1VQ83

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq8300
1KQS2 1K9M4 1W2B2 2QEX3 2QA43 1YHQ3 1VQ63 3OW22 1VQM3 1K8A4 1M1K4 3CXC2 1Q864 3G713 1NJI4 1KD14 2OTJ3 1YIT3 1YJN3 3CCJ3 1VQN3 2OTL3 3CC23 1YIJ3 3CCS3 1JJ22 1VQ73 1VQP3 1YJ93 1QVF2 3CME3 1Q824 3CCR3 1VQ93 3CPW2 3CCV3 1VQ43 1VQ83 3I563 3CCE3 1YI23 1YJW3 1S723 3G4S3 1K734 1KC84 3CC73 1Q814 1VQL3 3CMA3 1VQO3 3CCU3 1VQ53 3G6E3 3CCQ3 1M904 3CC43 3CD63 1QVG2 1VQK3 1N8R4 3CCM3 1Q7Y4 3CCL3 3I553
chains in the Genus database with same CATH superfamily
4HJLB 4LEHA 1CQSA 1AV4A 2QEX3 1UUGB 4L8PA 1GYBA 3E99A 1Q7HA 6RNTA 4OUQA 1DMQA 3UJMA 4N6V0 5GSPA 3WOFB 1MWSA 1I2FA 3ECFA 1X1UA 4L8OA 1VQN3 2B1XB 5AEUB 4RNYA 5ELJA 3GZXB 4IPBA 4EV5A 1UCIA 3AGOA 4JF8A 4CDLA 5JPPA 1Q824 1A90A 1MWUA 4DKIA 4BTWA 1SJWA 5DREA 3CCE3 1B2MA 3CNMA 2F5MA 1GMPA 1S5AA 4EXRA 1W4NA 5FW5A 3S67A 1UGIA 1WQLB 4HM0B 2O3OA 4H61A 5IG3A 5KP4A 3LOYA 3Q2PA 1N8R4 3OV4A 3NUVA 3ROBA 1Q40A 2FNQA 1DVCA 1UUWB 1SARA 2XSOB 5EQLA 7RNTA 2XR8B 3FSDA 2HMKB 5RNTA 1AVKA 2ZHXB 1QALA 3F7SA 2Q07A 3KSPA 1YIT3 2XGNA 2IUJA 1VQ73 4N6OB 5BXQA 4I4KA 3SYUA 3EHCA 3NQZA 3SEDA 4N6TA 2B24B 1BIRA 2LQVA 3LXUX 3CPW2 3CU3A 1GY5A 3KIIA 1FGRA 2ZL8A 3HZPA 4NREA 1Z1SA 1D6ZA 3LTBA 3JUMA 4J5GA 3AMOB 2ML5A 1UDII 3KE7A 1VZZA 3CCQ3 2BMRB 1BUQA 1VQ53 1RMSA 3SVAA 2GXFA 2O9UX 4KZ1A 2CG1A 2W56B 2CFDA 3H51A 1F8NA 2CFGA 2F4YA 2KF4A 4TX4A 4ILFA 2OQEC 2KF3A 5AIIA 4LSOA 3UL5A 1BSCA 1G96A 1HU9A 1ZGXA 1M1K4 2CHCA 3PCRA 1GMRA 1TUHA 2R4IA 3NBJA 3Q1CA 4K90B 4NHFA 3N54B 1JKGA 4HM2B 3NBRA 3CC23 1JJ22 3LZAA 1NDOB 1BGSA 1FYSA 1FGMA 5M19A 4HYZA 3F8XA 1OCVA 1LXEA 2W0QA 2WOHA 4STDA 1Y4KA 4HM8B 2RSXA 4R9LA 2CWTA 1MWTA 2CW9A 3G0KA 1DMMA 1BNJA 3HI7A 1EA2A 1M904 2BNGA 2ZDJA 3S28A 3LH4A 1Q9EA 3ZFZA 1GOVA 4GL6A 2GEXA 1LOYA 4L7KA 2W56A 1A2KA 3GZRA 2FXTA 5G1LA 3WR2A 2HMLB 3AGNA 3SOAA 1K8A4 1V57A 1Q864 2CH9A 2XH9A 4HM7B 3BNDA 2PNCA 3N8BA 3CCJ3 1ISKA 8RNTA 1DVDA 4ZM8A 2K54A 5IEOA 3NV0A 2CX1A 4PEJA 3DY5A 3STDA 3X40A 1IT7A 4K1VA 2OQEA 5M1AA 3OX9A 1VQ93 2RGQA 3ALAA 2Y74A 5IG4A 1VQ83 3PXMA 3F7XA 3G4S3 1TRPA 1TFKA 3D5GA 4XBTA 1IT8A 1AY7A 3DMCA 2BT3A 5JBSA 3CCM3 1M9GA 1RGAA 4BL2A 1GY6A 1KQS2 1IVWA 3LYGA 3VGNA 3BNBA 1UCJA 1W2B2 3X3YA 1FW7A 3JUNA 1GD4A 2RBIA 1OF5A 3DH2A 1EKMA 2C10A 3URPA 6STDA 2XFTA 1BNFA 2WO0A 4XM4A 1CYUA 1RGEA 1JNQA 3LTCA 1E97A 5G1KA 4XDVA 3MWZA 5CLKA 4LZIA 5JPUA 3MPHA 3I563 4BL3A 1G02A 3AHSA 1BSAA 3MHEA 5AYRB 3SLUA 2LYXA 3D5IA 3LTDA 1I2EA 1UW1A 4GHOA 5CF1A 4FMCA 4HKVB 7GSPA 2P09A 2K0MA 2M7OA 3KKGA 1LQGC 3F14A 3UNLA 4X2HA 1N5HA 1B2SA 1I0XA 1MGWA 1MNLA 2CFLA 3RGRA 1OHPA 2INXA 5AIGA 1AR0A 1B3SA 1KSIA 1OF5B 4FMDA 3GRDA 1LOWA 3SXXA 1SPUA 1IQXA 3AMOA 3K0ZA 4LMIA 5STDA 3K63A 3NX0A 1OH0A 3RGAA 3DM8A 3WA2X 1YGEA 3IPTA 2UUGC 1A2PA 2KF6A 1W6YA 2SBLA 1BNSA 1BRSA 4FMBA 3ER7A 1EUIC 2JDIH 2XFSA 2P38A 5AIHA 4CJNA 4EYCA 7STDA 2W9QA 3B8LA 2H0HA 2CC3A 1FUTA 1QJGA 3CC73 2F98A 2GBXB 2GEYA 5BVBA 1VQO3 1JKGB 3S5CA 1OPYA 1W5ZA 3MKIA 5IENA 1IV9A 3OWUA 3F9SA 3DUKA 1B20A 2AAEA 1W02A 3NV0B 2W9PA 1K28A 3I553 3FH1A 1LNIA 4EW5A 1ULIB 1I2GA 2P0XA 2H0GA 4LYLB 4N6UA 1IVXA 1BRJA 1C7HA 1FZUA 1BUJA 4RZMA 3T8UA 2F5WA 3GSPA 1W6CA 1JB5A 1OGZA 1BRKA 4GB5A 1YJN3 4K1UA 1WMPA 4RBNA 3CPOA 1YVSA 1RLSA 1IVVA 2MF7A 3K5TA 3I0YA 3NM7A 5AYSC 5M18A 1YNVX 1B21A 5HGRA 3CME3 2QA43 2Z76A 3FLJA 3FZWA 4N6LA 1JBRA 1RN1A 3CCV3 3GWRA 1YJW3 1O7GB 4HVNA 2OOVA 3S29A 2AADA 2KXGA 1JB2A 2P05A 1WNHA 1PU4A 1ROVA 3KZTA 1B27A 2CWUA 3MYTA 2HOHA 2W6JH 1HYFA 3J7Yd 4K61A 4R9KA 4HBRA 5FGOA 1UGHI 4R80A 1C54A 1RGHA 3D79A 2BO9B 3V92A 2RFRA 2E2UA 2UX0A 1QMAA 1STDA 3B7CA 4HZ9B 2CX0A 1LVNA 1R4CA 1SIIA 1T5YA 3MG3A 2F56A 5LC6A 3VF1A 2OTL3 1IVUA 1R4YA 1MWRA 1RN7A 2BMOB 1NU3A 1ZS7A 3EX9A 1MOLA 3FGYA 1VQ43 1GD3A 1JRQA 3MSOA 1AQZA 3JUPA 1O7HB 1N5PA 3FKAA 4WHAA 2BHMA 2C11A 2W03A 2Z7AA 4J8TA 1RCKA 2KRTA 3G6E3 1BU4A 2D42A 5IEPA 3D4AA 4WFOA 6GSPA 3PGBA 1UCKA 1EEJA 2JQ5A 4HM1B 3CCL3 3OWYA 2XEPA 2IA7A 2YX9A 2CFKA 1VQM3 1BNRA 1NJI4 4MMZB 1KD14 1EG9B 5CF2A 4Q53A 4OVMA 2CWVA 4EBGA 8CHOA 2CK3H 3V98A 4ORLA 3Q90A 1UCLA 4QWTA 1Q40B 1RGKA 3D3LA 5EVHA 4FCJA 3MG1A 2UGIA 4RNZA 4J9AA 1CH0A 1RGFA 1O7PB 3BNEA 2YFIB 2Y73A 2Z77A 1Q814 2ML6A 3PYJA 1N9JA 1EQKA 1CYVA 3AHWA 2RNTA 3EE1A 1JZDA 1ASKA 5KP3A 3DXOA 5LC7A 1A67A 1S723 1FGQA 2GU1A 2XGLA 1QAKA 2P0MA 1RGCA 4N3VA 3LT9A 1BSBA 1DMNA 3O8YA 3ZG5A 3GZYB 4WYKA 5DRVA 3WMDA 3B4PA 3EBTA 1IQ8A 1BRHA 1IQYA 2C4BA 3KN4A 3H3HA 5IG0A 2CIUA 1YIJ3 1KWIA 4HM3B 4O8SA 5EEOA 3EF8A 2STDA 3RDEA 5IERA 4J5KA 1LNHA 1OHSA 4EV2A 2KCDA 2HMMB 4KT3B 3DGLA 1BRNL 1K41A 2R41A 3OWSA 3BIRA 1NB3I 3S27A 1VQK3 1W6GA 3MG2A 3N9HA 1IDPA 1TIJA 1IK3A 2D1WA 3BLZA 1BSDA 4XB5A 3BB9A 3OW22 5AIFA 1RHLA 3GAXA 1NNVA 1ZO2A 3ZG0A 3L0RA 1GY7A 3X3ZA 1T2HA 3CXC2 3G8ZA 1T3BA 2F99A 4FR9A 1FGTA 1GSPA 3CCS3 1STFI 1GOUA 3HX8A 1US1A 3DGNA 3WHOA 3F40A 3KFQC 1IV7A 1BVIA 1W7CA 3OXAA 1RRLA 3CCR3 4XBYA 1UUVB 2MC8A 1U5OA 2GU3A 2IYJA 2KAAA 4KFDA 2V1LA 1N8QA 2Z6BA 4LGQA 2E2TA 3FG3A 4EC6A 1K734 3DGOA 4R1KA 2IMJA 1TJDA 3NHXA 3EQQB 1RGGA 4N6NB 3EN8A 1QAFA 1VQQA 2XSHB 2CKFB 5D81A 1K9M4 5BIRA 1VQ63 1WMOA 2K3DA 1UI8A 3G713 1BSEA 3BNCA 1UI7A 2BU4A 1BNIA 3U97A 2HMNB 5IG5A 4G1MB 4R4KA 2OTJ3 3IJEB 3PCSA 1I3FA 4O2HA 2BMQB 2XRXB 1B2UA 1GS3A 1MGRA 3VSYA 4BTYA 3HK4A 3HOHA 1FGOA 4AEQA 1JBTA 4HAAA 4BU4A 1BRIA 1J2BA 1DE3A 3WOEB 2RCDA 1D6YA 1YI23 4IIAA 1E3VA 1TRQA 1JN5B 2H0IA 2YFJB 5G2GA 3SX1A 1RKYA 4HZBB 3CMA3 1V58A 2OWPA 3JVCA 1SQWA 3EB8A 1A2VA 1RCLA 2HMJB 1E3RA 1RNBA 3FG1A 1X1XA 3EJVA 5ELUA 2I9WA 3D9RA 1LQMB 1O7MB 1BNGA 1M1XB 3U1WA 1TTOA 3UB1A 1YGWA 5CK6A 4GSPA 3G16A 1DYUA 1RJOA 2L4VA 3DGMA 5KP1A 1OGXA 4FCMA 1TFOA 1RGLA 1RDSA 4AKYA 4JRFA 1GMQA 2PZVA 1RSNA 5AI1A 4RNTA 3K7CA 3V99A 1I3IA 2SARA 1NO3A 4H3UA 1JN5A 4HM5B 1VQL3 1I70A 3K9MC 1O7WB 2L1SA 3QK9A 3CCU3 3CC43 1OHOA 5TGNA 1RNTA 4CPKA 1OACA 1O7NB 1W2ZA 1QVG2 1BANA 1D6UA 1HKXA 3TDGA 1V74A 3WODG 5A0OB 2F86B 3FG4A 4KVHA 1Q7Y4 1W00A 4WP5A 3FF2A 2W2CA 1YHQ3 3PS8A 1JBSA 2GBWB 3FCSB 4XDWA 3EC9A 3LTAA 9RNTA 4IT7A 1HZ1A 1I0VA 1LRAA 1FUWA 4CCVA 3GZBA 4BIRA 1VQP3 2WGQA 3KSED 5D83A 5BU4A 3LT8A 2W04A 3HIGA 2WGOA 3JUQA 5D82A 3NXJA 2IY2A 3QRDA 3LMLA 1N9EA 2FGTA 4FMAA 3CD63 3F8HA 4OK0A 3EN1B 2IUKA 3HIIA 2YFLB 1W01A 2J8XB 3T0UA 3A5EA 1BNEA 1PY3A 2KF5A 1BOXA 2OOVC 5IF6A 1BAOA 4HOHA 1L5GB 4XBXA 1DETA 1RRHA 3NBBA 4WYKB 4AKZA 1IU7A 3JUOA 1ZX2A 3NQYA 1I8VA 1QVF2 2XF3A 4O02B 2BIRA 3IMAB 4MMXB 4N6MA 4O3VA 3KCHA 3T8NA 3DZLA 1NWWA 1KC84 4I5QA 5I97A 1G0TA 1B2ZA 3WA3A 1B2XA 4FCZA 2CG0A 2QIYA 1SIHA 1JZOA 1X1WA 2WOFA 4HM4B 3PZWA 1BRGA 1AVLA 1NB5I 1LOXA 4KFEA 1T2IA 1X1YA 4U13A 1FA3A 2A15A 1IYYA 4KFFA 4MMYB 3B4OA 4BTXA 1RTUA 1GOYA 4HM6B 3SOYA 1FUSA 5HOHA 3WDGB 3NM2A 5AEWB 2HMOB 3EBYA 3Q3FA 1LOVA 1ROAA 1JB4A 2CFWA 5CXOA 5IW9A 1YJ93 4MJDA 3BU4A 3CNXA 1Q42A 1ULJB 1RN4A 1CEWI 1JV2B 2QGUA 3FF0A 3RNTA 1TP6A 1U8CB 3X42A 3M8CA 2ZA4A 1PYLA 2GSPA 1OUNA 2OCTA 1WTHA 4NPBA 4X2OA 1WMNA 3X3XA 3UL6A 2E2VA 3DGYA 1PFPA 1TU5A 3A76A 4MEIA 4WWUC 1YVBI 3X41A
chains in the Genus database with same CATH topology
4HJLB 4LEHA 1CQSA 1AV4A 2QEX3 4L8PA 1GYBA 3E99A 4OUQA 1DMQA 3UJMA 4N6V0 3WOFB 3ECFA 4L8OA 1VQN3 2B1XB 5AEUB 4RNYA 5ELJA 3GZXB 4IPBA 4EV5A 4JF8A 4CDLA 5JPPA 1Q824 1A90A 4BTWA 1SJWA 5DREA 3CCE3 3CNMA 1S5AA 4EXRA 1W4NA 5FW5A 3S67A 1WQLB 4HM0B 5KP4A 2O3OA 4H61A 5IG3A 3LOYA 3Q2PA 1N8R4 3OV4A 3NUVA 3ROBA 1Q40A 2FNQA 1DVCA 1UUWB 2XSOB 5EQLA 2XR8B 3FSDA 2HMKB 1AVKA 1QALA 3F7SA 2Q07A 3KSPA 1YIT3 2XGNA 2IUJA 1VQ73 4N6OB 5BXQA 4I4KA 3EHCA 3NQZA 3SEDA 4N6TA 2B24B 2LQVA 3CPW2 3LXUX 3CU3A 1GY5A 3KIIA 1FGRA 2ZL8A 3HZPA 4NREA 1Z1SA 1D6ZA 3LTBA 3JUMA 3AMOB 2ML5A 3KE7A 3CCQ3 1VZZA 1BUQA 2BMRB 1VQ53 3SVAA 2GXFA 2O9UX 4KZ1A 2CG1A 2W56B 2CFDA 3H51A 1F8NA 2CFGA 4TX4A 5AIIA 3UL5A 2QA43 2OQEC 1M1K4 4LSOA 1G96A 1HU9A 2CHCA 3PCRA 1TUHA 2R4IA 4K90B 3NBJA 3Q1CA 4NHFA 3N54B 1JKGA 4HM2B 3NBRA 3CC23 1JJ22 3LZAA 1NDOB 1FGMA 4HYZA 3F8XA 1OCVA 1LXEA 2W0QA 2WOHA 4STDA 1Y4KA 4HM8B 2RSXA 4R9LA 2CWTA 2CW9A 3G0KA 1DMMA 3HI7A 1EA2A 1M904 2BNGA 2ZDJA 3S28A 3LH4A 4GL6A 2GEXA 4L7KA 2W56A 1A2KA 3GZRA 2FXTA 2HMLB 3SOAA 1K8A4 1Q864 2CH9A 2XH9A 4HM7B 3BNDA 2PNCA 3N8BA 3CCJ3 1ISKA 1DVDA 4ZM8A 2K54A 5IEOA 3NV0A 4PEJA 3DY5A 3STDA 3X40A 1IT7A 4K1VA 2OQEA 1VQ93 3OX9A 2RGQA 3ALAA 2Y74A 5IG4A 1VQ83 3PXMA 3F7XA 3G4S3 1TFKA 4XBTA 1IT8A 3DMCA 2BT3A 5JBSA 3CCM3 1M9GA 1GY6A 1KQS2 1IVWA 3LYGA 3VGNA 3BNBA 1W2B2 3X3YA 3JUNA 1GD4A 1OF5A 1EKMA 2C10A 6STDA 2XFTA 2WO0A 4XM4A 1CYUA 1JNQA 3LTCA 1E97A 4XDVA 3MWZA 5CLKA 4LZIA 5JPUA 3MPHA 3I563 5AYRB 3MHEA 3SLUA 2LYXA 3LTDA 1UW1A 5CF1A 4FMCA 4HKVB 2P09A 2K0MA 2M7OA 3KKGA 3F14A 3UNLA 4X2HA 1N5HA 1MNLA 2CFLA 3RGRA 1OHPA 2INXA 5AIGA 1AR0A 1KSIA 1OF5B 4FMDA 3GRDA 3SXXA 1SPUA 1IQXA 3AMOA 3K0ZA 4LMIA 5STDA 3K63A 3NX0A 1OH0A 3RGAA 3DM8A 3WA2X 1YGEA 3IPTA 1W6YA 2SBLA 4FMBA 3ER7A 2JDIH 7STDA 2XFSA 2P38A 5AIHA 4EYCA 2W9QA 3B8LA 2CC3A 1QJGA 3CC73 2F98A 2GBXB 2GEYA 5BVBA 1VQO3 1JKGB 3S5CA 1OPYA 1W5ZA 3MKIA 5IENA 1IV9A 3OWUA 3F9SA 3DUKA 3I553 1W02A 3NV0B 2W9PA 1K28A 3FH1A 1ULIB 2P0XA 4N6UA 1IVXA 1C7HA 4RZMA 3T8UA 1W6CA 1JB5A 1OGZA 4GB5A 1YJN3 4K1UA 1WMPA 4RBNA 3CPOA 2MF7A 3K5TA 1IVVA 3I0YA 3NM7A 5AYSC 3CME3 5HGRA 2Z76A 3FLJA 3FZWA 4N6LA 3CCV3 3GWRA 1YJW3 1O7GB 4HVNA 2OOVA 3S29A 2KXGA 1JB2A 2P05A 1WNHA 1PU4A 1ROVA 3KZTA 2CWUA 3MYTA 2W6JH 3J7Yd 4K61A 4R9KA 4HBRA 5FGOA 4R80A 3V92A 2BO9B 2RFRA 2E2UA 2UX0A 1QMAA 1STDA 3B7CA 4HZ9B 1LVNA 1R4CA 1SIIA 1T5YA 3MG3A 5LC6A 3VF1A 2OTL3 1IVUA 1RN7A 2BMOB 1NU3A 3EX9A 1MOLA 3FGYA 1VQ43 1GD3A 1JRQA 3MSOA 3JUPA 4WHAA 1O7HB 1N5PA 3FKAA 1S723 2BHMA 2C11A 2W03A 2Z7AA 4J8TA 2KRTA 3G6E3 2D42A 5IEPA 4WFOA 3PGBA 3CCL3 4HM1B 2JQ5A 3OWYA 2XEPA 2IA7A 2YX9A 2CFKA 1VQM3 1NJI4 4MMZB 1KD14 1EG9B 5CF2A 4Q53A 4OVMA 2CWVA 4EBGA 8CHOA 2CK3H 3V98A 4ORLA 3Q90A 4QWTA 1Q40B 3D3LA 5EVHA 4FCJA 3MG1A 4RNZA 4J9AA 1O7PB 3BNEA 2YFIB 2Y73A 2Z77A 1Q814 2ML6A 3PYJA 1N9JA 1EQKA 1CYVA 3EE1A 1ASKA 5KP3A 3DXOA 5LC7A 1A67A 1FGQA 2GU1A 2XGLA 1QAKA 2P0MA 4N3VA 3LT9A 3O8YA 1DMNA 3GZYB 4WYKA 5DRVA 3WMDA 3B4PA 3EBTA 1IQ8A 1IQYA 5IG0A 3KN4A 3H3HA 2CIUA 1YIJ3 1KWIA 4HM3B 4O8SA 5EEOA 3EF8A 2STDA 3RDEA 5IERA 1LNHA 1OHSA 4EV2A 2KCDA 2HMMB 3DGLA 1K41A 3OWSA 1NB3I 3S27A 1VQK3 1W6GA 3MG2A 3N9HA 1IDPA 1TIJA 1IK3A 2D1WA 3BLZA 4XB5A 3BB9A 3OW22 5AIFA 3GAXA 1ZO2A 3L0RA 1GY7A 3X3ZA 3CXC2 3G8ZA 2F99A 4FR9A 1FGTA 3CCS3 1STFI 3HX8A 1US1A 3DGNA 3F40A 3KFQC 1IV7A 1W7CA 3OXAA 1RRLA 3CCR3 4XBYA 1UUVB 2MC8A 1U5OA 2GU3A 4KFDA 4LGQA 1K734 2V1LA 1N8QA 2Z6BA 4EC6A 2E2TA 3FG3A 3DGOA 4R1KA 2IMJA 3NHXA 3EQQB 4N6NB 3EN8A 1QAFA 2XSHB 2CKFB 5D81A 1K9M4 1VQ63 1WMOA 1UI8A 3G713 3BNCA 1UI7A 3U97A 5IG5A 2HMNB 4G1MB 4R4KA 2OTJ3 3IJEB 3PCSA 4O2HA 2BMQB 2XRXB 1GS3A 3VSYA 4BTYA 3HK4A 1FGOA 4AEQA 1J2BA 3WOEB 2RCDA 1D6YA 1YI23 4IIAA 1E3VA 5G2GA 1JN5B 2YFJB 3SX1A 1RKYA 4HZBB 3CMA3 2OWPA 3JVCA 1SQWA 3EB8A 1A2VA 2HMJB 1E3RA 3FG1A 3EJVA 5ELUA 2I9WA 3D9RA 1O7MB 1M1XB 3U1WA 3UB1A 5CK6A 3G16A 1DYUA 1RJOA 2L4VA 3DGMA 5KP1A 1OGXA 4FCMA 1TFOA 4AKYA 4JRFA 2PZVA 5AI1A 3K7CA 3V99A 1NO3A 4H3UA 1JN5A 4HM5B 1VQL3 3K9MC 1O7WB 3QK9A 3CCU3 3CC43 1OHOA 5TGNA 1QVG2 1OACA 1O7NB 1W2ZA 1D6UA 1HKXA 3TDGA 1V74A 3WODG 5A0OB 2F86B 3FG4A 4KVHA 1Q7Y4 1W00A 4WP5A 3FF2A 2W2CA 1YHQ3 3PS8A 2GBWB 3FCSB 4XDWA 3EC9A 3LTAA 4IT7A 1FUWA 4CCVA 3GZBA 1VQP3 2WGQA 3KSED 5D83A 3LT8A 2W04A 3HIGA 2WGOA 3JUQA 5D82A 3NXJA 3QRDA 3LMLA 1N9EA 2FGTA 4FMAA 3CD63 3F8HA 4OK0A 3EN1B 2IUKA 3HIIA 2YFLB 1W01A 3T0UA 2OOVC 5IF6A 1L5GB 4XBXA 1RRHA 3NBBA 4WYKB 4AKZA 1IU7A 3JUOA 1ZX2A 3NQYA 1QVF2 2XF3A 4O02B 3IMAB 4MMXB 4N6MA 4O3VA 3T8NA 3DZLA 1NWWA 1KC84 5I97A 3WA3A 4FCZA 2CG0A 2QIYA 1SIHA 2WOFA 4HM4B 3PZWA 1AVLA 1NB5I 1LOXA 4KFEA 4U13A 1FA3A 2A15A 4KFFA 4MMYB 3B4OA 4BTXA 4HM6B 3SOYA 3WDGB 3NM2A 5AEWB 2HMOB 3EBYA 1ROAA 1JB4A 2CFWA 5CXOA 5IW9A 1YJ93 4MJDA 3CNXA 1Q42A 1ULJB 1CEWI 1JV2B 2QGUA 3FF0A 1TP6A 1U8CB 3X42A 3M8CA 1OUNA 2OCTA 1WTHA 4X2OA 3X3XA 1WMNA 3UL6A 2E2VA 1PFPA 1TU5A 3A76A 4MEIA 4WWUC 1YVBI 3X41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS 2;  1K9M 4;  1W2B 2;  2QEX 3;  2QA4 3;  1YHQ 3;  1VQ6 3;  3OW2 2;  1VQM 3;  1K8A 4;  1M1K 4;  3CXC 2;  1Q86 4;  3G71 3;  1NJI 4;  1KD1 4;  2OTJ 3;  1YIT 3;  1YJN 3;  3CCJ 3;  1VQN 3;  2OTL 3;  3CC2 3;  1YIJ 3;  3CCS 3;  1JJ2 2;  1VQ7 3;  1VQP 3;  1YJ9 3;  1QVF 2;  3CME 3;  1Q82 4;  3CCR 3;  1VQ9 3;  3CPW 2;  3CCV 3;  1VQ4 3;  1VQ8 3;  3I56 3;  3CCE 3;  1YI2 3;  1YJW 3;  1S72 3;  3G4S 3;  1K73 4;  1KC8 4;  3CC7 3;  1Q81 4;  1VQL 3;  3CMA 3;  1VQO 3;  3CCU 3;  1VQ5 3;  3G6E 3;  3CCQ 3;  1M90 4;  3CC4 3;  3CD6 3;  1QVG 2;  1VQK 3;  1N8R 4;  3CCM 3;  1Q7Y 4;  3CCL 3;  3I55 3; 
#chains in the Genus database with same CATH topology
 4HJL B;  4LEH A;  1CQS A;  1AV4 A;  2QEX 3;  1UUG B;  4L8P A;  1GYB A;  3E99 A;  1Q7H A;  6RNT A;  4OUQ A;  1DMQ A;  3UJM A;  4N6V 0;  5GSP A;  3WOF B;  1MWS A;  1I2F A;  3ECF A;  1X1U A;  4L8O A;  1VQN 3;  2B1X B;  5AEU B;  4RNY A;  5ELJ A;  3GZX B;  4IPB A;  4EV5 A;  1UCI A;  3AGO A;  4JF8 A;  4CDL A;  5JPP A;  1Q82 4;  1A90 A;  1MWU A;  4DKI A;  4BTW A;  1SJW A;  5DRE A;  3CCE 3;  1B2M A;  3CNM A;  2F5M A;  1GMP A;  1S5A A;  4EXR A;  1W4N A;  5FW5 A;  3S67 A;  1UGI A;  1WQL B;  4HM0 B;  2O3O A;  4H61 A;  5IG3 A;  5KP4 A;  3LOY A;  3Q2P A;  1N8R 4;  3OV4 A;  3NUV A;  3ROB A;  1Q40 A;  2FNQ A;  1DVC A;  1UUW B;  1SAR A;  2XSO B;  5EQL A;  7RNT A;  2XR8 B;  3FSD A;  2HMK B;  5RNT A;  1AVK A;  2ZHX B;  1QAL A;  3F7S A;  2Q07 A;  3KSP A;  1YIT 3;  2XGN A;  2IUJ A;  1VQ7 3;  4N6O B;  5BXQ A;  4I4K A;  3SYU A;  3EHC A;  3NQZ A;  3SED A;  4N6T A;  2B24 B;  1BIR A;  2LQV A;  3LXU X;  3CPW 2;  3CU3 A;  1GY5 A;  3KII A;  1FGR A;  2ZL8 A;  3HZP A;  4NRE A;  1Z1S A;  1D6Z A;  3LTB A;  3JUM A;  4J5G A;  3AMO B;  2ML5 A;  1UDI I;  3KE7 A;  1VZZ A;  3CCQ 3;  2BMR B;  1BUQ A;  1VQ5 3;  1RMS A;  3SVA A;  2GXF A;  2O9U X;  4KZ1 A;  2CG1 A;  2W56 B;  2CFD A;  3H51 A;  1F8N A;  2CFG A;  2F4Y A;  2KF4 A;  4TX4 A;  4ILF A;  2OQE C;  2KF3 A;  5AII A;  4LSO A;  3UL5 A;  1BSC A;  1G96 A;  1HU9 A;  1ZGX A;  1M1K 4;  2CHC A;  3PCR A;  1GMR A;  1TUH A;  2R4I A;  3NBJ A;  3Q1C A;  4K90 B;  4NHF A;  3N54 B;  1JKG A;  4HM2 B;  3NBR A;  3CC2 3;  1JJ2 2;  3LZA A;  1NDO B;  1BGS A;  1FYS A;  1FGM A;  5M19 A;  4HYZ A;  3F8X A;  1OCV A;  1LXE A;  2W0Q A;  2WOH A;  4STD A;  1Y4K A;  4HM8 B;  2RSX A;  4R9L A;  2CWT A;  1MWT A;  2CW9 A;  3G0K A;  1DMM A;  1BNJ A;  3HI7 A;  1EA2 A;  1M90 4;  2BNG A;  2ZDJ A;  3S28 A;  3LH4 A;  1Q9E A;  3ZFZ A;  1GOV A;  4GL6 A;  2GEX A;  1LOY A;  4L7K A;  2W56 A;  1A2K A;  3GZR A;  2FXT A;  5G1L A;  3WR2 A;  2HML B;  3AGN A;  3SOA A;  1K8A 4;  1V57 A;  1Q86 4;  2CH9 A;  2XH9 A;  4HM7 B;  3BND A;  2PNC A;  3N8B A;  3CCJ 3;  1ISK A;  8RNT A;  1DVD A;  4ZM8 A;  2K54 A;  5IEO A;  3NV0 A;  2CX1 A;  4PEJ A;  3DY5 A;  3STD A;  3X40 A;  1IT7 A;  4K1V A;  2OQE A;  5M1A A;  3OX9 A;  1VQ9 3;  2RGQ A;  3ALA A;  2Y74 A;  5IG4 A;  1VQ8 3;  3PXM A;  3F7X A;  3G4S 3;  1TRP A;  1TFK A;  3D5G A;  4XBT A;  1IT8 A;  1AY7 A;  3DMC A;  2BT3 A;  5JBS A;  3CCM 3;  1M9G A;  1RGA A;  4BL2 A;  1GY6 A;  1KQS 2;  1IVW A;  3LYG A;  3VGN A;  3BNB A;  1UCJ A;  1W2B 2;  3X3Y A;  1FW7 A;  3JUN A;  1GD4 A;  2RBI A;  1OF5 A;  3DH2 A;  1EKM A;  2C10 A;  3URP A;  6STD A;  2XFT A;  1BNF A;  2WO0 A;  4XM4 A;  1CYU A;  1RGE A;  1JNQ A;  3LTC A;  1E97 A;  5G1K A;  4XDV A;  3MWZ A;  5CLK A;  4LZI A;  5JPU A;  3MPH A;  3I56 3;  4BL3 A;  1G02 A;  3AHS A;  1BSA A;  3MHE A;  5AYR B;  3SLU A;  2LYX A;  3D5I A;  3LTD A;  1I2E A;  1UW1 A;  4GHO A;  5CF1 A;  4FMC A;  4HKV B;  7GSP A;  2P09 A;  2K0M A;  2M7O A;  3KKG A;  1LQG C;  3F14 A;  3UNL A;  4X2H A;  1N5H A;  1B2S A;  1I0X A;  1MGW A;  1MNL A;  2CFL A;  3RGR A;  1OHP A;  2INX A;  5AIG A;  1AR0 A;  1B3S A;  1KSI A;  1OF5 B;  4FMD A;  3GRD A;  1LOW A;  3SXX A;  1SPU A;  1IQX A;  3AMO A;  3K0Z A;  4LMI A;  5STD A;  3K63 A;  3NX0 A;  1OH0 A;  3RGA A;  3DM8 A;  3WA2 X;  1YGE A;  3IPT A;  2UUG C;  1A2P A;  2KF6 A;  1W6Y A;  2SBL A;  1BNS A;  1BRS A;  4FMB A;  3ER7 A;  1EUI C;  2JDI H;  2XFS A;  2P38 A;  5AIH A;  4CJN A;  4EYC A;  7STD A;  2W9Q A;  3B8L A;  2H0H A;  2CC3 A;  1FUT A;  1QJG A;  3CC7 3;  2F98 A;  2GBX B;  2GEY A;  5BVB A;  1VQO 3;  1JKG B;  3S5C A;  1OPY A;  1W5Z A;  3MKI A;  5IEN A;  1IV9 A;  3OWU A;  3F9S A;  3DUK A;  1B20 A;  2AAE A;  1W02 A;  3NV0 B;  2W9P A;  1K28 A;  3I55 3;  3FH1 A;  1LNI A;  4EW5 A;  1ULI B;  1I2G A;  2P0X A;  2H0G A;  4LYL B;  4N6U A;  1IVX A;  1BRJ A;  1C7H A;  1FZU A;  1BUJ A;  4RZM A;  3T8U A;  2F5W A;  3GSP A;  1W6C A;  1JB5 A;  1OGZ A;  1BRK A;  4GB5 A;  1YJN 3;  4K1U A;  1WMP A;  4RBN A;  3CPO A;  1YVS A;  1RLS A;  1IVV A;  2MF7 A;  3K5T A;  3I0Y A;  3NM7 A;  5AYS C;  5M18 A;  1YNV X;  1B21 A;  5HGR A;  3CME 3;  2QA4 3;  2Z76 A;  3FLJ A;  3FZW A;  4N6L A;  1JBR A;  1RN1 A;  3CCV 3;  3GWR A;  1YJW 3;  1O7G B;  4HVN A;  2OOV A;  3S29 A;  2AAD A;  2KXG A;  1JB2 A;  2P05 A;  1WNH A;  1PU4 A;  1ROV A;  3KZT A;  1B27 A;  2CWU A;  3MYT A;  2HOH A;  2W6J H;  1HYF A;  3J7Y d;  4K61 A;  4R9K A;  4HBR A;  5FGO A;  1UGH I;  4R80 A;  1C54 A;  1RGH A;  3D79 A;  2BO9 B;  3V92 A;  2RFR A;  2E2U A;  2UX0 A;  1QMA A;  1STD A;  3B7C A;  4HZ9 B;  2CX0 A;  1LVN A;  1R4C A;  1SII A;  1T5Y A;  3MG3 A;  2F56 A;  5LC6 A;  3VF1 A;  2OTL 3;  1IVU A;  1R4Y A;  1MWR A;  1RN7 A;  2BMO B;  1NU3 A;  1ZS7 A;  3EX9 A;  1MOL A;  3FGY A;  1VQ4 3;  1GD3 A;  1JRQ A;  3MSO A;  1AQZ A;  3JUP A;  1O7H B;  1N5P A;  3FKA A;  4WHA A;  2BHM A;  2C11 A;  2W03 A;  2Z7A A;  4J8T A;  1RCK A;  2KRT A;  3G6E 3;  1BU4 A;  2D42 A;  5IEP A;  3D4A A;  4WFO A;  6GSP A;  3PGB A;  1UCK A;  1EEJ A;  2JQ5 A;  4HM1 B;  3CCL 3;  3OWY A;  2XEP A;  2IA7 A;  2YX9 A;  2CFK A;  1VQM 3;  1BNR A;  1NJI 4;  4MMZ B;  1KD1 4;  1EG9 B;  5CF2 A;  4Q53 A;  4OVM A;  2CWV A;  4EBG A;  8CHO A;  2CK3 H;  3V98 A;  4ORL A;  3Q90 A;  1UCL A;  4QWT A;  1Q40 B;  1RGK A;  3D3L A;  5EVH A;  4FCJ A;  3MG1 A;  2UGI A;  4RNZ A;  4J9A A;  1CH0 A;  1RGF A;  1O7P B;  3BNE A;  2YFI B;  2Y73 A;  2Z77 A;  1Q81 4;  2ML6 A;  3PYJ A;  1N9J A;  1EQK A;  1CYV A;  3AHW A;  2RNT A;  3EE1 A;  1JZD A;  1ASK A;  5KP3 A;  3DXO A;  5LC7 A;  1A67 A;  1S72 3;  1FGQ A;  2GU1 A;  2XGL A;  1QAK A;  2P0M A;  1RGC A;  4N3V A;  3LT9 A;  1BSB A;  1DMN A;  3O8Y A;  3ZG5 A;  3GZY B;  4WYK A;  5DRV A;  3WMD A;  3B4P A;  3EBT A;  1IQ8 A;  1BRH A;  1IQY A;  2C4B A;  3KN4 A;  3H3H A;  5IG0 A;  2CIU A;  1YIJ 3;  1KWI A;  4HM3 B;  4O8S A;  5EEO A;  3EF8 A;  2STD A;  3RDE A;  5IER A;  4J5K A;  1LNH A;  1OHS A;  4EV2 A;  2KCD A;  2HMM B;  4KT3 B;  3DGL A;  1BRN L;  1K41 A;  2R41 A;  3OWS A;  3BIR A;  1NB3 I;  3S27 A;  1VQK 3;  1W6G A;  3MG2 A;  3N9H A;  1IDP A;  1TIJ A;  1IK3 A;  2D1W A;  3BLZ A;  1BSD A;  4XB5 A;  3BB9 A;  3OW2 2;  5AIF A;  1RHL A;  3GAX A;  1NNV A;  1ZO2 A;  3ZG0 A;  3L0R A;  1GY7 A;  3X3Z A;  1T2H A;  3CXC 2;  3G8Z A;  1T3B A;  2F99 A;  4FR9 A;  1FGT A;  1GSP A;  3CCS 3;  1STF I;  1GOU A;  3HX8 A;  1US1 A;  3DGN A;  3WHO A;  3F40 A;  3KFQ C;  1IV7 A;  1BVI A;  1W7C A;  3OXA A;  1RRL A;  3CCR 3;  4XBY A;  1UUV B;  2MC8 A;  1U5O A;  2GU3 A;  2IYJ A;  2KAA A;  4KFD A;  2V1L A;  1N8Q A;  2Z6B A;  4LGQ A;  2E2T A;  3FG3 A;  4EC6 A;  1K73 4;  3DGO A;  4R1K A;  2IMJ A;  1TJD A;  3NHX A;  3EQQ B;  1RGG A;  4N6N B;  3EN8 A;  1QAF A;  1VQQ A;  2XSH B;  2CKF B;  5D81 A;  1K9M 4;  5BIR A;  1VQ6 3;  1WMO A;  2K3D A;  1UI8 A;  3G71 3;  1BSE A;  3BNC A;  1UI7 A;  2BU4 A;  1BNI A;  3U97 A;  2HMN B;  5IG5 A;  4G1M B;  4R4K A;  2OTJ 3;  3IJE B;  3PCS A;  1I3F A;  4O2H A;  2BMQ B;  2XRX B;  1B2U A;  1GS3 A;  1MGR A;  3VSY A;  4BTY A;  3HK4 A;  3HOH A;  1FGO A;  4AEQ A;  1JBT A;  4HAA A;  4BU4 A;  1BRI A;  1J2B A;  1DE3 A;  3WOE B;  2RCD A;  1D6Y A;  1YI2 3;  4IIA A;  1E3V A;  1TRQ A;  1JN5 B;  2H0I A;  2YFJ B;  5G2G A;  3SX1 A;  1RKY A;  4HZB B;  3CMA 3;  1V58 A;  2OWP A;  3JVC A;  1SQW A;  3EB8 A;  1A2V A;  1RCL A;  2HMJ B;  1E3R A;  1RNB A;  3FG1 A;  1X1X A;  3EJV A;  5ELU A;  2I9W A;  3D9R A;  1LQM B;  1O7M B;  1BNG A;  1M1X B;  3U1W A;  1TTO A;  3UB1 A;  1YGW A;  5CK6 A;  4GSP A;  3G16 A;  1DYU A;  1RJO A;  2L4V A;  3DGM A;  5KP1 A;  1OGX A;  4FCM A;  1TFO A;  1RGL A;  1RDS A;  4AKY A;  4JRF A;  1GMQ A;  2PZV A;  1RSN A;  5AI1 A;  4RNT A;  3K7C A;  3V99 A;  1I3I A;  2SAR A;  1NO3 A;  4H3U A;  1JN5 A;  4HM5 B;  1VQL 3;  1I70 A;  3K9M C;  1O7W B;  2L1S A;  3QK9 A;  3CCU 3;  3CC4 3;  1OHO A;  5TGN A;  1RNT A;  4CPK A;  1OAC A;  1O7N B;  1W2Z A;  1QVG 2;  1BAN A;  1D6U A;  1HKX A;  3TDG A;  1V74 A;  3WOD G;  5A0O B;  2F86 B;  3FG4 A;  4KVH A;  1Q7Y 4;  1W00 A;  4WP5 A;  3FF2 A;  2W2C A;  1YHQ 3;  3PS8 A;  1JBS A;  2GBW B;  3FCS B;  4XDW A;  3EC9 A;  3LTA A;  9RNT A;  4IT7 A;  1HZ1 A;  1I0V A;  1LRA A;  1FUW A;  4CCV A;  3GZB A;  4BIR A;  1VQP 3;  2WGQ A;  3KSE D;  5D83 A;  5BU4 A;  3LT8 A;  2W04 A;  3HIG A;  2WGO A;  3JUQ A;  5D82 A;  3NXJ A;  2IY2 A;  3QRD A;  3LML A;  1N9E A;  2FGT A;  4FMA A;  3CD6 3;  3F8H A;  4OK0 A;  3EN1 B;  2IUK A;  3HII A;  2YFL B;  1W01 A;  2J8X B;  3T0U A;  3A5E A;  1BNE A;  1PY3 A;  2KF5 A;  1BOX A;  2OOV C;  5IF6 A;  1BAO A;  4HOH A;  1L5G B;  4XBX A;  1DET A;  1RRH A;  3NBB A;  4WYK B;  4AKZ A;  1IU7 A;  3JUO A;  1ZX2 A;  3NQY A;  1I8V A;  1QVF 2;  2XF3 A;  4O02 B;  2BIR A;  3IMA B;  4MMX B;  4N6M A;  4O3V A;  3KCH A;  3T8N A;  3DZL A;  1NWW A;  1KC8 4;  4I5Q A;  5I97 A;  1G0T A;  1B2Z A;  3WA3 A;  1B2X A;  4FCZ A;  2CG0 A;  2QIY A;  1SIH A;  1JZO A;  1X1W A;  2WOF A;  4HM4 B;  3PZW A;  1BRG A;  1AVL A;  1NB5 I;  1LOX A;  4KFE A;  1T2I A;  1X1Y A;  4U13 A;  1FA3 A;  2A15 A;  1IYY A;  4KFF A;  4MMY B;  3B4O A;  4BTX A;  1RTU A;  1GOY A;  4HM6 B;  3SOY A;  1FUS A;  5HOH A;  3WDG B;  3NM2 A;  5AEW B;  2HMO B;  3EBY A;  3Q3F A;  1LOV A;  1ROA A;  1JB4 A;  2CFW A;  5CXO A;  5IW9 A;  1YJ9 3;  4MJD A;  3BU4 A;  3CNX A;  1Q42 A;  1ULJ B;  1RN4 A;  1CEW I;  1JV2 B;  2QGU A;  3FF0 A;  3RNT A;  1TP6 A;  1U8C B;  3X42 A;  3M8C A;  2ZA4 A;  1PYL A;  2GSP A;  1OUN A;  2OCT A;  1WTH A;  4NPB A;  4X2O A;  1WMN A;  3X3X A;  3UL6 A;  2E2V A;  3DGY A;  1PFP A;  1TU5 A;  3A76 A;  4MEI A;  4WWU C;  1YVB I;  3X41 A; 
#chains in the Genus database with same CATH homology
 4HJL B;  4LEH A;  1CQS A;  1AV4 A;  2QEX 3;  4L8P A;  1GYB A;  3E99 A;  4OUQ A;  1DMQ A;  3UJM A;  4N6V 0;  3WOF B;  3ECF A;  4L8O A;  1VQN 3;  2B1X B;  5AEU B;  4RNY A;  5ELJ A;  3GZX B;  4IPB A;  4EV5 A;  4JF8 A;  4CDL A;  5JPP A;  1Q82 4;  1A90 A;  4BTW A;  1SJW A;  5DRE A;  3CCE 3;  3CNM A;  1S5A A;  4EXR A;  1W4N A;  5FW5 A;  3S67 A;  1WQL B;  4HM0 B;  5KP4 A;  2O3O A;  4H61 A;  5IG3 A;  3LOY A;  3Q2P A;  1N8R 4;  3OV4 A;  3NUV A;  3ROB A;  1Q40 A;  2FNQ A;  1DVC A;  1UUW B;  2XSO B;  5EQL A;  2XR8 B;  3FSD A;  2HMK B;  1AVK A;  1QAL A;  3F7S A;  2Q07 A;  3KSP A;  1YIT 3;  2XGN A;  2IUJ A;  1VQ7 3;  4N6O B;  5BXQ A;  4I4K A;  3EHC A;  3NQZ A;  3SED A;  4N6T A;  2B24 B;  2LQV A;  3CPW 2;  3LXU X;  3CU3 A;  1GY5 A;  3KII A;  1FGR A;  2ZL8 A;  3HZP A;  4NRE A;  1Z1S A;  1D6Z A;  3LTB A;  3JUM A;  3AMO B;  2ML5 A;  3KE7 A;  3CCQ 3;  1VZZ A;  1BUQ A;  2BMR B;  1VQ5 3;  3SVA A;  2GXF A;  2O9U X;  4KZ1 A;  2CG1 A;  2W56 B;  2CFD A;  3H51 A;  1F8N A;  2CFG A;  4TX4 A;  5AII A;  3UL5 A;  2QA4 3;  2OQE C;  1M1K 4;  4LSO A;  1G96 A;  1HU9 A;  2CHC A;  3PCR A;  1TUH A;  2R4I A;  4K90 B;  3NBJ A;  3Q1C A;  4NHF A;  3N54 B;  1JKG A;  4HM2 B;  3NBR A;  3CC2 3;  1JJ2 2;  3LZA A;  1NDO B;  1FGM A;  4HYZ A;  3F8X A;  1OCV A;  1LXE A;  2W0Q A;  2WOH A;  4STD A;  1Y4K A;  4HM8 B;  2RSX A;  4R9L A;  2CWT A;  2CW9 A;  3G0K A;  1DMM A;  3HI7 A;  1EA2 A;  1M90 4;  2BNG A;  2ZDJ A;  3S28 A;  3LH4 A;  4GL6 A;  2GEX A;  4L7K A;  2W56 A;  1A2K A;  3GZR A;  2FXT A;  2HML B;  3SOA A;  1K8A 4;  1Q86 4;  2CH9 A;  2XH9 A;  4HM7 B;  3BND A;  2PNC A;  3N8B A;  3CCJ 3;  1ISK A;  1DVD A;  4ZM8 A;  2K54 A;  5IEO A;  3NV0 A;  4PEJ A;  3DY5 A;  3STD A;  3X40 A;  1IT7 A;  4K1V A;  2OQE A;  1VQ9 3;  3OX9 A;  2RGQ A;  3ALA A;  2Y74 A;  5IG4 A;  1VQ8 3;  3PXM A;  3F7X A;  3G4S 3;  1TFK A;  4XBT A;  1IT8 A;  3DMC A;  2BT3 A;  5JBS A;  3CCM 3;  1M9G A;  1GY6 A;  1KQS 2;  1IVW A;  3LYG A;  3VGN A;  3BNB A;  1W2B 2;  3X3Y A;  3JUN A;  1GD4 A;  1OF5 A;  1EKM A;  2C10 A;  6STD A;  2XFT A;  2WO0 A;  4XM4 A;  1CYU A;  1JNQ A;  3LTC A;  1E97 A;  4XDV A;  3MWZ A;  5CLK A;  4LZI A;  5JPU A;  3MPH A;  3I56 3;  5AYR B;  3MHE A;  3SLU A;  2LYX A;  3LTD A;  1UW1 A;  5CF1 A;  4FMC A;  4HKV B;  2P09 A;  2K0M A;  2M7O A;  3KKG A;  3F14 A;  3UNL A;  4X2H A;  1N5H A;  1MNL A;  2CFL A;  3RGR A;  1OHP A;  2INX A;  5AIG A;  1AR0 A;  1KSI A;  1OF5 B;  4FMD A;  3GRD A;  3SXX A;  1SPU A;  1IQX A;  3AMO A;  3K0Z A;  4LMI A;  5STD A;  3K63 A;  3NX0 A;  1OH0 A;  3RGA A;  3DM8 A;  3WA2 X;  1YGE A;  3IPT A;  1W6Y A;  2SBL A;  4FMB A;  3ER7 A;  2JDI H;  7STD A;  2XFS A;  2P38 A;  5AIH A;  4EYC A;  2W9Q A;  3B8L A;  2CC3 A;  1QJG A;  3CC7 3;  2F98 A;  2GBX B;  2GEY A;  5BVB A;  1VQO 3;  1JKG B;  3S5C A;  1OPY A;  1W5Z A;  3MKI A;  5IEN A;  1IV9 A;  3OWU A;  3F9S A;  3DUK A;  3I55 3;  1W02 A;  3NV0 B;  2W9P A;  1K28 A;  3FH1 A;  1ULI B;  2P0X A;  4N6U A;  1IVX A;  1C7H A;  4RZM A;  3T8U A;  1W6C A;  1JB5 A;  1OGZ A;  4GB5 A;  1YJN 3;  4K1U A;  1WMP A;  4RBN A;  3CPO A;  2MF7 A;  3K5T A;  1IVV A;  3I0Y A;  3NM7 A;  5AYS C;  3CME 3;  5HGR A;  2Z76 A;  3FLJ A;  3FZW A;  4N6L A;  3CCV 3;  3GWR A;  1YJW 3;  1O7G B;  4HVN A;  2OOV A;  3S29 A;  2KXG A;  1JB2 A;  2P05 A;  1WNH A;  1PU4 A;  1ROV A;  3KZT A;  2CWU A;  3MYT A;  2W6J H;  3J7Y d;  4K61 A;  4R9K A;  4HBR A;  5FGO A;  4R80 A;  3V92 A;  2BO9 B;  2RFR A;  2E2U A;  2UX0 A;  1QMA A;  1STD A;  3B7C A;  4HZ9 B;  1LVN A;  1R4C A;  1SII A;  1T5Y A;  3MG3 A;  5LC6 A;  3VF1 A;  2OTL 3;  1IVU A;  1RN7 A;  2BMO B;  1NU3 A;  3EX9 A;  1MOL A;  3FGY A;  1VQ4 3;  1GD3 A;  1JRQ A;  3MSO A;  3JUP A;  4WHA A;  1O7H B;  1N5P A;  3FKA A;  1S72 3;  2BHM A;  2C11 A;  2W03 A;  2Z7A A;  4J8T A;  2KRT A;  3G6E 3;  2D42 A;  5IEP A;  4WFO A;  3PGB A;  3CCL 3;  4HM1 B;  2JQ5 A;  3OWY A;  2XEP A;  2IA7 A;  2YX9 A;  2CFK A;  1VQM 3;  1NJI 4;  4MMZ B;  1KD1 4;  1EG9 B;  5CF2 A;  4Q53 A;  4OVM A;  2CWV A;  4EBG A;  8CHO A;  2CK3 H;  3V98 A;  4ORL A;  3Q90 A;  4QWT A;  1Q40 B;  3D3L A;  5EVH A;  4FCJ A;  3MG1 A;  4RNZ A;  4J9A A;  1O7P B;  3BNE A;  2YFI B;  2Y73 A;  2Z77 A;  1Q81 4;  2ML6 A;  3PYJ A;  1N9J A;  1EQK A;  1CYV A;  3EE1 A;  1ASK A;  5KP3 A;  3DXO A;  5LC7 A;  1A67 A;  1FGQ A;  2GU1 A;  2XGL A;  1QAK A;  2P0M A;  4N3V A;  3LT9 A;  3O8Y A;  1DMN A;  3GZY B;  4WYK A;  5DRV A;  3WMD A;  3B4P A;  3EBT A;  1IQ8 A;  1IQY A;  5IG0 A;  3KN4 A;  3H3H A;  2CIU A;  1YIJ 3;  1KWI A;  4HM3 B;  4O8S A;  5EEO A;  3EF8 A;  2STD A;  3RDE A;  5IER A;  1LNH A;  1OHS A;  4EV2 A;  2KCD A;  2HMM B;  3DGL A;  1K41 A;  3OWS A;  1NB3 I;  3S27 A;  1VQK 3;  1W6G A;  3MG2 A;  3N9H A;  1IDP A;  1TIJ A;  1IK3 A;  2D1W A;  3BLZ A;  4XB5 A;  3BB9 A;  3OW2 2;  5AIF A;  3GAX A;  1ZO2 A;  3L0R A;  1GY7 A;  3X3Z A;  3CXC 2;  3G8Z A;  2F99 A;  4FR9 A;  1FGT A;  3CCS 3;  1STF I;  3HX8 A;  1US1 A;  3DGN A;  3F40 A;  3KFQ C;  1IV7 A;  1W7C A;  3OXA A;  1RRL A;  3CCR 3;  4XBY A;  1UUV B;  2MC8 A;  1U5O A;  2GU3 A;  4KFD A;  4LGQ A;  1K73 4;  2V1L A;  1N8Q A;  2Z6B A;  4EC6 A;  2E2T A;  3FG3 A;  3DGO A;  4R1K A;  2IMJ A;  3NHX A;  3EQQ B;  4N6N B;  3EN8 A;  1QAF A;  2XSH B;  2CKF B;  5D81 A;  1K9M 4;  1VQ6 3;  1WMO A;  1UI8 A;  3G71 3;  3BNC A;  1UI7 A;  3U97 A;  5IG5 A;  2HMN B;  4G1M B;  4R4K A;  2OTJ 3;  3IJE B;  3PCS A;  4O2H A;  2BMQ B;  2XRX B;  1GS3 A;  3VSY A;  4BTY A;  3HK4 A;  1FGO A;  4AEQ A;  1J2B A;  3WOE B;  2RCD A;  1D6Y A;  1YI2 3;  4IIA A;  1E3V A;  5G2G A;  1JN5 B;  2YFJ B;  3SX1 A;  1RKY A;  4HZB B;  3CMA 3;  2OWP A;  3JVC A;  1SQW A;  3EB8 A;  1A2V A;  2HMJ B;  1E3R A;  3FG1 A;  3EJV A;  5ELU A;  2I9W A;  3D9R A;  1O7M B;  1M1X B;  3U1W A;  3UB1 A;  5CK6 A;  3G16 A;  1DYU A;  1RJO A;  2L4V A;  3DGM A;  5KP1 A;  1OGX A;  4FCM A;  1TFO A;  4AKY A;  4JRF A;  2PZV A;  5AI1 A;  3K7C A;  3V99 A;  1NO3 A;  4H3U A;  1JN5 A;  4HM5 B;  1VQL 3;  3K9M C;  1O7W B;  3QK9 A;  3CCU 3;  3CC4 3;  1OHO A;  5TGN A;  1QVG 2;  1OAC A;  1O7N B;  1W2Z A;  1D6U A;  1HKX A;  3TDG A;  1V74 A;  3WOD G;  5A0O B;  2F86 B;  3FG4 A;  4KVH A;  1Q7Y 4;  1W00 A;  4WP5 A;  3FF2 A;  2W2C A;  1YHQ 3;  3PS8 A;  2GBW B;  3FCS B;  4XDW A;  3EC9 A;  3LTA A;  4IT7 A;  1FUW A;  4CCV A;  3GZB A;  1VQP 3;  2WGQ A;  3KSE D;  5D83 A;  3LT8 A;  2W04 A;  3HIG A;  2WGO A;  3JUQ A;  5D82 A;  3NXJ A;  3QRD A;  3LML A;  1N9E A;  2FGT A;  4FMA A;  3CD6 3;  3F8H A;  4OK0 A;  3EN1 B;  2IUK A;  3HII A;  2YFL B;  1W01 A;  3T0U A;  2OOV C;  5IF6 A;  1L5G B;  4XBX A;  1RRH A;  3NBB A;  4WYK B;  4AKZ A;  1IU7 A;  3JUO A;  1ZX2 A;  3NQY A;  1QVF 2;  2XF3 A;  4O02 B;  3IMA B;  4MMX B;  4N6M A;  4O3V A;  3T8N A;  3DZL A;  1NWW A;  1KC8 4;  5I97 A;  3WA3 A;  4FCZ A;  2CG0 A;  2QIY A;  1SIH A;  2WOF A;  4HM4 B;  3PZW A;  1AVL A;  1NB5 I;  1LOX A;  4KFE A;  4U13 A;  1FA3 A;  2A15 A;  4KFF A;  4MMY B;  3B4O A;  4BTX A;  4HM6 B;  3SOY A;  3WDG B;  3NM2 A;  5AEW B;  2HMO B;  3EBY A;  1ROA A;  1JB4 A;  2CFW A;  5CXO A;  5IW9 A;  1YJ9 3;  4MJD A;  3CNX A;  1Q42 A;  1ULJ B;  1CEW I;  1JV2 B;  2QGU A;  3FF0 A;  1TP6 A;  1U8C B;  3X42 A;  3M8C A;  1OUN A;  2OCT A;  1WTH A;  4X2O A;  3X3X A;  1WMN A;  3UL6 A;  2E2V A;  1PFP A;  1TU5 A;  3A76 A;  4MEI A;  4WWU C;  1YVB I;  3X41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...