2HMJB

Crystal structure of the naphthalene 1,2-dioxygenase phe-352-val mutant.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 57
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmjB00
1O7WB 4X2OA 3F40A 3FF2A 4XBXA 3JUOA 1UUWB 3F8HA 3MG1A 5AIGA 3FH1A 1JB2A 1ZO2A 3EX9A 3DUKA 1GS3A 4CDLA 1OGZA 5CLKA 2IMJA 4HM4B 3F7SA 3ER7A 1EG9B 4WP5A 1Q40A 2HMLB 3FLJA 3JUQA 4I4KA 4K1UA 1OPYA 3D9RA 3OXAA 5CXOA 3VGNA 1WQLB 4HM8B 1O7MB 5AI1A 3MYTA 2YFJB 3GWRA 4IIAA 1OHOA 3K0ZA 3KKGA 2F98A 3OWUA 5JPUA 1JKGA 5IENA 1NU3A 3RGAA 4ORLA 1OCVA 2UX0A 3WMDA 2I9WA 1GY7A 3B8LA 5IF6A 2HMKB 2HMJB 2BMOB 3EC9A 3FF0A 1DMNA 2B24B 2R4IA 3EN8A 1JN5A 3EBTA 2GEXA 1GY6A 3CU3A 5BVBA 5KP4A 1ULIB 3K7CA 7STDA 2HMMB 2STDA 1K41A 3UJMA 3M8CA 5G2GA 3BLZA 5STDA 4K1VA 5DREA 4R9KA 1HKXA 3NXJA 2XRXB 1DMMA 3A76A 2JQ5A 3CPOA 1JB5A 3KZTA 1JB4A 1AR0A 3BB9A 4MJDA 1U5OA 1OGXA 4LGQA 5AIIA 5IEPA 3B7CA 3F7XA 2PZVA 3OV4A 4HZ9B 3MKIA 4Q53A 4HM0B 3H3HA 4HZBB 4N3VA 1W02A 2CHCA 1OF5A 1QJGA 1QMAA 3G8ZA 3G16A 3GZYB 4XB5A 1ZX2A 2YFLB 4FCMA 1E3RA 3OX9A 4HM6B 5JPPA 3GZXB 3ECFA 3LYGA 3FKAA 3JUMA 2XSHB 3JUPA 5D83A 1O7PB 3HZPA 3DXOA 3KSPA 2XR8B 1SJWA 3EJVA 3DM8A 3GRDA 3EF8A 2GBXB 3IPTA 1A2KA 2BNGA 3GZBA 4R9LA 2W2CA 4PEJA 5IG3A 3NV0B 5TGNA 3SOAA 4WYKA 5IERA 3UNLA 4L8OA 1NWWA 2HMOB 3STDA 1OUNA 1O7HB 3EBYA 5KP3A 4H3UA 4U13A 3JUNA 5BXQA 4J8TA 2INXA 4HJLB 3EN1B 3F14A 2YFIB 1UUVB 3I0YA 1C7HA 3ROBA 1DMQA 3OWSA 3MG3A 5D81A 3SEDA 5IEOA 1JKGB 1W6YA 4HKVB 5IG4A 3NBRA 1GYBA 1O7NB 3NM2A 1Q42A 2F86B 5EVHA 1STDA 1OHSA 3H51A 5D82A 3NHXA 2XSOB 2QGUA 1JN5B 2A15A 4OVMA 4XDWA 4LEHA 3HK4A 5FW5A 1O7GB 2GBWB 3NV0A 1E97A 4OUQA 4LMIA 4HM2B 4XBYA 1CQSA 5IG5A 1ISKA 5CF2A 3NUVA 8CHOA 2GXFA 4WWUC 3OWYA 3FGYA 1W01A 2Z7AA 3LZAA 2CKFB 2F99A 4HM5B 3G0KA 1EA2A 5DRVA 3CNMA 2BMRB 3B4PA 1OH0A 5IG0A 1ULJB 3DZLA 2B1XB 1TUHA 1ASKA 3FSDA 5HGRA 2K54A 1GY5A 3EHCA 3F8XA 1OF5B 2Z77A 4STDA 2BMQB 2RCDA 4FCJA 3Q90A 1TP6A 3VSYA 4J9AA 1S5AA 3RGRA 4R1KA 1VZZA 5KP1A 3T8NA 1Q40B 2RFRA 2QIYA 3GZRA 5AEWB 5AEUB 3CNXA 3HX8A 4RZMA 4XDVA 3MSOA 4X2HA 1OHPA 3FZWA 4HVNA 4KVHA 4L7KA 3E99A 3SOYA 5AIHA 1W00A 2HMNB 5AIFA 6STDA 1NDOB 3T8UA 5CK6A 1IDPA 3S5CA 3MHEA 1E3VA 4HM1B 1Z1SA 4HM7B 2Z76A 3KE7A 4HM3B 3B4OA 4WYKB 4L8PA 2RGQA 3F9SA 3MG2A 4XM4A 4XBTA 4GB5A 5CF1A 2GEYA 1BUQA 2OWPA 3DMCA 3EQQB
chains in the Genus database with same CATH superfamily
6RNTA 1W6CA 1IVUA 1O7WB 4RBNA 4X2OA 3CCM3 3F40A 2BIRA 1BRIA 1YNVX 3FF2A 4HBRA 1D6YA 4XBXA 3PYJA 3JUOA 4N6LA 1UUWB 1MNLA 3F8HA 3MG1A 5ELUA 5AIGA 1BNIA 1RNTA 4MMXB 1VQP3 3FH1A 1BRGA 1JB2A 4O8SA 1B20A 1ZO2A 4I5QA 1LOXA 1TJDA 3DUKA 1GS3A 3EX9A 3CCE3 1I2FA 1OGZA 4CDLA 1FUSA 3FG3A 5CLKA 1RGFA 3D3LA 3CCL3 3N54B 1VQL3 1UGIA 2IMJA 4HM4B 4FCZA 1X1WA 3F7SA 1YJ93 3AMOB 3ER7A 1EG9B 4WP5A 1WMPA 1LRAA 2Y73A 3LTBA 1X1UA 3GSPA 1Q40A 2R41A 2HMLB 3FLJA 3JUQA 1JNQA 4I4KA 1J2BA 1RKYA 3DGLA 1W5ZA 3MWZA 1OACA 4K1UA 1OPYA 1RTUA 3D9RA 3OXAA 4EXRA 4O3VA 3CCS3 5CXOA 1I0XA 4IT7A 1A90A 4KFFA 1I3IA 1TTOA 4NREA 1BSEA 1I2GA 3VGNA 4OK0A 1WQLB 1RGAA 5LC7A 1BANA 2F4YA 3I563 4HM8B 2ZL8A 1CYUA 1O7MB 3TDGA 5AI1A 2CW9A 3WR2A 3MYTA 2CC3A 2YFJB 3AGOA 1N8QA 3GWRA 4IIAA 2LYXA 1OHOA 2KRTA 3K0ZA 2F98A 3KKGA 3OWUA 3SX1A 1JKGA 3S67A 5IENA 3FCSB 5JPUA 1K8A4 1NU3A 1ROAA 3CXC2 1SQWA 4BTWA 1IVWA 4RNYA 3RGAA 4ORLA 1BRJA 1NNVA 1SARA 2KF4A 3HI7A 3G4S3 2KF5A 4ILFA 1OCVA 2UX0A 1JJ22 2E2UA 4WFOA 1BUJA 3LH4A 1RMSA 3WMDA 1AQZA 1VQ43 2I9WA 1G96A 1R4CA 1GY7A 3B8LA 2P0MA 5IF6A 1Q7HA 2HMKB 2IY2A 2HMJB 2BMOB 3FG1A 4KFDA 1Q864 1L5GB 3EC9A 1MWRA 3FF0A 1YI23 3MPHA 1X1XA 3AHSA 4NPBA 1BRSA 4MEIA 1DMNA 2B24B 3CD63 4N6NB 2R4IA 1PYLA 3EN8A 1JN5A 2GSPA 3EBTA 2GEXA 2WGQA 5RNTA 1GY6A 3CU3A 1YIT3 5BVBA 5KP4A 1ULIB 2JDIH 2Z6BA 3K7CA 3Q3FA 5ELJA 1AVLA 2LQVA 3DGMA 4BU4A 1M9GA 1WMNA 1RGLA 7STDA 2HMMB 2STDA 4CJNA 1K41A 3UJMA 2H0IA 1VQK3 1AVKA 3RDEA 1LNHA 1RGEA 1VQ73 3WOEB 3DGOA 3CME3 3M8CA 1TRQA 3PGBA 5G1LA 5G2GA 5LC6A 3QK9A 2OQEA 3Q1CA 1BRNL 3BLZA 5STDA 2UGIA 3S28A 3AHWA 4K1VA 5DREA 1KSIA 3LOYA 4G1MB 3CCV3 4R9KA 1BSAA 3KSED 1HKXA 3NXJA 1GD3A 4AKZA 2XRXB 1DMMA 1V74A 3A76A 2JQ5A 1WNHA 1QVG2 3K9MC 3CPOA 1MWUA 1JB5A 2BO9B 3KZTA 3DGNA 1JB4A 1UCKA 3SLUA 4CPKA 1AR0A 4GL6A 3FG4A 1HZ1A 1PFPA 3LTCA 3BB9A 4MJDA 4WHAA 3ZG0A 3NQYA 4LZIA 2FGTA 4ZM8A 5JBSA 1BNEA 1SIIA 1U5OA 1T5YA 1VQ83 1FGOA 1OGXA 4LGQA 5AIIA 5IEPA 3B7CA 4GSPA 4EV2A 1BSBA 1BNGA 3F7XA 1DYUA 1RGKA 2PZVA 1EKMA 1GOUA 3OV4A 3WDGB 4HZ9B 2CG1A 4O02B 4KZ1A 1AV4A 3MKIA 1UDII 4Q53A 4HM0B 3H3HA 1TU5A 1NO3A 1FZUA 1T3BA 4HZBB 5A0OB 4N3VA 1W02A 1JZOA 1G0TA 1K9M4 2CHCA 3S29A 2XF3A 1OF5A 1QJGA 1LQMB 1QMAA 2F5WA 1GD4A 1B3SA 3WODG 2XFTA 3UB1A 3G8ZA 3G16A 3GZYB 1MGRA 4EV5A 4XB5A 1B2UA 4RNTA 3NM7A 1LOVA 2CX1A 3SXXA 2OCTA 1ZX2A 2YFLB 3DY5A 3IMAB 4FCMA 1V58A 1E3RA 3OX9A 4HM6B 2K3DA 9RNTA 4R80A 3PXMA 5JPPA 3GZXB 1VQM3 2WO0A 3ECFA 3LYGA 3Q2PA 2ML5A 4AKYA 4FMDA 3LT9A 4K90B 2OOVA 3K63A 3FKAA 1FA3A 1IQXA 3JUMA 1FW7A 2HOHA 2XSHB 1YHQ3 1GMPA 2QA43 2P09A 2P38A 2WOFA 3JUPA 5D83A 3X40A 2KXGA 3CC43 3VF1A 1O7PB 2CWTA 1MWSA 1YVBI 1KWIA 3HZPA 4N6V0 1JRQA 3PCSA 3LT8A 1IQ8A 2XEPA 1BIRA 3DXOA 1BNFA 3KSPA 4IPBA 1LVNA 1GSPA 1ROVA 1KQS2 2XR8B 1STFI 1SJWA 2Y74A 3EJVA 4KFEA 3DM8A 3X3XA 4AEQA 3GRDA 5FGOA 3X41A 5I97A 3N8BA 3EF8A 2GBXB 3U97A 3IPTA 1A2KA 1JBRA 3X42A 1RDSA 2W56B 2BNGA 2Q07A 2MC8A 1G02A 2V1LA 1QALA 2W03A 3GZBA 4R9LA 1RN7A 1TFOA 1U8CB 2OOVC 1IQYA 7GSPA 2W2CA 4PEJA 1IYYA 5IG3A 1I8VA 1W7CA 2IUJA 3NV0B 2D1WA 5TGNA 4N6TA 3SYUA 3SOAA 1GMQA 5EEOA 1B2ZA 4KT3B 4WYKA 1VQQA 1CYVA 5HOHA 5IERA 1CH0A 3UNLA 2E2VA 4L8OA 1NWWA 2HMOB 2ZA4A 2ZDJA 1A2VA 1N5PA 3STDA 1OUNA 1ZGXA 1US1A 2RSXA 1RCKA 2QEX3 2C10A 3O8YA 4NHFA 1O7HB 1BNRA 4BIRA 1S723 1BSDA 1SPUA 2CWUA 3EBYA 5KP3A 3LTDA 4H3UA 4LYLB 4U13A 3JUNA 1EEJA 5BXQA 3A5EA 4J8TA 1B2SA 2INXA 1B2XA 1YJW3 2RNTA 1TRPA 2CFLA 1D6ZA 1Q824 4HJLB 3EN1B 3BNDA 4EYCA 1FGMA 1BRHA 3D4AA 1BRKA 2AADA 1EUIC 4FMAA 1YGWA 2CH9A 3F14A 4HAAA 2YFIB 1PU4A 1RGHA 1LNIA 1UUVB 2XGLA 1TIJA 4JRFA 1M1K4 4LSOA 3KN4A 3I0YA 1C7HA 3U1WA 1LXEA 1UCLA 4BTYA 3ROBA 1V57A 3ZFZA 3NBJA 4O2HA 2WOHA 2IYJA 3J7Yd 1Q7Y4 1A2PA 4EC6A 3NBBA 5AYSC 3WA3A 2AAEA 1VQ53 1DMQA 3L0RA 3OWSA 1FGQA 1QAFA 3MG3A 2L4VA 3WA2X 2F5MA 2SBLA 5D81A 1IK3A 1IVVA 1RCLA 1W4NA 3SEDA 1IT7A 3ZG5A 1VQ63 3D5GA 5IEOA 4JF8A 1MWTA 4TX4A 1RLSA 1JKGB 3CMA3 3AMOA 3DH2A 1IVXA 1Q9EA 1W6YA 1K734 4HKVB 3CC23 5IG4A 3G6E3 3CCQ3 1GOYA 1F8NA 4BTXA 1BVIA 1BU4A 1SIHA 3BU4A 1FUWA 2MF7A 2J8XB 3NBRA 3PCRA 1GYBA 3V98A 1O7NB 1Y4KA 3EB8A 3EE1A 3NX0A 1RGCA 3NM2A 1Q42A 2F86B 3RNTA 5EVHA 5M19A 3KFQC 1STDA 2OQEC 1C54A 2FNQA 1B21A 3ALAA 4DKIA 3N9HA 1OHSA 3H51A 1FGRA 5D82A 3NHXA 1BOXA 1IT8A 1RRHA 2XSOB 1B2MA 2QGUA 1JN5B 4MMYB 5BIRA 3D5IA 2A15A 4OVMA 4N6MA 4XDWA 4RNZA 4LEHA 3WOFB 1RN4A 4QWTA 3HK4A 1R4YA 1NJI4 5FW5A 1K28A 1O7GB 2W56A 1VQO3 1BAOA 3AGNA 1KD14 1IU7A 2GBWB 4EW5A 6GSPA 1WMOA 3BNBA 1FYSA 1YJN3 1LQGC 1CEWI 1YGEA 1E97A 3NV0A 4OUQA 2O9UX 5EQLA 5G1KA 3OW22 3PZWA 1MOLA 1UCJA 2H0GA 3PS8A 4LMIA 4HM2B 1A67A 2CIUA 4XBYA 1CQSA 3V99A 5IG5A 1ISKA 1T2IA 5CF2A 3NUVA 2OTJ3 1WTHA 2CFWA 8RNTA 8CHOA 1EQKA 4N6OB 1M1XB 2GXFA 2YX9A 1RHLA 2P0XA 3FGYA 1W01A 2Z7AA 3BNCA 3OWYA 4WWUC 3LZAA 1N9EA 2W9PA 4BL3A 3CPW2 1HYFA 2CKFB 3LXUX 2F99A 1B27A 4HM5B 1EA2A 3G0KA 3DGYA 1DE3A 5DRVA 3URPA 3X3YA 4BL2A 1I3FA 1JBTA 1N9JA 1UI8A 2BHMA 3CNMA 1IV9A 1JV2B 2SARA 1W2ZA 2CFDA 3QRDA 1UUGB 3K5TA 3T0UA 3V92A 2W0QA 4FMBA 3HIIA 2UUGC 2BMRB 1NB3I 3B4PA 1GMRA 1OH0A 2CFKA 7RNTA 5IG0A 1ULJB 1UCIA 3DZLA 1RJOA 1FGTA 2B1XB 1TUHA 1ASKA 3FSDA 5HGRA 4MMZB 1Q814 2W04A 2K54A 2ZHXB 1LOWA 2H0HA 1GY5A 3EHCA 5M1AA 3I553 2RBIA 1VQ93 2O3OA 1VQN3 1UI7A 3F8XA 1OF5B 2Z77A 4STDA 2BMQB 2GU3A 1DVCA 2RCDA 4FCJA 2ML6A 1YVSA 3Q90A 3UL5A 1AY7A 4R4KA 1IV7A 1TP6A 2M7OA 3VSYA 4FMCA 2CFGA 4J9AA 3IJEB 2IA7A 1S5AA 1UGHI 2BT3A 1DVDA 3RGRA 3JVCA 1I70A 3NQZA 4R1KA 1VZZA 3HIGA 5KP1A 4GHOA 2KCDA 1D6UA 3T8NA 2FXTA 2P05A 1Q40B 2E2TA 2RFRA 2BU4A 2QIYA 2IUKA 5AYRB 1JBSA 2XGNA 3GZRA 5AEWB 5AEUB 1I0VA 4J5KA 1JZDA 4FR9A 3CNXA 3CCR3 1QVF2 1TFKA 2XH9A 3HX8A 4RZMA 4XDVA 1FUTA 3LMLA 3MSOA 4X2HA 3BNEA 1OHPA 2F56A 1QAKA 3FZWA 3CCU3 4HVNA 4KVHA 3HOHA 4L7KA 3WHOA 3E99A 3SOYA 1RGGA 1RNBA 5AIHA 1X1YA 1HU9A 2D42A 1W00A 1RRLA 1BNJA 2HMNB 4HYZA 4J5GA 5AIFA 3SVAA 1BSCA 6STDA 4K61A 1T2HA 1DETA 5BU4A 1NDOB 3S27A 1BNSA 3KCHA 1MGWA 3T8UA 3CC73 1M904 1NB5I 5CK6A 1IDPA 1KC84 3S5CA 1W6GA 1RSNA 2KF6A 3MHEA 1E3VA 1UW1A 4HM1B 1W2B2 1RN1A 2C4BA 1Z1SA 4HM7B 3D79A 2KF3A 2Z76A 3KE7A 1GOVA 1N5HA 2WGOA 4HM3B 4CCVA 1I2EA 2C11A 4H61A 2GU1A 3B4OA 2KAAA 3UL6A 4WYKB 4L8PA 4HOHA 2CX0A 3G713 2XFSA 5GSPA 2CG0A 2RGQA 1ZS7A 1LOYA 3F9SA 3MG2A 1BGSA 3GAXA 1YIJ3 3KIIA 4EBGA 2CWVA 3BIRA 3CCJ3 4XM4A 3LTAA 1PY3A 2K0MA 4XBTA 1N8R4 2OTL3 2PNCA 4GB5A 5M18A 4N6UA 5CF1A 2GEYA 5IW9A 2L1SA 1BUQA 2OWPA 3X3ZA 3DMCA 2W9QA 2CK3H 3EQQB 2W6JH
chains in the Genus database with same CATH topology
1W6CA 1IVUA 1O7WB 4RBNA 4X2OA 3CCM3 3F40A 3FF2A 4HBRA 1D6YA 4XBXA 3PYJA 3JUOA 4N6LA 1UUWB 1MNLA 3F8HA 3MG1A 5ELUA 5AIGA 4MMXB 1VQP3 3FH1A 1JB2A 4O8SA 1ZO2A 1LOXA 3DUKA 3EX9A 1GS3A 3CCE3 4CDLA 1OGZA 3FG3A 5CLKA 3CCL3 3D3LA 3N54B 1VQL3 2IMJA 4HM4B 4FCZA 3F7SA 1YJ93 3AMOB 3ER7A 1EG9B 4WP5A 1WMPA 2Y73A 3LTBA 1Q40A 2HMLB 3FLJA 3JUQA 1JNQA 4I4KA 1J2BA 1RKYA 3DGLA 1W5ZA 3MWZA 1OACA 4K1UA 1OPYA 3D9RA 4EXRA 3OXAA 3CCS3 4O3VA 5CXOA 4IT7A 1A90A 4KFFA 4NREA 3VGNA 4OK0A 1WQLB 5LC7A 3I563 4HM8B 2ZL8A 1CYUA 1O7MB 3TDGA 5AI1A 2CW9A 3MYTA 2CC3A 2YFJB 1N8QA 3GWRA 4IIAA 2LYXA 1OHOA 2KRTA 3K0ZA 2F98A 3KKGA 3OWUA 3SX1A 1JKGA 5JPUA 5IENA 3FCSB 1K8A4 1NU3A 1ROAA 3CXC2 1SQWA 4BTWA 1IVWA 4RNYA 3RGAA 4ORLA 3HI7A 3G4S3 1OCVA 2UX0A 1JJ22 2E2UA 4WFOA 3LH4A 3WMDA 1VQ43 2I9WA 1G96A 1R4CA 1GY7A 3B8LA 2P0MA 5IF6A 2HMKB 2HMJB 2BMOB 3FG1A 4KFDA 1Q864 1L5GB 3EC9A 3FF0A 1YI23 3MPHA 4MEIA 1DMNA 2B24B 3CD63 4N6NB 2R4IA 3EN8A 1JN5A 3EBTA 2GEXA 2WGQA 1GY6A 3CU3A 1YIT3 5BVBA 5KP4A 1ULIB 2JDIH 2Z6BA 3K7CA 5ELJA 1AVLA 2LQVA 3DGMA 1M9GA 1WMNA 7STDA 2HMMB 2STDA 1K41A 3UJMA 1VQK3 1AVKA 3RDEA 1LNHA 1VQ73 3WOEB 3DGOA 3CME3 3M8CA 3PGBA 5G2GA 5LC6A 3QK9A 2OQEA 3Q1CA 3BLZA 5STDA 3S28A 4K1VA 5DREA 1KSIA 3LOYA 4G1MB 3CCV3 4R9KA 3KSED 1HKXA 3NXJA 1GD3A 4AKZA 2XRXB 1DMMA 1V74A 3A76A 2JQ5A 1WNHA 1QVG2 3K9MC 3CPOA 1JB5A 2BO9B 3KZTA 3DGNA 1JB4A 3SLUA 1AR0A 4GL6A 3FG4A 1PFPA 3LTCA 4WHAA 3BB9A 4MJDA 3NQYA 4LZIA 2FGTA 4ZM8A 5JBSA 1SIIA 1U5OA 1T5YA 1VQ83 1FGOA 1OGXA 4LGQA 5AIIA 5IEPA 3B7CA 4EV2A 3F7XA 1DYUA 2PZVA 1EKMA 3OV4A 3WDGB 4HZ9B 2CG1A 4O02B 4KZ1A 1AV4A 3MKIA 4Q53A 4HM0B 3H3HA 1TU5A 1NO3A 4HZBB 5A0OB 4N3VA 1W02A 1K9M4 2CHCA 3S29A 2XF3A 1OF5A 1QJGA 1QMAA 1GD4A 3WODG 2XFTA 3UB1A 3G8ZA 3G16A 3GZYB 4EV5A 4XB5A 3NM7A 3SXXA 2OCTA 1ZX2A 2YFLB 3DY5A 3IMAB 4FCMA 1E3RA 3OX9A 4HM6B 4R80A 3PXMA 5JPPA 3GZXB 1VQM3 2WO0A 3ECFA 3LYGA 3Q2PA 2ML5A 4AKYA 4FMDA 3LT9A 4K90B 2OOVA 3K63A 3FKAA 1FA3A 1IQXA 3JUMA 2XSHB 1YHQ3 2QA43 2P09A 2P38A 2WOFA 3JUPA 5D83A 3X40A 2KXGA 3CC43 3VF1A 1O7PB 2CWTA 1YVBI 1KWIA 3HZPA 4N6V0 1JRQA 3PCSA 3LT8A 1IQ8A 2XEPA 3DXOA 3KSPA 4IPBA 1LVNA 1ROVA 1KQS2 2XR8B 1STFI 1SJWA 2Y74A 3EJVA 4KFEA 3DM8A 3X3XA 4AEQA 3GRDA 5FGOA 3X41A 5I97A 3N8BA 3EF8A 2GBXB 3U97A 3IPTA 1A2KA 3X42A 2W56B 2BNGA 2Q07A 2MC8A 2W03A 2V1LA 1QALA 3GZBA 4R9LA 1RN7A 1TFOA 1U8CB 2OOVC 1IQYA 2W2CA 4PEJA 5IG3A 1W7CA 2IUJA 3NV0B 2D1WA 5TGNA 4N6TA 3SOAA 5EEOA 4WYKA 1CYVA 5IERA 3UNLA 2E2VA 4L8OA 1NWWA 2HMOB 2ZDJA 1A2VA 1N5PA 3STDA 1OUNA 1US1A 2RSXA 2QEX3 2C10A 3O8YA 4NHFA 1O7HB 1S723 1SPUA 2CWUA 3EBYA 5KP3A 3LTDA 4H3UA 4U13A 3JUNA 5BXQA 4J8TA 2INXA 1YJW3 2CFLA 1D6ZA 1Q824 4HJLB 3EN1B 3BNDA 4EYCA 1FGMA 4FMAA 2CH9A 3F14A 2YFIB 1PU4A 1UUVB 2XGLA 1TIJA 4JRFA 1M1K4 4LSOA 3KN4A 3I0YA 1C7HA 3U1WA 1LXEA 4BTYA 3ROBA 3NBJA 4O2HA 2WOHA 1Q7Y4 3J7Yd 1VQ53 4EC6A 3WA3A 3NBBA 5AYSC 1DMQA 3L0RA 3OWSA 1FGQA 1QAFA 3MG3A 2L4VA 3WA2X 2SBLA 5D81A 1IK3A 1IVVA 1W4NA 3SEDA 1IT7A 1VQ63 5IEOA 4JF8A 4TX4A 1JKGB 3CMA3 3AMOA 1IVXA 1W6YA 1K734 4HKVB 3CC23 5IG4A 3G6E3 3CCQ3 1F8NA 4BTXA 1SIHA 1FUWA 2MF7A 3NBRA 3PCRA 1GYBA 3V98A 1O7NB 1Y4KA 3EB8A 3EE1A 3NX0A 3NM2A 1Q42A 2F86B 5EVHA 3KFQC 1STDA 2OQEC 2FNQA 3ALAA 3N9HA 1OHSA 3H51A 1FGRA 5D82A 3NHXA 1IT8A 1RRHA 2XSOB 2QGUA 1JN5B 4MMYB 2A15A 4OVMA 4N6MA 4XDWA 4RNZA 4LEHA 3WOFB 4QWTA 3HK4A 1NJI4 5FW5A 1K28A 1O7GB 2W56A 1VQO3 1KD14 1IU7A 2GBWB 1WMOA 3BNBA 1YJN3 1CEWI 1YGEA 1E97A 3NV0A 4OUQA 2O9UX 5EQLA 3OW22 3PZWA 1MOLA 3PS8A 4LMIA 4HM2B 1A67A 2CIUA 4XBYA 1CQSA 3V99A 5IG5A 1ISKA 5CF2A 3NUVA 2OTJ3 1WTHA 2CFWA 8CHOA 1EQKA 4N6OB 1M1XB 2GXFA 2YX9A 4WWUC 2P0XA 3FGYA 1W01A 2Z7AA 3BNCA 3OWYA 3S67A 3LZAA 1N9EA 2W9PA 3CPW2 2CKFB 3LXUX 2F99A 4HM5B 1EA2A 3G0KA 5DRVA 3X3YA 1N9JA 1UI8A 2BHMA 3CNMA 1IV9A 1JV2B 1W2ZA 2CFDA 3QRDA 3K5TA 3T0UA 3V92A 2W0QA 4FMBA 3HIIA 2BMRB 1NB3I 3B4PA 1OH0A 2CFKA 5IG0A 1ULJB 3DZLA 1RJOA 1FGTA 2B1XB 1TUHA 1ASKA 3FSDA 5HGRA 4MMZB 1Q814 2W04A 2K54A 1GY5A 3EHCA 3I553 1VQ93 2O3OA 1VQN3 1UI7A 3F8XA 1OF5B 2Z77A 4STDA 2BMQB 2GU3A 1DVCA 2RCDA 4FCJA 2ML6A 3Q90A 3UL5A 4R4KA 1IV7A 1TP6A 2M7OA 3VSYA 4FMCA 2CFGA 4J9AA 3IJEB 2IA7A 1S5AA 2BT3A 1DVDA 3RGRA 3JVCA 3NQZA 4R1KA 1VZZA 3HIGA 5KP1A 2KCDA 1D6UA 3T8NA 2FXTA 2P05A 1Q40B 2E2TA 2RFRA 2QIYA 2IUKA 5AYRB 2XGNA 3GZRA 5AEWB 5AEUB 4FR9A 3CNXA 3CCR3 1QVF2 1TFKA 2XH9A 3HX8A 4RZMA 4XDVA 3LMLA 3MSOA 4X2HA 3BNEA 1OHPA 3FZWA 1QAKA 3CCU3 4HVNA 4KVHA 4L7KA 3E99A 3SOYA 5AIHA 1HU9A 2D42A 1W00A 1RRLA 2HMNB 5AIFA 4HYZA 3SVAA 6STDA 4K61A 1NDOB 3S27A 3T8UA 3CC73 1M904 1NB5I 5CK6A 1IDPA 1KC84 3S5CA 1W6GA 3MHEA 1E3VA 1UW1A 4HM1B 1W2B2 1Z1SA 4HM7B 2Z76A 3KE7A 4HM3B 1N5HA 2WGOA 4CCVA 4H61A 2C11A 2GU1A 3B4OA 3UL6A 4WYKB 4L8PA 3G713 2XFSA 2CG0A 2RGQA 3F9SA 3MG2A 3GAXA 1YIJ3 3KIIA 4EBGA 2CWVA 3CCJ3 4XM4A 3LTAA 2K0MA 4XBTA 1N8R4 2OTL3 2PNCA 4GB5A 4N6UA 5CF1A 2GEYA 5IW9A 1BUQA 2OWPA 3X3ZA 3DMCA 2W9QA 2CK3H 3EQQB 2W6JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7W B;  4X2O A;  3F40 A;  3FF2 A;  4XBX A;  3JUO A;  1UUW B;  3F8H A;  3MG1 A;  5AIG A;  3FH1 A;  1JB2 A;  1ZO2 A;  3EX9 A;  3DUK A;  1GS3 A;  4CDL A;  1OGZ A;  5CLK A;  2IMJ A;  4HM4 B;  3F7S A;  3ER7 A;  1EG9 B;  4WP5 A;  1Q40 A;  2HML B;  3FLJ A;  3JUQ A;  4I4K A;  4K1U A;  1OPY A;  3D9R A;  3OXA A;  5CXO A;  3VGN A;  1WQL B;  4HM8 B;  1O7M B;  5AI1 A;  3MYT A;  2YFJ B;  3GWR A;  4IIA A;  1OHO A;  3K0Z A;  3KKG A;  2F98 A;  3OWU A;  5JPU A;  1JKG A;  5IEN A;  1NU3 A;  3RGA A;  4ORL A;  1OCV A;  2UX0 A;  3WMD A;  2I9W A;  1GY7 A;  3B8L A;  5IF6 A;  2HMK B;  2HMJ B;  2BMO B;  3EC9 A;  3FF0 A;  1DMN A;  2B24 B;  2R4I A;  3EN8 A;  1JN5 A;  3EBT A;  2GEX A;  1GY6 A;  3CU3 A;  5BVB A;  5KP4 A;  1ULI B;  3K7C A;  7STD A;  2HMM B;  2STD A;  1K41 A;  3UJM A;  3M8C A;  5G2G A;  3BLZ A;  5STD A;  4K1V A;  5DRE A;  4R9K A;  1HKX A;  3NXJ A;  2XRX B;  1DMM A;  3A76 A;  2JQ5 A;  3CPO A;  1JB5 A;  3KZT A;  1JB4 A;  1AR0 A;  3BB9 A;  4MJD A;  1U5O A;  1OGX A;  4LGQ A;  5AII A;  5IEP A;  3B7C A;  3F7X A;  2PZV A;  3OV4 A;  4HZ9 B;  3MKI A;  4Q53 A;  4HM0 B;  3H3H A;  4HZB B;  4N3V A;  1W02 A;  2CHC A;  1OF5 A;  1QJG A;  1QMA A;  3G8Z A;  3G16 A;  3GZY B;  4XB5 A;  1ZX2 A;  2YFL B;  4FCM A;  1E3R A;  3OX9 A;  4HM6 B;  5JPP A;  3GZX B;  3ECF A;  3LYG A;  3FKA A;  3JUM A;  2XSH B;  3JUP A;  5D83 A;  1O7P B;  3HZP A;  3DXO A;  3KSP A;  2XR8 B;  1SJW A;  3EJV A;  3DM8 A;  3GRD A;  3EF8 A;  2GBX B;  3IPT A;  1A2K A;  2BNG A;  3GZB A;  4R9L A;  2W2C A;  4PEJ A;  5IG3 A;  3NV0 B;  5TGN A;  3SOA A;  4WYK A;  5IER A;  3UNL A;  4L8O A;  1NWW A;  2HMO B;  3STD A;  1OUN A;  1O7H B;  3EBY A;  5KP3 A;  4H3U A;  4U13 A;  3JUN A;  5BXQ A;  4J8T A;  2INX A;  4HJL B;  3EN1 B;  3F14 A;  2YFI B;  1UUV B;  3I0Y A;  1C7H A;  3ROB A;  1DMQ A;  3OWS A;  3MG3 A;  5D81 A;  3SED A;  5IEO A;  1JKG B;  1W6Y A;  4HKV B;  5IG4 A;  3NBR A;  1GYB A;  1O7N B;  3NM2 A;  1Q42 A;  2F86 B;  5EVH A;  1STD A;  1OHS A;  3H51 A;  5D82 A;  3NHX A;  2XSO B;  2QGU A;  1JN5 B;  2A15 A;  4OVM A;  4XDW A;  4LEH A;  3HK4 A;  5FW5 A;  1O7G B;  2GBW B;  3NV0 A;  1E97 A;  4OUQ A;  4LMI A;  4HM2 B;  4XBY A;  1CQS A;  5IG5 A;  1ISK A;  5CF2 A;  3NUV A;  8CHO A;  2GXF A;  4WWU C;  3OWY A;  3FGY A;  1W01 A;  2Z7A A;  3LZA A;  2CKF B;  2F99 A;  4HM5 B;  3G0K A;  1EA2 A;  5DRV A;  3CNM A;  2BMR B;  3B4P A;  1OH0 A;  5IG0 A;  1ULJ B;  3DZL A;  2B1X B;  1TUH A;  1ASK A;  3FSD A;  5HGR A;  2K54 A;  1GY5 A;  3EHC A;  3F8X A;  1OF5 B;  2Z77 A;  4STD A;  2BMQ B;  2RCD A;  4FCJ A;  3Q90 A;  1TP6 A;  3VSY A;  4J9A A;  1S5A A;  3RGR A;  4R1K A;  1VZZ A;  5KP1 A;  3T8N A;  1Q40 B;  2RFR A;  2QIY A;  3GZR A;  5AEW B;  5AEU B;  3CNX A;  3HX8 A;  4RZM A;  4XDV A;  3MSO A;  4X2H A;  1OHP A;  3FZW A;  4HVN A;  4KVH A;  4L7K A;  3E99 A;  3SOY A;  5AIH A;  1W00 A;  2HMN B;  5AIF A;  6STD A;  1NDO B;  3T8U A;  5CK6 A;  1IDP A;  3S5C A;  3MHE A;  1E3V A;  4HM1 B;  1Z1S A;  4HM7 B;  2Z76 A;  3KE7 A;  4HM3 B;  3B4O A;  4WYK B;  4L8P A;  2RGQ A;  3F9S A;  3MG2 A;  4XM4 A;  4XBT A;  4GB5 A;  5CF1 A;  2GEY A;  1BUQ A;  2OWP A;  3DMC A;  3EQQ B; 
#chains in the Genus database with same CATH topology
 6RNT A;  1W6C A;  1IVU A;  1O7W B;  4RBN A;  4X2O A;  3CCM 3;  3F40 A;  2BIR A;  1BRI A;  1YNV X;  3FF2 A;  4HBR A;  1D6Y A;  4XBX A;  3PYJ A;  3JUO A;  4N6L A;  1UUW B;  1MNL A;  3F8H A;  3MG1 A;  5ELU A;  5AIG A;  1BNI A;  1RNT A;  4MMX B;  1VQP 3;  3FH1 A;  1BRG A;  1JB2 A;  4O8S A;  1B20 A;  1ZO2 A;  4I5Q A;  1LOX A;  1TJD A;  3DUK A;  1GS3 A;  3EX9 A;  3CCE 3;  1I2F A;  1OGZ A;  4CDL A;  1FUS A;  3FG3 A;  5CLK A;  1RGF A;  3D3L A;  3CCL 3;  3N54 B;  1VQL 3;  1UGI A;  2IMJ A;  4HM4 B;  4FCZ A;  1X1W A;  3F7S A;  1YJ9 3;  3AMO B;  3ER7 A;  1EG9 B;  4WP5 A;  1WMP A;  1LRA A;  2Y73 A;  3LTB A;  1X1U A;  3GSP A;  1Q40 A;  2R41 A;  2HML B;  3FLJ A;  3JUQ A;  1JNQ A;  4I4K A;  1J2B A;  1RKY A;  3DGL A;  1W5Z A;  3MWZ A;  1OAC A;  4K1U A;  1OPY A;  1RTU A;  3D9R A;  3OXA A;  4EXR A;  4O3V A;  3CCS 3;  5CXO A;  1I0X A;  4IT7 A;  1A90 A;  4KFF A;  1I3I A;  1TTO A;  4NRE A;  1BSE A;  1I2G A;  3VGN A;  4OK0 A;  1WQL B;  1RGA A;  5LC7 A;  1BAN A;  2F4Y A;  3I56 3;  4HM8 B;  2ZL8 A;  1CYU A;  1O7M B;  3TDG A;  5AI1 A;  2CW9 A;  3WR2 A;  3MYT A;  2CC3 A;  2YFJ B;  3AGO A;  1N8Q A;  3GWR A;  4IIA A;  2LYX A;  1OHO A;  2KRT A;  3K0Z A;  2F98 A;  3KKG A;  3OWU A;  3SX1 A;  1JKG A;  3S67 A;  5IEN A;  3FCS B;  5JPU A;  1K8A 4;  1NU3 A;  1ROA A;  3CXC 2;  1SQW A;  4BTW A;  1IVW A;  4RNY A;  3RGA A;  4ORL A;  1BRJ A;  1NNV A;  1SAR A;  2KF4 A;  3HI7 A;  3G4S 3;  2KF5 A;  4ILF A;  1OCV A;  2UX0 A;  1JJ2 2;  2E2U A;  4WFO A;  1BUJ A;  3LH4 A;  1RMS A;  3WMD A;  1AQZ A;  1VQ4 3;  2I9W A;  1G96 A;  1R4C A;  1GY7 A;  3B8L A;  2P0M A;  5IF6 A;  1Q7H A;  2HMK B;  2IY2 A;  2HMJ B;  2BMO B;  3FG1 A;  4KFD A;  1Q86 4;  1L5G B;  3EC9 A;  1MWR A;  3FF0 A;  1YI2 3;  3MPH A;  1X1X A;  3AHS A;  4NPB A;  1BRS A;  4MEI A;  1DMN A;  2B24 B;  3CD6 3;  4N6N B;  2R4I A;  1PYL A;  3EN8 A;  1JN5 A;  2GSP A;  3EBT A;  2GEX A;  2WGQ A;  5RNT A;  1GY6 A;  3CU3 A;  1YIT 3;  5BVB A;  5KP4 A;  1ULI B;  2JDI H;  2Z6B A;  3K7C A;  3Q3F A;  5ELJ A;  1AVL A;  2LQV A;  3DGM A;  4BU4 A;  1M9G A;  1WMN A;  1RGL A;  7STD A;  2HMM B;  2STD A;  4CJN A;  1K41 A;  3UJM A;  2H0I A;  1VQK 3;  1AVK A;  3RDE A;  1LNH A;  1RGE A;  1VQ7 3;  3WOE B;  3DGO A;  3CME 3;  3M8C A;  1TRQ A;  3PGB A;  5G1L A;  5G2G A;  5LC6 A;  3QK9 A;  2OQE A;  3Q1C A;  1BRN L;  3BLZ A;  5STD A;  2UGI A;  3S28 A;  3AHW A;  4K1V A;  5DRE A;  1KSI A;  3LOY A;  4G1M B;  3CCV 3;  4R9K A;  1BSA A;  3KSE D;  1HKX A;  3NXJ A;  1GD3 A;  4AKZ A;  2XRX B;  1DMM A;  1V74 A;  3A76 A;  2JQ5 A;  1WNH A;  1QVG 2;  3K9M C;  3CPO A;  1MWU A;  1JB5 A;  2BO9 B;  3KZT A;  3DGN A;  1JB4 A;  1UCK A;  3SLU A;  4CPK A;  1AR0 A;  4GL6 A;  3FG4 A;  1HZ1 A;  1PFP A;  3LTC A;  3BB9 A;  4MJD A;  4WHA A;  3ZG0 A;  3NQY A;  4LZI A;  2FGT A;  4ZM8 A;  5JBS A;  1BNE A;  1SII A;  1U5O A;  1T5Y A;  1VQ8 3;  1FGO A;  1OGX A;  4LGQ A;  5AII A;  5IEP A;  3B7C A;  4GSP A;  4EV2 A;  1BSB A;  1BNG A;  3F7X A;  1DYU A;  1RGK A;  2PZV A;  1EKM A;  1GOU A;  3OV4 A;  3WDG B;  4HZ9 B;  2CG1 A;  4O02 B;  4KZ1 A;  1AV4 A;  3MKI A;  1UDI I;  4Q53 A;  4HM0 B;  3H3H A;  1TU5 A;  1NO3 A;  1FZU A;  1T3B A;  4HZB B;  5A0O B;  4N3V A;  1W02 A;  1JZO A;  1G0T A;  1K9M 4;  2CHC A;  3S29 A;  2XF3 A;  1OF5 A;  1QJG A;  1LQM B;  1QMA A;  2F5W A;  1GD4 A;  1B3S A;  3WOD G;  2XFT A;  3UB1 A;  3G8Z A;  3G16 A;  3GZY B;  1MGR A;  4EV5 A;  4XB5 A;  1B2U A;  4RNT A;  3NM7 A;  1LOV A;  2CX1 A;  3SXX A;  2OCT A;  1ZX2 A;  2YFL B;  3DY5 A;  3IMA B;  4FCM A;  1V58 A;  1E3R A;  3OX9 A;  4HM6 B;  2K3D A;  9RNT A;  4R80 A;  3PXM A;  5JPP A;  3GZX B;  1VQM 3;  2WO0 A;  3ECF A;  3LYG A;  3Q2P A;  2ML5 A;  4AKY A;  4FMD A;  3LT9 A;  4K90 B;  2OOV A;  3K63 A;  3FKA A;  1FA3 A;  1IQX A;  3JUM A;  1FW7 A;  2HOH A;  2XSH B;  1YHQ 3;  1GMP A;  2QA4 3;  2P09 A;  2P38 A;  2WOF A;  3JUP A;  5D83 A;  3X40 A;  2KXG A;  3CC4 3;  3VF1 A;  1O7P B;  2CWT A;  1MWS A;  1YVB I;  1KWI A;  3HZP A;  4N6V 0;  1JRQ A;  3PCS A;  3LT8 A;  1IQ8 A;  2XEP A;  1BIR A;  3DXO A;  1BNF A;  3KSP A;  4IPB A;  1LVN A;  1GSP A;  1ROV A;  1KQS 2;  2XR8 B;  1STF I;  1SJW A;  2Y74 A;  3EJV A;  4KFE A;  3DM8 A;  3X3X A;  4AEQ A;  3GRD A;  5FGO A;  3X41 A;  5I97 A;  3N8B A;  3EF8 A;  2GBX B;  3U97 A;  3IPT A;  1A2K A;  1JBR A;  3X42 A;  1RDS A;  2W56 B;  2BNG A;  2Q07 A;  2MC8 A;  1G02 A;  2V1L A;  1QAL A;  2W03 A;  3GZB A;  4R9L A;  1RN7 A;  1TFO A;  1U8C B;  2OOV C;  1IQY A;  7GSP A;  2W2C A;  4PEJ A;  1IYY A;  5IG3 A;  1I8V A;  1W7C A;  2IUJ A;  3NV0 B;  2D1W A;  5TGN A;  4N6T A;  3SYU A;  3SOA A;  1GMQ A;  5EEO A;  1B2Z A;  4KT3 B;  4WYK A;  1VQQ A;  1CYV A;  5HOH A;  5IER A;  1CH0 A;  3UNL A;  2E2V A;  4L8O A;  1NWW A;  2HMO B;  2ZA4 A;  2ZDJ A;  1A2V A;  1N5P A;  3STD A;  1OUN A;  1ZGX A;  1US1 A;  2RSX A;  1RCK A;  2QEX 3;  2C10 A;  3O8Y A;  4NHF A;  1O7H B;  1BNR A;  4BIR A;  1S72 3;  1BSD A;  1SPU A;  2CWU A;  3EBY A;  5KP3 A;  3LTD A;  4H3U A;  4LYL B;  4U13 A;  3JUN A;  1EEJ A;  5BXQ A;  3A5E A;  4J8T A;  1B2S A;  2INX A;  1B2X A;  1YJW 3;  2RNT A;  1TRP A;  2CFL A;  1D6Z A;  1Q82 4;  4HJL B;  3EN1 B;  3BND A;  4EYC A;  1FGM A;  1BRH A;  3D4A A;  1BRK A;  2AAD A;  1EUI C;  4FMA A;  1YGW A;  2CH9 A;  3F14 A;  4HAA A;  2YFI B;  1PU4 A;  1RGH A;  1LNI A;  1UUV B;  2XGL A;  1TIJ A;  4JRF A;  1M1K 4;  4LSO A;  3KN4 A;  3I0Y A;  1C7H A;  3U1W A;  1LXE A;  1UCL A;  4BTY A;  3ROB A;  1V57 A;  3ZFZ A;  3NBJ A;  4O2H A;  2WOH A;  2IYJ A;  3J7Y d;  1Q7Y 4;  1A2P A;  4EC6 A;  3NBB A;  5AYS C;  3WA3 A;  2AAE A;  1VQ5 3;  1DMQ A;  3L0R A;  3OWS A;  1FGQ A;  1QAF A;  3MG3 A;  2L4V A;  3WA2 X;  2F5M A;  2SBL A;  5D81 A;  1IK3 A;  1IVV A;  1RCL A;  1W4N A;  3SED A;  1IT7 A;  3ZG5 A;  1VQ6 3;  3D5G A;  5IEO A;  4JF8 A;  1MWT A;  4TX4 A;  1RLS A;  1JKG B;  3CMA 3;  3AMO A;  3DH2 A;  1IVX A;  1Q9E A;  1W6Y A;  1K73 4;  4HKV B;  3CC2 3;  5IG4 A;  3G6E 3;  3CCQ 3;  1GOY A;  1F8N A;  4BTX A;  1BVI A;  1BU4 A;  1SIH A;  3BU4 A;  1FUW A;  2MF7 A;  2J8X B;  3NBR A;  3PCR A;  1GYB A;  3V98 A;  1O7N B;  1Y4K A;  3EB8 A;  3EE1 A;  3NX0 A;  1RGC A;  3NM2 A;  1Q42 A;  2F86 B;  3RNT A;  5EVH A;  5M19 A;  3KFQ C;  1STD A;  2OQE C;  1C54 A;  2FNQ A;  1B21 A;  3ALA A;  4DKI A;  3N9H A;  1OHS A;  3H51 A;  1FGR A;  5D82 A;  3NHX A;  1BOX A;  1IT8 A;  1RRH A;  2XSO B;  1B2M A;  2QGU A;  1JN5 B;  4MMY B;  5BIR A;  3D5I A;  2A15 A;  4OVM A;  4N6M A;  4XDW A;  4RNZ A;  4LEH A;  3WOF B;  1RN4 A;  4QWT A;  3HK4 A;  1R4Y A;  1NJI 4;  5FW5 A;  1K28 A;  1O7G B;  2W56 A;  1VQO 3;  1BAO A;  3AGN A;  1KD1 4;  1IU7 A;  2GBW B;  4EW5 A;  6GSP A;  1WMO A;  3BNB A;  1FYS A;  1YJN 3;  1LQG C;  1CEW I;  1YGE A;  1E97 A;  3NV0 A;  4OUQ A;  2O9U X;  5EQL A;  5G1K A;  3OW2 2;  3PZW A;  1MOL A;  1UCJ A;  2H0G A;  3PS8 A;  4LMI A;  4HM2 B;  1A67 A;  2CIU A;  4XBY A;  1CQS A;  3V99 A;  5IG5 A;  1ISK A;  1T2I A;  5CF2 A;  3NUV A;  2OTJ 3;  1WTH A;  2CFW A;  8RNT A;  8CHO A;  1EQK A;  4N6O B;  1M1X B;  2GXF A;  2YX9 A;  1RHL A;  2P0X A;  3FGY A;  1W01 A;  2Z7A A;  3BNC A;  3OWY A;  4WWU C;  3LZA A;  1N9E A;  2W9P A;  4BL3 A;  3CPW 2;  1HYF A;  2CKF B;  3LXU X;  2F99 A;  1B27 A;  4HM5 B;  1EA2 A;  3G0K A;  3DGY A;  1DE3 A;  5DRV A;  3URP A;  3X3Y A;  4BL2 A;  1I3F A;  1JBT A;  1N9J A;  1UI8 A;  2BHM A;  3CNM A;  1IV9 A;  1JV2 B;  2SAR A;  1W2Z A;  2CFD A;  3QRD A;  1UUG B;  3K5T A;  3T0U A;  3V92 A;  2W0Q A;  4FMB A;  3HII A;  2UUG C;  2BMR B;  1NB3 I;  3B4P A;  1GMR A;  1OH0 A;  2CFK A;  7RNT A;  5IG0 A;  1ULJ B;  1UCI A;  3DZL A;  1RJO A;  1FGT A;  2B1X B;  1TUH A;  1ASK A;  3FSD A;  5HGR A;  4MMZ B;  1Q81 4;  2W04 A;  2K54 A;  2ZHX B;  1LOW A;  2H0H A;  1GY5 A;  3EHC A;  5M1A A;  3I55 3;  2RBI A;  1VQ9 3;  2O3O A;  1VQN 3;  1UI7 A;  3F8X A;  1OF5 B;  2Z77 A;  4STD A;  2BMQ B;  2GU3 A;  1DVC A;  2RCD A;  4FCJ A;  2ML6 A;  1YVS A;  3Q90 A;  3UL5 A;  1AY7 A;  4R4K A;  1IV7 A;  1TP6 A;  2M7O A;  3VSY A;  4FMC A;  2CFG A;  4J9A A;  3IJE B;  2IA7 A;  1S5A A;  1UGH I;  2BT3 A;  1DVD A;  3RGR A;  3JVC A;  1I70 A;  3NQZ A;  4R1K A;  1VZZ A;  3HIG A;  5KP1 A;  4GHO A;  2KCD A;  1D6U A;  3T8N A;  2FXT A;  2P05 A;  1Q40 B;  2E2T A;  2RFR A;  2BU4 A;  2QIY A;  2IUK A;  5AYR B;  1JBS A;  2XGN A;  3GZR A;  5AEW B;  5AEU B;  1I0V A;  4J5K A;  1JZD A;  4FR9 A;  3CNX A;  3CCR 3;  1QVF 2;  1TFK A;  2XH9 A;  3HX8 A;  4RZM A;  4XDV A;  1FUT A;  3LML A;  3MSO A;  4X2H A;  3BNE A;  1OHP A;  2F56 A;  1QAK A;  3FZW A;  3CCU 3;  4HVN A;  4KVH A;  3HOH A;  4L7K A;  3WHO A;  3E99 A;  3SOY A;  1RGG A;  1RNB A;  5AIH A;  1X1Y A;  1HU9 A;  2D42 A;  1W00 A;  1RRL A;  1BNJ A;  2HMN B;  4HYZ A;  4J5G A;  5AIF A;  3SVA A;  1BSC A;  6STD A;  4K61 A;  1T2H A;  1DET A;  5BU4 A;  1NDO B;  3S27 A;  1BNS A;  3KCH A;  1MGW A;  3T8U A;  3CC7 3;  1M90 4;  1NB5 I;  5CK6 A;  1IDP A;  1KC8 4;  3S5C A;  1W6G A;  1RSN A;  2KF6 A;  3MHE A;  1E3V A;  1UW1 A;  4HM1 B;  1W2B 2;  1RN1 A;  2C4B A;  1Z1S A;  4HM7 B;  3D79 A;  2KF3 A;  2Z76 A;  3KE7 A;  1GOV A;  1N5H A;  2WGO A;  4HM3 B;  4CCV A;  1I2E A;  2C11 A;  4H61 A;  2GU1 A;  3B4O A;  2KAA A;  3UL6 A;  4WYK B;  4L8P A;  4HOH A;  2CX0 A;  3G71 3;  2XFS A;  5GSP A;  2CG0 A;  2RGQ A;  1ZS7 A;  1LOY A;  3F9S A;  3MG2 A;  1BGS A;  3GAX A;  1YIJ 3;  3KII A;  4EBG A;  2CWV A;  3BIR A;  3CCJ 3;  4XM4 A;  3LTA A;  1PY3 A;  2K0M A;  4XBT A;  1N8R 4;  2OTL 3;  2PNC A;  4GB5 A;  5M18 A;  4N6U A;  5CF1 A;  2GEY A;  5IW9 A;  2L1S A;  1BUQ A;  2OWP A;  3X3Z A;  3DMC A;  2W9Q A;  2CK3 H;  3EQQ B;  2W6J H; 
#chains in the Genus database with same CATH homology
 1W6C A;  1IVU A;  1O7W B;  4RBN A;  4X2O A;  3CCM 3;  3F40 A;  3FF2 A;  4HBR A;  1D6Y A;  4XBX A;  3PYJ A;  3JUO A;  4N6L A;  1UUW B;  1MNL A;  3F8H A;  3MG1 A;  5ELU A;  5AIG A;  4MMX B;  1VQP 3;  3FH1 A;  1JB2 A;  4O8S A;  1ZO2 A;  1LOX A;  3DUK A;  3EX9 A;  1GS3 A;  3CCE 3;  4CDL A;  1OGZ A;  3FG3 A;  5CLK A;  3CCL 3;  3D3L A;  3N54 B;  1VQL 3;  2IMJ A;  4HM4 B;  4FCZ A;  3F7S A;  1YJ9 3;  3AMO B;  3ER7 A;  1EG9 B;  4WP5 A;  1WMP A;  2Y73 A;  3LTB A;  1Q40 A;  2HML B;  3FLJ A;  3JUQ A;  1JNQ A;  4I4K A;  1J2B A;  1RKY A;  3DGL A;  1W5Z A;  3MWZ A;  1OAC A;  4K1U A;  1OPY A;  3D9R A;  4EXR A;  3OXA A;  3CCS 3;  4O3V A;  5CXO A;  4IT7 A;  1A90 A;  4KFF A;  4NRE A;  3VGN A;  4OK0 A;  1WQL B;  5LC7 A;  3I56 3;  4HM8 B;  2ZL8 A;  1CYU A;  1O7M B;  3TDG A;  5AI1 A;  2CW9 A;  3MYT A;  2CC3 A;  2YFJ B;  1N8Q A;  3GWR A;  4IIA A;  2LYX A;  1OHO A;  2KRT A;  3K0Z A;  2F98 A;  3KKG A;  3OWU A;  3SX1 A;  1JKG A;  5JPU A;  5IEN A;  3FCS B;  1K8A 4;  1NU3 A;  1ROA A;  3CXC 2;  1SQW A;  4BTW A;  1IVW A;  4RNY A;  3RGA A;  4ORL A;  3HI7 A;  3G4S 3;  1OCV A;  2UX0 A;  1JJ2 2;  2E2U A;  4WFO A;  3LH4 A;  3WMD A;  1VQ4 3;  2I9W A;  1G96 A;  1R4C A;  1GY7 A;  3B8L A;  2P0M A;  5IF6 A;  2HMK B;  2HMJ B;  2BMO B;  3FG1 A;  4KFD A;  1Q86 4;  1L5G B;  3EC9 A;  3FF0 A;  1YI2 3;  3MPH A;  4MEI A;  1DMN A;  2B24 B;  3CD6 3;  4N6N B;  2R4I A;  3EN8 A;  1JN5 A;  3EBT A;  2GEX A;  2WGQ A;  1GY6 A;  3CU3 A;  1YIT 3;  5BVB A;  5KP4 A;  1ULI B;  2JDI H;  2Z6B A;  3K7C A;  5ELJ A;  1AVL A;  2LQV A;  3DGM A;  1M9G A;  1WMN A;  7STD A;  2HMM B;  2STD A;  1K41 A;  3UJM A;  1VQK 3;  1AVK A;  3RDE A;  1LNH A;  1VQ7 3;  3WOE B;  3DGO A;  3CME 3;  3M8C A;  3PGB A;  5G2G A;  5LC6 A;  3QK9 A;  2OQE A;  3Q1C A;  3BLZ A;  5STD A;  3S28 A;  4K1V A;  5DRE A;  1KSI A;  3LOY A;  4G1M B;  3CCV 3;  4R9K A;  3KSE D;  1HKX A;  3NXJ A;  1GD3 A;  4AKZ A;  2XRX B;  1DMM A;  1V74 A;  3A76 A;  2JQ5 A;  1WNH A;  1QVG 2;  3K9M C;  3CPO A;  1JB5 A;  2BO9 B;  3KZT A;  3DGN A;  1JB4 A;  3SLU A;  1AR0 A;  4GL6 A;  3FG4 A;  1PFP A;  3LTC A;  4WHA A;  3BB9 A;  4MJD A;  3NQY A;  4LZI A;  2FGT A;  4ZM8 A;  5JBS A;  1SII A;  1U5O A;  1T5Y A;  1VQ8 3;  1FGO A;  1OGX A;  4LGQ A;  5AII A;  5IEP A;  3B7C A;  4EV2 A;  3F7X A;  1DYU A;  2PZV A;  1EKM A;  3OV4 A;  3WDG B;  4HZ9 B;  2CG1 A;  4O02 B;  4KZ1 A;  1AV4 A;  3MKI A;  4Q53 A;  4HM0 B;  3H3H A;  1TU5 A;  1NO3 A;  4HZB B;  5A0O B;  4N3V A;  1W02 A;  1K9M 4;  2CHC A;  3S29 A;  2XF3 A;  1OF5 A;  1QJG A;  1QMA A;  1GD4 A;  3WOD G;  2XFT A;  3UB1 A;  3G8Z A;  3G16 A;  3GZY B;  4EV5 A;  4XB5 A;  3NM7 A;  3SXX A;  2OCT A;  1ZX2 A;  2YFL B;  3DY5 A;  3IMA B;  4FCM A;  1E3R A;  3OX9 A;  4HM6 B;  4R80 A;  3PXM A;  5JPP A;  3GZX B;  1VQM 3;  2WO0 A;  3ECF A;  3LYG A;  3Q2P A;  2ML5 A;  4AKY A;  4FMD A;  3LT9 A;  4K90 B;  2OOV A;  3K63 A;  3FKA A;  1FA3 A;  1IQX A;  3JUM A;  2XSH B;  1YHQ 3;  2QA4 3;  2P09 A;  2P38 A;  2WOF A;  3JUP A;  5D83 A;  3X40 A;  2KXG A;  3CC4 3;  3VF1 A;  1O7P B;  2CWT A;  1YVB I;  1KWI A;  3HZP A;  4N6V 0;  1JRQ A;  3PCS A;  3LT8 A;  1IQ8 A;  2XEP A;  3DXO A;  3KSP A;  4IPB A;  1LVN A;  1ROV A;  1KQS 2;  2XR8 B;  1STF I;  1SJW A;  2Y74 A;  3EJV A;  4KFE A;  3DM8 A;  3X3X A;  4AEQ A;  3GRD A;  5FGO A;  3X41 A;  5I97 A;  3N8B A;  3EF8 A;  2GBX B;  3U97 A;  3IPT A;  1A2K A;  3X42 A;  2W56 B;  2BNG A;  2Q07 A;  2MC8 A;  2W03 A;  2V1L A;  1QAL A;  3GZB A;  4R9L A;  1RN7 A;  1TFO A;  1U8C B;  2OOV C;  1IQY A;  2W2C A;  4PEJ A;  5IG3 A;  1W7C A;  2IUJ A;  3NV0 B;  2D1W A;  5TGN A;  4N6T A;  3SOA A;  5EEO A;  4WYK A;  1CYV A;  5IER A;  3UNL A;  2E2V A;  4L8O A;  1NWW A;  2HMO B;  2ZDJ A;  1A2V A;  1N5P A;  3STD A;  1OUN A;  1US1 A;  2RSX A;  2QEX 3;  2C10 A;  3O8Y A;  4NHF A;  1O7H B;  1S72 3;  1SPU A;  2CWU A;  3EBY A;  5KP3 A;  3LTD A;  4H3U A;  4U13 A;  3JUN A;  5BXQ A;  4J8T A;  2INX A;  1YJW 3;  2CFL A;  1D6Z A;  1Q82 4;  4HJL B;  3EN1 B;  3BND A;  4EYC A;  1FGM A;  4FMA A;  2CH9 A;  3F14 A;  2YFI B;  1PU4 A;  1UUV B;  2XGL A;  1TIJ A;  4JRF A;  1M1K 4;  4LSO A;  3KN4 A;  3I0Y A;  1C7H A;  3U1W A;  1LXE A;  4BTY A;  3ROB A;  3NBJ A;  4O2H A;  2WOH A;  1Q7Y 4;  3J7Y d;  1VQ5 3;  4EC6 A;  3WA3 A;  3NBB A;  5AYS C;  1DMQ A;  3L0R A;  3OWS A;  1FGQ A;  1QAF A;  3MG3 A;  2L4V A;  3WA2 X;  2SBL A;  5D81 A;  1IK3 A;  1IVV A;  1W4N A;  3SED A;  1IT7 A;  1VQ6 3;  5IEO A;  4JF8 A;  4TX4 A;  1JKG B;  3CMA 3;  3AMO A;  1IVX A;  1W6Y A;  1K73 4;  4HKV B;  3CC2 3;  5IG4 A;  3G6E 3;  3CCQ 3;  1F8N A;  4BTX A;  1SIH A;  1FUW A;  2MF7 A;  3NBR A;  3PCR A;  1GYB A;  3V98 A;  1O7N B;  1Y4K A;  3EB8 A;  3EE1 A;  3NX0 A;  3NM2 A;  1Q42 A;  2F86 B;  5EVH A;  3KFQ C;  1STD A;  2OQE C;  2FNQ A;  3ALA A;  3N9H A;  1OHS A;  3H51 A;  1FGR A;  5D82 A;  3NHX A;  1IT8 A;  1RRH A;  2XSO B;  2QGU A;  1JN5 B;  4MMY B;  2A15 A;  4OVM A;  4N6M A;  4XDW A;  4RNZ A;  4LEH A;  3WOF B;  4QWT A;  3HK4 A;  1NJI 4;  5FW5 A;  1K28 A;  1O7G B;  2W56 A;  1VQO 3;  1KD1 4;  1IU7 A;  2GBW B;  1WMO A;  3BNB A;  1YJN 3;  1CEW I;  1YGE A;  1E97 A;  3NV0 A;  4OUQ A;  2O9U X;  5EQL A;  3OW2 2;  3PZW A;  1MOL A;  3PS8 A;  4LMI A;  4HM2 B;  1A67 A;  2CIU A;  4XBY A;  1CQS A;  3V99 A;  5IG5 A;  1ISK A;  5CF2 A;  3NUV A;  2OTJ 3;  1WTH A;  2CFW A;  8CHO A;  1EQK A;  4N6O B;  1M1X B;  2GXF A;  2YX9 A;  4WWU C;  2P0X A;  3FGY A;  1W01 A;  2Z7A A;  3BNC A;  3OWY A;  3S67 A;  3LZA A;  1N9E A;  2W9P A;  3CPW 2;  2CKF B;  3LXU X;  2F99 A;  4HM5 B;  1EA2 A;  3G0K A;  5DRV A;  3X3Y A;  1N9J A;  1UI8 A;  2BHM A;  3CNM A;  1IV9 A;  1JV2 B;  1W2Z A;  2CFD A;  3QRD A;  3K5T A;  3T0U A;  3V92 A;  2W0Q A;  4FMB A;  3HII A;  2BMR B;  1NB3 I;  3B4P A;  1OH0 A;  2CFK A;  5IG0 A;  1ULJ B;  3DZL A;  1RJO A;  1FGT A;  2B1X B;  1TUH A;  1ASK A;  3FSD A;  5HGR A;  4MMZ B;  1Q81 4;  2W04 A;  2K54 A;  1GY5 A;  3EHC A;  3I55 3;  1VQ9 3;  2O3O A;  1VQN 3;  1UI7 A;  3F8X A;  1OF5 B;  2Z77 A;  4STD A;  2BMQ B;  2GU3 A;  1DVC A;  2RCD A;  4FCJ A;  2ML6 A;  3Q90 A;  3UL5 A;  4R4K A;  1IV7 A;  1TP6 A;  2M7O A;  3VSY A;  4FMC A;  2CFG A;  4J9A A;  3IJE B;  2IA7 A;  1S5A A;  2BT3 A;  1DVD A;  3RGR A;  3JVC A;  3NQZ A;  4R1K A;  1VZZ A;  3HIG A;  5KP1 A;  2KCD A;  1D6U A;  3T8N A;  2FXT A;  2P05 A;  1Q40 B;  2E2T A;  2RFR A;  2QIY A;  2IUK A;  5AYR B;  2XGN A;  3GZR A;  5AEW B;  5AEU B;  4FR9 A;  3CNX A;  3CCR 3;  1QVF 2;  1TFK A;  2XH9 A;  3HX8 A;  4RZM A;  4XDV A;  3LML A;  3MSO A;  4X2H A;  3BNE A;  1OHP A;  3FZW A;  1QAK A;  3CCU 3;  4HVN A;  4KVH A;  4L7K A;  3E99 A;  3SOY A;  5AIH A;  1HU9 A;  2D42 A;  1W00 A;  1RRL A;  2HMN B;  5AIF A;  4HYZ A;  3SVA A;  6STD A;  4K61 A;  1NDO B;  3S27 A;  3T8U A;  3CC7 3;  1M90 4;  1NB5 I;  5CK6 A;  1IDP A;  1KC8 4;  3S5C A;  1W6G A;  3MHE A;  1E3V A;  1UW1 A;  4HM1 B;  1W2B 2;  1Z1S A;  4HM7 B;  2Z76 A;  3KE7 A;  4HM3 B;  1N5H A;  2WGO A;  4CCV A;  4H61 A;  2C11 A;  2GU1 A;  3B4O A;  3UL6 A;  4WYK B;  4L8P A;  3G71 3;  2XFS A;  2CG0 A;  2RGQ A;  3F9S A;  3MG2 A;  3GAX A;  1YIJ 3;  3KII A;  4EBG A;  2CWV A;  3CCJ 3;  4XM4 A;  3LTA A;  2K0M A;  4XBT A;  1N8R 4;  2OTL 3;  2PNC A;  4GB5 A;  4N6U A;  5CF1 A;  2GEY A;  5IW9 A;  1BUQ A;  2OWP A;  3X3Z A;  3DMC A;  2W9Q A;  2CK3 H;  3EQQ B;  2W6J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...