1VQ83

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq8300
1VQL3 1YJN3 1QVG2 3CCE3 1VQO3 1VQM3 3CME3 1VQK3 1M1K4 2OTL3 1Q7Y4 1JJ22 1YI23 3CCQ3 1VQ93 3G4S3 3CC73 1YIJ3 1QVF2 1YJW3 1YIT3 1VQ73 3G713 3CCV3 1NJI4 3CC43 3CD63 1N8R4 1S723 3CCR3 1K9M4 1VQ53 3CCM3 1Q824 1KC84 3CC23 1VQP3 2QEX3 1Q864 1VQN3 3OW22 3CCU3 3CPW2 1Q814 1K734 3CCS3 1KD14 3I553 3CXC2 3I563 1YJ93 3CCL3 1K8A4 1VQ43 1VQ83 3CMA3 1VQ63 1W2B2 2OTJ3 3G6E3 1M904 3CCJ3 1KQS2 1YHQ3 2QA43
chains in the Genus database with same CATH superfamily
4MMYB 3AGOA 1STFI 1I2GA 3MSOA 1JKGB 3BU4A 4XBXA 1FUTA 4HM3B 1VQO3 1QVG2 1QMAA 1ZX2A 2W56A 5CF2A 3LT8A 4CCVA 5LC7A 1TP6A 3CC73 4U13A 2JQ5A 4O3VA 4HKVB 7RNTA 1GOYA 1OACA 1S723 4LZIA 3F7XA 1RNBA 1JZDA 5CF1A 1RCLA 1BRKA 3DMCA 3SOAA 3CCL3 2IY2A 2P0MA 3Q90A 5DRVA 4RZMA 1ZS7A 1LOWA 3SOYA 5EVHA 4KFFA 2QA43 1VQL3 5D82A 1M1XB 3D3LA 2GU1A 4XBTA 4N6MA 3DGMA 1GY7A 3STDA 3CME3 1O7PB 2UX0A 1NNVA 5CXOA 1UUGB 3U1WA 3KZTA 3CCQ3 2YX9A 1E97A 1RTUA 3LYGA 1JV2B 2UUGC 4RBNA 5JPPA 1TU5A 2CW9A 1IVUA 1VQ73 4TX4A 1CEWI 2C4BA 5LC6A 4R1KA 4LGQA 2XGNA 5AIIA 3CCM3 1Q824 1L5GB 2O9UX 5TGNA 1N5PA 3PZWA 1UCLA 4GL6A 2WGQA 3D5GA 4R80A 3URPA 3OW22 2IMJA 4HM1B 1B3SA 2OWPA 3F7SA 3LTCA 4R4KA 2IA7A 4FMDA 5HOHA 1TJDA 1AY7A 1GSPA 3BNDA 1O7NB 4H3UA 4N6OB 4PEJA 3SLUA 3D9RA 1YHQ3 1MWTA 4X2OA 3UNLA 3LMLA 3NHXA 5G2GA 2HMNB 4K1VA 1YI23 1LOYA 4HZ9B 3G4S3 2AAEA 3HX8A 1YVBI 2BMRB 4KFDA 1QVF2 3UL5A 3A5EA 5BVBA 4HM8B 1ROAA 3GZRA 3PCSA 4FMBA 4EYCA 1RN1A 1RGKA 1VQ53 1W4NA 1BSBA 1GOVA 1GY5A 2AADA 1FUSA 2JDIH 3K7CA 1OPYA 4HVNA 3FG1A 3GZXB 3BB9A 2MF7A 5ELJA 1WMPA 4JRFA 1HYFA 3N8BA 6RNTA 3GZBA 3CNMA 3J7Yd 4DKIA 2ML5A 3KIIA 6GSPA 3CCJ3 4XB5A 2D42A 1GY6A 1X1WA 3GRDA 1SPUA 1NU3A 3L0RA 2P05A 1OGXA 2OTL3 1OF5A 3B7CA 3O8YA 3VSYA 2GEYA 1YGEA 3VGNA 1I0XA 3HIIA 3S28A 2O3OA 2CIUA 4FCJA 5G1LA 3CC43 1D6UA 1OH0A 3EBYA 1TRQA 2E2UA 2CFWA 4EV5A 1VQP3 1DVCA 3G6E3 3IMAB 1GMRA 3WOFB 1CQSA 1VQN3 3CCS3 3OWYA 3NV0B 1ROVA 4N6V0 3HZPA 4RNYA 1PFPA 3OV4A 1C7HA 2WGOA 1V74A 2PNCA 4MJDA 1RDSA 3UB1A 2F5MA 4XBYA 2H0GA 3LTAA 4HYZA 1WQLB 3HOHA 1BNSA 2BMQB 2GEXA 1GS3A 2I9WA 3PS8A 3ROBA 3MKIA 4OK0A 1TFKA 1EG9B 3ZG5A 4IIAA 2OOVC 1JBRA 2KF3A 2RBIA 4LYLB 2HMOB 1I3FA 1HKXA 4EV2A 1UCKA 1F8NA 2BIRA 3WA3A 3VF1A 3KKGA 3E99A 1KWIA 2ZDJA 4OUQA 1MWUA 3Q3FA 4MEIA 4FMAA 5IEPA 1B2UA 5KP4A 1BRNL 3X42A 1BSDA 2K54A 2R41A 3KCHA 4J9AA 3BNEA 1JBSA 1JN5B 3MHEA 3U97A 2KAAA 1DMNA 2XFSA 1W7CA 3EF8A 1BNIA 3G0KA 3QK9A 1RGGA 3V99A 2CFGA 3LH4A 4WHAA 3WOEB 8RNTA 3AHWA 3BLZA 5KP3A 3S29A 1CYUA 5D83A 1AVKA 4WFOA 3NBRA 2M7OA 1YNVX 5IG3A 1IV9A 1O7GB 2ZA4A 1DETA 5AI1A 1WNHA 4GHOA 1LXEA 3TDGA 1FA3A 3MG3A 5BXQA 1RGFA 3ZG0A 1Q40B 1O7WB 4FCZA 3EHCA 1RSNA 2L4VA 1AVLA 2H0IA 1MOLA 4EBGA 1UDII 1WTHA 2QIYA 4EW5A 4I5QA 1OHOA 1V57A 4N6LA 3DUKA 3OXAA 4J5GA 1BUJA 2INXA 4ILFA 1W00A 3CCU3 4KFEA 1STDA 5M19A 3CXC2 1VQ83 5BU4A 4LEHA 2H0HA 1BGSA 1W2B2 1JRQA 1GD4A 1JZOA 1B2SA 1W02A 2P38A 2GU3A 1OHPA 3K5TA 3CCE3 1V58A 5IEOA 1ZGXA 3X41A 1M1K4 2E2VA 1Q7Y4 3LT9A 3UJMA 1CYVA 3QRDA 1VQ93 1NB3I 4XDWA 3NUVA 2RNTA 1DE3A 3LZAA 5G1KA 1AR0A 3K63A 3CD63 3WA2X 1FGQA 1OGZA 1FYSA 3FSDA 1U5OA 1X1UA 1Z1SA 2CKFB 3EQQB 4AEQA 2BHMA 2W6JH 4N3VA 3DGNA 4CDLA 1Q864 6STDA 3BNBA 2KCDA 1RN7A 3I553 2WOHA 4O8SA 2CWTA 1YJ93 1NWWA 2J8XB 2P0XA 1IT7A 1IV7A 1MWSA 2HOHA 3GSPA 3IPTA 3MPHA 3K0ZA 3Q1CA 5IG5A 1EKMA 1FGOA 1JB2A 3AMOA 3LOYA 2SBLA 2CC3A 2CFKA 4I4KA 4HM5B 5EEOA 1BSAA 1A2VA 1DMQA 2KF6A 1RGLA 1BRIA 1QAKA 2XF3A 1UW1A 3ER7A 2C11A 3RNTA 2CX1A 2OQEA 3KSED 1YIT3 4BTYA 1NDOB 3G8ZA 3B4PA 1B2ZA 3OWUA 1I3IA 1RNTA 3H51A 4K61A 1DMMA 4K1UA 1A90A 1PY3A 2KF4A 1BRGA 2R4IA 2W56B 2WO0A 4LSOA 2QEX3 1C54A 1B21A 1JNQA 2K3DA 1FGRA 1LOVA 2GBWB 1MGWA 1AQZA 4J5KA 1Q42A 1BANA 1IVXA 1ZO2A 2HMLB 3DZLA 4IT7A 1VQ43 1IQXA 3SEDA 4STDA 1E3VA 3N9HA 3Q2PA 4O02B 2WOFA 3AMOB 1OCVA 3NQYA 4H61A 4ZM8A 2Z7AA 3B4OA 3EC9A 2UGIA 5I97A 1YGWA 1IT8A 1BAOA 1W6GA 3DGLA 3FF0A 3F8HA 4OVMA 3NM2A 4R9KA 5AIFA 3V92A 2FXTA 1T2HA 1LQGC 2GXFA 4RNTA 2QGUA 7GSPA 4EXRA 1LVNA 2PZVA 3X3YA 1TTOA 4L8OA 1ULJB 3FKAA 3T0UA 2W2CA 1UCJA 3DM8A 2F98A 5IF6A 2IUJA 2BT3A 3K9MC 5IG4A 8CHOA 1EQKA 3KE7A 4NREA 3S67A 1VQ63 1LNHA 3RDEA 3A76A 1JB5A 1RGHA 2W0QA 2OQEC 1TFOA 3GAXA 3OWSA 1UI7A 2CWUA 5STDA 1PYLA 2B1XB 2HMJB 1RCKA 1AV4A 1ISKA 5GSPA 1E3RA 1W6CA 2CFDA 2Z6BA 1BNJA 3I0YA 3DGYA 1IVWA 1OHSA 3JUMA 3FLJA 1HZ1A 3FH1A 1EEJA 3EN8A 1N8R4 4GSPA 3JUNA 1K9M4 2F4YA 4WWUC 3WHOA 2FGTA 3T8UA 1MGRA 3F9SA 4GB5A 3FG4A 2Y74A 4N6UA 3X3XA 1K734 3WDGB 5IW9A 4BU4A 3DH2A 5BIRA 3PCRA 2XSHB 1K8A4 1JB4A 3PXMA 3FG3A 4O2HA 4BL2A 1RGEA 1UI8A 2V1LA 2ZL8A 2W04A 4R9LA 1JKGA 3HIGA 4LMIA 1J2BA 3PGBA 4IPBA 1BRJA 3F8XA 2KRTA 4HAAA 2CG1A 1A67A 2F86B 2B24B 2W9PA 1BRHA 1K28A 9RNTA 5AYRB 3KN4A 3X40A 1ASKA 1D6ZA 3F40A 1A2PA 4MMZB 2K0MA 1YIJ3 2L1SA 4HM2B 3MG1A 1Q40A 1SIIA 2P09A 1NJI4 1QALA 1BVIA 3FGYA 1B27A 1RHLA 4BTWA 3N54B 3AGNA 1FGMA 1VQQA 2BNGA 5JBSA 1G0TA 1LNIA 3B8LA 4NPBA 1MNLA 2CX0A 1IDPA 1EUIC 5FGOA 1BIRA 2F99A 4HM7B 3T8NA 4BIRA 1UGIA 3GWRA 5FW5A 1UCIA 2HMMB 5D81A 3G16A 1VQM3 4KZ1A 1VQK3 2XH9A 3ALAA 2IUKA 3NV0A 1BUQA 2CHCA 3KSPA 1BNEA 3NQZA 1RMSA 1HU9A 2YFJB 3EBTA 4ORLA 3V98A 1RKYA 2LYXA 1DYUA 5ELUA 1LQMB 1LOXA 1UGHI 1WMOA 4WYKB 3HI7A 3JUPA 4FCMA 1DVDA 4WYKA 1KSIA 1T5YA 3KFQC 1IQYA 2CFLA 1SJWA 1FGTA 4N6TA 3NX0A 2Z76A 5IG0A 1UUVB 1G02A 2CG0A 4BTXA 1S5AA 1IYYA 1I8VA 2Z77A 2ZHXB 1GOUA 3CNXA 4HM4B 2BU4A 1I70A 1BNGA 1SARA 4HM6B 5AIHA 1PU4A 1M904 1YJN3 1W2ZA 1BNRA 2Q07A 1UUWB 2F5WA 3BIRA 1GD3A 2YFLB 1TIJA 3BNCA 2BO9B 2BMOB 1RRLA 4N6NB 3D4AA 5DREA 7STDA 1LRAA 4CJNA 1A2KA 3D5IA 3CPOA 2RSXA 1YJW3 1BU4A 1RLSA 5HGRA 5M18A 3LTBA 3F14A 4L8PA 2F56A 1N9EA 3DXOA 1GYBA 2RGQA 3FF2A 2XSOB 3D79A 3JUQA 3WMDA 1TRPA 1N5HA 5IERA 1FW7A 2IYJA 3H3HA 2W03A 2D1WA 1OUNA 1W6YA 4AKZA 2OTJ3 3FZWA 3SXXA 4HOHA 3NM7A 1KQS2 2STDA 1X1YA 5EQLA 1NB5I 2GBXB 3EN1B 4QWTA 4XM4A 5CLKA 3NBBA 1SQWA 3MYTA 3LTDA 1BSCA 3SVAA 1JJ22 3CU3A 2XEPA 3JVCA 2CH9A 3S5CA 1I2EA 2XGLA 2C10A 3CCV3 2OCTA 4RNZA 4HM0B 1I0VA 2HMKB 1SIHA 3EX9A 3CCR3 1T3BA 1BRSA 4HZBB 1KC84 1B20A 2XRXB 5AEUB 3MG2A 1O7HB 1QAFA 3M8CA 1U8CB 3EJVA 2KF5A 1D6YA 1RJOA 1FZUA 3CMA3 3RGAA 1IU7A 1G96A 3JUOA 1EA2A 1JN5A 1YVSA 1RRHA 1US1A 5CK6A 4FR9A 2XFTA 1TUHA 1N9JA 3SX1A 2E2TA 4JF8A 4CPKA 2KXGA 1T2IA 2W9QA 3X3ZA 1QJGA 5JPUA 1RGAA 3DY5A 3ZFZA 1RN4A 1WMNA 1ULIB 3NBJA 1BSEA 3AHSA 3G713 2FNQA 2OOVA 4G1MB 5KP1A 3FCSB 3RGRA 2LQVA 3OX9A 4FMCA 2Y73A 3CC23 5AIGA 2YFIB 2RCDA 3EB8A 4J8TA 1B2XA 1Y4KA 1Q814 3UL6A 4KT3B 2RFRA 5IENA 1KD14 4WP5A 4X2HA 3I563 4BL3A 3WODG 1NO3A 1N8QA 1BNFA 1W5ZA 1VZZA 3LXUX 4HBRA 1X1XA 2GSPA 4EC6A 4HJLB 1R4CA 1RGCA 4L7KA 2ML6A 2CK3H 2A15A 3PYJA 2CWVA 2XR8B 2SARA 3IJEB 1BOXA 1CH0A 1I2FA 1R4YA 1JBTA 1M9GA 3ECFA 3HK4A 3EE1A 1Q7HA 3NXJA 1IK3A 3DGOA 1O7MB 5M1AA 1OF5B 5AEWB 1IQ8A 1Q9EA 3GZYB 5AYSC 3SYUA 1W01A 4K90B 2MC8A 1GMPA 4MMXB 4Q53A 3CPW2 5A0OB 5RNTA 1MWRA 1B2MA 3S27A 1K41A 4NHFA 1GMQA 1IVVA 4AKYA 3MWZA 3WR2A 4XDVA 1FUWA 4KVHA
chains in the Genus database with same CATH topology
4MMYB 1STFI 3MSOA 1JKGB 4XBXA 1QVG2 4HM3B 1VQO3 1QMAA 1ZX2A 2W56A 5CF2A 3LT8A 4CCVA 5LC7A 1TP6A 3CC73 4U13A 2JQ5A 4O3VA 4HKVB 1OACA 1S723 4LZIA 3F7XA 5CF1A 3DMCA 3SOAA 3CCL3 2P0MA 3Q90A 5DRVA 4RZMA 3SOYA 5EVHA 4KFFA 2QA43 1VQL3 5D82A 1M1XB 3D3LA 2GU1A 4XBTA 4N6MA 3DGMA 1GY7A 3STDA 3CME3 1O7PB 2UX0A 5CXOA 3U1WA 3KZTA 3CCQ3 2YX9A 1E97A 4RBNA 3LYGA 1JV2B 1TU5A 5JPPA 2CW9A 1IVUA 1VQ73 4TX4A 1CEWI 5LC6A 4R1KA 4LGQA 2XGNA 5AIIA 3CCM3 1Q824 1L5GB 2O9UX 5TGNA 1N5PA 3PZWA 4GL6A 2WGQA 4R80A 3OW22 2IMJA 4HM1B 2OWPA 3F7SA 3LTCA 4R4KA 2IA7A 4FMDA 3BNDA 1O7NB 4H3UA 4N6OB 4PEJA 3SLUA 3D9RA 1YHQ3 4X2OA 3UNLA 3LMLA 3NHXA 5G2GA 2HMNB 4K1VA 1YI23 4HZ9B 3G4S3 3HX8A 1YVBI 2BMRB 4KFDA 1QVF2 3UL5A 5BVBA 4HM8B 1ROAA 3GZRA 3PCSA 4FMBA 4EYCA 1VQ53 1W4NA 1GY5A 3K7CA 2JDIH 4HVNA 1OPYA 3FG1A 3GZXB 3BB9A 2MF7A 5ELJA 1WMPA 4JRFA 3N8BA 3GZBA 3CNMA 3J7Yd 2ML5A 3KIIA 3CCJ3 4XB5A 2D42A 1GY6A 3GRDA 1SPUA 1NU3A 3L0RA 2P05A 1OGXA 2OTL3 1OF5A 3B7CA 3O8YA 3VSYA 2GEYA 1YGEA 3VGNA 3S28A 3HIIA 2O3OA 2CIUA 4FCJA 3CC43 1D6UA 1OH0A 3EBYA 2E2UA 2CFWA 4EV5A 1VQP3 1DVCA 3IMAB 3WOFB 1VQN3 1CQSA 3CCS3 3OWYA 3NV0B 1ROVA 4N6V0 3HZPA 4RNYA 1PFPA 3OV4A 1C7HA 2WGOA 1V74A 2PNCA 4MJDA 3UB1A 3G6E3 4XBYA 3LTAA 4HYZA 1WQLB 2BMQB 2GEXA 1GS3A 2I9WA 3PS8A 3ROBA 3MKIA 4OK0A 1TFKA 1EG9B 4IIAA 2OOVC 2HMOB 1HKXA 4EV2A 1F8NA 3WA3A 3VF1A 3KKGA 3E99A 1KWIA 2ZDJA 4OUQA 4MEIA 4FMAA 5IEPA 5KP4A 3X42A 2K54A 4J9AA 3BNEA 1JN5B 3MHEA 3U97A 1DMNA 2XFSA 1W7CA 3EF8A 3QK9A 3G0KA 3V99A 2CFGA 3LH4A 4WHAA 3WOEB 3S29A 3BLZA 5KP3A 1CYUA 5D83A 1AVKA 4WFOA 3NBRA 2M7OA 5IG3A 1IV9A 1O7GB 5AI1A 1WNHA 1LXEA 3TDGA 1FA3A 3MG3A 5BXQA 1Q40B 1O7WB 4FCZA 3EHCA 2L4VA 1AVLA 1MOLA 4EBGA 1WTHA 2QIYA 1OHOA 4N6LA 3DUKA 3OXAA 2INXA 1W00A 3CCU3 4KFEA 1STDA 3CXC2 1VQ83 4LEHA 1W2B2 1JRQA 1GD4A 1W02A 2P38A 2GU3A 1OHPA 3K5TA 3CCE3 5IEOA 3X41A 1M1K4 2E2VA 1Q7Y4 3LT9A 3UJMA 1CYVA 3QRDA 1VQ93 1NB3I 4XDWA 3NUVA 3LZAA 1AR0A 3K63A 3CD63 3WA2X 1FGQA 1OGZA 3FSDA 1U5OA 1Z1SA 2CKFB 3EQQB 4AEQA 2BHMA 2W6JH 4N3VA 3DGNA 4CDLA 1Q864 6STDA 3BNBA 2KCDA 1RN7A 3I553 2WOHA 4O8SA 2CWTA 1YJ93 1NWWA 2P0XA 1IT7A 1IV7A 3IPTA 3MPHA 3K0ZA 3Q1CA 5IG5A 1EKMA 1FGOA 1JB2A 3AMOA 3LOYA 2SBLA 2CC3A 2CFKA 4I4KA 4HM5B 5EEOA 1A2VA 1DMQA 1QAKA 2XF3A 1UW1A 3ER7A 2C11A 2OQEA 3KSED 1YIT3 4BTYA 1NDOB 3G8ZA 3B4PA 3OWUA 3H51A 4K61A 1DMMA 4K1UA 1A90A 2R4IA 4LSOA 2W56B 2WO0A 2QEX3 1JNQA 1FGRA 2GBWB 1Q42A 1IVXA 1ZO2A 2HMLB 3DZLA 4IT7A 1VQ43 1IQXA 3SEDA 4STDA 1E3VA 3N9HA 3Q2PA 4O02B 2WOFA 3AMOB 1OCVA 3NQYA 4H61A 4ZM8A 3B4OA 2Z7AA 3EC9A 5I97A 1IT8A 1W6GA 3DGLA 4OVMA 3FF0A 3F8HA 4R9KA 3NM2A 5AIFA 3V92A 2FXTA 2GXFA 2QGUA 4EXRA 1LVNA 2PZVA 3X3YA 4L8OA 1ULJB 3FKAA 3T0UA 2W2CA 3DM8A 2F98A 5IF6A 2IUJA 2BT3A 3K9MC 5IG4A 8CHOA 1EQKA 3KE7A 4NREA 3S67A 1VQ63 1LNHA 3RDEA 3A76A 1JB5A 2W0QA 2OQEC 1TFOA 3GAXA 3OWSA 1UI7A 2CWUA 5STDA 2B1XB 2HMJB 1AV4A 1ISKA 1E3RA 1W6CA 2CFDA 2Z6BA 3I0YA 1IVWA 1OHSA 3JUMA 3FLJA 3FH1A 3EN8A 1N8R4 3JUNA 1K9M4 4WWUC 2FGTA 3T8UA 3F9SA 4GB5A 3FG4A 2Y74A 4N6UA 3X3XA 1K734 3WDGB 5IW9A 3PCRA 2XSHB 1K8A4 1JB4A 3PXMA 3FG3A 4O2HA 1UI8A 2V1LA 2ZL8A 2W04A 4R9LA 1JKGA 3HIGA 4LMIA 1J2BA 3PGBA 4IPBA 3F8XA 2KRTA 2CG1A 1A67A 2F86B 2B24B 2W9PA 1K28A 5AYRB 3KN4A 3X40A 1ASKA 1D6ZA 3F40A 4MMZB 2K0MA 1YIJ3 4HM2B 3MG1A 1Q40A 1SIIA 2P09A 1NJI4 1QALA 3FGYA 3N54B 1FGMA 2BNGA 5JBSA 3B8LA 1MNLA 1IDPA 5FGOA 2F99A 4HM7B 3T8NA 3GWRA 5FW5A 2HMMB 5D81A 3G16A 1VQM3 4KZ1A 1VQK3 2XH9A 3ALAA 2IUKA 3NV0A 1BUQA 2CHCA 3KSPA 3NQZA 4ORLA 1HU9A 2YFJB 3EBTA 1RKYA 3V98A 2LYXA 1DYUA 5ELUA 1LOXA 1WMOA 4WYKB 3HI7A 3JUPA 4FCMA 1DVDA 4WYKA 1KSIA 1T5YA 3KFQC 1IQYA 2CFLA 1SJWA 1FGTA 4N6TA 3NX0A 2Z76A 5IG0A 1UUVB 2CG0A 4BTXA 1S5AA 2Z77A 4HM4B 3CNXA 1M904 4HM6B 5AIHA 1PU4A 1YJN3 1W2ZA 2Q07A 1UUWB 1GD3A 2YFLB 1TIJA 3BNCA 2BO9B 2BMOB 1RRLA 4N6NB 5DREA 7STDA 1A2KA 3CPOA 2RSXA 1YJW3 5HGRA 3LTBA 3F14A 4L8PA 3DXOA 1N9EA 1GYBA 2RGQA 3FF2A 2XSOB 3JUQA 3WMDA 1N5HA 5IERA 3H3HA 2W03A 2D1WA 1OUNA 1W6YA 4AKZA 2OTJ3 3FZWA 3SXXA 3NM7A 1KQS2 2STDA 5EQLA 1NB5I 2GBXB 3EN1B 4QWTA 4XM4A 5CLKA 3NBBA 1SQWA 3MYTA 3LTDA 3SVAA 1JJ22 3CU3A 2XEPA 3JVCA 2CH9A 3S5CA 2XGLA 2C10A 3CCV3 2OCTA 4RNZA 4HM0B 2HMKB 1SIHA 3EX9A 3CCR3 4HZBB 1KC84 2XRXB 5AEUB 3MG2A 1O7HB 1QAFA 3M8CA 1U8CB 3EJVA 1D6YA 1RJOA 3CMA3 3RGAA 1IU7A 1G96A 3JUOA 1EA2A 1JN5A 1US1A 1RRHA 4BTWA 5CK6A 4FR9A 2XFTA 1TUHA 1N9JA 3SX1A 2E2TA 4JF8A 2KXGA 2W9QA 3X3ZA 1QJGA 5JPUA 3DY5A 1WMNA 1ULIB 3NBJA 3G713 2FNQA 2OOVA 4G1MB 5KP1A 3FCSB 3RGRA 2LQVA 3OX9A 4FMCA 2Y73A 3CC23 5AIGA 2YFIB 3EB8A 2RCDA 4J8TA 1Y4KA 1Q814 3UL6A 5IENA 2RFRA 1KD14 4WP5A 4X2HA 3I563 3WODG 1NO3A 1N8QA 1W5ZA 1VZZA 3LXUX 4HBRA 4EC6A 4HJLB 1R4CA 4L7KA 2ML6A 2CK3H 2A15A 3PYJA 2CWVA 2XR8B 3IJEB 1M9GA 3ECFA 3HK4A 3EE1A 3NXJA 1IK3A 3DGOA 1O7MB 1OF5B 5AEWB 1IQ8A 3GZYB 5AYSC 1W01A 4K90B 2MC8A 4MMXB 4Q53A 3CPW2 5A0OB 3S27A 1K41A 4NHFA 1IVVA 4AKYA 3MWZA 4XDVA 1FUWA 4KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL 3;  1YJN 3;  1QVG 2;  3CCE 3;  1VQO 3;  1VQM 3;  3CME 3;  1VQK 3;  1M1K 4;  2OTL 3;  1Q7Y 4;  1JJ2 2;  1YI2 3;  3CCQ 3;  1VQ9 3;  3G4S 3;  3CC7 3;  1YIJ 3;  1QVF 2;  1YJW 3;  1YIT 3;  1VQ7 3;  3G71 3;  3CCV 3;  1NJI 4;  3CC4 3;  3CD6 3;  1N8R 4;  1S72 3;  3CCR 3;  1K9M 4;  1VQ5 3;  3CCM 3;  1Q82 4;  1KC8 4;  3CC2 3;  1VQP 3;  2QEX 3;  1Q86 4;  1VQN 3;  3OW2 2;  3CCU 3;  3CPW 2;  1Q81 4;  1K73 4;  3CCS 3;  1KD1 4;  3I55 3;  3CXC 2;  3I56 3;  1YJ9 3;  3CCL 3;  1K8A 4;  1VQ4 3;  1VQ8 3;  3CMA 3;  1VQ6 3;  1W2B 2;  2OTJ 3;  3G6E 3;  1M90 4;  3CCJ 3;  1KQS 2;  1YHQ 3;  2QA4 3; 
#chains in the Genus database with same CATH topology
 4MMY B;  3AGO A;  1STF I;  1I2G A;  3MSO A;  1JKG B;  3BU4 A;  4XBX A;  1FUT A;  4HM3 B;  1VQO 3;  1QVG 2;  1QMA A;  1ZX2 A;  2W56 A;  5CF2 A;  3LT8 A;  4CCV A;  5LC7 A;  1TP6 A;  3CC7 3;  4U13 A;  2JQ5 A;  4O3V A;  4HKV B;  7RNT A;  1GOY A;  1OAC A;  1S72 3;  4LZI A;  3F7X A;  1RNB A;  1JZD A;  5CF1 A;  1RCL A;  1BRK A;  3DMC A;  3SOA A;  3CCL 3;  2IY2 A;  2P0M A;  3Q90 A;  5DRV A;  4RZM A;  1ZS7 A;  1LOW A;  3SOY A;  5EVH A;  4KFF A;  2QA4 3;  1VQL 3;  5D82 A;  1M1X B;  3D3L A;  2GU1 A;  4XBT A;  4N6M A;  3DGM A;  1GY7 A;  3STD A;  3CME 3;  1O7P B;  2UX0 A;  1NNV A;  5CXO A;  1UUG B;  3U1W A;  3KZT A;  3CCQ 3;  2YX9 A;  1E97 A;  1RTU A;  3LYG A;  1JV2 B;  2UUG C;  4RBN A;  5JPP A;  1TU5 A;  2CW9 A;  1IVU A;  1VQ7 3;  4TX4 A;  1CEW I;  2C4B A;  5LC6 A;  4R1K A;  4LGQ A;  2XGN A;  5AII A;  3CCM 3;  1Q82 4;  1L5G B;  2O9U X;  5TGN A;  1N5P A;  3PZW A;  1UCL A;  4GL6 A;  2WGQ A;  3D5G A;  4R80 A;  3URP A;  3OW2 2;  2IMJ A;  4HM1 B;  1B3S A;  2OWP A;  3F7S A;  3LTC A;  4R4K A;  2IA7 A;  4FMD A;  5HOH A;  1TJD A;  1AY7 A;  1GSP A;  3BND A;  1O7N B;  4H3U A;  4N6O B;  4PEJ A;  3SLU A;  3D9R A;  1YHQ 3;  1MWT A;  4X2O A;  3UNL A;  3LML A;  3NHX A;  5G2G A;  2HMN B;  4K1V A;  1YI2 3;  1LOY A;  4HZ9 B;  3G4S 3;  2AAE A;  3HX8 A;  1YVB I;  2BMR B;  4KFD A;  1QVF 2;  3UL5 A;  3A5E A;  5BVB A;  4HM8 B;  1ROA A;  3GZR A;  3PCS A;  4FMB A;  4EYC A;  1RN1 A;  1RGK A;  1VQ5 3;  1W4N A;  1BSB A;  1GOV A;  1GY5 A;  2AAD A;  1FUS A;  2JDI H;  3K7C A;  1OPY A;  4HVN A;  3FG1 A;  3GZX B;  3BB9 A;  2MF7 A;  5ELJ A;  1WMP A;  4JRF A;  1HYF A;  3N8B A;  6RNT A;  3GZB A;  3CNM A;  3J7Y d;  4DKI A;  2ML5 A;  3KII A;  6GSP A;  3CCJ 3;  4XB5 A;  2D42 A;  1GY6 A;  1X1W A;  3GRD A;  1SPU A;  1NU3 A;  3L0R A;  2P05 A;  1OGX A;  2OTL 3;  1OF5 A;  3B7C A;  3O8Y A;  3VSY A;  2GEY A;  1YGE A;  3VGN A;  1I0X A;  3HII A;  3S28 A;  2O3O A;  2CIU A;  4FCJ A;  5G1L A;  3CC4 3;  1D6U A;  1OH0 A;  3EBY A;  1TRQ A;  2E2U A;  2CFW A;  4EV5 A;  1VQP 3;  1DVC A;  3G6E 3;  3IMA B;  1GMR A;  3WOF B;  1CQS A;  1VQN 3;  3CCS 3;  3OWY A;  3NV0 B;  1ROV A;  4N6V 0;  3HZP A;  4RNY A;  1PFP A;  3OV4 A;  1C7H A;  2WGO A;  1V74 A;  2PNC A;  4MJD A;  1RDS A;  3UB1 A;  2F5M A;  4XBY A;  2H0G A;  3LTA A;  4HYZ A;  1WQL B;  3HOH A;  1BNS A;  2BMQ B;  2GEX A;  1GS3 A;  2I9W A;  3PS8 A;  3ROB A;  3MKI A;  4OK0 A;  1TFK A;  1EG9 B;  3ZG5 A;  4IIA A;  2OOV C;  1JBR A;  2KF3 A;  2RBI A;  4LYL B;  2HMO B;  1I3F A;  1HKX A;  4EV2 A;  1UCK A;  1F8N A;  2BIR A;  3WA3 A;  3VF1 A;  3KKG A;  3E99 A;  1KWI A;  2ZDJ A;  4OUQ A;  1MWU A;  3Q3F A;  4MEI A;  4FMA A;  5IEP A;  1B2U A;  5KP4 A;  1BRN L;  3X42 A;  1BSD A;  2K54 A;  2R41 A;  3KCH A;  4J9A A;  3BNE A;  1JBS A;  1JN5 B;  3MHE A;  3U97 A;  2KAA A;  1DMN A;  2XFS A;  1W7C A;  3EF8 A;  1BNI A;  3G0K A;  3QK9 A;  1RGG A;  3V99 A;  2CFG A;  3LH4 A;  4WHA A;  3WOE B;  8RNT A;  3AHW A;  3BLZ A;  5KP3 A;  3S29 A;  1CYU A;  5D83 A;  1AVK A;  4WFO A;  3NBR A;  2M7O A;  1YNV X;  5IG3 A;  1IV9 A;  1O7G B;  2ZA4 A;  1DET A;  5AI1 A;  1WNH A;  4GHO A;  1LXE A;  3TDG A;  1FA3 A;  3MG3 A;  5BXQ A;  1RGF A;  3ZG0 A;  1Q40 B;  1O7W B;  4FCZ A;  3EHC A;  1RSN A;  2L4V A;  1AVL A;  2H0I A;  1MOL A;  4EBG A;  1UDI I;  1WTH A;  2QIY A;  4EW5 A;  4I5Q A;  1OHO A;  1V57 A;  4N6L A;  3DUK A;  3OXA A;  4J5G A;  1BUJ A;  2INX A;  4ILF A;  1W00 A;  3CCU 3;  4KFE A;  1STD A;  5M19 A;  3CXC 2;  1VQ8 3;  5BU4 A;  4LEH A;  2H0H A;  1BGS A;  1W2B 2;  1JRQ A;  1GD4 A;  1JZO A;  1B2S A;  1W02 A;  2P38 A;  2GU3 A;  1OHP A;  3K5T A;  3CCE 3;  1V58 A;  5IEO A;  1ZGX A;  3X41 A;  1M1K 4;  2E2V A;  1Q7Y 4;  3LT9 A;  3UJM A;  1CYV A;  3QRD A;  1VQ9 3;  1NB3 I;  4XDW A;  3NUV A;  2RNT A;  1DE3 A;  3LZA A;  5G1K A;  1AR0 A;  3K63 A;  3CD6 3;  3WA2 X;  1FGQ A;  1OGZ A;  1FYS A;  3FSD A;  1U5O A;  1X1U A;  1Z1S A;  2CKF B;  3EQQ B;  4AEQ A;  2BHM A;  2W6J H;  4N3V A;  3DGN A;  4CDL A;  1Q86 4;  6STD A;  3BNB A;  2KCD A;  1RN7 A;  3I55 3;  2WOH A;  4O8S A;  2CWT A;  1YJ9 3;  1NWW A;  2J8X B;  2P0X A;  1IT7 A;  1IV7 A;  1MWS A;  2HOH A;  3GSP A;  3IPT A;  3MPH A;  3K0Z A;  3Q1C A;  5IG5 A;  1EKM A;  1FGO A;  1JB2 A;  3AMO A;  3LOY A;  2SBL A;  2CC3 A;  2CFK A;  4I4K A;  4HM5 B;  5EEO A;  1BSA A;  1A2V A;  1DMQ A;  2KF6 A;  1RGL A;  1BRI A;  1QAK A;  2XF3 A;  1UW1 A;  3ER7 A;  2C11 A;  3RNT A;  2CX1 A;  2OQE A;  3KSE D;  1YIT 3;  4BTY A;  1NDO B;  3G8Z A;  3B4P A;  1B2Z A;  3OWU A;  1I3I A;  1RNT A;  3H51 A;  4K61 A;  1DMM A;  4K1U A;  1A90 A;  1PY3 A;  2KF4 A;  1BRG A;  2R4I A;  2W56 B;  2WO0 A;  4LSO A;  2QEX 3;  1C54 A;  1B21 A;  1JNQ A;  2K3D A;  1FGR A;  1LOV A;  2GBW B;  1MGW A;  1AQZ A;  4J5K A;  1Q42 A;  1BAN A;  1IVX A;  1ZO2 A;  2HML B;  3DZL A;  4IT7 A;  1VQ4 3;  1IQX A;  3SED A;  4STD A;  1E3V A;  3N9H A;  3Q2P A;  4O02 B;  2WOF A;  3AMO B;  1OCV A;  3NQY A;  4H61 A;  4ZM8 A;  2Z7A A;  3B4O A;  3EC9 A;  2UGI A;  5I97 A;  1YGW A;  1IT8 A;  1BAO A;  1W6G A;  3DGL A;  3FF0 A;  3F8H A;  4OVM A;  3NM2 A;  4R9K A;  5AIF A;  3V92 A;  2FXT A;  1T2H A;  1LQG C;  2GXF A;  4RNT A;  2QGU A;  7GSP A;  4EXR A;  1LVN A;  2PZV A;  3X3Y A;  1TTO A;  4L8O A;  1ULJ B;  3FKA A;  3T0U A;  2W2C A;  1UCJ A;  3DM8 A;  2F98 A;  5IF6 A;  2IUJ A;  2BT3 A;  3K9M C;  5IG4 A;  8CHO A;  1EQK A;  3KE7 A;  4NRE A;  3S67 A;  1VQ6 3;  1LNH A;  3RDE A;  3A76 A;  1JB5 A;  1RGH A;  2W0Q A;  2OQE C;  1TFO A;  3GAX A;  3OWS A;  1UI7 A;  2CWU A;  5STD A;  1PYL A;  2B1X B;  2HMJ B;  1RCK A;  1AV4 A;  1ISK A;  5GSP A;  1E3R A;  1W6C A;  2CFD A;  2Z6B A;  1BNJ A;  3I0Y A;  3DGY A;  1IVW A;  1OHS A;  3JUM A;  3FLJ A;  1HZ1 A;  3FH1 A;  1EEJ A;  3EN8 A;  1N8R 4;  4GSP A;  3JUN A;  1K9M 4;  2F4Y A;  4WWU C;  3WHO A;  2FGT A;  3T8U A;  1MGR A;  3F9S A;  4GB5 A;  3FG4 A;  2Y74 A;  4N6U A;  3X3X A;  1K73 4;  3WDG B;  5IW9 A;  4BU4 A;  3DH2 A;  5BIR A;  3PCR A;  2XSH B;  1K8A 4;  1JB4 A;  3PXM A;  3FG3 A;  4O2H A;  4BL2 A;  1RGE A;  1UI8 A;  2V1L A;  2ZL8 A;  2W04 A;  4R9L A;  1JKG A;  3HIG A;  4LMI A;  1J2B A;  3PGB A;  4IPB A;  1BRJ A;  3F8X A;  2KRT A;  4HAA A;  2CG1 A;  1A67 A;  2F86 B;  2B24 B;  2W9P A;  1BRH A;  1K28 A;  9RNT A;  5AYR B;  3KN4 A;  3X40 A;  1ASK A;  1D6Z A;  3F40 A;  1A2P A;  4MMZ B;  2K0M A;  1YIJ 3;  2L1S A;  4HM2 B;  3MG1 A;  1Q40 A;  1SII A;  2P09 A;  1NJI 4;  1QAL A;  1BVI A;  3FGY A;  1B27 A;  1RHL A;  4BTW A;  3N54 B;  3AGN A;  1FGM A;  1VQQ A;  2BNG A;  5JBS A;  1G0T A;  1LNI A;  3B8L A;  4NPB A;  1MNL A;  2CX0 A;  1IDP A;  1EUI C;  5FGO A;  1BIR A;  2F99 A;  4HM7 B;  3T8N A;  4BIR A;  1UGI A;  3GWR A;  5FW5 A;  1UCI A;  2HMM B;  5D81 A;  3G16 A;  1VQM 3;  4KZ1 A;  1VQK 3;  2XH9 A;  3ALA A;  2IUK A;  3NV0 A;  1BUQ A;  2CHC A;  3KSP A;  1BNE A;  3NQZ A;  1RMS A;  1HU9 A;  2YFJ B;  3EBT A;  4ORL A;  3V98 A;  1RKY A;  2LYX A;  1DYU A;  5ELU A;  1LQM B;  1LOX A;  1UGH I;  1WMO A;  4WYK B;  3HI7 A;  3JUP A;  4FCM A;  1DVD A;  4WYK A;  1KSI A;  1T5Y A;  3KFQ C;  1IQY A;  2CFL A;  1SJW A;  1FGT A;  4N6T A;  3NX0 A;  2Z76 A;  5IG0 A;  1UUV B;  1G02 A;  2CG0 A;  4BTX A;  1S5A A;  1IYY A;  1I8V A;  2Z77 A;  2ZHX B;  1GOU A;  3CNX A;  4HM4 B;  2BU4 A;  1I70 A;  1BNG A;  1SAR A;  4HM6 B;  5AIH A;  1PU4 A;  1M90 4;  1YJN 3;  1W2Z A;  1BNR A;  2Q07 A;  1UUW B;  2F5W A;  3BIR A;  1GD3 A;  2YFL B;  1TIJ A;  3BNC A;  2BO9 B;  2BMO B;  1RRL A;  4N6N B;  3D4A A;  5DRE A;  7STD A;  1LRA A;  4CJN A;  1A2K A;  3D5I A;  3CPO A;  2RSX A;  1YJW 3;  1BU4 A;  1RLS A;  5HGR A;  5M18 A;  3LTB A;  3F14 A;  4L8P A;  2F56 A;  1N9E A;  3DXO A;  1GYB A;  2RGQ A;  3FF2 A;  2XSO B;  3D79 A;  3JUQ A;  3WMD A;  1TRP A;  1N5H A;  5IER A;  1FW7 A;  2IYJ A;  3H3H A;  2W03 A;  2D1W A;  1OUN A;  1W6Y A;  4AKZ A;  2OTJ 3;  3FZW A;  3SXX A;  4HOH A;  3NM7 A;  1KQS 2;  2STD A;  1X1Y A;  5EQL A;  1NB5 I;  2GBX B;  3EN1 B;  4QWT A;  4XM4 A;  5CLK A;  3NBB A;  1SQW A;  3MYT A;  3LTD A;  1BSC A;  3SVA A;  1JJ2 2;  3CU3 A;  2XEP A;  3JVC A;  2CH9 A;  3S5C A;  1I2E A;  2XGL A;  2C10 A;  3CCV 3;  2OCT A;  4RNZ A;  4HM0 B;  1I0V A;  2HMK B;  1SIH A;  3EX9 A;  3CCR 3;  1T3B A;  1BRS A;  4HZB B;  1KC8 4;  1B20 A;  2XRX B;  5AEU B;  3MG2 A;  1O7H B;  1QAF A;  3M8C A;  1U8C B;  3EJV A;  2KF5 A;  1D6Y A;  1RJO A;  1FZU A;  3CMA 3;  3RGA A;  1IU7 A;  1G96 A;  3JUO A;  1EA2 A;  1JN5 A;  1YVS A;  1RRH A;  1US1 A;  5CK6 A;  4FR9 A;  2XFT A;  1TUH A;  1N9J A;  3SX1 A;  2E2T A;  4JF8 A;  4CPK A;  2KXG A;  1T2I A;  2W9Q A;  3X3Z A;  1QJG A;  5JPU A;  1RGA A;  3DY5 A;  3ZFZ A;  1RN4 A;  1WMN A;  1ULI B;  3NBJ A;  1BSE A;  3AHS A;  3G71 3;  2FNQ A;  2OOV A;  4G1M B;  5KP1 A;  3FCS B;  3RGR A;  2LQV A;  3OX9 A;  4FMC A;  2Y73 A;  3CC2 3;  5AIG A;  2YFI B;  2RCD A;  3EB8 A;  4J8T A;  1B2X A;  1Y4K A;  1Q81 4;  3UL6 A;  4KT3 B;  2RFR A;  5IEN A;  1KD1 4;  4WP5 A;  4X2H A;  3I56 3;  4BL3 A;  3WOD G;  1NO3 A;  1N8Q A;  1BNF A;  1W5Z A;  1VZZ A;  3LXU X;  4HBR A;  1X1X A;  2GSP A;  4EC6 A;  4HJL B;  1R4C A;  1RGC A;  4L7K A;  2ML6 A;  2CK3 H;  2A15 A;  3PYJ A;  2CWV A;  2XR8 B;  2SAR A;  3IJE B;  1BOX A;  1CH0 A;  1I2F A;  1R4Y A;  1JBT A;  1M9G A;  3ECF A;  3HK4 A;  3EE1 A;  1Q7H A;  3NXJ A;  1IK3 A;  3DGO A;  1O7M B;  5M1A A;  1OF5 B;  5AEW B;  1IQ8 A;  1Q9E A;  3GZY B;  5AYS C;  3SYU A;  1W01 A;  4K90 B;  2MC8 A;  1GMP A;  4MMX B;  4Q53 A;  3CPW 2;  5A0O B;  5RNT A;  1MWR A;  1B2M A;  3S27 A;  1K41 A;  4NHF A;  1GMQ A;  1IVV A;  4AKY A;  3MWZ A;  3WR2 A;  4XDV A;  1FUW A;  4KVH A; 
#chains in the Genus database with same CATH homology
 4MMY B;  1STF I;  3MSO A;  1JKG B;  4XBX A;  1QVG 2;  4HM3 B;  1VQO 3;  1QMA A;  1ZX2 A;  2W56 A;  5CF2 A;  3LT8 A;  4CCV A;  5LC7 A;  1TP6 A;  3CC7 3;  4U13 A;  2JQ5 A;  4O3V A;  4HKV B;  1OAC A;  1S72 3;  4LZI A;  3F7X A;  5CF1 A;  3DMC A;  3SOA A;  3CCL 3;  2P0M A;  3Q90 A;  5DRV A;  4RZM A;  3SOY A;  5EVH A;  4KFF A;  2QA4 3;  1VQL 3;  5D82 A;  1M1X B;  3D3L A;  2GU1 A;  4XBT A;  4N6M A;  3DGM A;  1GY7 A;  3STD A;  3CME 3;  1O7P B;  2UX0 A;  5CXO A;  3U1W A;  3KZT A;  3CCQ 3;  2YX9 A;  1E97 A;  4RBN A;  3LYG A;  1JV2 B;  1TU5 A;  5JPP A;  2CW9 A;  1IVU A;  1VQ7 3;  4TX4 A;  1CEW I;  5LC6 A;  4R1K A;  4LGQ A;  2XGN A;  5AII A;  3CCM 3;  1Q82 4;  1L5G B;  2O9U X;  5TGN A;  1N5P A;  3PZW A;  4GL6 A;  2WGQ A;  4R80 A;  3OW2 2;  2IMJ A;  4HM1 B;  2OWP A;  3F7S A;  3LTC A;  4R4K A;  2IA7 A;  4FMD A;  3BND A;  1O7N B;  4H3U A;  4N6O B;  4PEJ A;  3SLU A;  3D9R A;  1YHQ 3;  4X2O A;  3UNL A;  3LML A;  3NHX A;  5G2G A;  2HMN B;  4K1V A;  1YI2 3;  4HZ9 B;  3G4S 3;  3HX8 A;  1YVB I;  2BMR B;  4KFD A;  1QVF 2;  3UL5 A;  5BVB A;  4HM8 B;  1ROA A;  3GZR A;  3PCS A;  4FMB A;  4EYC A;  1VQ5 3;  1W4N A;  1GY5 A;  3K7C A;  2JDI H;  4HVN A;  1OPY A;  3FG1 A;  3GZX B;  3BB9 A;  2MF7 A;  5ELJ A;  1WMP A;  4JRF A;  3N8B A;  3GZB A;  3CNM A;  3J7Y d;  2ML5 A;  3KII A;  3CCJ 3;  4XB5 A;  2D42 A;  1GY6 A;  3GRD A;  1SPU A;  1NU3 A;  3L0R A;  2P05 A;  1OGX A;  2OTL 3;  1OF5 A;  3B7C A;  3O8Y A;  3VSY A;  2GEY A;  1YGE A;  3VGN A;  3S28 A;  3HII A;  2O3O A;  2CIU A;  4FCJ A;  3CC4 3;  1D6U A;  1OH0 A;  3EBY A;  2E2U A;  2CFW A;  4EV5 A;  1VQP 3;  1DVC A;  3IMA B;  3WOF B;  1VQN 3;  1CQS A;  3CCS 3;  3OWY A;  3NV0 B;  1ROV A;  4N6V 0;  3HZP A;  4RNY A;  1PFP A;  3OV4 A;  1C7H A;  2WGO A;  1V74 A;  2PNC A;  4MJD A;  3UB1 A;  3G6E 3;  4XBY A;  3LTA A;  4HYZ A;  1WQL B;  2BMQ B;  2GEX A;  1GS3 A;  2I9W A;  3PS8 A;  3ROB A;  3MKI A;  4OK0 A;  1TFK A;  1EG9 B;  4IIA A;  2OOV C;  2HMO B;  1HKX A;  4EV2 A;  1F8N A;  3WA3 A;  3VF1 A;  3KKG A;  3E99 A;  1KWI A;  2ZDJ A;  4OUQ A;  4MEI A;  4FMA A;  5IEP A;  5KP4 A;  3X42 A;  2K54 A;  4J9A A;  3BNE A;  1JN5 B;  3MHE A;  3U97 A;  1DMN A;  2XFS A;  1W7C A;  3EF8 A;  3QK9 A;  3G0K A;  3V99 A;  2CFG A;  3LH4 A;  4WHA A;  3WOE B;  3S29 A;  3BLZ A;  5KP3 A;  1CYU A;  5D83 A;  1AVK A;  4WFO A;  3NBR A;  2M7O A;  5IG3 A;  1IV9 A;  1O7G B;  5AI1 A;  1WNH A;  1LXE A;  3TDG A;  1FA3 A;  3MG3 A;  5BXQ A;  1Q40 B;  1O7W B;  4FCZ A;  3EHC A;  2L4V A;  1AVL A;  1MOL A;  4EBG A;  1WTH A;  2QIY A;  1OHO A;  4N6L A;  3DUK A;  3OXA A;  2INX A;  1W00 A;  3CCU 3;  4KFE A;  1STD A;  3CXC 2;  1VQ8 3;  4LEH A;  1W2B 2;  1JRQ A;  1GD4 A;  1W02 A;  2P38 A;  2GU3 A;  1OHP A;  3K5T A;  3CCE 3;  5IEO A;  3X41 A;  1M1K 4;  2E2V A;  1Q7Y 4;  3LT9 A;  3UJM A;  1CYV A;  3QRD A;  1VQ9 3;  1NB3 I;  4XDW A;  3NUV A;  3LZA A;  1AR0 A;  3K63 A;  3CD6 3;  3WA2 X;  1FGQ A;  1OGZ A;  3FSD A;  1U5O A;  1Z1S A;  2CKF B;  3EQQ B;  4AEQ A;  2BHM A;  2W6J H;  4N3V A;  3DGN A;  4CDL A;  1Q86 4;  6STD A;  3BNB A;  2KCD A;  1RN7 A;  3I55 3;  2WOH A;  4O8S A;  2CWT A;  1YJ9 3;  1NWW A;  2P0X A;  1IT7 A;  1IV7 A;  3IPT A;  3MPH A;  3K0Z A;  3Q1C A;  5IG5 A;  1EKM A;  1FGO A;  1JB2 A;  3AMO A;  3LOY A;  2SBL A;  2CC3 A;  2CFK A;  4I4K A;  4HM5 B;  5EEO A;  1A2V A;  1DMQ A;  1QAK A;  2XF3 A;  1UW1 A;  3ER7 A;  2C11 A;  2OQE A;  3KSE D;  1YIT 3;  4BTY A;  1NDO B;  3G8Z A;  3B4P A;  3OWU A;  3H51 A;  4K61 A;  1DMM A;  4K1U A;  1A90 A;  2R4I A;  4LSO A;  2W56 B;  2WO0 A;  2QEX 3;  1JNQ A;  1FGR A;  2GBW B;  1Q42 A;  1IVX A;  1ZO2 A;  2HML B;  3DZL A;  4IT7 A;  1VQ4 3;  1IQX A;  3SED A;  4STD A;  1E3V A;  3N9H A;  3Q2P A;  4O02 B;  2WOF A;  3AMO B;  1OCV A;  3NQY A;  4H61 A;  4ZM8 A;  3B4O A;  2Z7A A;  3EC9 A;  5I97 A;  1IT8 A;  1W6G A;  3DGL A;  4OVM A;  3FF0 A;  3F8H A;  4R9K A;  3NM2 A;  5AIF A;  3V92 A;  2FXT A;  2GXF A;  2QGU A;  4EXR A;  1LVN A;  2PZV A;  3X3Y A;  4L8O A;  1ULJ B;  3FKA A;  3T0U A;  2W2C A;  3DM8 A;  2F98 A;  5IF6 A;  2IUJ A;  2BT3 A;  3K9M C;  5IG4 A;  8CHO A;  1EQK A;  3KE7 A;  4NRE A;  3S67 A;  1VQ6 3;  1LNH A;  3RDE A;  3A76 A;  1JB5 A;  2W0Q A;  2OQE C;  1TFO A;  3GAX A;  3OWS A;  1UI7 A;  2CWU A;  5STD A;  2B1X B;  2HMJ B;  1AV4 A;  1ISK A;  1E3R A;  1W6C A;  2CFD A;  2Z6B A;  3I0Y A;  1IVW A;  1OHS A;  3JUM A;  3FLJ A;  3FH1 A;  3EN8 A;  1N8R 4;  3JUN A;  1K9M 4;  4WWU C;  2FGT A;  3T8U A;  3F9S A;  4GB5 A;  3FG4 A;  2Y74 A;  4N6U A;  3X3X A;  1K73 4;  3WDG B;  5IW9 A;  3PCR A;  2XSH B;  1K8A 4;  1JB4 A;  3PXM A;  3FG3 A;  4O2H A;  1UI8 A;  2V1L A;  2ZL8 A;  2W04 A;  4R9L A;  1JKG A;  3HIG A;  4LMI A;  1J2B A;  3PGB A;  4IPB A;  3F8X A;  2KRT A;  2CG1 A;  1A67 A;  2F86 B;  2B24 B;  2W9P A;  1K28 A;  5AYR B;  3KN4 A;  3X40 A;  1ASK A;  1D6Z A;  3F40 A;  4MMZ B;  2K0M A;  1YIJ 3;  4HM2 B;  3MG1 A;  1Q40 A;  1SII A;  2P09 A;  1NJI 4;  1QAL A;  3FGY A;  3N54 B;  1FGM A;  2BNG A;  5JBS A;  3B8L A;  1MNL A;  1IDP A;  5FGO A;  2F99 A;  4HM7 B;  3T8N A;  3GWR A;  5FW5 A;  2HMM B;  5D81 A;  3G16 A;  1VQM 3;  4KZ1 A;  1VQK 3;  2XH9 A;  3ALA A;  2IUK A;  3NV0 A;  1BUQ A;  2CHC A;  3KSP A;  3NQZ A;  4ORL A;  1HU9 A;  2YFJ B;  3EBT A;  1RKY A;  3V98 A;  2LYX A;  1DYU A;  5ELU A;  1LOX A;  1WMO A;  4WYK B;  3HI7 A;  3JUP A;  4FCM A;  1DVD A;  4WYK A;  1KSI A;  1T5Y A;  3KFQ C;  1IQY A;  2CFL A;  1SJW A;  1FGT A;  4N6T A;  3NX0 A;  2Z76 A;  5IG0 A;  1UUV B;  2CG0 A;  4BTX A;  1S5A A;  2Z77 A;  4HM4 B;  3CNX A;  1M90 4;  4HM6 B;  5AIH A;  1PU4 A;  1YJN 3;  1W2Z A;  2Q07 A;  1UUW B;  1GD3 A;  2YFL B;  1TIJ A;  3BNC A;  2BO9 B;  2BMO B;  1RRL A;  4N6N B;  5DRE A;  7STD A;  1A2K A;  3CPO A;  2RSX A;  1YJW 3;  5HGR A;  3LTB A;  3F14 A;  4L8P A;  3DXO A;  1N9E A;  1GYB A;  2RGQ A;  3FF2 A;  2XSO B;  3JUQ A;  3WMD A;  1N5H A;  5IER A;  3H3H A;  2W03 A;  2D1W A;  1OUN A;  1W6Y A;  4AKZ A;  2OTJ 3;  3FZW A;  3SXX A;  3NM7 A;  1KQS 2;  2STD A;  5EQL A;  1NB5 I;  2GBX B;  3EN1 B;  4QWT A;  4XM4 A;  5CLK A;  3NBB A;  1SQW A;  3MYT A;  3LTD A;  3SVA A;  1JJ2 2;  3CU3 A;  2XEP A;  3JVC A;  2CH9 A;  3S5C A;  2XGL A;  2C10 A;  3CCV 3;  2OCT A;  4RNZ A;  4HM0 B;  2HMK B;  1SIH A;  3EX9 A;  3CCR 3;  4HZB B;  1KC8 4;  2XRX B;  5AEU B;  3MG2 A;  1O7H B;  1QAF A;  3M8C A;  1U8C B;  3EJV A;  1D6Y A;  1RJO A;  3CMA 3;  3RGA A;  1IU7 A;  1G96 A;  3JUO A;  1EA2 A;  1JN5 A;  1US1 A;  1RRH A;  4BTW A;  5CK6 A;  4FR9 A;  2XFT A;  1TUH A;  1N9J A;  3SX1 A;  2E2T A;  4JF8 A;  2KXG A;  2W9Q A;  3X3Z A;  1QJG A;  5JPU A;  3DY5 A;  1WMN A;  1ULI B;  3NBJ A;  3G71 3;  2FNQ A;  2OOV A;  4G1M B;  5KP1 A;  3FCS B;  3RGR A;  2LQV A;  3OX9 A;  4FMC A;  2Y73 A;  3CC2 3;  5AIG A;  2YFI B;  3EB8 A;  2RCD A;  4J8T A;  1Y4K A;  1Q81 4;  3UL6 A;  5IEN A;  2RFR A;  1KD1 4;  4WP5 A;  4X2H A;  3I56 3;  3WOD G;  1NO3 A;  1N8Q A;  1W5Z A;  1VZZ A;  3LXU X;  4HBR A;  4EC6 A;  4HJL B;  1R4C A;  4L7K A;  2ML6 A;  2CK3 H;  2A15 A;  3PYJ A;  2CWV A;  2XR8 B;  3IJE B;  1M9G A;  3ECF A;  3HK4 A;  3EE1 A;  3NXJ A;  1IK3 A;  3DGO A;  1O7M B;  1OF5 B;  5AEW B;  1IQ8 A;  3GZY B;  5AYS C;  1W01 A;  4K90 B;  2MC8 A;  4MMX B;  4Q53 A;  3CPW 2;  5A0O B;  3S27 A;  1K41 A;  4NHF A;  1IVV A;  4AKY A;  3MWZ A;  4XDV A;  1FUW A;  4KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...