1JN5A

Structural basis for the recognition of a nucleoporin fg-repeat by the ntf2-like domain of tap-p15 mrna export factor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
VDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords p15
publication title Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jn5A00
5DRVA 1WQLB 2BMRB 4ORLA 5AEUB 3K0ZA 5JPPA 4J8TA 3EBTA 1GY7A 2HMOB 4HM2B 4XDVA 5TGNA 5BVBA 1OGXA 2R4IA 3F8XA 4STDA 3OWSA 4R9LA 3NXJA 1NWWA 2K54A 1DMNA 3GZYB 1W6YA 1Q40A 2OWPA 1OH0A 2Z76A 1E3VA 1VZZA 2XRXB 2I9WA 4FCJA 4I4KA 5CLKA 4J9AA 4LGQA 4PEJA 4HZBB 2BMQB 4HJLB 4HM8B 4L7KA 3FKAA 1O7HB 2BMOB 3JUQA 4R9KA 4WYKA 3FZWA 4K1UA 1ULJB 1Q42A 1EG9B 1Q40B 3E99A 3F40A 5EVHA 3RGRA 3VSYA 3FLJA 2XSOB 3OV4A 3OX9A 1STDA 3EQQB 4HVNA 1O7WB 3FF2A 3H51A 3T8UA 4MJDA 3DMCA 4WYKB 1ZX2A 3NV0B 3B8LA 4WP5A 3ECFA 1IDPA 3JUNA 1JB5A 3KE7A 5D83A 4XB5A 3ER7A 3SEDA 4K1VA 1NU3A 3GZBA 3CU3A 3UJMA 3NUVA 5KP4A 1OHOA 5IG5A 4N3VA 3GWRA 5CK6A 5JPUA 4RZMA 4H3UA 3S5CA 2CHCA 5STDA 4KVHA 3B4OA 4Q53A 1W00A 1O7NB 2F86B 3BLZA 2YFLB 1GY6A 1NDOB 1ULIB 3G16A 3Q90A 4HKVB 5AI1A 2INXA 3EF8A 1GY5A 1E3RA 3B4PA 5CF1A 5BXQA 1E97A 1QMAA 3MG3A 3M8CA 2RGQA 3NHXA 3MHEA 3MSOA 1OUNA 3LYGA 4CDLA 3OXAA 5IEPA 4XBXA 2F98A 3DUKA 5IENA 4IIAA 5KP3A 2GEXA 1CQSA 4HM5B 3GZXB 2F99A 3A76A 1JKGA 1UUVB 4L8PA 1U5OA 1OHPA 1TUHA 3KZTA 5FW5A 5IERA 2GBXB 3B7CA 3EC9A 4XM4A 2QIYA 2GXFA 1C7HA 5HGRA 3STDA 4X2HA 1GS3A 3NM2A 5AIHA 2STDA 3HZPA 3EHCA 3KKGA 1OF5A 3DM8A 7STDA 8CHOA 4HM4B 3OWYA 1JKGB 4LEHA 1HKXA 3RGAA 1DMMA 3HK4A 1ASKA 3HX8A 3MKIA 3LZAA 4XBTA 4HM1B 3EN8A 2RFRA 3EBYA 1QJGA 2BNGA 5IF6A 2W2CA 4R1KA 2GBWB 2Z77A 5D81A 5AIGA 5KP1A 1JN5A 3G8ZA 1A2KA 3NBRA 5IG0A 2A15A 2PZVA 3KSPA 1Z1SA 2RCDA 3EX9A 3K7CA 1OPYA 5AEWB 1OCVA 3MG2A 5AIFA 2Z7AA 2CKFB 1S5AA 2UX0A 1TP6A 3EJVA 3FF0A 1W01A 1W02A 2HMMB 1JN5B 3CNMA 4WWUC 4HM0B 3I0YA 3UNLA 3VGNA 4HM6B 6STDA 4OVMA 4FCMA 4U13A 1DMQA 1JB2A 5G2GA 2JQ5A 5AIIA 4XDWA 1GYBA 5DREA 1UUWB 2B1XB 2HMNB 5IG3A 3FGYA 1O7PB 3DXOA 4L8OA 1BUQA 1EA2A 4X2OA 5D82A 3F8HA 4XBYA 3EN1B 3G0KA 3WMDA 3NV0A 5IEOA 3GZRA 3JUPA 3JUOA 2GEYA 2HMKB 2YFJB 2QGUA 3F7SA 3CNXA 4LMIA 1OHSA 3SOYA 2YFIB 4GB5A 1OGZA 1SJWA 3GRDA 3MYTA 5IG4A 2HMJB 1O7MB 4HM3B 1AR0A 3FSDA 3JUMA 2IMJA 1O7GB 3SOAA 1ISKA 3F7XA 3MG1A 2XSHB 5CXOA 3T8NA 1OF5B 4OUQA 3H3HA 3BB9A 2HMLB 2XR8B 3CPOA 3DZLA 1JB4A 3OWUA 3F9SA 3ROBA 2B24B 3FH1A 3D9RA 4HM7B 3F14A 1ZO2A 3IPTA 5CF2A 1K41A 4HZ9B
chains in the Genus database with same CATH superfamily
3FG4A 3Q3FA 1BRJA 1WQLB 2BMRB 4ORLA 1TRQA 5DRVA 5AEUB 3PZWA 1CYUA 2E2UA 1VQ83 3K0ZA 5JPPA 4EYCA 1VQM3 1BSBA 4CPKA 1STFI 2AAEA 1BRKA 1RGKA 4J8TA 2MF7A 1LNIA 3EBTA 4AKYA 1L5GB 2Z6BA 2LYXA 1GY7A 4LYLB 1UI7A 1M1K4 2HMOB 1NO3A 4HM2B 4KFFA 1Q7HA 2WGOA 4XDVA 4N6NB 5TGNA 4KFDA 5BVBA 1OGXA 4O2HA 3K5TA 2CG1A 2K3DA 2R4IA 3F8XA 4STDA 1UCLA 3OWSA 3KFQC 2W9PA 5ELJA 3Q1CA 1K9M4 3BIRA 1K28A 1BIRA 4R9LA 1T5YA 1YI23 3NXJA 1NWWA 3X3ZA 2K54A 2OQEA 3EE1A 4EC6A 4BTYA 1DMNA 1UGIA 3GZYB 3RDEA 1W6YA 1I8VA 1Q40A 2ML5A 2OWPA 1W2B2 3ZG0A 1OH0A 2Z76A 1UDII 1E3VA 1VZZA 1FGRA 2XRXB 1J2BA 1GMRA 3CCS3 1RMSA 2I9WA 4FCJA 4I4KA 1A2VA 3KSED 5CLKA 1VQO3 1GD4A 2CFLA 2QEX3 1SIIA 3AHSA 4J9AA 1CYVA 3A5EA 3X42A 4LGQA 2CX0A 2WO0A 1LOWA 4PEJA 3O8YA 4HZBB 1Q7Y4 3LH4A 1EUIC 2H0HA 3I563 2BMQB 3DGMA 4HJLB 4JRFA 4HM8B 4L7KA 3FKAA 1RGHA 4EXRA 1O7HB 2BMOB 3BNDA 1AVKA 1PFPA 2RSXA 5M18A 3DGLA 1VQ43 1VQ93 2YX9A 3JUQA 1RRLA 2KAAA 2BHMA 1VQL3 1X1XA 2Q07A 1K734 3LT8A 1PY3A 4R9KA 3QRDA 4WYKA 1B21A 1MWSA 3FZWA 4K1UA 4IT7A 1BU4A 2CX1A 1FGOA 1ULJB 1Q42A 2W56A 1FGMA 2XFSA 3HIGA 1EG9B 3UL6A 1Q40B 2D1WA 1IVWA 3E99A 3F40A 5EVHA 3FLJA 3RGRA 3VSYA 1R4YA 3J7Yd 2OTL3 2XSOB 2P0XA 3OV4A 5AYRB 1I0XA 2XGNA 3LMLA 2CWTA 3OX9A 5EQLA 1IVUA 1STDA 1YVSA 1SARA 3PGBA 2XF3A 2HOHA 1GOVA 2KXGA 3EQQB 1I3FA 2W9QA 3AGNA 4HVNA 5BIRA 2BO9B 3AHWA 1N8R4 1A90A 5LC6A 1RCLA 1JJ22 1BOXA 2IUJA 1O7WB 2CW9A 4HOHA 3WA3A 3FF2A 3H51A 2KF6A 1JNQA 1QVG2 3CCR3 3T8UA 4MJDA 1YNVX 2D42A 3CCU3 1BNSA 2E2VA 2F4YA 3CCL3 2W03A 1N8QA 1UCIA 1W6GA 3DMCA 3TDGA 1DETA 2P38A 5M1AA 3CC23 5G1LA 2ZDJA 1T3BA 2L4VA 3PXMA 4WYKB 1TFKA 1LRAA 1QAFA 2WOHA 1ZX2A 3NV0B 1VQ63 1MOLA 2W56B 2OQEC 3NBBA 2PNCA 3B8LA 4GSPA 4WP5A 3ECFA 3OW22 1IDPA 3NBJA 3X3YA 3JUNA 3S28A 1JB5A 3DY5A 3KE7A 2W0QA 4HAAA 3PCRA 5D83A 4XB5A 2Y73A 1BSDA 3ER7A 4IPBA 1BVIA 3V92A 3SEDA 4BIRA 1WMPA 3VF1A 1I2GA 1UCJA 2C11A 1RNBA 1ROVA 4K1VA 2KF3A 1NU3A 3KCHA 3GZBA 1CEWI 4N6OB 3CU3A 3UJMA 1BNGA 3NUVA 7GSPA 4N6LA 1OHOA 5KP4A 2UUGC 5IG5A 4N3VA 1RTUA 2W04A 3GWRA 1VQN3 4TX4A 5AYSC 3BNCA 4BTWA 1V57A 5CK6A 3S27A 3SX1A 1AV4A 2CWVA 1KSIA 5JPUA 4RZMA 4H3UA 3S5CA 4FR9A 1RN4A 1BNRA 2CHCA 3UB1A 1I70A 3SLUA 1YJN3 5STDA 1GSPA 4KVHA 4ILFA 5JBSA 1RSNA 3B4OA 4N6TA 4Q53A 1W00A 1O7NB 2F86B 3BLZA 1MGRA 3ZG5A 2BIRA 2YFLB 4K90B 3CMA3 1JBRA 1GY6A 3NQYA 3U1WA 1NDOB 3HIIA 1ULIB 1SQWA 1BSCA 3G16A 3LOYA 3Q90A 1LQMB 2H0GA 1W5ZA 4HKVB 5AI1A 1UCKA 2R41A 3G713 2INXA 1IK3A 3EF8A 1GOUA 1GY5A 2F5MA 3N9HA 3KIIA 1PYLA 3BU4A 2J8XB 1E3RA 3B4PA 1SIHA 1M9GA 3U97A 5CF1A 4OK0A 1YIT3 3X40A 1NNVA 4BU4A 3DGOA 3CCE3 1W7CA 5BXQA 2XEPA 2QA43 1E97A 1QMAA 1X1UA 3MG3A 2ZL8A 1WMOA 3IJEB 1A67A 3M8CA 2OCTA 1YJW3 1UI8A 1OACA 2KF5A 3K63A 2RGQA 3GSPA 4RBNA 1DVCA 3NHXA 3MHEA 1YGWA 3MSOA 3FG1A 1OUNA 2GU3A 1X1WA 3LYGA 1AVLA 4CDLA 1KQS2 4KFEA 1B2SA 3OXAA 4GHOA 4WFOA 1HU9A 1RJOA 2ZHXB 3CPW2 2CFKA 2F56A 2UGIA 5EEOA 5IEPA 3NX0A 4XBXA 2FNQA 1UW1A 3S67A 4NPBA 4LZIA 1D6YA 2F98A 3DUKA 3K9MC 5IENA 4IIAA 3D5IA 4MMZB 1BNEA 1JZDA 1CH0A 5KP3A 2CWUA 2GEXA 1CQSA 1QAKA 1RGEA 3GZXB 4HM5B 3X3XA 3CCV3 1Q824 1BRNL 1FUSA 2F99A 1N9EA 3G6E3 3A76A 1JKGA 1V58A 4O02B 7RNTA 1BUJA 1UUVB 3SXXA 3HI7A 1BAOA 4L8PA 3D4AA 1U5OA 3CXC2 2GSPA 4N6MA 1OHPA 4NREA 1TUHA 4G1MB 1UGHI 3T0UA 5ELUA 1N5HA 1FYSA 1QALA 2IUKA 1IYYA 3KZTA 1I2FA 3AGOA 5FW5A 5IERA 1Q814 2GBXB 2GU1A 2WOFA 3B7CA 3D79A 1G02A 3EC9A 1TJDA 2CK3H 4XM4A 2CFGA 4EV5A 3DH2A 5A0OB 3GAXA 2QIYA 2GXFA 1C7HA 1GD3A 1RGCA 5HGRA 1TU5A 4RNTA 1LQGC 3STDA 1WMNA 1DE3A 4X2HA 1GS3A 3NM2A 1RN7A 5AIHA 1IT7A 1UUGB 1T2HA 1JZOA 1LNHA 2STDA 3HZPA 2IY2A 3EHCA 1RGLA 2OTJ3 3KKGA 4O3VA 1TTOA 1OF5A 1B27A 1RRHA 3DM8A 1LXEA 3N8BA 2CFDA 1Y4KA 7STDA 4RNZA 4O8SA 1MNLA 8CHOA 4HM4B 3OWYA 4JF8A 5HOHA 3L0RA 3Q2PA 1JKGB 1IU7A 2CG0A 1HKXA 4LEHA 3RGAA 1DMMA 3HK4A 1KC84 1I0VA 1TIJA 1TFOA 3UL5A 1ASKA 1WTHA 3HX8A 3NQZA 1S723 2JDIH 1T2IA 1BANA 3MKIA 3LZAA 4XBTA 1RDSA 2C10A 4HM1B 1IV9A 1M1XB 4NHFA 3EN8A 1BRGA 1VQP3 1RNTA 1YJ93 1VQK3 2RFRA 3EBYA 2KF4A 1QJGA 3JVCA 2OOVA 1VQ73 1RKYA 1I2EA 2BNGA 4QWTA 1NB3I 3LTBA 4WHAA 1Q864 1JV2B 3I553 4FMDA 8RNTA 4EBGA 2IA7A 2F5WA 1LVNA 5LC7A 2W2CA 1US1A 4R1KA 5BU4A 1LOYA 2GBWB 2Z77A 3MWZA 5IF6A 1HZ1A 5D81A 1YGEA 3X41A 1B20A 1FGTA 5AIGA 5KP1A 1B2UA 1AQZA 1BGSA 2FGTA 2MC8A 3DGYA 1JN5A 1IVXA 2ML6A 1G0TA 1D6UA 1ZS7A 1W6CA 3G8ZA 4N6V0 3S29A 1RN1A 1B2MA 2FXTA 1N9JA 1IQXA 2SBLA 4N6UA 3SVAA 1A2KA 1W4NA 1GOYA 2AADA 1ZGXA 1TRPA 1VQ53 3NBRA 5IG0A 2A15A 6RNTA 2PZVA 1LOXA 5FGOA 3KSPA 2O3OA 4AEQA 1MWRA 3CME3 1Z1SA 2M7OA 3CD63 2XGLA 2RCDA 3EX9A 3K7CA 2CIUA 3WR2A 1OPYA 5AEWB 2KRTA 1RGFA 4J5GA 1OCVA 3MG2A 5AIFA 1KWIA 2Z7AA 1RCKA 1PU4A 2CKFB 5G1KA 1S5AA 3LTAA 3LTCA 1IV7A 2UX0A 1TP6A 3DGNA 3HOHA 4FMAA 2BT3A 2L1SA 3EJVA 4FCZA 1U8CB 3FF0A 3G4S3 1R4CA 2XH9A 1VQQA 2E2TA 2W6JH 1W01A 1W02A 1IQYA 1BRHA 2HMMB 3CC73 2LQVA 1JN5B 4KT3B 4EW5A 3RNTA 3CNMA 4RNYA 4WWUC 1DVDA 4HM0B 3EB8A 1YVBI 3I0YA 4FMCA 1I3IA 3ALAA 3UNLA 5RNTA 1Q9EA 1FA3A 4FMBA 4HM6B 1JRQA 3VGNA 4OVMA 4FCMA 4U13A 6STDA 1DMQA 3AMOA 4BTXA 2K0MA 2V1LA 1JB2A 1QVF2 3BNEA 2JQ5A 5G2GA 1DYUA 5AIIA 1BSEA 4MEIA 4XDWA 1GYBA 4CCVA 2C4BA 3LT9A 5DREA 1YHQ3 1UUWB 2B1XB 3FCSB 2HMNB 1KD14 2CFWA 2OOVC 2KCDA 4K61A 1N5PA 2RBIA 5IW9A 1X1YA 2WGQA 1JBSA 4BL2A 3LTDA 1AY7A 4HYZA 5IG3A 3FGYA 3V98A 1BRSA 1O7PB 3DXOA 2P05A 3V99A 3MPHA 4L8OA 1BUQA 1EA2A 4X2OA 5D82A 3F8HA 4XBYA 3EN1B 2XFTA 1G96A 3G0KA 3WMDA 3WDGB 1BRIA 2Y74A 1BNJA 1FGQA 1FW7A 3NV0A 3CCQ3 4HBRA 5IEOA 3GZRA 1IVVA 3WOEB 2CH9A 1RGAA 3BNBA 1V74A 5M19A 3ZFZA 1FUWA 3SYUA 1SPUA 1MGWA 3JUPA 3D3LA 3JUOA 2GEYA 3PYJA 2HMKB 2O9UX 3AMOB 3IMAB 4J5KA 3WODG 2IYJA 1EQKA 4H61A 2YFJB 1RHLA 2QGUA 1W2ZA 1YIJ3 4I5QA 3F7SA 1IQ8A 1GMQA 1A2PA 1NB5I 3CNXA 4LMIA 1EKMA 1B3SA 1OHSA 3SOYA 3KN4A 2YFIB 4R4KA 1EEJA 3D5GA 1WNHA 4GB5A 1OGZA 1B2XA 3CCJ3 1SJWA 1FZUA 3URPA 2SARA 1BSAA 3GRDA 2HMJB 3MYTA 1O7MB 5IG4A 3PS8A 4HM3B 1ROAA 1AR0A 1F8NA 3FSDA 4CJNA 3JUMA 4MMXB 2IMJA 1O7GB 2RNTA 3SOAA 3WHOA 4KZ1A 1ISKA 3NM7A 4AKZA 9RNTA 1HYFA 2CC3A 3F7XA 1LOVA 1BNFA 3MG1A 5GSPA 3CC43 2XSHB 4EV2A 1MWTA 4MMYB 5CXOA 2BU4A 2P0MA 1M904 3PCSA 3T8NA 3LXUX 1C54A 1OF5B 4GL6A 1BNIA 4OUQA 3CCM3 4DKIA 3H3HA 3FG3A 6GSPA 3WOFB 3BB9A 1IT8A 2H0IA 4ZM8A 5I97A 2HMLB 2XR8B 1MWUA 3CPOA 1JBTA 1K8A4 1NJI4 3DZLA 1FUTA 1B2ZA 1D6ZA 1JB4A 3OWUA 4BL3A 4R80A 3F9SA 1RLSA 3ROBA 1GMPA 3QK9A 2P09A 2B24B 3FH1A 3D9RA 4HM7B 1RGGA 3F14A 1ZO2A 2ZA4A 3IPTA 3WA2X 5CF2A 1K41A 3N54B 4LSOA 4HZ9B
chains in the Genus database with same CATH topology
3FG4A 5DRVA 1WQLB 2BMRB 4ORLA 5AEUB 3PZWA 1CYUA 2E2UA 1VQ83 3K0ZA 5JPPA 4EYCA 1VQM3 1STFI 4J8TA 2MF7A 3EBTA 4AKYA 1L5GB 2Z6BA 2LYXA 1GY7A 1UI7A 1M1K4 2HMOB 1NO3A 4HM2B 4KFFA 2WGOA 4XDVA 4N6NB 5TGNA 4KFDA 5BVBA 1OGXA 4O2HA 3K5TA 2CG1A 2R4IA 3F8XA 4STDA 3OWSA 3KFQC 2W9PA 5ELJA 3Q1CA 1K9M4 1K28A 4R9LA 1T5YA 1YI23 3NXJA 1NWWA 3X3ZA 2K54A 2OQEA 3EE1A 4EC6A 4BTYA 1DMNA 3RDEA 3GZYB 1W6YA 1Q40A 2ML5A 2OWPA 1W2B2 1OH0A 2Z76A 1E3VA 1VZZA 1FGRA 2XRXB 1J2BA 3CCS3 2I9WA 4FCJA 4I4KA 1A2VA 3KSED 5CLKA 1VQO3 1GD4A 2CFLA 2QEX3 1SIIA 4J9AA 1CYVA 3X42A 4LGQA 2WO0A 4PEJA 3O8YA 4HZBB 1Q7Y4 3LH4A 3I563 2BMQB 3DGMA 4HJLB 4JRFA 4HM8B 4L7KA 3FKAA 4EXRA 1O7HB 2BMOB 3BNDA 1AVKA 1PFPA 2RSXA 1VQ43 3DGLA 1VQ93 2YX9A 3JUQA 1RRLA 2BHMA 1VQL3 2Q07A 1K734 3LT8A 4R9KA 3QRDA 4WYKA 3FZWA 4K1UA 4IT7A 2W56A 2XFSA 1FGOA 1Q42A 1ULJB 1FGMA 3HIGA 1EG9B 3UL6A 1Q40B 2D1WA 1IVWA 3E99A 3F40A 5EVHA 3FLJA 3RGRA 3VSYA 3J7Yd 2OTL3 2XSOB 2P0XA 3OV4A 5AYRB 2XGNA 3LMLA 2CWTA 3OX9A 5EQLA 1IVUA 1STDA 3PGBA 2XF3A 2KXGA 3EQQB 2W9QA 4HVNA 2BO9B 1N8R4 1A90A 5LC6A 1JJ22 2IUJA 1O7WB 2CW9A 3WA3A 3FF2A 3H51A 1JNQA 1QVG2 3CCR3 3T8UA 4MJDA 2D42A 3CCU3 3CCL3 2E2VA 2W03A 1N8QA 1W6GA 3DMCA 3TDGA 2P38A 3CC23 2ZDJA 3PXMA 2L4VA 4WYKB 1TFKA 1QAFA 2WOHA 1ZX2A 3NV0B 1VQ63 1MOLA 2W56B 2OQEC 3NBBA 2PNCA 3B8LA 4WP5A 3ECFA 3OW22 1IDPA 3NBJA 3X3YA 3JUNA 3S28A 1JB5A 3DY5A 3KE7A 2W0QA 3PCRA 5D83A 4XB5A 2Y73A 3ER7A 4IPBA 3V92A 3SEDA 1WMPA 3VF1A 2C11A 1ROVA 4K1VA 1NU3A 3GZBA 1CEWI 4N6OB 3CU3A 3UJMA 3NUVA 5KP4A 4N6LA 1OHOA 5IG5A 4N3VA 2W04A 3GWRA 1VQN3 4TX4A 5AYSC 3BNCA 4BTWA 5CK6A 3S27A 3SX1A 1AV4A 2CWVA 1KSIA 5JPUA 4RZMA 4H3UA 3S5CA 4FR9A 2CHCA 3UB1A 3SLUA 1YJN3 5STDA 4KVHA 5JBSA 3B4OA 4N6TA 4Q53A 1W00A 1O7NB 2F86B 3BLZA 4K90B 2YFLB 3CMA3 1GY6A 3NQYA 3U1WA 1NDOB 3HIIA 1ULIB 1SQWA 3LOYA 3G16A 3Q90A 1W5ZA 4HKVB 5AI1A 3G713 2INXA 1IK3A 3EF8A 1GY5A 3N9HA 3KIIA 1E3RA 3B4PA 1SIHA 1M9GA 3U97A 5CF1A 4OK0A 1YIT3 3X40A 3DGOA 3CCE3 1W7CA 5BXQA 2XEPA 2QA43 1E97A 1QMAA 3MG3A 2ZL8A 1WMOA 3IJEB 1A67A 3M8CA 2OCTA 1YJW3 1UI8A 1OACA 3K63A 4RBNA 2RGQA 1DVCA 3NHXA 3MHEA 3MSOA 3FG1A 1OUNA 2GU3A 3LYGA 1AVLA 4CDLA 1KQS2 4KFEA 3OXAA 4WFOA 1HU9A 1RJOA 3CPW2 2CFKA 5EEOA 5IEPA 3NX0A 4XBXA 2FNQA 1UW1A 3S67A 4LZIA 1D6YA 2F98A 3DUKA 3K9MC 5IENA 4IIAA 4MMZB 5KP3A 2CWUA 2GEXA 1CQSA 1QAKA 3GZXB 4HM5B 3X3XA 3CCV3 1Q824 2F99A 1N9EA 3G6E3 3A76A 1JKGA 4O02B 1UUVB 3SXXA 3HI7A 4L8PA 1U5OA 3CXC2 4N6MA 1OHPA 4NREA 1TUHA 4G1MB 3T0UA 5ELUA 1N5HA 1QALA 2IUKA 3KZTA 5FW5A 5IERA 1Q814 2GBXB 2GU1A 2WOFA 3B7CA 3EC9A 2CK3H 4XM4A 2CFGA 4EV5A 5A0OB 3GAXA 2QIYA 2GXFA 1C7HA 1GD3A 5HGRA 1TU5A 3STDA 1WMNA 4X2HA 1GS3A 3NM2A 1RN7A 5AIHA 1IT7A 2STDA 3HZPA 1LNHA 3EHCA 2OTJ3 3KKGA 4O3VA 1OF5A 1RRHA 3DM8A 1LXEA 3N8BA 2CFDA 1Y4KA 7STDA 4RNZA 4O8SA 1MNLA 8CHOA 4HM4B 3OWYA 4JF8A 3L0RA 3Q2PA 1JKGB 1IU7A 2CG0A 1HKXA 4LEHA 3RGAA 1DMMA 3HK4A 1KC84 1TIJA 1TFOA 3UL5A 1ASKA 1WTHA 3HX8A 3NQZA 1S723 2JDIH 3MKIA 3LZAA 4XBTA 4HM1B 2C10A 1IV9A 1M1XB 4NHFA 3EN8A 1VQP3 1YJ93 1VQK3 2RFRA 3EBYA 1QJGA 3JVCA 2OOVA 1VQ73 1RKYA 2BNGA 4QWTA 1NB3I 3LTBA 4WHAA 1Q864 1JV2B 3I553 4FMDA 4EBGA 2IA7A 1LVNA 5LC7A 2W2CA 1US1A 4R1KA 5IF6A 2GBWB 2Z77A 3MWZA 5D81A 1YGEA 3X41A 1FGTA 5AIGA 5KP1A 2FGTA 2MC8A 4N6V0 1JN5A 1IVXA 2ML6A 1W6CA 1D6UA 3G8ZA 3S29A 2FXTA 1N9JA 2SBLA 1IQXA 4N6UA 3SVAA 1A2KA 1W4NA 1VQ53 3NBRA 5IG0A 2A15A 2PZVA 1LOXA 5FGOA 3KSPA 2O3OA 4AEQA 3CME3 1Z1SA 2M7OA 3CD63 2XGLA 2RCDA 3EX9A 3K7CA 2CIUA 1OPYA 5AEWB 2KRTA 1OCVA 3MG2A 5AIFA 1KWIA 2Z7AA 1PU4A 2CKFB 1S5AA 3LTAA 3LTCA 1IV7A 2UX0A 1TP6A 3DGNA 4FMAA 2BT3A 3EJVA 4FCZA 1U8CB 3FF0A 3G4S3 1R4CA 2XH9A 2E2TA 2W6JH 1W01A 1W02A 1IQYA 2HMMB 3CC73 2LQVA 1JN5B 3CNMA 4RNYA 4WWUC 1DVDA 4HM0B 3EB8A 1YVBI 3I0YA 4FMCA 3ALAA 3UNLA 1FA3A 4FMBA 4HM6B 1JRQA 3VGNA 4OVMA 4FCMA 4U13A 6STDA 1DMQA 3AMOA 4BTXA 2K0MA 2V1LA 1JB2A 1QVF2 3BNEA 2JQ5A 5G2GA 1DYUA 5AIIA 4MEIA 4XDWA 1GYBA 4CCVA 3LT9A 5DREA 1YHQ3 1UUWB 2B1XB 3FCSB 2HMNB 1KD14 2CFWA 2OOVC 2KCDA 4K61A 1N5PA 5IW9A 2WGQA 3LTDA 5IG3A 4HYZA 3FGYA 3V98A 1O7PB 3DXOA 2P05A 3V99A 3MPHA 4L8OA 1BUQA 1EA2A 4X2OA 5D82A 3F8HA 4XBYA 3EN1B 2XFTA 1G96A 3G0KA 3WMDA 3WDGB 2Y74A 1FGQA 3NV0A 3CCQ3 4HBRA 5IEOA 3GZRA 1IVVA 3WOEB 2CH9A 3BNBA 1V74A 1FUWA 1SPUA 3JUPA 3D3LA 3JUOA 2GEYA 3PYJA 2HMKB 2O9UX 3AMOB 3IMAB 3WODG 1EQKA 4H61A 2YFJB 2QGUA 1W2ZA 1YIJ3 3F7SA 1IQ8A 1NB5I 3CNXA 4LMIA 1EKMA 1OHSA 3SOYA 3KN4A 2YFIB 4R4KA 1WNHA 4GB5A 1OGZA 3CCJ3 1SJWA 3GRDA 3MYTA 5IG4A 2HMJB 1O7MB 3PS8A 4HM3B 1ROAA 1AR0A 1F8NA 3FSDA 3JUMA 4MMXB 2IMJA 1O7GB 3SOAA 4KZ1A 1ISKA 3NM7A 4AKZA 2CC3A 3F7XA 3MG1A 3CC43 2XSHB 4EV2A 4MMYB 5CXOA 2P0MA 1M904 3PCSA 3T8NA 3LXUX 1OF5B 4GL6A 4OUQA 3CCM3 3H3HA 3FG3A 3WOFB 3BB9A 1IT8A 4ZM8A 5I97A 2HMLB 2XR8B 3CPOA 1K8A4 1NJI4 3DZLA 1D6ZA 1JB4A 3OWUA 4R80A 3F9SA 3ROBA 3QK9A 2P09A 2B24B 3FH1A 3D9RA 4HM7B 3F14A 1ZO2A 3IPTA 3WA2X 5CF2A 1K41A 3N54B 4LSOA 4HZ9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DRV A;  1WQL B;  2BMR B;  4ORL A;  5AEU B;  3K0Z A;  5JPP A;  4J8T A;  3EBT A;  1GY7 A;  2HMO B;  4HM2 B;  4XDV A;  5TGN A;  5BVB A;  1OGX A;  2R4I A;  3F8X A;  4STD A;  3OWS A;  4R9L A;  3NXJ A;  1NWW A;  2K54 A;  1DMN A;  3GZY B;  1W6Y A;  1Q40 A;  2OWP A;  1OH0 A;  2Z76 A;  1E3V A;  1VZZ A;  2XRX B;  2I9W A;  4FCJ A;  4I4K A;  5CLK A;  4J9A A;  4LGQ A;  4PEJ A;  4HZB B;  2BMQ B;  4HJL B;  4HM8 B;  4L7K A;  3FKA A;  1O7H B;  2BMO B;  3JUQ A;  4R9K A;  4WYK A;  3FZW A;  4K1U A;  1ULJ B;  1Q42 A;  1EG9 B;  1Q40 B;  3E99 A;  3F40 A;  5EVH A;  3RGR A;  3VSY A;  3FLJ A;  2XSO B;  3OV4 A;  3OX9 A;  1STD A;  3EQQ B;  4HVN A;  1O7W B;  3FF2 A;  3H51 A;  3T8U A;  4MJD A;  3DMC A;  4WYK B;  1ZX2 A;  3NV0 B;  3B8L A;  4WP5 A;  3ECF A;  1IDP A;  3JUN A;  1JB5 A;  3KE7 A;  5D83 A;  4XB5 A;  3ER7 A;  3SED A;  4K1V A;  1NU3 A;  3GZB A;  3CU3 A;  3UJM A;  3NUV A;  5KP4 A;  1OHO A;  5IG5 A;  4N3V A;  3GWR A;  5CK6 A;  5JPU A;  4RZM A;  4H3U A;  3S5C A;  2CHC A;  5STD A;  4KVH A;  3B4O A;  4Q53 A;  1W00 A;  1O7N B;  2F86 B;  3BLZ A;  2YFL B;  1GY6 A;  1NDO B;  1ULI B;  3G16 A;  3Q90 A;  4HKV B;  5AI1 A;  2INX A;  3EF8 A;  1GY5 A;  1E3R A;  3B4P A;  5CF1 A;  5BXQ A;  1E97 A;  1QMA A;  3MG3 A;  3M8C A;  2RGQ A;  3NHX A;  3MHE A;  3MSO A;  1OUN A;  3LYG A;  4CDL A;  3OXA A;  5IEP A;  4XBX A;  2F98 A;  3DUK A;  5IEN A;  4IIA A;  5KP3 A;  2GEX A;  1CQS A;  4HM5 B;  3GZX B;  2F99 A;  3A76 A;  1JKG A;  1UUV B;  4L8P A;  1U5O A;  1OHP A;  1TUH A;  3KZT A;  5FW5 A;  5IER A;  2GBX B;  3B7C A;  3EC9 A;  4XM4 A;  2QIY A;  2GXF A;  1C7H A;  5HGR A;  3STD A;  4X2H A;  1GS3 A;  3NM2 A;  5AIH A;  2STD A;  3HZP A;  3EHC A;  3KKG A;  1OF5 A;  3DM8 A;  7STD A;  8CHO A;  4HM4 B;  3OWY A;  1JKG B;  4LEH A;  1HKX A;  3RGA A;  1DMM A;  3HK4 A;  1ASK A;  3HX8 A;  3MKI A;  3LZA A;  4XBT A;  4HM1 B;  3EN8 A;  2RFR A;  3EBY A;  1QJG A;  2BNG A;  5IF6 A;  2W2C A;  4R1K A;  2GBW B;  2Z77 A;  5D81 A;  5AIG A;  5KP1 A;  1JN5 A;  3G8Z A;  1A2K A;  3NBR A;  5IG0 A;  2A15 A;  2PZV A;  3KSP A;  1Z1S A;  2RCD A;  3EX9 A;  3K7C A;  1OPY A;  5AEW B;  1OCV A;  3MG2 A;  5AIF A;  2Z7A A;  2CKF B;  1S5A A;  2UX0 A;  1TP6 A;  3EJV A;  3FF0 A;  1W01 A;  1W02 A;  2HMM B;  1JN5 B;  3CNM A;  4WWU C;  4HM0 B;  3I0Y A;  3UNL A;  3VGN A;  4HM6 B;  6STD A;  4OVM A;  4FCM A;  4U13 A;  1DMQ A;  1JB2 A;  5G2G A;  2JQ5 A;  5AII A;  4XDW A;  1GYB A;  5DRE A;  1UUW B;  2B1X B;  2HMN B;  5IG3 A;  3FGY A;  1O7P B;  3DXO A;  4L8O A;  1BUQ A;  1EA2 A;  4X2O A;  5D82 A;  3F8H A;  4XBY A;  3EN1 B;  3G0K A;  3WMD A;  3NV0 A;  5IEO A;  3GZR A;  3JUP A;  3JUO A;  2GEY A;  2HMK B;  2YFJ B;  2QGU A;  3F7S A;  3CNX A;  4LMI A;  1OHS A;  3SOY A;  2YFI B;  4GB5 A;  1OGZ A;  1SJW A;  3GRD A;  3MYT A;  5IG4 A;  2HMJ B;  1O7M B;  4HM3 B;  1AR0 A;  3FSD A;  3JUM A;  2IMJ A;  1O7G B;  3SOA A;  1ISK A;  3F7X A;  3MG1 A;  2XSH B;  5CXO A;  3T8N A;  1OF5 B;  4OUQ A;  3H3H A;  3BB9 A;  2HML B;  2XR8 B;  3CPO A;  3DZL A;  1JB4 A;  3OWU A;  3F9S A;  3ROB A;  2B24 B;  3FH1 A;  3D9R A;  4HM7 B;  3F14 A;  1ZO2 A;  3IPT A;  5CF2 A;  1K41 A;  4HZ9 B; 
#chains in the Genus database with same CATH topology
 3FG4 A;  3Q3F A;  1BRJ A;  1WQL B;  2BMR B;  4ORL A;  1TRQ A;  5DRV A;  5AEU B;  3PZW A;  1CYU A;  2E2U A;  1VQ8 3;  3K0Z A;  5JPP A;  4EYC A;  1VQM 3;  1BSB A;  4CPK A;  1STF I;  2AAE A;  1BRK A;  1RGK A;  4J8T A;  2MF7 A;  1LNI A;  3EBT A;  4AKY A;  1L5G B;  2Z6B A;  2LYX A;  1GY7 A;  4LYL B;  1UI7 A;  1M1K 4;  2HMO B;  1NO3 A;  4HM2 B;  4KFF A;  1Q7H A;  2WGO A;  4XDV A;  4N6N B;  5TGN A;  4KFD A;  5BVB A;  1OGX A;  4O2H A;  3K5T A;  2CG1 A;  2K3D A;  2R4I A;  3F8X A;  4STD A;  1UCL A;  3OWS A;  3KFQ C;  2W9P A;  5ELJ A;  3Q1C A;  1K9M 4;  3BIR A;  1K28 A;  1BIR A;  4R9L A;  1T5Y A;  1YI2 3;  3NXJ A;  1NWW A;  3X3Z A;  2K54 A;  2OQE A;  3EE1 A;  4EC6 A;  4BTY A;  1DMN A;  1UGI A;  3GZY B;  3RDE A;  1W6Y A;  1I8V A;  1Q40 A;  2ML5 A;  2OWP A;  1W2B 2;  3ZG0 A;  1OH0 A;  2Z76 A;  1UDI I;  1E3V A;  1VZZ A;  1FGR A;  2XRX B;  1J2B A;  1GMR A;  3CCS 3;  1RMS A;  2I9W A;  4FCJ A;  4I4K A;  1A2V A;  3KSE D;  5CLK A;  1VQO 3;  1GD4 A;  2CFL A;  2QEX 3;  1SII A;  3AHS A;  4J9A A;  1CYV A;  3A5E A;  3X42 A;  4LGQ A;  2CX0 A;  2WO0 A;  1LOW A;  4PEJ A;  3O8Y A;  4HZB B;  1Q7Y 4;  3LH4 A;  1EUI C;  2H0H A;  3I56 3;  2BMQ B;  3DGM A;  4HJL B;  4JRF A;  4HM8 B;  4L7K A;  3FKA A;  1RGH A;  4EXR A;  1O7H B;  2BMO B;  3BND A;  1AVK A;  1PFP A;  2RSX A;  5M18 A;  3DGL A;  1VQ4 3;  1VQ9 3;  2YX9 A;  3JUQ A;  1RRL A;  2KAA A;  2BHM A;  1VQL 3;  1X1X A;  2Q07 A;  1K73 4;  3LT8 A;  1PY3 A;  4R9K A;  3QRD A;  4WYK A;  1B21 A;  1MWS A;  3FZW A;  4K1U A;  4IT7 A;  1BU4 A;  2CX1 A;  1FGO A;  1ULJ B;  1Q42 A;  2W56 A;  1FGM A;  2XFS A;  3HIG A;  1EG9 B;  3UL6 A;  1Q40 B;  2D1W A;  1IVW A;  3E99 A;  3F40 A;  5EVH A;  3FLJ A;  3RGR A;  3VSY A;  1R4Y A;  3J7Y d;  2OTL 3;  2XSO B;  2P0X A;  3OV4 A;  5AYR B;  1I0X A;  2XGN A;  3LML A;  2CWT A;  3OX9 A;  5EQL A;  1IVU A;  1STD A;  1YVS A;  1SAR A;  3PGB A;  2XF3 A;  2HOH A;  1GOV A;  2KXG A;  3EQQ B;  1I3F A;  2W9Q A;  3AGN A;  4HVN A;  5BIR A;  2BO9 B;  3AHW A;  1N8R 4;  1A90 A;  5LC6 A;  1RCL A;  1JJ2 2;  1BOX A;  2IUJ A;  1O7W B;  2CW9 A;  4HOH A;  3WA3 A;  3FF2 A;  3H51 A;  2KF6 A;  1JNQ A;  1QVG 2;  3CCR 3;  3T8U A;  4MJD A;  1YNV X;  2D42 A;  3CCU 3;  1BNS A;  2E2V A;  2F4Y A;  3CCL 3;  2W03 A;  1N8Q A;  1UCI A;  1W6G A;  3DMC A;  3TDG A;  1DET A;  2P38 A;  5M1A A;  3CC2 3;  5G1L A;  2ZDJ A;  1T3B A;  2L4V A;  3PXM A;  4WYK B;  1TFK A;  1LRA A;  1QAF A;  2WOH A;  1ZX2 A;  3NV0 B;  1VQ6 3;  1MOL A;  2W56 B;  2OQE C;  3NBB A;  2PNC A;  3B8L A;  4GSP A;  4WP5 A;  3ECF A;  3OW2 2;  1IDP A;  3NBJ A;  3X3Y A;  3JUN A;  3S28 A;  1JB5 A;  3DY5 A;  3KE7 A;  2W0Q A;  4HAA A;  3PCR A;  5D83 A;  4XB5 A;  2Y73 A;  1BSD A;  3ER7 A;  4IPB A;  1BVI A;  3V92 A;  3SED A;  4BIR A;  1WMP A;  3VF1 A;  1I2G A;  1UCJ A;  2C11 A;  1RNB A;  1ROV A;  4K1V A;  2KF3 A;  1NU3 A;  3KCH A;  3GZB A;  1CEW I;  4N6O B;  3CU3 A;  3UJM A;  1BNG A;  3NUV A;  7GSP A;  4N6L A;  1OHO A;  5KP4 A;  2UUG C;  5IG5 A;  4N3V A;  1RTU A;  2W04 A;  3GWR A;  1VQN 3;  4TX4 A;  5AYS C;  3BNC A;  4BTW A;  1V57 A;  5CK6 A;  3S27 A;  3SX1 A;  1AV4 A;  2CWV A;  1KSI A;  5JPU A;  4RZM A;  4H3U A;  3S5C A;  4FR9 A;  1RN4 A;  1BNR A;  2CHC A;  3UB1 A;  1I70 A;  3SLU A;  1YJN 3;  5STD A;  1GSP A;  4KVH A;  4ILF A;  5JBS A;  1RSN A;  3B4O A;  4N6T A;  4Q53 A;  1W00 A;  1O7N B;  2F86 B;  3BLZ A;  1MGR A;  3ZG5 A;  2BIR A;  2YFL B;  4K90 B;  3CMA 3;  1JBR A;  1GY6 A;  3NQY A;  3U1W A;  1NDO B;  3HII A;  1ULI B;  1SQW A;  1BSC A;  3G16 A;  3LOY A;  3Q90 A;  1LQM B;  2H0G A;  1W5Z A;  4HKV B;  5AI1 A;  1UCK A;  2R41 A;  3G71 3;  2INX A;  1IK3 A;  3EF8 A;  1GOU A;  1GY5 A;  2F5M A;  3N9H A;  3KII A;  1PYL A;  3BU4 A;  2J8X B;  1E3R A;  3B4P A;  1SIH A;  1M9G A;  3U97 A;  5CF1 A;  4OK0 A;  1YIT 3;  3X40 A;  1NNV A;  4BU4 A;  3DGO A;  3CCE 3;  1W7C A;  5BXQ A;  2XEP A;  2QA4 3;  1E97 A;  1QMA A;  1X1U A;  3MG3 A;  2ZL8 A;  1WMO A;  3IJE B;  1A67 A;  3M8C A;  2OCT A;  1YJW 3;  1UI8 A;  1OAC A;  2KF5 A;  3K63 A;  2RGQ A;  3GSP A;  4RBN A;  1DVC A;  3NHX A;  3MHE A;  1YGW A;  3MSO A;  3FG1 A;  1OUN A;  2GU3 A;  1X1W A;  3LYG A;  1AVL A;  4CDL A;  1KQS 2;  4KFE A;  1B2S A;  3OXA A;  4GHO A;  4WFO A;  1HU9 A;  1RJO A;  2ZHX B;  3CPW 2;  2CFK A;  2F56 A;  2UGI A;  5EEO A;  5IEP A;  3NX0 A;  4XBX A;  2FNQ A;  1UW1 A;  3S67 A;  4NPB A;  4LZI A;  1D6Y A;  2F98 A;  3DUK A;  3K9M C;  5IEN A;  4IIA A;  3D5I A;  4MMZ B;  1BNE A;  1JZD A;  1CH0 A;  5KP3 A;  2CWU A;  2GEX A;  1CQS A;  1QAK A;  1RGE A;  3GZX B;  4HM5 B;  3X3X A;  3CCV 3;  1Q82 4;  1BRN L;  1FUS A;  2F99 A;  1N9E A;  3G6E 3;  3A76 A;  1JKG A;  1V58 A;  4O02 B;  7RNT A;  1BUJ A;  1UUV B;  3SXX A;  3HI7 A;  1BAO A;  4L8P A;  3D4A A;  1U5O A;  3CXC 2;  2GSP A;  4N6M A;  1OHP A;  4NRE A;  1TUH A;  4G1M B;  1UGH I;  3T0U A;  5ELU A;  1N5H A;  1FYS A;  1QAL A;  2IUK A;  1IYY A;  3KZT A;  1I2F A;  3AGO A;  5FW5 A;  5IER A;  1Q81 4;  2GBX B;  2GU1 A;  2WOF A;  3B7C A;  3D79 A;  1G02 A;  3EC9 A;  1TJD A;  2CK3 H;  4XM4 A;  2CFG A;  4EV5 A;  3DH2 A;  5A0O B;  3GAX A;  2QIY A;  2GXF A;  1C7H A;  1GD3 A;  1RGC A;  5HGR A;  1TU5 A;  4RNT A;  1LQG C;  3STD A;  1WMN A;  1DE3 A;  4X2H A;  1GS3 A;  3NM2 A;  1RN7 A;  5AIH A;  1IT7 A;  1UUG B;  1T2H A;  1JZO A;  1LNH A;  2STD A;  3HZP A;  2IY2 A;  3EHC A;  1RGL A;  2OTJ 3;  3KKG A;  4O3V A;  1TTO A;  1OF5 A;  1B27 A;  1RRH A;  3DM8 A;  1LXE A;  3N8B A;  2CFD A;  1Y4K A;  7STD A;  4RNZ A;  4O8S A;  1MNL A;  8CHO A;  4HM4 B;  3OWY A;  4JF8 A;  5HOH A;  3L0R A;  3Q2P A;  1JKG B;  1IU7 A;  2CG0 A;  1HKX A;  4LEH A;  3RGA A;  1DMM A;  3HK4 A;  1KC8 4;  1I0V A;  1TIJ A;  1TFO A;  3UL5 A;  1ASK A;  1WTH A;  3HX8 A;  3NQZ A;  1S72 3;  2JDI H;  1T2I A;  1BAN A;  3MKI A;  3LZA A;  4XBT A;  1RDS A;  2C10 A;  4HM1 B;  1IV9 A;  1M1X B;  4NHF A;  3EN8 A;  1BRG A;  1VQP 3;  1RNT A;  1YJ9 3;  1VQK 3;  2RFR A;  3EBY A;  2KF4 A;  1QJG A;  3JVC A;  2OOV A;  1VQ7 3;  1RKY A;  1I2E A;  2BNG A;  4QWT A;  1NB3 I;  3LTB A;  4WHA A;  1Q86 4;  1JV2 B;  3I55 3;  4FMD A;  8RNT A;  4EBG A;  2IA7 A;  2F5W A;  1LVN A;  5LC7 A;  2W2C A;  1US1 A;  4R1K A;  5BU4 A;  1LOY A;  2GBW B;  2Z77 A;  3MWZ A;  5IF6 A;  1HZ1 A;  5D81 A;  1YGE A;  3X41 A;  1B20 A;  1FGT A;  5AIG A;  5KP1 A;  1B2U A;  1AQZ A;  1BGS A;  2FGT A;  2MC8 A;  3DGY A;  1JN5 A;  1IVX A;  2ML6 A;  1G0T A;  1D6U A;  1ZS7 A;  1W6C A;  3G8Z A;  4N6V 0;  3S29 A;  1RN1 A;  1B2M A;  2FXT A;  1N9J A;  1IQX A;  2SBL A;  4N6U A;  3SVA A;  1A2K A;  1W4N A;  1GOY A;  2AAD A;  1ZGX A;  1TRP A;  1VQ5 3;  3NBR A;  5IG0 A;  2A15 A;  6RNT A;  2PZV A;  1LOX A;  5FGO A;  3KSP A;  2O3O A;  4AEQ A;  1MWR A;  3CME 3;  1Z1S A;  2M7O A;  3CD6 3;  2XGL A;  2RCD A;  3EX9 A;  3K7C A;  2CIU A;  3WR2 A;  1OPY A;  5AEW B;  2KRT A;  1RGF A;  4J5G A;  1OCV A;  3MG2 A;  5AIF A;  1KWI A;  2Z7A A;  1RCK A;  1PU4 A;  2CKF B;  5G1K A;  1S5A A;  3LTA A;  3LTC A;  1IV7 A;  2UX0 A;  1TP6 A;  3DGN A;  3HOH A;  4FMA A;  2BT3 A;  2L1S A;  3EJV A;  4FCZ A;  1U8C B;  3FF0 A;  3G4S 3;  1R4C A;  2XH9 A;  1VQQ A;  2E2T A;  2W6J H;  1W01 A;  1W02 A;  1IQY A;  1BRH A;  2HMM B;  3CC7 3;  2LQV A;  1JN5 B;  4KT3 B;  4EW5 A;  3RNT A;  3CNM A;  4RNY A;  4WWU C;  1DVD A;  4HM0 B;  3EB8 A;  1YVB I;  3I0Y A;  4FMC A;  1I3I A;  3ALA A;  3UNL A;  5RNT A;  1Q9E A;  1FA3 A;  4FMB A;  4HM6 B;  1JRQ A;  3VGN A;  4OVM A;  4FCM A;  4U13 A;  6STD A;  1DMQ A;  3AMO A;  4BTX A;  2K0M A;  2V1L A;  1JB2 A;  1QVF 2;  3BNE A;  2JQ5 A;  5G2G A;  1DYU A;  5AII A;  1BSE A;  4MEI A;  4XDW A;  1GYB A;  4CCV A;  2C4B A;  3LT9 A;  5DRE A;  1YHQ 3;  1UUW B;  2B1X B;  3FCS B;  2HMN B;  1KD1 4;  2CFW A;  2OOV C;  2KCD A;  4K61 A;  1N5P A;  2RBI A;  5IW9 A;  1X1Y A;  2WGQ A;  1JBS A;  4BL2 A;  3LTD A;  1AY7 A;  4HYZ A;  5IG3 A;  3FGY A;  3V98 A;  1BRS A;  1O7P B;  3DXO A;  2P05 A;  3V99 A;  3MPH A;  4L8O A;  1BUQ A;  1EA2 A;  4X2O A;  5D82 A;  3F8H A;  4XBY A;  3EN1 B;  2XFT A;  1G96 A;  3G0K A;  3WMD A;  3WDG B;  1BRI A;  2Y74 A;  1BNJ A;  1FGQ A;  1FW7 A;  3NV0 A;  3CCQ 3;  4HBR A;  5IEO A;  3GZR A;  1IVV A;  3WOE B;  2CH9 A;  1RGA A;  3BNB A;  1V74 A;  5M19 A;  3ZFZ A;  1FUW A;  3SYU A;  1SPU A;  1MGW A;  3JUP A;  3D3L A;  3JUO A;  2GEY A;  3PYJ A;  2HMK B;  2O9U X;  3AMO B;  3IMA B;  4J5K A;  3WOD G;  2IYJ A;  1EQK A;  4H61 A;  2YFJ B;  1RHL A;  2QGU A;  1W2Z A;  1YIJ 3;  4I5Q A;  3F7S A;  1IQ8 A;  1GMQ A;  1A2P A;  1NB5 I;  3CNX A;  4LMI A;  1EKM A;  1B3S A;  1OHS A;  3SOY A;  3KN4 A;  2YFI B;  4R4K A;  1EEJ A;  3D5G A;  1WNH A;  4GB5 A;  1OGZ A;  1B2X A;  3CCJ 3;  1SJW A;  1FZU A;  3URP A;  2SAR A;  1BSA A;  3GRD A;  2HMJ B;  3MYT A;  1O7M B;  5IG4 A;  3PS8 A;  4HM3 B;  1ROA A;  1AR0 A;  1F8N A;  3FSD A;  4CJN A;  3JUM A;  4MMX B;  2IMJ A;  1O7G B;  2RNT A;  3SOA A;  3WHO A;  4KZ1 A;  1ISK A;  3NM7 A;  4AKZ A;  9RNT A;  1HYF A;  2CC3 A;  3F7X A;  1LOV A;  1BNF A;  3MG1 A;  5GSP A;  3CC4 3;  2XSH B;  4EV2 A;  1MWT A;  4MMY B;  5CXO A;  2BU4 A;  2P0M A;  1M90 4;  3PCS A;  3T8N A;  3LXU X;  1C54 A;  1OF5 B;  4GL6 A;  1BNI A;  4OUQ A;  3CCM 3;  4DKI A;  3H3H A;  3FG3 A;  6GSP A;  3WOF B;  3BB9 A;  1IT8 A;  2H0I A;  4ZM8 A;  5I97 A;  2HML B;  2XR8 B;  1MWU A;  3CPO A;  1JBT A;  1K8A 4;  1NJI 4;  3DZL A;  1FUT A;  1B2Z A;  1D6Z A;  1JB4 A;  3OWU A;  4BL3 A;  4R80 A;  3F9S A;  1RLS A;  3ROB A;  1GMP A;  3QK9 A;  2P09 A;  2B24 B;  3FH1 A;  3D9R A;  4HM7 B;  1RGG A;  3F14 A;  1ZO2 A;  2ZA4 A;  3IPT A;  3WA2 X;  5CF2 A;  1K41 A;  3N54 B;  4LSO A;  4HZ9 B; 
#chains in the Genus database with same CATH homology
 3FG4 A;  5DRV A;  1WQL B;  2BMR B;  4ORL A;  5AEU B;  3PZW A;  1CYU A;  2E2U A;  1VQ8 3;  3K0Z A;  5JPP A;  4EYC A;  1VQM 3;  1STF I;  4J8T A;  2MF7 A;  3EBT A;  4AKY A;  1L5G B;  2Z6B A;  2LYX A;  1GY7 A;  1UI7 A;  1M1K 4;  2HMO B;  1NO3 A;  4HM2 B;  4KFF A;  2WGO A;  4XDV A;  4N6N B;  5TGN A;  4KFD A;  5BVB A;  1OGX A;  4O2H A;  3K5T A;  2CG1 A;  2R4I A;  3F8X A;  4STD A;  3OWS A;  3KFQ C;  2W9P A;  5ELJ A;  3Q1C A;  1K9M 4;  1K28 A;  4R9L A;  1T5Y A;  1YI2 3;  3NXJ A;  1NWW A;  3X3Z A;  2K54 A;  2OQE A;  3EE1 A;  4EC6 A;  4BTY A;  1DMN A;  3RDE A;  3GZY B;  1W6Y A;  1Q40 A;  2ML5 A;  2OWP A;  1W2B 2;  1OH0 A;  2Z76 A;  1E3V A;  1VZZ A;  1FGR A;  2XRX B;  1J2B A;  3CCS 3;  2I9W A;  4FCJ A;  4I4K A;  1A2V A;  3KSE D;  5CLK A;  1VQO 3;  1GD4 A;  2CFL A;  2QEX 3;  1SII A;  4J9A A;  1CYV A;  3X42 A;  4LGQ A;  2WO0 A;  4PEJ A;  3O8Y A;  4HZB B;  1Q7Y 4;  3LH4 A;  3I56 3;  2BMQ B;  3DGM A;  4HJL B;  4JRF A;  4HM8 B;  4L7K A;  3FKA A;  4EXR A;  1O7H B;  2BMO B;  3BND A;  1AVK A;  1PFP A;  2RSX A;  1VQ4 3;  3DGL A;  1VQ9 3;  2YX9 A;  3JUQ A;  1RRL A;  2BHM A;  1VQL 3;  2Q07 A;  1K73 4;  3LT8 A;  4R9K A;  3QRD A;  4WYK A;  3FZW A;  4K1U A;  4IT7 A;  2W56 A;  2XFS A;  1FGO A;  1Q42 A;  1ULJ B;  1FGM A;  3HIG A;  1EG9 B;  3UL6 A;  1Q40 B;  2D1W A;  1IVW A;  3E99 A;  3F40 A;  5EVH A;  3FLJ A;  3RGR A;  3VSY A;  3J7Y d;  2OTL 3;  2XSO B;  2P0X A;  3OV4 A;  5AYR B;  2XGN A;  3LML A;  2CWT A;  3OX9 A;  5EQL A;  1IVU A;  1STD A;  3PGB A;  2XF3 A;  2KXG A;  3EQQ B;  2W9Q A;  4HVN A;  2BO9 B;  1N8R 4;  1A90 A;  5LC6 A;  1JJ2 2;  2IUJ A;  1O7W B;  2CW9 A;  3WA3 A;  3FF2 A;  3H51 A;  1JNQ A;  1QVG 2;  3CCR 3;  3T8U A;  4MJD A;  2D42 A;  3CCU 3;  3CCL 3;  2E2V A;  2W03 A;  1N8Q A;  1W6G A;  3DMC A;  3TDG A;  2P38 A;  3CC2 3;  2ZDJ A;  3PXM A;  2L4V A;  4WYK B;  1TFK A;  1QAF A;  2WOH A;  1ZX2 A;  3NV0 B;  1VQ6 3;  1MOL A;  2W56 B;  2OQE C;  3NBB A;  2PNC A;  3B8L A;  4WP5 A;  3ECF A;  3OW2 2;  1IDP A;  3NBJ A;  3X3Y A;  3JUN A;  3S28 A;  1JB5 A;  3DY5 A;  3KE7 A;  2W0Q A;  3PCR A;  5D83 A;  4XB5 A;  2Y73 A;  3ER7 A;  4IPB A;  3V92 A;  3SED A;  1WMP A;  3VF1 A;  2C11 A;  1ROV A;  4K1V A;  1NU3 A;  3GZB A;  1CEW I;  4N6O B;  3CU3 A;  3UJM A;  3NUV A;  5KP4 A;  4N6L A;  1OHO A;  5IG5 A;  4N3V A;  2W04 A;  3GWR A;  1VQN 3;  4TX4 A;  5AYS C;  3BNC A;  4BTW A;  5CK6 A;  3S27 A;  3SX1 A;  1AV4 A;  2CWV A;  1KSI A;  5JPU A;  4RZM A;  4H3U A;  3S5C A;  4FR9 A;  2CHC A;  3UB1 A;  3SLU A;  1YJN 3;  5STD A;  4KVH A;  5JBS A;  3B4O A;  4N6T A;  4Q53 A;  1W00 A;  1O7N B;  2F86 B;  3BLZ A;  4K90 B;  2YFL B;  3CMA 3;  1GY6 A;  3NQY A;  3U1W A;  1NDO B;  3HII A;  1ULI B;  1SQW A;  3LOY A;  3G16 A;  3Q90 A;  1W5Z A;  4HKV B;  5AI1 A;  3G71 3;  2INX A;  1IK3 A;  3EF8 A;  1GY5 A;  3N9H A;  3KII A;  1E3R A;  3B4P A;  1SIH A;  1M9G A;  3U97 A;  5CF1 A;  4OK0 A;  1YIT 3;  3X40 A;  3DGO A;  3CCE 3;  1W7C A;  5BXQ A;  2XEP A;  2QA4 3;  1E97 A;  1QMA A;  3MG3 A;  2ZL8 A;  1WMO A;  3IJE B;  1A67 A;  3M8C A;  2OCT A;  1YJW 3;  1UI8 A;  1OAC A;  3K63 A;  4RBN A;  2RGQ A;  1DVC A;  3NHX A;  3MHE A;  3MSO A;  3FG1 A;  1OUN A;  2GU3 A;  3LYG A;  1AVL A;  4CDL A;  1KQS 2;  4KFE A;  3OXA A;  4WFO A;  1HU9 A;  1RJO A;  3CPW 2;  2CFK A;  5EEO A;  5IEP A;  3NX0 A;  4XBX A;  2FNQ A;  1UW1 A;  3S67 A;  4LZI A;  1D6Y A;  2F98 A;  3DUK A;  3K9M C;  5IEN A;  4IIA A;  4MMZ B;  5KP3 A;  2CWU A;  2GEX A;  1CQS A;  1QAK A;  3GZX B;  4HM5 B;  3X3X A;  3CCV 3;  1Q82 4;  2F99 A;  1N9E A;  3G6E 3;  3A76 A;  1JKG A;  4O02 B;  1UUV B;  3SXX A;  3HI7 A;  4L8P A;  1U5O A;  3CXC 2;  4N6M A;  1OHP A;  4NRE A;  1TUH A;  4G1M B;  3T0U A;  5ELU A;  1N5H A;  1QAL A;  2IUK A;  3KZT A;  5FW5 A;  5IER A;  1Q81 4;  2GBX B;  2GU1 A;  2WOF A;  3B7C A;  3EC9 A;  2CK3 H;  4XM4 A;  2CFG A;  4EV5 A;  5A0O B;  3GAX A;  2QIY A;  2GXF A;  1C7H A;  1GD3 A;  5HGR A;  1TU5 A;  3STD A;  1WMN A;  4X2H A;  1GS3 A;  3NM2 A;  1RN7 A;  5AIH A;  1IT7 A;  2STD A;  3HZP A;  1LNH A;  3EHC A;  2OTJ 3;  3KKG A;  4O3V A;  1OF5 A;  1RRH A;  3DM8 A;  1LXE A;  3N8B A;  2CFD A;  1Y4K A;  7STD A;  4RNZ A;  4O8S A;  1MNL A;  8CHO A;  4HM4 B;  3OWY A;  4JF8 A;  3L0R A;  3Q2P A;  1JKG B;  1IU7 A;  2CG0 A;  1HKX A;  4LEH A;  3RGA A;  1DMM A;  3HK4 A;  1KC8 4;  1TIJ A;  1TFO A;  3UL5 A;  1ASK A;  1WTH A;  3HX8 A;  3NQZ A;  1S72 3;  2JDI H;  3MKI A;  3LZA A;  4XBT A;  4HM1 B;  2C10 A;  1IV9 A;  1M1X B;  4NHF A;  3EN8 A;  1VQP 3;  1YJ9 3;  1VQK 3;  2RFR A;  3EBY A;  1QJG A;  3JVC A;  2OOV A;  1VQ7 3;  1RKY A;  2BNG A;  4QWT A;  1NB3 I;  3LTB A;  4WHA A;  1Q86 4;  1JV2 B;  3I55 3;  4FMD A;  4EBG A;  2IA7 A;  1LVN A;  5LC7 A;  2W2C A;  1US1 A;  4R1K A;  5IF6 A;  2GBW B;  2Z77 A;  3MWZ A;  5D81 A;  1YGE A;  3X41 A;  1FGT A;  5AIG A;  5KP1 A;  2FGT A;  2MC8 A;  4N6V 0;  1JN5 A;  1IVX A;  2ML6 A;  1W6C A;  1D6U A;  3G8Z A;  3S29 A;  2FXT A;  1N9J A;  2SBL A;  1IQX A;  4N6U A;  3SVA A;  1A2K A;  1W4N A;  1VQ5 3;  3NBR A;  5IG0 A;  2A15 A;  2PZV A;  1LOX A;  5FGO A;  3KSP A;  2O3O A;  4AEQ A;  3CME 3;  1Z1S A;  2M7O A;  3CD6 3;  2XGL A;  2RCD A;  3EX9 A;  3K7C A;  2CIU A;  1OPY A;  5AEW B;  2KRT A;  1OCV A;  3MG2 A;  5AIF A;  1KWI A;  2Z7A A;  1PU4 A;  2CKF B;  1S5A A;  3LTA A;  3LTC A;  1IV7 A;  2UX0 A;  1TP6 A;  3DGN A;  4FMA A;  2BT3 A;  3EJV A;  4FCZ A;  1U8C B;  3FF0 A;  3G4S 3;  1R4C A;  2XH9 A;  2E2T A;  2W6J H;  1W01 A;  1W02 A;  1IQY A;  2HMM B;  3CC7 3;  2LQV A;  1JN5 B;  3CNM A;  4RNY A;  4WWU C;  1DVD A;  4HM0 B;  3EB8 A;  1YVB I;  3I0Y A;  4FMC A;  3ALA A;  3UNL A;  1FA3 A;  4FMB A;  4HM6 B;  1JRQ A;  3VGN A;  4OVM A;  4FCM A;  4U13 A;  6STD A;  1DMQ A;  3AMO A;  4BTX A;  2K0M A;  2V1L A;  1JB2 A;  1QVF 2;  3BNE A;  2JQ5 A;  5G2G A;  1DYU A;  5AII A;  4MEI A;  4XDW A;  1GYB A;  4CCV A;  3LT9 A;  5DRE A;  1YHQ 3;  1UUW B;  2B1X B;  3FCS B;  2HMN B;  1KD1 4;  2CFW A;  2OOV C;  2KCD A;  4K61 A;  1N5P A;  5IW9 A;  2WGQ A;  3LTD A;  5IG3 A;  4HYZ A;  3FGY A;  3V98 A;  1O7P B;  3DXO A;  2P05 A;  3V99 A;  3MPH A;  4L8O A;  1BUQ A;  1EA2 A;  4X2O A;  5D82 A;  3F8H A;  4XBY A;  3EN1 B;  2XFT A;  1G96 A;  3G0K A;  3WMD A;  3WDG B;  2Y74 A;  1FGQ A;  3NV0 A;  3CCQ 3;  4HBR A;  5IEO A;  3GZR A;  1IVV A;  3WOE B;  2CH9 A;  3BNB A;  1V74 A;  1FUW A;  1SPU A;  3JUP A;  3D3L A;  3JUO A;  2GEY A;  3PYJ A;  2HMK B;  2O9U X;  3AMO B;  3IMA B;  3WOD G;  1EQK A;  4H61 A;  2YFJ B;  2QGU A;  1W2Z A;  1YIJ 3;  3F7S A;  1IQ8 A;  1NB5 I;  3CNX A;  4LMI A;  1EKM A;  1OHS A;  3SOY A;  3KN4 A;  2YFI B;  4R4K A;  1WNH A;  4GB5 A;  1OGZ A;  3CCJ 3;  1SJW A;  3GRD A;  3MYT A;  5IG4 A;  2HMJ B;  1O7M B;  3PS8 A;  4HM3 B;  1ROA A;  1AR0 A;  1F8N A;  3FSD A;  3JUM A;  4MMX B;  2IMJ A;  1O7G B;  3SOA A;  4KZ1 A;  1ISK A;  3NM7 A;  4AKZ A;  2CC3 A;  3F7X A;  3MG1 A;  3CC4 3;  2XSH B;  4EV2 A;  4MMY B;  5CXO A;  2P0M A;  1M90 4;  3PCS A;  3T8N A;  3LXU X;  1OF5 B;  4GL6 A;  4OUQ A;  3CCM 3;  3H3H A;  3FG3 A;  3WOF B;  3BB9 A;  1IT8 A;  4ZM8 A;  5I97 A;  2HML B;  2XR8 B;  3CPO A;  1K8A 4;  1NJI 4;  3DZL A;  1D6Z A;  1JB4 A;  3OWU A;  4R80 A;  3F9S A;  3ROB A;  3QK9 A;  2P09 A;  2B24 B;  3FH1 A;  3D9R A;  4HM7 B;  3F14 A;  1ZO2 A;  3IPT A;  3WA2 X;  5CF2 A;  1K41 A;  3N54 B;  4LSO A;  4HZ9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...