1VQ83

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq8300
1K8A4 3CME3 3CCV3 1YJ93 1VQ83 1S723 1VQ73 3OW22 1VQM3 1VQP3 1KC84 1KD14 3CCR3 3CC43 3CCJ3 1QVF2 1NJI4 1VQ43 2QEX3 1VQ53 1JJ22 1VQ93 1Q7Y4 1VQN3 1VQ63 1YI23 1VQO3 1Q824 2OTJ3 3G713 1KQS2 3CCU3 3I553 3CXC2 1YIT3 1YJN3 1YJW3 3CCE3 1K9M4 1M904 1VQL3 2OTL3 3G4S3 1YIJ3 1Q814 3CD63 3CMA3 3CPW2 1Q864 1W2B2 3CCL3 3I563 3CC23 3CCS3 1M1K4 3CCQ3 1N8R4 1K734 2QA43 3CC73 1VQK3 1YHQ3 3G6E3 3CCM3 1QVG2
chains in the Genus database with same CATH superfamily
4AKYA 1PFPA 5JPUA 2W56B 3FKAA 1QALA 3PGBA 1LNHA 3CC43 3UNLA 2PNCA 1C7HA 1WMOA 1QAFA 2KF5A 2WOHA 3A5EA 3NM2A 3GZYB 1T2IA 4HM2B 2WGOA 2AAEA 2C11A 3WOEB 1SARA 1O7WB 1ISKA 1C54A 3HI7A 3PCRA 1I0VA 5KP3A 2OTL3 1WTHA 5JBSA 2R41A 7GSPA 2H0HA 3CC23 3ZG0A 3M8CA 3D5GA 5AEUB 1TTOA 3DMCA 5EQLA 2AADA 2CFWA 1RRLA 2HMLB 2IY2A 1IV7A 2KF4A 3MG3A 3O8YA 4FMAA 3L0RA 3CNXA 1A90A 3ER7A 3OW22 2MC8A 4K61A 1BSCA 4N6TA 5AYSC 4N3VA 2UGIA 1O7MB 4ORLA 4RZMA 4WYKB 1CYVA 4FMDA 4HVNA 4ILFA 2XRXB 1NU3A 4FCJA 1ROVA 3HOHA 3F8XA 3OWSA 1RN7A 4XBXA 1B2UA 1X1YA 2RSXA 4XDVA 7STDA 2OTJ3 5M18A 2IUKA 2GU3A 2D1WA 2FGTA 1X1XA 3JVCA 3AGNA 1T5YA 1EG9B 2KF6A 2F86B 4J5GA 5M1AA 1B2MA 1ULJB 3LTCA 2W9PA 1JB5A 1GSPA 1JV2B 4LEHA 1U8CB 3HIGA 2IUJA 1J2BA 2L1SA 4TX4A 3DGLA 1IVXA 1K734 1VQK3 4L8OA 1UCJA 3BU4A 1OF5B 1A2PA 2XH9A 3WHOA 2E2UA 1BSEA 4HOHA 4HZBB 3NBBA 3S5CA 1I3FA 1MGRA 3LT8A 2CWTA 3PCSA 1VQ93 4MMXB 2KCDA 3DGMA 3FCSB 3IMAB 1VQ63 2Q07A 3D9RA 2XEPA 4LZIA 4HBRA 1VQ43 3GZXB 4N6V0 1IVWA 3U1WA 3EC9A 1CEWI 3FH1A 1YJN3 2CG0A 1YJW3 1IQYA 8RNTA 3EJVA 3DXOA 1GYBA 4FMBA 4N6MA 3Q1CA 3G16A 1A67A 1HU9A 2RNTA 3QRDA 3CCL3 1V58A 5D83A 3K5TA 2YFIB 1W00A 4GL6A 1SJWA 3GSPA 4X2OA 1BRJA 1JBRA 3EN8A 4MMYB 4WP5A 1KC84 1UGIA 1W6YA 1JRQA 2CX1A 4NPBA 1BRIA 1NJI4 2ZDJA 3DUKA 4WWUC 2OOVA 2B1XB 3D5IA 5IENA 3LMLA 3N8BA 2GBWB 2RBIA 3LH4A 1N5HA 3CNMA 3F40A 3NV0B 4JRFA 4EBGA 3X3YA 1KWIA 1HYFA 2ZL8A 2LYXA 3SOYA 1T3BA 4EXRA 1BANA 1OGXA 3Q90A 1UDII 3UB1A 1Q42A 3WDGB 4X2HA 2WOFA 4WFOA 4L8PA 3LTDA 1W02A 3I563 5BVBA 3EHCA 1LOVA 4O3VA 1WMNA 5M19A 1I8VA 1UI7A 1B20A 1TFKA 1TRQA 3ALAA 3CCM3 1K28A 3D4AA 3X3ZA 2F56A 1GOVA 1GMRA 1IV9A 3FSDA 3PYJA 3STDA 3WA2X 1K8A4 3EB8A 3WR2A 1BVIA 2Y73A 1B3SA 3CCR3 1RMSA 1TJDA 5CXOA 4LMIA 3FLJA 1IQ8A 3PS8A 4N6NB 1ULIB 2XGNA 2XF3A 1Q7Y4 2C10A 4K90B 1I2FA 3DGNA 2HMNB 3DY5A 1AVLA 2PZVA 3K9MC 4MJDA 3JUNA 4J8TA 3FG3A 3RGRA 1Y4KA 2HMMB 3VF1A 1IK3A 2I9WA 1SQWA 3IJEB 3ECFA 2GXFA 3F8HA 1I0XA 1TUHA 3G4S3 3VGNA 4QWTA 3LT9A 5IG0A 1BSAA 1M1K4 2F5WA 4AKZA 2W03A 3LXUX 2CFLA 4IIAA 2XSOB 3UJMA 1YHQ3 1BSDA 2F4YA 1QVG2 4H61A 1BRKA 1FUTA 1Q7HA 1RN1A 1B2XA 2BHMA 5AIHA 3GZRA 3MYTA 4KZ1A 5AEWB 3MKIA 1SIIA 2HOHA 1IVUA 1JN5B 3CCJ3 1FZUA 3SX1A 1VQ53 2CFKA 2E2TA 3AHWA 1CQSA 4HM7B 2JDIH 3T8NA 1FYSA 5IG4A 2ML5A 1X1WA 1TIJA 3BIRA 1ASKA 4IPBA 4HM1B 1HZ1A 1YGWA 1RN4A 3BNCA 3LTBA 5AIIA 1RNBA 1OF5A 1Q814 1VQQA 3CPW2 1O7HB 1Q864 1BGSA 5ELJA 3WA3A 2INXA 2P38A 1AVKA 5BU4A 1PY3A 4O8SA 1RCLA 1BRGA 1D6UA 5TGNA 2GU1A 1FA3A 3CME3 1U5OA 2W0QA 3DGYA 1NB5I 2CHCA 4HM4B 1FGQA 1D6ZA 1OACA 4EV2A 1MWRA 1R4YA 2Z7AA 1MWTA 1K41A 3HX8A 1IVVA 1O7PB 1IQXA 1US1A 1NDOB 3HK4A 3NHXA 3IPTA 1RLSA 4AEQA 3G713 3BNEA 1K9M4 1IDPA 2E2VA 3V92A 1N9JA 1IU7A 5AIGA 1QJGA 3HIIA 3EF8A 3Q3FA 2CH9A 1UCLA 2W6JH 2K3DA 3NV0A 2R4IA 5KP4A 2QA43 3B4OA 4BTWA 3K63A 1TU5A 2RGQA 1VQ73 1UI8A 2GBXB 2UUGC 1N9EA 2OQEC 3K0ZA 1W6CA 1G96A 1B27A 4KFDA 3WOFB 3G0KA 3WMDA 4CPKA 5AI1A 6GSPA 1RRHA 1B2ZA 1ZS7A 1FGRA 2LQVA 2BMRB 6RNTA 1JJ22 3N54B 2BT3A 1VQN3 9RNTA 3DZLA 1V57A 4J5KA 1PU4A 1LVNA 2H0GA 3MPHA 3PZWA 1VQL3 4R80A 1FGOA 3F7SA 2CKFB 1SPUA 1UGHI 3JUMA 3H51A 3X3XA 1OHOA 1MNLA 5BXQA 1GMQA 3DGOA 2QIYA 4NREA 1LXEA 3AMOA 4MEIA 1PYLA 1DMQA 1OPYA 4H3UA 5LC7A 4BTXA 2BU4A 3VSYA 1JBTA 2D42A 4HM5B 1BSBA 4WHAA 1JNQA 3B7CA 4RBNA 1AV4A 3SVAA 4IT7A 3X42A 2XGLA 1BU4A 3DH2A 3GAXA 5DRVA 2W9QA 4OUQA 1BNSA 5RNTA 3U97A 1UUGB 1RGLA 2CFDA 1LQMB 2P05A 4L7KA 1A2VA 1BNJA 4O02B 3EX9A 3F7XA 5HOHA 1BIRA 3S67A 3I0YA 4JF8A 1NWWA 1IT7A 3URPA 1MWSA 1BNIA 1UCKA 2MF7A 2Z77A 2YFLB 5EVHA 1M1XB 3TDGA 2SBLA 4K1VA 1EKMA 1BNRA 4CDLA 5CK6A 1JBSA 4WYKA 1FGTA 3Q2PA 1NO3A 1WNHA 1RGCA 2RFRA 1JKGA 4FCMA 2BMOB 4KT3B 1TFOA 2SARA 3NUVA 3EBTA 4MMZB 3EQQB 1STDA 1S5AA 4OVMA 4PEJA 4BTYA 5IERA 3HZPA 2QEX3 5IEPA 1GY7A 1EEJA 1UCIA 2FXTA 3NM7A 3J7Yd 4FR9A 4HJLB 1BRSA 1RSNA 2HMKB 1R4CA 4R4KA 2KXGA 3I553 3RGAA 1LRAA 1GOUA 3CD63 1BUQA 1YNVX 2CWVA 1BAOA 1G02A 2BNGA 3GRDA 3SYUA 1E3VA 1BRNL 1DE3A 1JB2A 1OH0A 1SIHA 3S29A 4BU4A 3BNDA 3T0UA 3KFQC 1N8R4 1RJOA 1UUWB 5A0OB 1I2EA 5LC6A 1GOYA 3WODG 1E97A 1RTUA 3BNBA 1EUIC 3FG1A 1GD4A 1B21A 1L5GB 4ZM8A 3PXMA 1LOWA 4HKVB 3V98A 1AY7A 5IF6A 3BLZA 3FZWA 3NQZA 2KAAA 2V1LA 4HM8B 2YFJB 4HM3B 3SLUA 1N8QA 3GWRA 5CF2A 3BB9A 5KP1A 2GSPA 2P0MA 1G0TA 1GS3A 1RGKA 5HGRA 1VZZA 3B4PA 1QMAA 3OV4A 1NNVA 3JUPA 1YVSA 3LYGA 2CC3A 1JZOA 1DVCA 4FCZA 1OUNA 2J8XB 2W04A 3NBRA 4GHOA 4N6OB 2CIUA 4I5QA 1DMNA 3H3HA 1T2HA 3QK9A 4STDA 4EC6A 2WO0A 1FGMA 1AQZA 1TRPA 1EQKA 3NXJA 4XB5A 1OHPA 1VQP3 2CFGA 1GY5A 1I2GA 1OHSA 4BIRA 2O3OA 3D79A 1JKGB 1FUSA 1NB3I 3S28A 4BL2A 4KVHA 4K1UA 2BIRA 1AR0A 2UX0A 5D82A 5FGOA 1OGZA 4O2HA 3DM8A 1JZDA 2GEYA 2ML6A 2XFTA 2OQEA 2L4VA 2K0MA 3FF2A 2CG1A 1RDSA 3T8UA 5G1LA 3B8LA 3CU3A 2CX0A 1BNEA 2K54A 2STDA 3KCHA 2HMOB 2IA7A 3KKGA 5IG5A 2KF3A 3JUOA 4DKIA 3F14A 3OWUA 3RNTA 1STFI 4R1KA 4EYCA 3CMA3 3AGOA 4R9KA 1DYUA 3KZTA 6STDA 1X1UA 3X41A 4RNYA 3N9HA 1Q40B 1JB4A 3UL5A 4CJNA 3SXXA 3G6E3 2XR8B 4LSOA 5JPPA 1E3RA 4R9LA 3CCV3 3ZG5A 4HZ9B 1RKYA 1JN5A 1I70A 1V74A 2HMJB 1OCVA 1QVF2 4XDWA 3UL6A 3EE1A 5BIRA 3AMOB 4XM4A 1BOXA 3NX0A 1F8NA 1BNFA 3AHSA 1IYYA 1DVDA 4LYLB 2IMJA 2OWPA 2YX9A 4GB5A 2B24B 1W4NA 2F5MA 2M7OA 3FGYA 5CF1A 1KSIA 2Z76A 2KRTA 1M904 2W2CA 1RCKA 4BL3A 1W2B2 3KE7A 2BMQB 1TP6A 5AIFA 1GMPA 1I3IA 2F99A 3MG2A 1Q40A 3CPOA 1WQLB 4G1MB 1BNGA 4J9AA 4KFEA 2IYJA 4N6LA 7RNTA 5IW9A 1GD3A 3GZBA 4U13A 1EA2A 3MHEA 1W01A 3RDEA 4EV5A 2GEXA 4NHFA 4HM6B 1YI23 3LOYA 3NQYA 4XBYA 1ROAA 3X40A 2BO9B 2OOVC 3CXC2 1GY6A 3CCE3 1CH0A 2CWUA 2XFSA 3OX9A 1YIJ3 3K7CA 2A15A 3JUQA 5CLKA 1B2SA 4RNTA 2Z6BA 1RGHA 2XSHB 3CCS3 2H0IA 3SEDA 1CYUA 4XBTA 5FW5A 1BRHA 1UUVB 1W7CA 2WGQA 3CC73 1RGGA 4HM0B 2P0XA 3E99A 1A2KA 1YJ93 1RGEA 1KD14 1FW7A 1LOYA 2CK3H 3G8ZA 4GSPA 4I4KA 4Q53A 1Z1SA 3EN1B 2O9UX 3FG4A 1KQS2 2JQ5A 4HAAA 1YGEA 3ROBA 5EEOA 1ZX2A 3KSPA 1N5PA 2ZA4A 1Q9EA 1RNTA 1MOLA 1DETA 1BUJA 1M9GA 4FMCA 1LOXA 3MSOA 2ZHXB 1FUWA 5DREA 5AYRB 1D6YA 3KN4A 3MG1A 4KFFA 3ZFZA 3OWYA 2C4BA 1O7GB 3S27A 4LGQA 3F9SA 2W56A 4OK0A 3V99A 1DMMA 5G2GA 1MGWA 3KIIA 1HKXA 3SOAA 1LQGC 1O7NB 1QAKA 1LNIA 1UW1A 3OXAA 1MWUA 5G1KA 1VQ83 1S723 1W2ZA 2FNQA 1VQM3 2OCTA 8CHOA 2CW9A 5D81A 5STDA 3D3LA 1RGFA 3KSED 3NBJA 1ZGXA 5GSPA 1W6GA 5IG3A 5IEOA 5ELUA 1ZO2A 1WMPA 1RHLA 1VQO3 1Q824 4HYZA 1IT8A 2RCDA 2Y74A 4EW5A 3CCU3 2F98A 1YIT3 4CCVA 3LZAA 4N6UA 2QGUA 5I97A 3MWZA 1YVBI 1RGAA 2P09A 3A76A 3EBYA 4RNZA 3CCQ3 1W5ZA 3LTAA 3FF0A
chains in the Genus database with same CATH topology
4AKYA 1PFPA 5JPUA 2W56B 3FKAA 1QALA 3PGBA 1LNHA 3CC43 3UNLA 2PNCA 1C7HA 1WMOA 1QAFA 2WOHA 3NM2A 3GZYB 4HM2B 2WGOA 2C11A 1O7WB 1ISKA 3HI7A 3PCRA 5KP3A 2OTL3 1WTHA 5JBSA 3CC23 3M8CA 5AEUB 3DMCA 5EQLA 2CFWA 1RRLA 2HMLB 1IV7A 3MG3A 3O8YA 4FMAA 3L0RA 3CNXA 1A90A 3ER7A 3OW22 2MC8A 4K61A 4N6TA 5AYSC 4N3VA 1VQ43 1O7MB 4ORLA 4RZMA 4WYKB 1CYVA 4FMDA 4HVNA 2XRXB 1NU3A 4FCJA 1ROVA 3F8XA 3OWSA 1RN7A 4XBXA 4XDVA 7STDA 2RSXA 2OTJ3 2IUKA 2GU3A 2D1WA 2FGTA 3JVCA 3NUVA 1T5YA 1EG9B 2F86B 1ULJB 3LTCA 2W9PA 1JB5A 1JV2B 4LEHA 1U8CB 3HIGA 2IUJA 1J2BA 4TX4A 3DGLA 1IVXA 1K734 1VQK3 4L8OA 1OF5B 2XH9A 2E2UA 4HZBB 3NBBA 3S5CA 3LT8A 3PCSA 2CWTA 1VQ93 4MMXB 2KCDA 3DGMA 3FCSB 3IMAB 1VQ63 2Q07A 3D9RA 2XEPA 4LZIA 4HBRA 3GZXB 4N6V0 1IVWA 3U1WA 3EC9A 1CEWI 3FH1A 1YJN3 2CG0A 1YJW3 1IQYA 3EJVA 3DXOA 1GYBA 4FMBA 4N6MA 3Q1CA 3G16A 1A67A 1HU9A 3QRDA 3CCL3 5D83A 3K5TA 2YFIB 1W00A 4GL6A 1SJWA 4X2OA 3EN8A 4MMYB 4WP5A 1KC84 1W6YA 1JRQA 1NJI4 2ZDJA 3DUKA 4WWUC 2OOVA 2B1XB 5IENA 3LMLA 3N8BA 2GBWB 3LH4A 3NV0B 1N5HA 3CNMA 3F40A 4JRFA 3WOEB 4EBGA 3X3YA 1KWIA 2ZL8A 2LYXA 3SOYA 4EXRA 1OGXA 3Q90A 3UB1A 1Q42A 3WDGB 4X2HA 2WOFA 4WFOA 4L8PA 3LTDA 1W02A 3I563 5BVBA 3EHCA 4O3VA 1WMNA 1UI7A 1TFKA 3ALAA 3CCM3 1K28A 3X3ZA 1K8A4 1IV9A 3FSDA 3PYJA 3STDA 3WA2X 3EB8A 2Y73A 3CCR3 5CXOA 4LMIA 3FLJA 1IQ8A 3PS8A 4N6NB 1ULIB 2XGNA 2XF3A 1Q7Y4 2C10A 4K90B 3DGNA 2HMNB 3DY5A 1AVLA 2PZVA 3K9MC 4MJDA 3JUNA 4J8TA 3FG3A 3RGRA 1Y4KA 2HMMB 3VF1A 1IK3A 2I9WA 1SQWA 3IJEB 3ECFA 2GXFA 3F8HA 3G4S3 1TUHA 3VGNA 4QWTA 3LT9A 5IG0A 1M1K4 4AKZA 2W03A 3LXUX 2CFLA 4IIAA 2XSOB 3UJMA 1YHQ3 1QVG2 4H61A 5AIHA 2BHMA 3GZRA 3MYTA 4KZ1A 5AEWB 3MKIA 1SIIA 1IVUA 1JN5B 3CCJ3 3SX1A 1VQ53 2CFKA 2E2TA 4HM7B 1CQSA 2JDIH 3T8NA 5IG4A 2ML5A 1TIJA 1ASKA 4IPBA 4HM1B 3LTBA 3BNCA 5AIIA 1OF5A 1Q814 3CPW2 1O7HB 1Q864 5ELJA 3WA3A 2INXA 2P38A 1AVKA 4O8SA 5TGNA 1D6UA 2GU1A 1FA3A 3CME3 1U5OA 2W0QA 1NB5I 2CHCA 4HM4B 1FGQA 1D6ZA 1OACA 4EV2A 2Z7AA 1K41A 3HX8A 1IVVA 1O7PB 1IQXA 1US1A 1NDOB 3HK4A 3NHXA 3IPTA 4AEQA 3G713 3BNEA 1K9M4 1IDPA 2E2VA 3V92A 1N9JA 1IU7A 5AIGA 1QJGA 3HIIA 3EF8A 2CH9A 2W6JH 3NV0A 2R4IA 5KP4A 2QA43 3B4OA 4BTWA 3K63A 1TU5A 2RGQA 1VQ73 2GBXB 1UI8A 1N9EA 2OQEC 3K0ZA 1W6CA 1G96A 3WOFB 4KFDA 3WMDA 3G0KA 5AI1A 1RRHA 1FGRA 2LQVA 2BMRB 1JJ22 3N54B 2BT3A 1VQN3 3DZLA 1PU4A 1LVNA 3MPHA 3PZWA 1VQL3 4R80A 1FGOA 3F7SA 2CKFB 1SPUA 3JUMA 3H51A 3X3XA 1OHOA 1MNLA 5BXQA 3DGOA 2QIYA 4NREA 1LXEA 3AMOA 4MEIA 4H3UA 1DMQA 1OPYA 5LC7A 4BTXA 3VSYA 2D42A 4HM5B 4WHAA 1JNQA 3B7CA 4RBNA 1AV4A 3SVAA 4IT7A 3X42A 2XGLA 3GAXA 5DRVA 2W9QA 4OUQA 3U97A 2CFDA 2P05A 4L7KA 1A2VA 4O02B 3EX9A 3F7XA 3S67A 3I0YA 4JF8A 1NWWA 1IT7A 2Z77A 2MF7A 5EVHA 2YFLB 1M1XB 3TDGA 2SBLA 4K1VA 1EKMA 4CDLA 5CK6A 4WYKA 1FGTA 3Q2PA 1NO3A 1WNHA 2RFRA 1JKGA 4FCMA 2BMOB 1TFOA 4OVMA 4MMZB 3EBTA 4PEJA 3EQQB 1STDA 1S5AA 4BTYA 5IERA 3HZPA 2QEX3 5IEPA 1GY7A 2FXTA 3J7Yd 3NM7A 4FR9A 4HJLB 2HMKB 1R4CA 4R4KA 2KXGA 3I553 3RGAA 3CD63 1BUQA 2CWVA 2BNGA 3GRDA 1E3VA 1JB2A 1OH0A 1SIHA 3S29A 3BNDA 3T0UA 3KFQC 1N8R4 1RJOA 1UUWB 5A0OB 5LC6A 3WODG 1E97A 3BNBA 3FG1A 1GD4A 1L5GB 4ZM8A 3PXMA 4HKVB 3V98A 5IF6A 3BLZA 3FZWA 3NQZA 2V1LA 4HM8B 2YFJB 4HM3B 3SLUA 1N8QA 3GWRA 5CF2A 3BB9A 5KP1A 2P0MA 1GS3A 5HGRA 1VZZA 3B4PA 1QMAA 3OV4A 3JUPA 3LYGA 2CC3A 1DVCA 4FCZA 1OUNA 3NBRA 2W04A 4N6OB 2CIUA 1DMNA 3H3HA 3QK9A 4STDA 4EC6A 2WO0A 1FGMA 1EQKA 3NXJA 4XB5A 1OHPA 1VQP3 2CFGA 1GY5A 1OHSA 2O3OA 1JKGB 1NB3I 3S28A 4KVHA 4K1UA 1AR0A 2UX0A 5D82A 5FGOA 1OGZA 4O2HA 3DM8A 2ML6A 2GEYA 2XFTA 2OQEA 2L4VA 2K0MA 3FF2A 2CG1A 3T8UA 3B8LA 3CU3A 2K54A 2STDA 2HMOB 2IA7A 3KKGA 5IG5A 3JUOA 3F14A 3OWUA 3CMA3 1STFI 4R1KA 4EYCA 4R9KA 1DYUA 3KZTA 6STDA 3X41A 4RNYA 3N9HA 1Q40B 1JB4A 3UL5A 3SXXA 3G6E3 2XR8B 4LSOA 5JPPA 1E3RA 4R9LA 3CCV3 4HZ9B 1RKYA 1JN5A 1V74A 2HMJB 1OCVA 1QVF2 4XDWA 3UL6A 3EE1A 3AMOB 4XM4A 3NX0A 1F8NA 1DVDA 2IMJA 2OWPA 2YX9A 4GB5A 2B24B 1W4NA 2M7OA 3FGYA 5CF1A 1KSIA 2Z76A 2KRTA 1M904 2W2CA 1W2B2 3KE7A 2BMQB 1TP6A 5AIFA 2F99A 3MG2A 1Q40A 3CPOA 1WQLB 4G1MB 4J9AA 4KFEA 4N6LA 5IW9A 1GD3A 3GZBA 4U13A 1EA2A 3MHEA 1W01A 3RDEA 4EV5A 2GEXA 4NHFA 4HM6B 1YI23 3LOYA 3NQYA 4XBYA 1ROAA 3X40A 2BO9B 2OOVC 3CXC2 1GY6A 3CCE3 2CWUA 2XFSA 3OX9A 1YIJ3 3K7CA 2A15A 3JUQA 5CLKA 2Z6BA 2XSHB 3CCS3 3SEDA 1CYUA 4XBTA 5FW5A 1UUVB 1W7CA 2WGQA 3CC73 4HM0B 2P0XA 3E99A 1A2KA 1YJ93 1KD14 2CK3H 3G8ZA 4I4KA 4Q53A 1Z1SA 3EN1B 2O9UX 3FG4A 1KQS2 2JQ5A 1YGEA 3ROBA 5EEOA 1ZX2A 3KSPA 1N5PA 1MOLA 1M9GA 4FMCA 1LOXA 3MSOA 1FUWA 5DREA 5AYRB 1D6YA 3KN4A 3MG1A 4KFFA 3OWYA 1O7GB 3S27A 4LGQA 3F9SA 2W56A 4OK0A 3V99A 1DMMA 5G2GA 3KIIA 1HKXA 3SOAA 1O7NB 1QAKA 1UW1A 3OXAA 1VQ83 1S723 1W2ZA 2FNQA 1VQM3 2OCTA 8CHOA 2CW9A 5D81A 5STDA 3D3LA 3KSED 3NBJA 1W6GA 5IG3A 5IEOA 5ELUA 1ZO2A 1WMPA 1VQO3 1Q824 4HYZA 1IT8A 2RCDA 2Y74A 3CCU3 2F98A 1YIT3 4CCVA 3LZAA 4N6UA 2QGUA 5I97A 3MWZA 1YVBI 3A76A 2P09A 3EBYA 4RNZA 3CCQ3 1W5ZA 3LTAA 3FF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 4;  3CME 3;  3CCV 3;  1YJ9 3;  1VQ8 3;  1S72 3;  1VQ7 3;  3OW2 2;  1VQM 3;  1VQP 3;  1KC8 4;  1KD1 4;  3CCR 3;  3CC4 3;  3CCJ 3;  1QVF 2;  1NJI 4;  1VQ4 3;  2QEX 3;  1VQ5 3;  1JJ2 2;  1VQ9 3;  1Q7Y 4;  1VQN 3;  1VQ6 3;  1YI2 3;  1VQO 3;  1Q82 4;  2OTJ 3;  3G71 3;  1KQS 2;  3CCU 3;  3I55 3;  3CXC 2;  1YIT 3;  1YJN 3;  1YJW 3;  3CCE 3;  1K9M 4;  1M90 4;  1VQL 3;  2OTL 3;  3G4S 3;  1YIJ 3;  1Q81 4;  3CD6 3;  3CMA 3;  3CPW 2;  1Q86 4;  1W2B 2;  3CCL 3;  3I56 3;  3CC2 3;  3CCS 3;  1M1K 4;  3CCQ 3;  1N8R 4;  1K73 4;  2QA4 3;  3CC7 3;  1VQK 3;  1YHQ 3;  3G6E 3;  3CCM 3;  1QVG 2; 
#chains in the Genus database with same CATH topology
 4AKY A;  1PFP A;  5JPU A;  2W56 B;  3FKA A;  1QAL A;  3PGB A;  1LNH A;  3CC4 3;  3UNL A;  2PNC A;  1C7H A;  1WMO A;  1QAF A;  2KF5 A;  2WOH A;  3A5E A;  3NM2 A;  3GZY B;  1T2I A;  4HM2 B;  2WGO A;  2AAE A;  2C11 A;  3WOE B;  1SAR A;  1O7W B;  1ISK A;  1C54 A;  3HI7 A;  3PCR A;  1I0V A;  5KP3 A;  2OTL 3;  1WTH A;  5JBS A;  2R41 A;  7GSP A;  2H0H A;  3CC2 3;  3ZG0 A;  3M8C A;  3D5G A;  5AEU B;  1TTO A;  3DMC A;  5EQL A;  2AAD A;  2CFW A;  1RRL A;  2HML B;  2IY2 A;  1IV7 A;  2KF4 A;  3MG3 A;  3O8Y A;  4FMA A;  3L0R A;  3CNX A;  1A90 A;  3ER7 A;  3OW2 2;  2MC8 A;  4K61 A;  1BSC A;  4N6T A;  5AYS C;  4N3V A;  2UGI A;  1O7M B;  4ORL A;  4RZM A;  4WYK B;  1CYV A;  4FMD A;  4HVN A;  4ILF A;  2XRX B;  1NU3 A;  4FCJ A;  1ROV A;  3HOH A;  3F8X A;  3OWS A;  1RN7 A;  4XBX A;  1B2U A;  1X1Y A;  2RSX A;  4XDV A;  7STD A;  2OTJ 3;  5M18 A;  2IUK A;  2GU3 A;  2D1W A;  2FGT A;  1X1X A;  3JVC A;  3AGN A;  1T5Y A;  1EG9 B;  2KF6 A;  2F86 B;  4J5G A;  5M1A A;  1B2M A;  1ULJ B;  3LTC A;  2W9P A;  1JB5 A;  1GSP A;  1JV2 B;  4LEH A;  1U8C B;  3HIG A;  2IUJ A;  1J2B A;  2L1S A;  4TX4 A;  3DGL A;  1IVX A;  1K73 4;  1VQK 3;  4L8O A;  1UCJ A;  3BU4 A;  1OF5 B;  1A2P A;  2XH9 A;  3WHO A;  2E2U A;  1BSE A;  4HOH A;  4HZB B;  3NBB A;  3S5C A;  1I3F A;  1MGR A;  3LT8 A;  2CWT A;  3PCS A;  1VQ9 3;  4MMX B;  2KCD A;  3DGM A;  3FCS B;  3IMA B;  1VQ6 3;  2Q07 A;  3D9R A;  2XEP A;  4LZI A;  4HBR A;  1VQ4 3;  3GZX B;  4N6V 0;  1IVW A;  3U1W A;  3EC9 A;  1CEW I;  3FH1 A;  1YJN 3;  2CG0 A;  1YJW 3;  1IQY A;  8RNT A;  3EJV A;  3DXO A;  1GYB A;  4FMB A;  4N6M A;  3Q1C A;  3G16 A;  1A67 A;  1HU9 A;  2RNT A;  3QRD A;  3CCL 3;  1V58 A;  5D83 A;  3K5T A;  2YFI B;  1W00 A;  4GL6 A;  1SJW A;  3GSP A;  4X2O A;  1BRJ A;  1JBR A;  3EN8 A;  4MMY B;  4WP5 A;  1KC8 4;  1UGI A;  1W6Y A;  1JRQ A;  2CX1 A;  4NPB A;  1BRI A;  1NJI 4;  2ZDJ A;  3DUK A;  4WWU C;  2OOV A;  2B1X B;  3D5I A;  5IEN A;  3LML A;  3N8B A;  2GBW B;  2RBI A;  3LH4 A;  1N5H A;  3CNM A;  3F40 A;  3NV0 B;  4JRF A;  4EBG A;  3X3Y A;  1KWI A;  1HYF A;  2ZL8 A;  2LYX A;  3SOY A;  1T3B A;  4EXR A;  1BAN A;  1OGX A;  3Q90 A;  1UDI I;  3UB1 A;  1Q42 A;  3WDG B;  4X2H A;  2WOF A;  4WFO A;  4L8P A;  3LTD A;  1W02 A;  3I56 3;  5BVB A;  3EHC A;  1LOV A;  4O3V A;  1WMN A;  5M19 A;  1I8V A;  1UI7 A;  1B20 A;  1TFK A;  1TRQ A;  3ALA A;  3CCM 3;  1K28 A;  3D4A A;  3X3Z A;  2F56 A;  1GOV A;  1GMR A;  1IV9 A;  3FSD A;  3PYJ A;  3STD A;  3WA2 X;  1K8A 4;  3EB8 A;  3WR2 A;  1BVI A;  2Y73 A;  1B3S A;  3CCR 3;  1RMS A;  1TJD A;  5CXO A;  4LMI A;  3FLJ A;  1IQ8 A;  3PS8 A;  4N6N B;  1ULI B;  2XGN A;  2XF3 A;  1Q7Y 4;  2C10 A;  4K90 B;  1I2F A;  3DGN A;  2HMN B;  3DY5 A;  1AVL A;  2PZV A;  3K9M C;  4MJD A;  3JUN A;  4J8T A;  3FG3 A;  3RGR A;  1Y4K A;  2HMM B;  3VF1 A;  1IK3 A;  2I9W A;  1SQW A;  3IJE B;  3ECF A;  2GXF A;  3F8H A;  1I0X A;  1TUH A;  3G4S 3;  3VGN A;  4QWT A;  3LT9 A;  5IG0 A;  1BSA A;  1M1K 4;  2F5W A;  4AKZ A;  2W03 A;  3LXU X;  2CFL A;  4IIA A;  2XSO B;  3UJM A;  1YHQ 3;  1BSD A;  2F4Y A;  1QVG 2;  4H61 A;  1BRK A;  1FUT A;  1Q7H A;  1RN1 A;  1B2X A;  2BHM A;  5AIH A;  3GZR A;  3MYT A;  4KZ1 A;  5AEW B;  3MKI A;  1SII A;  2HOH A;  1IVU A;  1JN5 B;  3CCJ 3;  1FZU A;  3SX1 A;  1VQ5 3;  2CFK A;  2E2T A;  3AHW A;  1CQS A;  4HM7 B;  2JDI H;  3T8N A;  1FYS A;  5IG4 A;  2ML5 A;  1X1W A;  1TIJ A;  3BIR A;  1ASK A;  4IPB A;  4HM1 B;  1HZ1 A;  1YGW A;  1RN4 A;  3BNC A;  3LTB A;  5AII A;  1RNB A;  1OF5 A;  1Q81 4;  1VQQ A;  3CPW 2;  1O7H B;  1Q86 4;  1BGS A;  5ELJ A;  3WA3 A;  2INX A;  2P38 A;  1AVK A;  5BU4 A;  1PY3 A;  4O8S A;  1RCL A;  1BRG A;  1D6U A;  5TGN A;  2GU1 A;  1FA3 A;  3CME 3;  1U5O A;  2W0Q A;  3DGY A;  1NB5 I;  2CHC A;  4HM4 B;  1FGQ A;  1D6Z A;  1OAC A;  4EV2 A;  1MWR A;  1R4Y A;  2Z7A A;  1MWT A;  1K41 A;  3HX8 A;  1IVV A;  1O7P B;  1IQX A;  1US1 A;  1NDO B;  3HK4 A;  3NHX A;  3IPT A;  1RLS A;  4AEQ A;  3G71 3;  3BNE A;  1K9M 4;  1IDP A;  2E2V A;  3V92 A;  1N9J A;  1IU7 A;  5AIG A;  1QJG A;  3HII A;  3EF8 A;  3Q3F A;  2CH9 A;  1UCL A;  2W6J H;  2K3D A;  3NV0 A;  2R4I A;  5KP4 A;  2QA4 3;  3B4O A;  4BTW A;  3K63 A;  1TU5 A;  2RGQ A;  1VQ7 3;  1UI8 A;  2GBX B;  2UUG C;  1N9E A;  2OQE C;  3K0Z A;  1W6C A;  1G96 A;  1B27 A;  4KFD A;  3WOF B;  3G0K A;  3WMD A;  4CPK A;  5AI1 A;  6GSP A;  1RRH A;  1B2Z A;  1ZS7 A;  1FGR A;  2LQV A;  2BMR B;  6RNT A;  1JJ2 2;  3N54 B;  2BT3 A;  1VQN 3;  9RNT A;  3DZL A;  1V57 A;  4J5K A;  1PU4 A;  1LVN A;  2H0G A;  3MPH A;  3PZW A;  1VQL 3;  4R80 A;  1FGO A;  3F7S A;  2CKF B;  1SPU A;  1UGH I;  3JUM A;  3H51 A;  3X3X A;  1OHO A;  1MNL A;  5BXQ A;  1GMQ A;  3DGO A;  2QIY A;  4NRE A;  1LXE A;  3AMO A;  4MEI A;  1PYL A;  1DMQ A;  1OPY A;  4H3U A;  5LC7 A;  4BTX A;  2BU4 A;  3VSY A;  1JBT A;  2D42 A;  4HM5 B;  1BSB A;  4WHA A;  1JNQ A;  3B7C A;  4RBN A;  1AV4 A;  3SVA A;  4IT7 A;  3X42 A;  2XGL A;  1BU4 A;  3DH2 A;  3GAX A;  5DRV A;  2W9Q A;  4OUQ A;  1BNS A;  5RNT A;  3U97 A;  1UUG B;  1RGL A;  2CFD A;  1LQM B;  2P05 A;  4L7K A;  1A2V A;  1BNJ A;  4O02 B;  3EX9 A;  3F7X A;  5HOH A;  1BIR A;  3S67 A;  3I0Y A;  4JF8 A;  1NWW A;  1IT7 A;  3URP A;  1MWS A;  1BNI A;  1UCK A;  2MF7 A;  2Z77 A;  2YFL B;  5EVH A;  1M1X B;  3TDG A;  2SBL A;  4K1V A;  1EKM A;  1BNR A;  4CDL A;  5CK6 A;  1JBS A;  4WYK A;  1FGT A;  3Q2P A;  1NO3 A;  1WNH A;  1RGC A;  2RFR A;  1JKG A;  4FCM A;  2BMO B;  4KT3 B;  1TFO A;  2SAR A;  3NUV A;  3EBT A;  4MMZ B;  3EQQ B;  1STD A;  1S5A A;  4OVM A;  4PEJ A;  4BTY A;  5IER A;  3HZP A;  2QEX 3;  5IEP A;  1GY7 A;  1EEJ A;  1UCI A;  2FXT A;  3NM7 A;  3J7Y d;  4FR9 A;  4HJL B;  1BRS A;  1RSN A;  2HMK B;  1R4C A;  4R4K A;  2KXG A;  3I55 3;  3RGA A;  1LRA A;  1GOU A;  3CD6 3;  1BUQ A;  1YNV X;  2CWV A;  1BAO A;  1G02 A;  2BNG A;  3GRD A;  3SYU A;  1E3V A;  1BRN L;  1DE3 A;  1JB2 A;  1OH0 A;  1SIH A;  3S29 A;  4BU4 A;  3BND A;  3T0U A;  3KFQ C;  1N8R 4;  1RJO A;  1UUW B;  5A0O B;  1I2E A;  5LC6 A;  1GOY A;  3WOD G;  1E97 A;  1RTU A;  3BNB A;  1EUI C;  3FG1 A;  1GD4 A;  1B21 A;  1L5G B;  4ZM8 A;  3PXM A;  1LOW A;  4HKV B;  3V98 A;  1AY7 A;  5IF6 A;  3BLZ A;  3FZW A;  3NQZ A;  2KAA A;  2V1L A;  4HM8 B;  2YFJ B;  4HM3 B;  3SLU A;  1N8Q A;  3GWR A;  5CF2 A;  3BB9 A;  5KP1 A;  2GSP A;  2P0M A;  1G0T A;  1GS3 A;  1RGK A;  5HGR A;  1VZZ A;  3B4P A;  1QMA A;  3OV4 A;  1NNV A;  3JUP A;  1YVS A;  3LYG A;  2CC3 A;  1JZO A;  1DVC A;  4FCZ A;  1OUN A;  2J8X B;  2W04 A;  3NBR A;  4GHO A;  4N6O B;  2CIU A;  4I5Q A;  1DMN A;  3H3H A;  1T2H A;  3QK9 A;  4STD A;  4EC6 A;  2WO0 A;  1FGM A;  1AQZ A;  1TRP A;  1EQK A;  3NXJ A;  4XB5 A;  1OHP A;  1VQP 3;  2CFG A;  1GY5 A;  1I2G A;  1OHS A;  4BIR A;  2O3O A;  3D79 A;  1JKG B;  1FUS A;  1NB3 I;  3S28 A;  4BL2 A;  4KVH A;  4K1U A;  2BIR A;  1AR0 A;  2UX0 A;  5D82 A;  5FGO A;  1OGZ A;  4O2H A;  3DM8 A;  1JZD A;  2GEY A;  2ML6 A;  2XFT A;  2OQE A;  2L4V A;  2K0M A;  3FF2 A;  2CG1 A;  1RDS A;  3T8U A;  5G1L A;  3B8L A;  3CU3 A;  2CX0 A;  1BNE A;  2K54 A;  2STD A;  3KCH A;  2HMO B;  2IA7 A;  3KKG A;  5IG5 A;  2KF3 A;  3JUO A;  4DKI A;  3F14 A;  3OWU A;  3RNT A;  1STF I;  4R1K A;  4EYC A;  3CMA 3;  3AGO A;  4R9K A;  1DYU A;  3KZT A;  6STD A;  1X1U A;  3X41 A;  4RNY A;  3N9H A;  1Q40 B;  1JB4 A;  3UL5 A;  4CJN A;  3SXX A;  3G6E 3;  2XR8 B;  4LSO A;  5JPP A;  1E3R A;  4R9L A;  3CCV 3;  3ZG5 A;  4HZ9 B;  1RKY A;  1JN5 A;  1I70 A;  1V74 A;  2HMJ B;  1OCV A;  1QVF 2;  4XDW A;  3UL6 A;  3EE1 A;  5BIR A;  3AMO B;  4XM4 A;  1BOX A;  3NX0 A;  1F8N A;  1BNF A;  3AHS A;  1IYY A;  1DVD A;  4LYL B;  2IMJ A;  2OWP A;  2YX9 A;  4GB5 A;  2B24 B;  1W4N A;  2F5M A;  2M7O A;  3FGY A;  5CF1 A;  1KSI A;  2Z76 A;  2KRT A;  1M90 4;  2W2C A;  1RCK A;  4BL3 A;  1W2B 2;  3KE7 A;  2BMQ B;  1TP6 A;  5AIF A;  1GMP A;  1I3I A;  2F99 A;  3MG2 A;  1Q40 A;  3CPO A;  1WQL B;  4G1M B;  1BNG A;  4J9A A;  4KFE A;  2IYJ A;  4N6L A;  7RNT A;  5IW9 A;  1GD3 A;  3GZB A;  4U13 A;  1EA2 A;  3MHE A;  1W01 A;  3RDE A;  4EV5 A;  2GEX A;  4NHF A;  4HM6 B;  1YI2 3;  3LOY A;  3NQY A;  4XBY A;  1ROA A;  3X40 A;  2BO9 B;  2OOV C;  3CXC 2;  1GY6 A;  3CCE 3;  1CH0 A;  2CWU A;  2XFS A;  3OX9 A;  1YIJ 3;  3K7C A;  2A15 A;  3JUQ A;  5CLK A;  1B2S A;  4RNT A;  2Z6B A;  1RGH A;  2XSH B;  3CCS 3;  2H0I A;  3SED A;  1CYU A;  4XBT A;  5FW5 A;  1BRH A;  1UUV B;  1W7C A;  2WGQ A;  3CC7 3;  1RGG A;  4HM0 B;  2P0X A;  3E99 A;  1A2K A;  1YJ9 3;  1RGE A;  1KD1 4;  1FW7 A;  1LOY A;  2CK3 H;  3G8Z A;  4GSP A;  4I4K A;  4Q53 A;  1Z1S A;  3EN1 B;  2O9U X;  3FG4 A;  1KQS 2;  2JQ5 A;  4HAA A;  1YGE A;  3ROB A;  5EEO A;  1ZX2 A;  3KSP A;  1N5P A;  2ZA4 A;  1Q9E A;  1RNT A;  1MOL A;  1DET A;  1BUJ A;  1M9G A;  4FMC A;  1LOX A;  3MSO A;  2ZHX B;  1FUW A;  5DRE A;  5AYR B;  1D6Y A;  3KN4 A;  3MG1 A;  4KFF A;  3ZFZ A;  3OWY A;  2C4B A;  1O7G B;  3S27 A;  4LGQ A;  3F9S A;  2W56 A;  4OK0 A;  3V99 A;  1DMM A;  5G2G A;  1MGW A;  3KII A;  1HKX A;  3SOA A;  1LQG C;  1O7N B;  1QAK A;  1LNI A;  1UW1 A;  3OXA A;  1MWU A;  5G1K A;  1VQ8 3;  1S72 3;  1W2Z A;  2FNQ A;  1VQM 3;  2OCT A;  8CHO A;  2CW9 A;  5D81 A;  5STD A;  3D3L A;  1RGF A;  3KSE D;  3NBJ A;  1ZGX A;  5GSP A;  1W6G A;  5IG3 A;  5IEO A;  5ELU A;  1ZO2 A;  1WMP A;  1RHL A;  1VQO 3;  1Q82 4;  4HYZ A;  1IT8 A;  2RCD A;  2Y74 A;  4EW5 A;  3CCU 3;  2F98 A;  1YIT 3;  4CCV A;  3LZA A;  4N6U A;  2QGU A;  5I97 A;  3MWZ A;  1YVB I;  1RGA A;  2P09 A;  3A76 A;  3EBY A;  4RNZ A;  3CCQ 3;  1W5Z A;  3LTA A;  3FF0 A; 
#chains in the Genus database with same CATH homology
 4AKY A;  1PFP A;  5JPU A;  2W56 B;  3FKA A;  1QAL A;  3PGB A;  1LNH A;  3CC4 3;  3UNL A;  2PNC A;  1C7H A;  1WMO A;  1QAF A;  2WOH A;  3NM2 A;  3GZY B;  4HM2 B;  2WGO A;  2C11 A;  1O7W B;  1ISK A;  3HI7 A;  3PCR A;  5KP3 A;  2OTL 3;  1WTH A;  5JBS A;  3CC2 3;  3M8C A;  5AEU B;  3DMC A;  5EQL A;  2CFW A;  1RRL A;  2HML B;  1IV7 A;  3MG3 A;  3O8Y A;  4FMA A;  3L0R A;  3CNX A;  1A90 A;  3ER7 A;  3OW2 2;  2MC8 A;  4K61 A;  4N6T A;  5AYS C;  4N3V A;  1VQ4 3;  1O7M B;  4ORL A;  4RZM A;  4WYK B;  1CYV A;  4FMD A;  4HVN A;  2XRX B;  1NU3 A;  4FCJ A;  1ROV A;  3F8X A;  3OWS A;  1RN7 A;  4XBX A;  4XDV A;  7STD A;  2RSX A;  2OTJ 3;  2IUK A;  2GU3 A;  2D1W A;  2FGT A;  3JVC A;  3NUV A;  1T5Y A;  1EG9 B;  2F86 B;  1ULJ B;  3LTC A;  2W9P A;  1JB5 A;  1JV2 B;  4LEH A;  1U8C B;  3HIG A;  2IUJ A;  1J2B A;  4TX4 A;  3DGL A;  1IVX A;  1K73 4;  1VQK 3;  4L8O A;  1OF5 B;  2XH9 A;  2E2U A;  4HZB B;  3NBB A;  3S5C A;  3LT8 A;  3PCS A;  2CWT A;  1VQ9 3;  4MMX B;  2KCD A;  3DGM A;  3FCS B;  3IMA B;  1VQ6 3;  2Q07 A;  3D9R A;  2XEP A;  4LZI A;  4HBR A;  3GZX B;  4N6V 0;  1IVW A;  3U1W A;  3EC9 A;  1CEW I;  3FH1 A;  1YJN 3;  2CG0 A;  1YJW 3;  1IQY A;  3EJV A;  3DXO A;  1GYB A;  4FMB A;  4N6M A;  3Q1C A;  3G16 A;  1A67 A;  1HU9 A;  3QRD A;  3CCL 3;  5D83 A;  3K5T A;  2YFI B;  1W00 A;  4GL6 A;  1SJW A;  4X2O A;  3EN8 A;  4MMY B;  4WP5 A;  1KC8 4;  1W6Y A;  1JRQ A;  1NJI 4;  2ZDJ A;  3DUK A;  4WWU C;  2OOV A;  2B1X B;  5IEN A;  3LML A;  3N8B A;  2GBW B;  3LH4 A;  3NV0 B;  1N5H A;  3CNM A;  3F40 A;  4JRF A;  3WOE B;  4EBG A;  3X3Y A;  1KWI A;  2ZL8 A;  2LYX A;  3SOY A;  4EXR A;  1OGX A;  3Q90 A;  3UB1 A;  1Q42 A;  3WDG B;  4X2H A;  2WOF A;  4WFO A;  4L8P A;  3LTD A;  1W02 A;  3I56 3;  5BVB A;  3EHC A;  4O3V A;  1WMN A;  1UI7 A;  1TFK A;  3ALA A;  3CCM 3;  1K28 A;  3X3Z A;  1K8A 4;  1IV9 A;  3FSD A;  3PYJ A;  3STD A;  3WA2 X;  3EB8 A;  2Y73 A;  3CCR 3;  5CXO A;  4LMI A;  3FLJ A;  1IQ8 A;  3PS8 A;  4N6N B;  1ULI B;  2XGN A;  2XF3 A;  1Q7Y 4;  2C10 A;  4K90 B;  3DGN A;  2HMN B;  3DY5 A;  1AVL A;  2PZV A;  3K9M C;  4MJD A;  3JUN A;  4J8T A;  3FG3 A;  3RGR A;  1Y4K A;  2HMM B;  3VF1 A;  1IK3 A;  2I9W A;  1SQW A;  3IJE B;  3ECF A;  2GXF A;  3F8H A;  3G4S 3;  1TUH A;  3VGN A;  4QWT A;  3LT9 A;  5IG0 A;  1M1K 4;  4AKZ A;  2W03 A;  3LXU X;  2CFL A;  4IIA A;  2XSO B;  3UJM A;  1YHQ 3;  1QVG 2;  4H61 A;  5AIH A;  2BHM A;  3GZR A;  3MYT A;  4KZ1 A;  5AEW B;  3MKI A;  1SII A;  1IVU A;  1JN5 B;  3CCJ 3;  3SX1 A;  1VQ5 3;  2CFK A;  2E2T A;  4HM7 B;  1CQS A;  2JDI H;  3T8N A;  5IG4 A;  2ML5 A;  1TIJ A;  1ASK A;  4IPB A;  4HM1 B;  3LTB A;  3BNC A;  5AII A;  1OF5 A;  1Q81 4;  3CPW 2;  1O7H B;  1Q86 4;  5ELJ A;  3WA3 A;  2INX A;  2P38 A;  1AVK A;  4O8S A;  5TGN A;  1D6U A;  2GU1 A;  1FA3 A;  3CME 3;  1U5O A;  2W0Q A;  1NB5 I;  2CHC A;  4HM4 B;  1FGQ A;  1D6Z A;  1OAC A;  4EV2 A;  2Z7A A;  1K41 A;  3HX8 A;  1IVV A;  1O7P B;  1IQX A;  1US1 A;  1NDO B;  3HK4 A;  3NHX A;  3IPT A;  4AEQ A;  3G71 3;  3BNE A;  1K9M 4;  1IDP A;  2E2V A;  3V92 A;  1N9J A;  1IU7 A;  5AIG A;  1QJG A;  3HII A;  3EF8 A;  2CH9 A;  2W6J H;  3NV0 A;  2R4I A;  5KP4 A;  2QA4 3;  3B4O A;  4BTW A;  3K63 A;  1TU5 A;  2RGQ A;  1VQ7 3;  2GBX B;  1UI8 A;  1N9E A;  2OQE C;  3K0Z A;  1W6C A;  1G96 A;  3WOF B;  4KFD A;  3WMD A;  3G0K A;  5AI1 A;  1RRH A;  1FGR A;  2LQV A;  2BMR B;  1JJ2 2;  3N54 B;  2BT3 A;  1VQN 3;  3DZL A;  1PU4 A;  1LVN A;  3MPH A;  3PZW A;  1VQL 3;  4R80 A;  1FGO A;  3F7S A;  2CKF B;  1SPU A;  3JUM A;  3H51 A;  3X3X A;  1OHO A;  1MNL A;  5BXQ A;  3DGO A;  2QIY A;  4NRE A;  1LXE A;  3AMO A;  4MEI A;  4H3U A;  1DMQ A;  1OPY A;  5LC7 A;  4BTX A;  3VSY A;  2D42 A;  4HM5 B;  4WHA A;  1JNQ A;  3B7C A;  4RBN A;  1AV4 A;  3SVA A;  4IT7 A;  3X42 A;  2XGL A;  3GAX A;  5DRV A;  2W9Q A;  4OUQ A;  3U97 A;  2CFD A;  2P05 A;  4L7K A;  1A2V A;  4O02 B;  3EX9 A;  3F7X A;  3S67 A;  3I0Y A;  4JF8 A;  1NWW A;  1IT7 A;  2Z77 A;  2MF7 A;  5EVH A;  2YFL B;  1M1X B;  3TDG A;  2SBL A;  4K1V A;  1EKM A;  4CDL A;  5CK6 A;  4WYK A;  1FGT A;  3Q2P A;  1NO3 A;  1WNH A;  2RFR A;  1JKG A;  4FCM A;  2BMO B;  1TFO A;  4OVM A;  4MMZ B;  3EBT A;  4PEJ A;  3EQQ B;  1STD A;  1S5A A;  4BTY A;  5IER A;  3HZP A;  2QEX 3;  5IEP A;  1GY7 A;  2FXT A;  3J7Y d;  3NM7 A;  4FR9 A;  4HJL B;  2HMK B;  1R4C A;  4R4K A;  2KXG A;  3I55 3;  3RGA A;  3CD6 3;  1BUQ A;  2CWV A;  2BNG A;  3GRD A;  1E3V A;  1JB2 A;  1OH0 A;  1SIH A;  3S29 A;  3BND A;  3T0U A;  3KFQ C;  1N8R 4;  1RJO A;  1UUW B;  5A0O B;  5LC6 A;  3WOD G;  1E97 A;  3BNB A;  3FG1 A;  1GD4 A;  1L5G B;  4ZM8 A;  3PXM A;  4HKV B;  3V98 A;  5IF6 A;  3BLZ A;  3FZW A;  3NQZ A;  2V1L A;  4HM8 B;  2YFJ B;  4HM3 B;  3SLU A;  1N8Q A;  3GWR A;  5CF2 A;  3BB9 A;  5KP1 A;  2P0M A;  1GS3 A;  5HGR A;  1VZZ A;  3B4P A;  1QMA A;  3OV4 A;  3JUP A;  3LYG A;  2CC3 A;  1DVC A;  4FCZ A;  1OUN A;  3NBR A;  2W04 A;  4N6O B;  2CIU A;  1DMN A;  3H3H A;  3QK9 A;  4STD A;  4EC6 A;  2WO0 A;  1FGM A;  1EQK A;  3NXJ A;  4XB5 A;  1OHP A;  1VQP 3;  2CFG A;  1GY5 A;  1OHS A;  2O3O A;  1JKG B;  1NB3 I;  3S28 A;  4KVH A;  4K1U A;  1AR0 A;  2UX0 A;  5D82 A;  5FGO A;  1OGZ A;  4O2H A;  3DM8 A;  2ML6 A;  2GEY A;  2XFT A;  2OQE A;  2L4V A;  2K0M A;  3FF2 A;  2CG1 A;  3T8U A;  3B8L A;  3CU3 A;  2K54 A;  2STD A;  2HMO B;  2IA7 A;  3KKG A;  5IG5 A;  3JUO A;  3F14 A;  3OWU A;  3CMA 3;  1STF I;  4R1K A;  4EYC A;  4R9K A;  1DYU A;  3KZT A;  6STD A;  3X41 A;  4RNY A;  3N9H A;  1Q40 B;  1JB4 A;  3UL5 A;  3SXX A;  3G6E 3;  2XR8 B;  4LSO A;  5JPP A;  1E3R A;  4R9L A;  3CCV 3;  4HZ9 B;  1RKY A;  1JN5 A;  1V74 A;  2HMJ B;  1OCV A;  1QVF 2;  4XDW A;  3UL6 A;  3EE1 A;  3AMO B;  4XM4 A;  3NX0 A;  1F8N A;  1DVD A;  2IMJ A;  2OWP A;  2YX9 A;  4GB5 A;  2B24 B;  1W4N A;  2M7O A;  3FGY A;  5CF1 A;  1KSI A;  2Z76 A;  2KRT A;  1M90 4;  2W2C A;  1W2B 2;  3KE7 A;  2BMQ B;  1TP6 A;  5AIF A;  2F99 A;  3MG2 A;  1Q40 A;  3CPO A;  1WQL B;  4G1M B;  4J9A A;  4KFE A;  4N6L A;  5IW9 A;  1GD3 A;  3GZB A;  4U13 A;  1EA2 A;  3MHE A;  1W01 A;  3RDE A;  4EV5 A;  2GEX A;  4NHF A;  4HM6 B;  1YI2 3;  3LOY A;  3NQY A;  4XBY A;  1ROA A;  3X40 A;  2BO9 B;  2OOV C;  3CXC 2;  1GY6 A;  3CCE 3;  2CWU A;  2XFS A;  3OX9 A;  1YIJ 3;  3K7C A;  2A15 A;  3JUQ A;  5CLK A;  2Z6B A;  2XSH B;  3CCS 3;  3SED A;  1CYU A;  4XBT A;  5FW5 A;  1UUV B;  1W7C A;  2WGQ A;  3CC7 3;  4HM0 B;  2P0X A;  3E99 A;  1A2K A;  1YJ9 3;  1KD1 4;  2CK3 H;  3G8Z A;  4I4K A;  4Q53 A;  1Z1S A;  3EN1 B;  2O9U X;  3FG4 A;  1KQS 2;  2JQ5 A;  1YGE A;  3ROB A;  5EEO A;  1ZX2 A;  3KSP A;  1N5P A;  1MOL A;  1M9G A;  4FMC A;  1LOX A;  3MSO A;  1FUW A;  5DRE A;  5AYR B;  1D6Y A;  3KN4 A;  3MG1 A;  4KFF A;  3OWY A;  1O7G B;  3S27 A;  4LGQ A;  3F9S A;  2W56 A;  4OK0 A;  3V99 A;  1DMM A;  5G2G A;  3KII A;  1HKX A;  3SOA A;  1O7N B;  1QAK A;  1UW1 A;  3OXA A;  1VQ8 3;  1S72 3;  1W2Z A;  2FNQ A;  1VQM 3;  2OCT A;  8CHO A;  2CW9 A;  5D81 A;  5STD A;  3D3L A;  3KSE D;  3NBJ A;  1W6G A;  5IG3 A;  5IEO A;  5ELU A;  1ZO2 A;  1WMP A;  1VQO 3;  1Q82 4;  4HYZ A;  1IT8 A;  2RCD A;  2Y74 A;  3CCU 3;  2F98 A;  1YIT 3;  4CCV A;  3LZA A;  4N6U A;  2QGU A;  5I97 A;  3MWZ A;  1YVB I;  3A76 A;  2P09 A;  3EBY A;  4RNZ A;  3CCQ 3;  1W5Z A;  3LTA A;  3FF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...