I;  3RGA A;  1K9M 4;  2BO9 B;  3IJE B;  4O2H A;  1IVX A;  3STD A;  3HZP A;  3EC9 A;  1CYV A;  1Q86 4;  1DMN A;  4KVH A;  3ROB A;  2CW9 A;  2RSX A;  1E3R A;  3CCR 3;  1Q81 4;  5AIG A;  3N8B A;  4HZB B;  3CU3 A;  2GEY A;  5FGO A;  1VQK 3;  4FR9 A;  4N6L A;  4XBT A;  2IA7 A;  1GS3 A;  5G2G A;  1TP6 A;  3BLZ A;  2MF7 A;  1RKY A;  4RNY A;  3G71 3;  2RFR A;  3FF0 A;  1WTH A;  3X42 A;  3F8H A;  4Q53 A;  3CCU 3;  1A67 A;  2CFL A;  5IEN A;  3OW2 2;  3CCE 3;  1IU7 A;  5I97 A;  1VQL 3;  2XF3 A;  1VQN 3;  2WOH A;  3PS8 A;  1OH0 A;  1SIH A;  4OUQ A;  2CG1 A;  3NV0 B;  2YFI B;  4JF8 A;  4HKV B;  1DVD A;  2OTJ 3;  2F98 A;  2I9W A;  3X41 A;  3NX0 A;  3DZL A;  1FGQ A;  3AMO B;  3SOY A;  1N8R 4;  3ER7 A;  1JV2 B;  5D81 A;  1IVW A;  2Z77 A;  1GD4 A;  3H51 A;  5AYS C;  1EQK A;  3OWS A;  1JJ2 2;  4JRF A;  2QEX 3;  1NWW A;  2CFG A;  3S28 A;  1ZO2 A;  2E2V A;  2ZDJ A;  3DGM A;  4O3V A;  3OX9 A;  2RGQ A;  5JPP A;  2LQV A;  1OHO A;  2HMJ B;  5AYR B;  1N9E A;  1UUW B;  1PU4 A;  1M9G A;  3EBT A;  1S5A A;  1STF I;  3CCJ 3;  1A90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...