4GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 7 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4gspA00
1B21A 3BU4A 1BSCA 1B27A 1B3SA 1BNGA 1CH0A 1FYSA 1PY3A 1BSEA 1RCKA 1RGKA 1UCJA 1UCLA 1RTUA 1G02A 1RLSA 2KF5A 1GMPA 3GSPA 8RNTA 1X1WA 5GSPA 4RNTA 1B2SA 1I2EA 1RGFA 3RNTA 1FZUA 5BIRA 1I2FA 1RGEA 1PYLA 6RNTA 3SYUA 1I0XA 1BUJA 1IYYA 1GOUA 1SARA 1BSBA 1MGWA 5HOHA 1BOXA 1HYFA 1I3FA 3BIRA 1RGLA 1FW7A 1GOYA 1RGGA 1I0VA 1X1YA 2GSPA 1YNVX 7RNTA 1DETA 2F5WA 1X1XA 2BU4A 1JBTA 3AHSA 1B2UA 3WHOA 5RNTA 1FUTA 1I8VA 1TTOA 1RGHA 2ZA4A 1B2MA 2RNTA 1HZ1A 1RSNA 1LOVA 4HAAA 1BNFA 1LRAA 7GSPA 1RNBA 1BU4A 1BRJA 1LOYA 1B2ZA 1RHLA 4J5KA 1BAOA 1UCKA 1RCLA 1AY7A 1Q9EA 1YVSA 1RGAA 3D4AA 1BNJA 2F56A 1C54A 1RN1A 3HOHA 1BNRA 2SARA 1B2XA 1BIRA 2BIRA 6GSPA 1GSPA 1T2HA 1UCIA 1RMSA 3AGNA 4GHOA 1I2GA 9RNTA 4HOHA 4GSPA 1RGCA 1BRGA 1BRIA 2KF3A 1GMQA 1BSAA 1TRQA 3DH2A 1LNIA 1RNTA 1T2IA 1ZGXA 1BNSA 1BNIA 1BSDA 2F4YA 3AGOA 1BRHA 1BRSA 1B20A 3D5IA 3URPA 3DGYA 4J5GA 2AAEA 4BIRA 3WR2A 1BRNL 1LOWA 2F5MA 1YGWA 1R4YA 2C4BA 1JBSA 4BU4A 1FUSA 2KF6A 1X1UA 1BGSA 3AHWA 1GMRA 1I3IA 1A2PA 1BRKA 3Q3FA 5BU4A 1JBRA 1BVIA 2AADA 2RBIA 1DE3A 3KCHA 1GOVA 2HOHA 1BANA 1RN4A 1TRPA 3D5GA 1AQZA 1RDSA 1BNEA 3A5EA 1MGRA 2KF4A 1I70A 2KAAA
chains in the Genus database with same CATH superfamily
1B21A 1NO3A 1T5YA 4LZIA 4FMCA 5D82A 1RCKA 3HX8A 4STDA 1N5HA 4X2HA 3LOYA 5KP1A 1JB2A 1IDPA 1UCLA 1RTUA 4EV2A 2HMJB 5BXQA 5JBSA 1Q42A 1GMPA 1GY6A 4XBTA 1JRQA 8RNTA 1UUVB 1IQXA 5GSPA 2UGIA 4ZM8A 2OTJ3 3F8HA 1WNHA 3CD63 3T8NA 4LEHA 5KP3A 6RNTA 2I9WA 3BLZA 3SYUA 3DY5A 3HIGA 1BUJA 5LC6A 1VQ73 4BL2A 2XGLA 2XSHB 3OWUA 2K0MA 1GD3A 3B7CA 1RRHA 5CLKA 3KN4A 4XBYA 2H0HA 2YX9A 4BTXA 1GOYA 1RGGA 1YJW3 1YNVX 1A2KA 1JN5A 3B4PA 4I5QA 1IVUA 3CCR3 3H3HA 1VQO3 3K5TA 2RCDA 1JBTA 1NDOB 5EEOA 1MWTA 2D1WA 2YFJB 1KQS2 2WOFA 2R41A 1EA2A 1S5AA 3IPTA 1O7HB 1GY5A 4OUQA 1U5OA 1UUGB 1U8CB 3D3LA 2XH9A 4IT7A 2XSOB 3NV0B 1RSNA 2Z76A 2CIUA 4HAAA 1DMQA 1BNFA 3IJEB 1IVWA 1SIHA 5IG3A 1RNBA 1BRJA 1LOYA 1IV7A 4FMAA 1AV4A 3KSPA 3N8BA 4WYKB 3CCE3 2Y73A 2IMJA 3T0UA 2PZVA 2BT3A 1VQP3 1LVNA 3QRDA 4R4KA 1RGAA 2GU3A 2OWPA 1BNJA 1Q7HA 4GL6A 1M1K4 2CFDA 4HM4B 3S27A 3S29A 3HOHA 2GU1A 3BNBA 1B2XA 1W02A 4AEQA 5CF1A 1O7GB 1D6UA 3EBYA 1R4CA 3FGYA 4RNZA 3MSOA 1UGHI 2BMRB 3MYTA 4GHOA 1I2GA 2F99A 1N8QA 3NXJA 4WP5A 4HOHA 4GSPA 4RBNA 1RGCA 1TU5A 1BRGA 2C11A 4AKZA 2BO9B 1DMNA 4N6NB 1VQM3 5IG0A 2V1LA 1TRQA 3HI7A 4L8OA 1WMPA 1LNIA 3G16A 5IEOA 4XB5A 1RNTA 1T2IA 1N8R4 5AYRB 1BNSA 1BSDA 5EVHA 5CF2A 2A15A 4J5GA 2CFGA 3X3XA 4BIRA 1W6CA 3RGAA 2YFIB 1YGWA 1TFKA 1AVLA 3EC9A 3D9RA 1AR0A 1TIJA 4HM3B 3F7XA 5AIFA 1JBSA 1J2BA 4WHAA 2Z7AA 3X3YA 2CWVA 2KF6A 2W0QA 3X42A 3DUKA 1N9JA 1E97A 3ZG0A 3S5CA 4FR9A 3G6E3 1I3IA 1JBRA 4N6UA 4R80A 1IQYA 2ZL8A 1MWSA 1W2B2 1YGEA 4EV5A 1DE3A 2ZDJA 2HOHA 1ZO2A 1LQMB 1RN4A 4CJNA 1FGRA 3K63A 1AQZA 1MWRA 3OWSA 1RDSA 4XM4A 1OGXA 2OCTA 3WA2X 4OK0A 3EBTA 3G8ZA 4FMDA 3BU4A 2Z6BA 1TFOA 2P38A 1B27A 1B3SA 3CNXA 1CH0A 1PY3A 2Q07A 4MMXB 3CC23 1VQL3 4HM6B 1G02A 1RLSA 4O02B 2KF5A 2KXGA 3KFQC 4XDWA 4LSOA 3GSPA 4N6LA 4EC6A 4EW5A 2W9QA 2XFTA 6STDA 2H0IA 2FXTA 4HBRA 1RGFA 3S28A 3HIIA 3RNTA 2CK3H 2QGUA 5IW9A 1FZUA 1MNLA 5BIRA 2BMQB 1PYLA 1ZX2A 1FGQA 1IYYA 1D6YA 3N9HA 1KWIA 3ALAA 4FCJA 1A90A 1EEJA 1K8A4 2OOVA 1MGWA 5HOHA 1BOXA 3B8LA 5IENA 1I3FA 3BNEA 1RGLA 5DRVA 5EQLA 4CCVA 1FW7A 4J8TA 4EXRA 3SEDA 1STDA 1OUNA 1QMAA 1IV9A 4NPBA 1E3RA 4DKIA 3LMLA 3LTCA 3X3ZA 3JUOA 1NB3I 2ML6A 1B2UA 3KKGA 3NQYA 4MMZB 4O3VA 3WHOA 1I8VA 2GBWB 3U97A 1LQGC 1O7PB 3LTDA 2LQVA 2RNTA 3E99A 3NV0A 4HZ9B 2WOHA 3JUNA 3CCV3 1VQ83 1ULJB 1LRAA 5AIIA 1BU4A 1C7HA 1US1A 5KP4A 2MF7A 1B2ZA 2W03A 1JKGB 3BNCA 3OX9A 3EF8A 1SJWA 1NWWA 3I563 3KZTA 1Q824 5AIGA 2QEX3 4J5KA 1CQSA 3DGLA 1JZDA 5M19A 3WDGB 1Q9EA 3FKAA 3NM2A 3GRDA 3D4AA 3MWZA 1YJ93 3VF1A 3LYGA 1UI8A 1KC84 1ULIB 2F56A 3FZWA 3F8XA 2KRTA 3IMAB 4I4KA 4O8SA 3NUVA 1C54A 1MWUA 2QIYA 1BNRA 2CHCA 1FA3A 5AI1A 4EBGA 2SARA 2HMNB 4OVMA 3CCQ3 3A76A 1QAFA 3JUMA 1GSPA 1UCIA 2GEYA 2CC3A 2MC8A 1QALA 1RMSA 3AGNA 3DGNA 3EN1B 5LC7A 3V99A 3PXMA 1HU9A 3JUQA 2WGOA 1W5ZA 1JB4A 1GMQA 1QJGA 1IVXA 1OHOA 1GYBA 3DH2A 1LXEA 3CXC2 1VQ63 5ELJA 1VQ93 5M1AA 4J9AA 3G0KA 2RSXA 2CG0A 3AMOA 3X40A 1BRSA 2P0XA 1EKMA 1B20A 3KIIA 3UNLA 3LT9A 3DGYA 2OQEA 5JPPA 3CMA3 2AAEA 3LH4A 1EQKA 1V74A 3STDA 2XF3A 3CU3A 2LYXA 3EN8A 4NHFA 3F7SA 1STFI 3CCM3 1R4YA 4HKVB 3MG2A 3OWYA 3ZG5A 3CCJ3 2C4BA 5G1KA 1RN7A 1JB5A 3PCRA 1FUSA 2XEPA 3DGOA 3AHWA 3PZWA 1GMRA 3V92A 5IG4A 3VSYA 2PNCA 2KCDA 1BRKA 1Q40A 2W56B 2Z77A 4HJLB 2IA7A 2K3DA 2RBIA 1QAKA 3WOEB 4BTYA 1YJN3 3T8UA 3KCHA 1BANA 5D81A 1UDII 4GB5A 1S723 1GS3A 4R9LA 3SVAA 4HM7B 1W01A 1IK3A 2KAAA 2L1SA 5AEWB 1BSCA 2CFKA 5IEPA 1BNGA 1FYSA 2F98A 1RGKA 1UCJA 4HM5B 4TX4A 1D6ZA 1K28A 1OH0A 1UUWB 2D42A 4KVHA 3WOFB 1O7NB 1AVKA 1OF5B 2B1XB 4Q53A 4LYLB 3RGRA 1X1WA 1VQK3 1VQQA 2W9PA 2XFSA 3DM8A 1DVCA 4JRFA 4RNTA 1IT7A 1SQWA 3SOYA 4FCMA 1T3BA 1ROAA 1I2FA 1RGEA 1TUHA 1RKYA 3BB9A 1CYUA 1I0XA 3GWRA 1GOUA 3X41A 2SBLA 3EX9A 5AIHA 1IQ8A 4KT3B 2K54A 3WA3A 2W04A 3LTBA 4LGQA 3K7CA 2CX1A 3BIRA 5A0OB 3F9SA 1X1YA 3FG1A 3MG1A 3CCS3 1DETA 4HM8B 1UW1A 5TGNA 1W7CA 3FLJA 1JZOA 1V58A 2CG1A 1Z1SA 2BU4A 2P0MA 1OPYA 2Y74A 1NJI4 1UGIA 3CC43 3AHSA 3MKIA 7STDA 3V98A 5ELUA 1FGTA 1WMNA 2E2TA 1OACA 1N9EA 5JPUA 1QVG2 3EJVA 4MEIA 1ZS7A 2E2VA 2CX0A 1N5PA 4ORLA 3MG3A 2J8XB 1JJ22 2HMOB 4HZBB 5D83A 3D79A 3NBBA 2IY2A 1Q814 4JF8A 4XDVA 3NM7A 1JKGA 3ECFA 1G96A 5FGOA 1LNHA 1KD14 3MHEA 1RHLA 2O9UX 1ROVA 1E3VA 1KSIA 1UCKA 2BMOB 2XR8B 3F14A 3SXXA 1PU4A 1AY7A 1V57A 2BHMA 2RFRA 4NREA 1M1XB 3WODG 2XGNA 5STDA 1NU3A 3Q90A 4WFOA 1Q864 5HGRA 1WQLB 2W6JH 4HM2B 2P09A 4O2HA 1EG9B 3BNDA 3N54B 6GSPA 3CCL3 2L4VA 2OQEC 4IPBA 1OGZA 2CKFB 3DMCA 3U1WA 9RNTA 3UJMA 2JDIH 2XRXB 3RDEA 2E2UA 4H61A 2OOVC 2KF3A 1NNVA 4IIAA 3OXAA 1JNQA 1UI7A 5IF6A 1TJDA 1ZGXA 2F4YA 3JUPA 3AMOB 1BRHA 1LOXA 5IG5A 3URPA 3GZYB 3TDGA 2IUKA 5IERA 4U13A 1NB5I 3ER7A 4HVNA 3WR2A 3CME3 3CC73 3HK4A 1YIT3 1A2VA 1M9GA 2C10A 2CWUA 3UB1A 4CPKA 3PYJA 3CPW2 3LXUX 1X1UA 2RGQA 1BGSA 2ZHXB 3I0YA 2W2CA 3M8CA 3PS8A 4FMBA 3S67A 1ASKA 3Q3FA 1Q40B 2W56A 8CHOA 3FG4A 2AADA 3CCU3 3WMDA 4N6TA 1K9M4 5M18A 1GOVA 4KFEA 2H0GA 4RZMA 3SLUA 1OHSA 1TRPA 5FW5A 2FGTA 5AYSC 1ISKA 2B24B 1MGRA 2JQ5A 5G2GA 3G4S3 1DYUA 3G713 4K90B 1VZZA 1QVF2 1TP6A 1BSEA 3H51A 1GY7A 4AKYA 1YHQ3 4CDLA 1DVDA 1OF5A 4ILFA 2HMLB 3DGMA 3SX1A 3UL6A 1SIIA 4XBXA 2CH9A 3K9MC 1B2SA 1I2EA 2GXFA 1FGMA 2YFLB 3O8YA 1BUQA 1WTHA 3LZAA 3B4OA 3I553 1PFPA 3FF2A 1SARA 1W2ZA 4FCZA 4R9KA 1BSBA 1IU7A 4MJDA 3GZXB 4WWUC 4HM1B 3CPOA 3FF0A 1HKXA 1HYFA 2WGQA 3KE7A 2WO0A 4KFFA 1F8NA 1I0VA 2HMMB 2GSPA 3PGBA 4G1MB 7RNTA 2F5WA 1JN5B 1YVBI 1X1XA 4R1KA 3NBRA 4KFDA 1O7WB 3VGNA 3ZFZA 4N6V0 4PEJA 5CK6A 3EB8A 3PCSA 1FUTA 1TTOA 2ZA4A 1RGHA 3DZLA 3OV4A 5RNTA 1B2MA 3J7Yd 3NQZA 3Q1CA 3NHXA 1HZ1A 1LOVA 2UUGC 7GSPA 1RJOA 4LMIA 2UX0A 1FGOA 2CW9A 1W6YA 4WYKA 3F40A 1O7MB 1WMOA 3QK9A 3UL5A 3Q2PA 1BAOA 3JVCA 4K61A 1RCLA 1FUWA 1VQN3 1YVSA 3CNMA 3NBJA 2INXA 3GZBA 1RRLA 1JV2B 1RN1A 2CWTA 2F86B 3EE1A 2IUJA 1K41A 4MMYB 1YIJ3 3HZPA 1BIRA 2BIRA 2OTL3 1GD4A 4BTWA 1SPUA 1T2HA 4N6MA 5AEUB 5I97A 1M904 3EQQB 3DXOA 3EHCA 5BVBA 1OHPA 2STDA 2R4IA 1W00A 1Y4KA 4BL3A 1Q7Y4 1BRIA 4L7KA 1BSAA 3OW22 4RNYA 2P05A 3FH1A 3FG3A 3ROBA 4X2OA 2GEXA 2M7OA 1L5GB 1BNIA 1IT8A 3AGOA 3FSDA 4K1VA 5CXOA 1W6GA 3D5IA 4QWTA 1MOLA 1YI23 4K1UA 3GZRA 1BRNL 2CFWA 2QA43 2ML5A 1LOWA 2F5MA 4H3UA 1W4NA 3L0RA 4BU4A 4HM0B 4N3VA 4KZ1A 1OCVA 2O3OA 1CYVA 3KSED 5DREA 3GAXA 4L8PA 1VQ43 2IYJA 1G0TA 2CFLA 3NX0A 4N6OB 5BU4A 1A2PA 1IVVA 3FCSB 5G1LA 1BVIA 1VQ53 1DMMA 3K0ZA 3LTAA 1K734 1CEWI 2BNGA 1EUIC 2FNQA 2GBXB 3D5GA 1A67A 4EYCA 1BNEA 3A5EA 2KF4A 3MPHA 1I70A 4HYZA 3LT8A 3SOAA 2HMKB
chains in the Genus database with same CATH topology
1B21A 3BU4A 1BSCA 1B27A 1B3SA 1BNGA 1CH0A 1FYSA 1PY3A 1BSEA 1RCKA 1RGKA 1UCJA 1UCLA 1RTUA 1G02A 1RLSA 2KF5A 1GMPA 3GSPA 8RNTA 1X1WA 5GSPA 4RNTA 1B2SA 1I2EA 1RGFA 3RNTA 1FZUA 5BIRA 1I2FA 1RGEA 1PYLA 6RNTA 3SYUA 1I0XA 1BUJA 1IYYA 1GOUA 1SARA 1BSBA 1MGWA 5HOHA 1BOXA 1HYFA 1I3FA 3BIRA 1RGLA 1FW7A 1GOYA 1RGGA 1I0VA 1X1YA 2GSPA 1YNVX 7RNTA 1DETA 2F5WA 1X1XA 2BU4A 1JBTA 3AHSA 1B2UA 3WHOA 5RNTA 1FUTA 1I8VA 1TTOA 1RGHA 2ZA4A 1B2MA 2RNTA 1HZ1A 1RSNA 1LOVA 4HAAA 1BNFA 1LRAA 7GSPA 1RNBA 1BU4A 1BRJA 1LOYA 1B2ZA 1RHLA 4J5KA 1BAOA 1UCKA 1RCLA 1AY7A 1Q9EA 1YVSA 1RGAA 3D4AA 1BNJA 2F56A 1C54A 1RN1A 3HOHA 1BNRA 2SARA 1B2XA 1BIRA 2BIRA 6GSPA 1GSPA 1T2HA 1UCIA 1RMSA 3AGNA 4GHOA 1I2GA 9RNTA 4HOHA 4GSPA 1RGCA 1BRGA 1BRIA 2KF3A 1GMQA 1BSAA 1TRQA 3DH2A 1LNIA 1RNTA 1T2IA 1ZGXA 1BNSA 1BNIA 1BSDA 2F4YA 3AGOA 1BRHA 1BRSA 1B20A 3D5IA 3URPA 3DGYA 4J5GA 2AAEA 4BIRA 3WR2A 1BRNL 1LOWA 2F5MA 1YGWA 1R4YA 2C4BA 1JBSA 4BU4A 1FUSA 2KF6A 1X1UA 1BGSA 3AHWA 1GMRA 1I3IA 1A2PA 1BRKA 3Q3FA 5BU4A 1JBRA 1BVIA 2AADA 2RBIA 1DE3A 3KCHA 1GOVA 2HOHA 1BANA 1RN4A 1TRPA 3D5GA 1AQZA 1RDSA 1BNEA 3A5EA 1MGRA 2KF4A 1I70A 2KAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B21 A;  3BU4 A;  1BSC A;  1B27 A;  1B3S A;  1BNG A;  1CH0 A;  1FYS A;  1PY3 A;  1BSE A;  1RCK A;  1RGK A;  1UCJ A;  1UCL A;  1RTU A;  1G02 A;  1RLS A;  2KF5 A;  1GMP A;  3GSP A;  8RNT A;  1X1W A;  5GSP A;  4RNT A;  1B2S A;  1I2E A;  1RGF A;  3RNT A;  1FZU A;  5BIR A;  1I2F A;  1RGE A;  1PYL A;  6RNT A;  3SYU A;  1I0X A;  1BUJ A;  1IYY A;  1GOU A;  1SAR A;  1BSB A;  1MGW A;  5HOH A;  1BOX A;  1HYF A;  1I3F A;  3BIR A;  1RGL A;  1FW7 A;  1GOY A;  1RGG A;  1I0V A;  1X1Y A;  2GSP A;  1YNV X;  7RNT A;  1DET A;  2F5W A;  1X1X A;  2BU4 A;  1JBT A;  3AHS A;  1B2U A;  3WHO A;  5RNT A;  1FUT A;  1I8V A;  1TTO A;  1RGH A;  2ZA4 A;  1B2M A;  2RNT A;  1HZ1 A;  1RSN A;  1LOV A;  4HAA A;  1BNF A;  1LRA A;  7GSP A;  1RNB A;  1BU4 A;  1BRJ A;  1LOY A;  1B2Z A;  1RHL A;  4J5K A;  1BAO A;  1UCK A;  1RCL A;  1AY7 A;  1Q9E A;  1YVS A;  1RGA A;  3D4A A;  1BNJ A;  2F56 A;  1C54 A;  1RN1 A;  3HOH A;  1BNR A;  2SAR A;  1B2X A;  1BIR A;  2BIR A;  6GSP A;  1GSP A;  1T2H A;  1UCI A;  1RMS A;  3AGN A;  4GHO A;  1I2G A;  9RNT A;  4HOH A;  4GSP A;  1RGC A;  1BRG A;  1BRI A;  2KF3 A;  1GMQ A;  1BSA A;  1TRQ A;  3DH2 A;  1LNI A;  1RNT A;  1T2I A;  1ZGX A;  1BNS A;  1BNI A;  1BSD A;  2F4Y A;  3AGO A;  1BRH A;  1BRS A;  1B20 A;  3D5I A;  3URP A;  3DGY A;  4J5G A;  2AAE A;  4BIR A;  3WR2 A;  1BRN L;  1LOW A;  2F5M A;  1YGW A;  1R4Y A;  2C4B A;  1JBS A;  4BU4 A;  1FUS A;  2KF6 A;  1X1U A;  1BGS A;  3AHW A;  1GMR A;  1I3I A;  1A2P A;  1BRK A;  3Q3F A;  5BU4 A;  1JBR A;  1BVI A;  2AAD A;  2RBI A;  1DE3 A;  3KCH A;  1GOV A;  2HOH A;  1BAN A;  1RN4 A;  1TRP A;  3D5G A;  1AQZ A;  1RDS A;  1BNE A;  3A5E A;  1MGR A;  2KF4 A;  1I70 A;  2KAA A; 
#chains in the Genus database with same CATH topology
 1B21 A;  1NO3 A;  1T5Y A;  4LZI A;  4FMC A;  5D82 A;  1RCK A;  3HX8 A;  4STD A;  1N5H A;  4X2H A;  3LOY A;  5KP1 A;  1JB2 A;  1IDP A;  1UCL A;  1RTU A;  4EV2 A;  2HMJ B;  5BXQ A;  5JBS A;  1Q42 A;  1GMP A;  1GY6 A;  4XBT A;  1JRQ A;  8RNT A;  1UUV B;  1IQX A;  5GSP A;  2UGI A;  4ZM8 A;  2OTJ 3;  3F8H A;  1WNH A;  3CD6 3;  3T8N A;  4LEH A;  5KP3 A;  6RNT A;  2I9W A;  3BLZ A;  3SYU A;  3DY5 A;  3HIG A;  1BUJ A;  5LC6 A;  1VQ7 3;  4BL2 A;  2XGL A;  2XSH B;  3OWU A;  2K0M A;  1GD3 A;  3B7C A;  1RRH A;  5CLK A;  3KN4 A;  4XBY A;  2H0H A;  2YX9 A;  4BTX A;  1GOY A;  1RGG A;  1YJW 3;  1YNV X;  1A2K A;  1JN5 A;  3B4P A;  4I5Q A;  1IVU A;  3CCR 3;  3H3H A;  1VQO 3;  3K5T A;  2RCD A;  1JBT A;  1NDO B;  5EEO A;  1MWT A;  2D1W A;  2YFJ B;  1KQS 2;  2WOF A;  2R41 A;  1EA2 A;  1S5A A;  3IPT A;  1O7H B;  1GY5 A;  4OUQ A;  1U5O A;  1UUG B;  1U8C B;  3D3L A;  2XH9 A;  4IT7 A;  2XSO B;  3NV0 B;  1RSN A;  2Z76 A;  2CIU A;  4HAA A;  1DMQ A;  1BNF A;  3IJE B;  1IVW A;  1SIH A;  5IG3 A;  1RNB A;  1BRJ A;  1LOY A;  1IV7 A;  4FMA A;  1AV4 A;  3KSP A;  3N8B A;  4WYK B;  3CCE 3;  2Y73 A;  2IMJ A;  3T0U A;  2PZV A;  2BT3 A;  1VQP 3;  1LVN A;  3QRD A;  4R4K A;  1RGA A;  2GU3 A;  2OWP A;  1BNJ A;  1Q7H A;  4GL6 A;  1M1K 4;  2CFD A;  4HM4 B;  3S27 A;  3S29 A;  3HOH A;  2GU1 A;  3BNB A;  1B2X A;  1W02 A;  4AEQ A;  5CF1 A;  1O7G B;  1D6U A;  3EBY A;  1R4C A;  3FGY A;  4RNZ A;  3MSO A;  1UGH I;  2BMR B;  3MYT A;  4GHO A;  1I2G A;  2F99 A;  1N8Q A;  3NXJ A;  4WP5 A;  4HOH A;  4GSP A;  4RBN A;  1RGC A;  1TU5 A;  1BRG A;  2C11 A;  4AKZ A;  2BO9 B;  1DMN A;  4N6N B;  1VQM 3;  5IG0 A;  2V1L A;  1TRQ A;  3HI7 A;  4L8O A;  1WMP A;  1LNI A;  3G16 A;  5IEO A;  4XB5 A;  1RNT A;  1T2I A;  1N8R 4;  5AYR B;  1BNS A;  1BSD A;  5EVH A;  5CF2 A;  2A15 A;  4J5G A;  2CFG A;  3X3X A;  4BIR A;  1W6C A;  3RGA A;  2YFI B;  1YGW A;  1TFK A;  1AVL A;  3EC9 A;  3D9R A;  1AR0 A;  1TIJ A;  4HM3 B;  3F7X A;  5AIF A;  1JBS A;  1J2B A;  4WHA A;  2Z7A A;  3X3Y A;  2CWV A;  2KF6 A;  2W0Q A;  3X42 A;  3DUK A;  1N9J A;  1E97 A;  3ZG0 A;  3S5C A;  4FR9 A;  3G6E 3;  1I3I A;  1JBR A;  4N6U A;  4R80 A;  1IQY A;  2ZL8 A;  1MWS A;  1W2B 2;  1YGE A;  4EV5 A;  1DE3 A;  2ZDJ A;  2HOH A;  1ZO2 A;  1LQM B;  1RN4 A;  4CJN A;  1FGR A;  3K63 A;  1AQZ A;  1MWR A;  3OWS A;  1RDS A;  4XM4 A;  1OGX A;  2OCT A;  3WA2 X;  4OK0 A;  3EBT A;  3G8Z A;  4FMD A;  3BU4 A;  2Z6B A;  1TFO A;  2P38 A;  1B27 A;  1B3S A;  3CNX A;  1CH0 A;  1PY3 A;  2Q07 A;  4MMX B;  3CC2 3;  1VQL 3;  4HM6 B;  1G02 A;  1RLS A;  4O02 B;  2KF5 A;  2KXG A;  3KFQ C;  4XDW A;  4LSO A;  3GSP A;  4N6L A;  4EC6 A;  4EW5 A;  2W9Q A;  2XFT A;  6STD A;  2H0I A;  2FXT A;  4HBR A;  1RGF A;  3S28 A;  3HII A;  3RNT A;  2CK3 H;  2QGU A;  5IW9 A;  1FZU A;  1MNL A;  5BIR A;  2BMQ B;  1PYL A;  1ZX2 A;  1FGQ A;  1IYY A;  1D6Y A;  3N9H A;  1KWI A;  3ALA A;  4FCJ A;  1A90 A;  1EEJ A;  1K8A 4;  2OOV A;  1MGW A;  5HOH A;  1BOX A;  3B8L A;  5IEN A;  1I3F A;  3BNE A;  1RGL A;  5DRV A;  5EQL A;  4CCV A;  1FW7 A;  4J8T A;  4EXR A;  3SED A;  1STD A;  1OUN A;  1QMA A;  1IV9 A;  4NPB A;  1E3R A;  4DKI A;  3LML A;  3LTC A;  3X3Z A;  3JUO A;  1NB3 I;  2ML6 A;  1B2U A;  3KKG A;  3NQY A;  4MMZ B;  4O3V A;  3WHO A;  1I8V A;  2GBW B;  3U97 A;  1LQG C;  1O7P B;  3LTD A;  2LQV A;  2RNT A;  3E99 A;  3NV0 A;  4HZ9 B;  2WOH A;  3JUN A;  3CCV 3;  1VQ8 3;  1ULJ B;  1LRA A;  5AII A;  1BU4 A;  1C7H A;  1US1 A;  5KP4 A;  2MF7 A;  1B2Z A;  2W03 A;  1JKG B;  3BNC A;  3OX9 A;  3EF8 A;  1SJW A;  1NWW A;  3I56 3;  3KZT A;  1Q82 4;  5AIG A;  2QEX 3;  4J5K A;  1CQS A;  3DGL A;  1JZD A;  5M19 A;  3WDG B;  1Q9E A;  3FKA A;  3NM2 A;  3GRD A;  3D4A A;  3MWZ A;  1YJ9 3;  3VF1 A;  3LYG A;  1UI8 A;  1KC8 4;  1ULI B;  2F56 A;  3FZW A;  3F8X A;  2KRT A;  3IMA B;  4I4K A;  4O8S A;  3NUV A;  1C54 A;  1MWU A;  2QIY A;  1BNR A;  2CHC A;  1FA3 A;  5AI1 A;  4EBG A;  2SAR A;  2HMN B;  4OVM A;  3CCQ 3;  3A76 A;  1QAF A;  3JUM A;  1GSP A;  1UCI A;  2GEY A;  2CC3 A;  2MC8 A;  1QAL A;  1RMS A;  3AGN A;  3DGN A;  3EN1 B;  5LC7 A;  3V99 A;  3PXM A;  1HU9 A;  3JUQ A;  2WGO A;  1W5Z A;  1JB4 A;  1GMQ A;  1QJG A;  1IVX A;  1OHO A;  1GYB A;  3DH2 A;  1LXE A;  3CXC 2;  1VQ6 3;  5ELJ A;  1VQ9 3;  5M1A A;  4J9A A;  3G0K A;  2RSX A;  2CG0 A;  3AMO A;  3X40 A;  1BRS A;  2P0X A;  1EKM A;  1B20 A;  3KII A;  3UNL A;  3LT9 A;  3DGY A;  2OQE A;  5JPP A;  3CMA 3;  2AAE A;  3LH4 A;  1EQK A;  1V74 A;  3STD A;  2XF3 A;  3CU3 A;  2LYX A;  3EN8 A;  4NHF A;  3F7S A;  1STF I;  3CCM 3;  1R4Y A;  4HKV B;  3MG2 A;  3OWY A;  3ZG5 A;  3CCJ 3;  2C4B A;  5G1K A;  1RN7 A;  1JB5 A;  3PCR A;  1FUS A;  2XEP A;  3DGO A;  3AHW A;  3PZW A;  1GMR A;  3V92 A;  5IG4 A;  3VSY A;  2PNC A;  2KCD A;  1BRK A;  1Q40 A;  2W56 B;  2Z77 A;  4HJL B;  2IA7 A;  2K3D A;  2RBI A;  1QAK A;  3WOE B;  4BTY A;  1YJN 3;  3T8U A;  3KCH A;  1BAN A;  5D81 A;  1UDI I;  4GB5 A;  1S72 3;  1GS3 A;  4R9L A;  3SVA A;  4HM7 B;  1W01 A;  1IK3 A;  2KAA A;  2L1S A;  5AEW B;  1BSC A;  2CFK A;  5IEP A;  1BNG A;  1FYS A;  2F98 A;  1RGK A;  1UCJ A;  4HM5 B;  4TX4 A;  1D6Z A;  1K28 A;  1OH0 A;  1UUW B;  2D42 A;  4KVH A;  3WOF B;  1O7N B;  1AVK A;  1OF5 B;  2B1X B;  4Q53 A;  4LYL B;  3RGR A;  1X1W A;  1VQK 3;  1VQQ A;  2W9P A;  2XFS A;  3DM8 A;  1DVC A;  4JRF A;  4RNT A;  1IT7 A;  1SQW A;  3SOY A;  4FCM A;  1T3B A;  1ROA A;  1I2F A;  1RGE A;  1TUH A;  1RKY A;  3BB9 A;  1CYU A;  1I0X A;  3GWR A;  1GOU A;  3X41 A;  2SBL A;  3EX9 A;  5AIH A;  1IQ8 A;  4KT3 B;  2K54 A;  3WA3 A;  2W04 A;  3LTB A;  4LGQ A;  3K7C A;  2CX1 A;  3BIR A;  5A0O B;  3F9S A;  1X1Y A;  3FG1 A;  3MG1 A;  3CCS 3;  1DET A;  4HM8 B;  1UW1 A;  5TGN A;  1W7C A;  3FLJ A;  1JZO A;  1V58 A;  2CG1 A;  1Z1S A;  2BU4 A;  2P0M A;  1OPY A;  2Y74 A;  1NJI 4;  1UGI A;  3CC4 3;  3AHS A;  3MKI A;  7STD A;  3V98 A;  5ELU A;  1FGT A;  1WMN A;  2E2T A;  1OAC A;  1N9E A;  5JPU A;  1QVG 2;  3EJV A;  4MEI A;  1ZS7 A;  2E2V A;  2CX0 A;  1N5P A;  4ORL A;  3MG3 A;  2J8X B;  1JJ2 2;  2HMO B;  4HZB B;  5D83 A;  3D79 A;  3NBB A;  2IY2 A;  1Q81 4;  4JF8 A;  4XDV A;  3NM7 A;  1JKG A;  3ECF A;  1G96 A;  5FGO A;  1LNH A;  1KD1 4;  3MHE A;  1RHL A;  2O9U X;  1ROV A;  1E3V A;  1KSI A;  1UCK A;  2BMO B;  2XR8 B;  3F14 A;  3SXX A;  1PU4 A;  1AY7 A;  1V57 A;  2BHM A;  2RFR A;  4NRE A;  1M1X B;  3WOD G;  2XGN A;  5STD A;  1NU3 A;  3Q90 A;  4WFO A;  1Q86 4;  5HGR A;  1WQL B;  2W6J H;  4HM2 B;  2P09 A;  4O2H A;  1EG9 B;  3BND A;  3N54 B;  6GSP A;  3CCL 3;  2L4V A;  2OQE C;  4IPB A;  1OGZ A;  2CKF B;  3DMC A;  3U1W A;  9RNT A;  3UJM A;  2JDI H;  2XRX B;  3RDE A;  2E2U A;  4H61 A;  2OOV C;  2KF3 A;  1NNV A;  4IIA A;  3OXA A;  1JNQ A;  1UI7 A;  5IF6 A;  1TJD A;  1ZGX A;  2F4Y A;  3JUP A;  3AMO B;  1BRH A;  1LOX A;  5IG5 A;  3URP A;  3GZY B;  3TDG A;  2IUK A;  5IER A;  4U13 A;  1NB5 I;  3ER7 A;  4HVN A;  3WR2 A;  3CME 3;  3CC7 3;  3HK4 A;  1YIT 3;  1A2V A;  1M9G A;  2C10 A;  2CWU A;  3UB1 A;  4CPK A;  3PYJ A;  3CPW 2;  3LXU X;  1X1U A;  2RGQ A;  1BGS A;  2ZHX B;  3I0Y A;  2W2C A;  3M8C A;  3PS8 A;  4FMB A;  3S67 A;  1ASK A;  3Q3F A;  1Q40 B;  2W56 A;  8CHO A;  3FG4 A;  2AAD A;  3CCU 3;  3WMD A;  4N6T A;  1K9M 4;  5M18 A;  1GOV A;  4KFE A;  2H0G A;  4RZM A;  3SLU A;  1OHS A;  1TRP A;  5FW5 A;  2FGT A;  5AYS C;  1ISK A;  2B24 B;  1MGR A;  2JQ5 A;  5G2G A;  3G4S 3;  1DYU A;  3G71 3;  4K90 B;  1VZZ A;  1QVF 2;  1TP6 A;  1BSE A;  3H51 A;  1GY7 A;  4AKY A;  1YHQ 3;  4CDL A;  1DVD A;  1OF5 A;  4ILF A;  2HML B;  3DGM A;  3SX1 A;  3UL6 A;  1SII A;  4XBX A;  2CH9 A;  3K9M C;  1B2S A;  1I2E A;  2GXF A;  1FGM A;  2YFL B;  3O8Y A;  1BUQ A;  1WTH A;  3LZA A;  3B4O A;  3I55 3;  1PFP A;  3FF2 A;  1SAR A;  1W2Z A;  4FCZ A;  4R9K A;  1BSB A;  1IU7 A;  4MJD A;  3GZX B;  4WWU C;  4HM1 B;  3CPO A;  3FF0 A;  1HKX A;  1HYF A;  2WGQ A;  3KE7 A;  2WO0 A;  4KFF A;  1F8N A;  1I0V A;  2HMM B;  2GSP A;  3PGB A;  4G1M B;  7RNT A;  2F5W A;  1JN5 B;  1YVB I;  1X1X A;  4R1K A;  3NBR A;  4KFD A;  1O7W B;  3VGN A;  3ZFZ A;  4N6V 0;  4PEJ A;  5CK6 A;  3EB8 A;  3PCS A;  1FUT A;  1TTO A;  2ZA4 A;  1RGH A;  3DZL A;  3OV4 A;  5RNT A;  1B2M A;  3J7Y d;  3NQZ A;  3Q1C A;  3NHX A;  1HZ1 A;  1LOV A;  2UUG C;  7GSP A;  1RJO A;  4LMI A;  2UX0 A;  1FGO A;  2CW9 A;  1W6Y A;  4WYK A;  3F40 A;  1O7M B;  1WMO A;  3QK9 A;  3UL5 A;  3Q2P A;  1BAO A;  3JVC A;  4K61 A;  1RCL A;  1FUW A;  1VQN 3;  1YVS A;  3CNM A;  3NBJ A;  2INX A;  3GZB A;  1RRL A;  1JV2 B;  1RN1 A;  2CWT A;  2F86 B;  3EE1 A;  2IUJ A;  1K41 A;  4MMY B;  1YIJ 3;  3HZP A;  1BIR A;  2BIR A;  2OTL 3;  1GD4 A;  4BTW A;  1SPU A;  1T2H A;  4N6M A;  5AEU B;  5I97 A;  1M90 4;  3EQQ B;  3DXO A;  3EHC A;  5BVB A;  1OHP A;  2STD A;  2R4I A;  1W00 A;  1Y4K A;  4BL3 A;  1Q7Y 4;  1BRI A;  4L7K A;  1BSA A;  3OW2 2;  4RNY A;  2P05 A;  3FH1 A;  3FG3 A;  3ROB A;  4X2O A;  2GEX A;  2M7O A;  1L5G B;  1BNI A;  1IT8 A;  3AGO A;  3FSD A;  4K1V A;  5CXO A;  1W6G A;  3D5I A;  4QWT A;  1MOL A;  1YI2 3;  4K1U A;  3GZR A;  1BRN L;  2CFW A;  2QA4 3;  2ML5 A;  1LOW A;  2F5M A;  4H3U A;  1W4N A;  3L0R A;  4BU4 A;  4HM0 B;  4N3V A;  4KZ1 A;  1OCV A;  2O3O A;  1CYV A;  3KSE D;  5DRE A;  3GAX A;  4L8P A;  1VQ4 3;  2IYJ A;  1G0T A;  2CFL A;  3NX0 A;  4N6O B;  5BU4 A;  1A2P A;  1IVV A;  3FCS B;  5G1L A;  1BVI A;  1VQ5 3;  1DMM A;  3K0Z A;  3LTA A;  1K73 4;  1CEW I;  2BNG A;  1EUI C;  2FNQ A;  2GBX B;  3D5G A;  1A67 A;  4EYC A;  1BNE A;  3A5E A;  2KF4 A;  3MPH A;  1I70 A;  4HYZ A;  3LT8 A;  3SOA A;  2HMK B; 
#chains in the Genus database with same CATH homology
 1B21 A;  3BU4 A;  1BSC A;  1B27 A;  1B3S A;  1BNG A;  1CH0 A;  1FYS A;  1PY3 A;  1BSE A;  1RCK A;  1RGK A;  1UCJ A;  1UCL A;  1RTU A;  1G02 A;  1RLS A;  2KF5 A;  1GMP A;  3GSP A;  8RNT A;  1X1W A;  5GSP A;  4RNT A;  1B2S A;  1I2E A;  1RGF A;  3RNT A;  1FZU A;  5BIR A;  1I2F A;  1RGE A;  1PYL A;  6RNT A;  3SYU A;  1I0X A;  1BUJ A;  1IYY A;  1GOU A;  1SAR A;  1BSB A;  1MGW A;  5HOH A;  1BOX A;  1HYF A;  1I3F A;  3BIR A;  1RGL A;  1FW7 A;  1GOY A;  1RGG A;  1I0V A;  1X1Y A;  2GSP A;  1YNV X;  7RNT A;  1DET A;  2F5W A;  1X1X A;  2BU4 A;  1JBT A;  3AHS A;  1B2U A;  3WHO A;  5RNT A;  1FUT A;  1I8V A;  1TTO A;  1RGH A;  2ZA4 A;  1B2M A;  2RNT A;  1HZ1 A;  1RSN A;  1LOV A;  4HAA A;  1BNF A;  1LRA A;  7GSP A;  1RNB A;  1BU4 A;  1BRJ A;  1LOY A;  1B2Z A;  1RHL A;  4J5K A;  1BAO A;  1UCK A;  1RCL A;  1AY7 A;  1Q9E A;  1YVS A;  1RGA A;  3D4A A;  1BNJ A;  2F56 A;  1C54 A;  1RN1 A;  3HOH A;  1BNR A;  2SAR A;  1B2X A;  1BIR A;  2BIR A;  6GSP A;  1GSP A;  1T2H A;  1UCI A;  1RMS A;  3AGN A;  4GHO A;  1I2G A;  9RNT A;  4HOH A;  4GSP A;  1RGC A;  1BRG A;  1BRI A;  2KF3 A;  1GMQ A;  1BSA A;  1TRQ A;  3DH2 A;  1LNI A;  1RNT A;  1T2I A;  1ZGX A;  1BNS A;  1BNI A;  1BSD A;  2F4Y A;  3AGO A;  1BRH A;  1BRS A;  1B20 A;  3D5I A;  3URP A;  3DGY A;  4J5G A;  2AAE A;  4BIR A;  3WR2 A;  1BRN L;  1LOW A;  2F5M A;  1YGW A;  1R4Y A;  2C4B A;  1JBS A;  4BU4 A;  1FUS A;  2KF6 A;  1X1U A;  1BGS A;  3AHW A;  1GMR A;  1I3I A;  1A2P A;  1BRK A;  3Q3F A;  5BU4 A;  1JBR A;  1BVI A;  2AAD A;  2RBI A;  1DE3 A;  3KCH A;  1GOV A;  2HOH A;  1BAN A;  1RN4 A;  1TRP A;  3D5G A;  1AQZ A;  1RDS A;  1BNE A;  3A5E A;  1MGR A;  2KF4 A;  1I70 A;  2KAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...