4GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 7 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4gspA00
1I3FA 1RGAA 1RGCA 1A2PA 1AY7A 1X1WA 5BIRA 1LOVA 1FYSA 6GSPA 1GOUA 2KF3A 2KF4A 3KCHA 1I2FA 1LOYA 1BSAA 1BNGA 1GOYA 2KF5A 3WR2A 1LOWA 1B2UA 1DE3A 4J5KA 3RNTA 1GMPA 1TRPA 1UCJA 1RN1A 1RN4A 1RDSA 1I8VA 1Q9EA 2F56A 1RHLA 1UCIA 1B20A 2ZA4A 2C4BA 1X1YA 1X1UA 1B3SA 1BRNL 3WHOA 1BVIA 5GSPA 1HYFA 1RGLA 1UCLA 3AGOA 1BIRA 4HOHA 1AQZA 1RCKA 1BGSA 3AHSA 1RTUA 1BRJA 2GSPA 3HOHA 1JBRA 2KAAA 1BU4A 1BSBA 5BU4A 1B21A 1I2EA 1BRHA 5HOHA 8RNTA 2AADA 1BRKA 3Q3FA 3URPA 1SARA 7GSPA 1HZ1A 1RLSA 4BU4A 1G02A 3D5IA 1B2ZA 1GOVA 3BU4A 6RNTA 1BNJA 1BNFA 1LNIA 3BIRA 5RNTA 1MGRA 1ZGXA 3D4AA 1DETA 1IYYA 1MGWA 3DGYA 1YVSA 3SYUA 1FUSA 1BOXA 1B2SA 1GSPA 1I2GA 1FZUA 1TRQA 1CH0A 1JBTA 1RGGA 1BANA 4GSPA 1BNEA 1I3IA 1YNVX 4BIRA 2HOHA 1UCKA 2AAEA 1I0VA 1BUJA 1RGHA 7RNTA 4HAAA 1TTOA 2BIRA 1T2IA 1GMRA 2RBIA 4RNTA 1I0XA 1PY3A 1YGWA 2KF6A 1T2HA 1RNTA 2SARA 1JBSA 4J5GA 3DH2A 1BNRA 1I70A 3AGNA 2F5MA 2RNTA 3D5GA 1B2MA 1BNSA 1RGFA 1BRSA 1GMQA 1R4YA 1RSNA 1RGKA 1RMSA 1BRGA 1BSCA 1BSEA 3A5EA 1BRIA 1X1XA 4GHOA 3GSPA 1C54A 1BAOA 1LRAA 1RCLA 1FW7A 1FUTA 2BU4A 1B2XA 2F4YA 9RNTA 2F5WA 3AHWA 1B27A 1BSDA 1RNBA 1PYLA 1RGEA 1BNIA
chains in the Genus database with same CATH superfamily
1Q864 1QVF2 1WMNA 1RGAA 5TGNA 6GSPA 2WOHA 3I553 1IDPA 2KF3A 3KCHA 3GRDA 4WYKA 5KP4A 1V58A 3F8XA 1IQ8A 1GY7A 2XR8B 3KE7A 2KF5A 1LOWA 1ZX2A 3IMAB 4O8SA 4RNYA 1PFPA 1NB3I 1RDSA 2GBXB 4O3VA 2HMMB 3X3XA 3FLJA 2F56A 2WGQA 5AIHA 1B20A 4HBRA 2ZA4A 1ASKA 3SEDA 2L1SA 3CU3A 1X1UA 1VQ83 1OUNA 1UGIA 1UW1A 2Z77A 4NPBA 1BRNL 3CCV3 3NM2A 5AIIA 4LYLB 3JUPA 3WOFB 2CK3H 2D1WA 3EB8A 4FMDA 1JZOA 1HYFA 2CC3A 3AGOA 1BIRA 1E3VA 2RCDA 1AQZA 1RCKA 2HMKB 4HOHA 3CXC2 2INXA 3AMOA 2CH9A 3SX1A 2GEYA 1A90A 1VQ63 4STDA 3HOHA 3DGLA 1JBRA 2KAAA 1KD14 1BU4A 3EE1A 4DKIA 1VQN3 1W02A 1B21A 1BRHA 1IV7A 2KRTA 1EEJA 2SBLA 3EJVA 1YJ93 3N54B 1IVUA 3LZAA 3T0UA 7GSPA 1VQK3 4BTWA 3B4PA 1WMPA 1HZ1A 1W01A 2IY2A 2K54A 5EVHA 4MEIA 4BL3A 2GU3A 1G02A 4MJDA 1B2ZA 3RGRA 1GOVA 1Z1SA 3A76A 3N8BA 2QGUA 2MC8A 2ZDJA 3BIRA 5IW9A 1NU3A 5G1LA 1Q824 3ROBA 1VQO3 1TFOA 3CCE3 1CYUA 2O9UX 3SOYA 1KC84 1FUSA 4O02B 3CME3 2OOVC 3JUQA 3CCS3 2R41A 3JUNA 1W00A 2Z76A 1CH0A 1SIHA 3MG2A 3FF2A 1JBTA 1IU7A 1SIIA 1Q7Y4 5IF6A 1VQ53 1GY5A 1OACA 3CCL3 3K7CA 1N8R4 3KN4A 4EYCA 3S67A 1IQYA 3D9RA 3GZBA 4N3VA 1NDOB 4BL2A 1Q814 5FW5A 2BIRA 2XGLA 4FCMA 4R1KA 1GMRA 1UUWB 1IT7A 1I0XA 3T8NA 1RRHA 1T2HA 2W9QA 3KZTA 2D42A 3DXOA 1RNTA 3NV0B 4XDVA 3WA3A 2SARA 3PYJA 3WDGB 3KKGA 3FSDA 4J5GA 1WMOA 1EA2A 1W6YA 5KP3A 2OTL3 1K28A 2CFGA 4EV2A 1RKYA 3DY5A 1BUQA 3EC9A 3DMCA 3X42A 1B2MA 1JB2A 3NV0A 3CMA3 4X2HA 1D6ZA 2E2UA 2XEPA 4EC6A 1VQ73 1U8CB 1QMAA 3EN8A 3ZG0A 1RGKA 2BHMA 3WA2X 2J8XB 1YIT3 1UI7A 3DZLA 1BRGA 1BSCA 1C54A 1BRIA 1OF5B 4KZ1A 2Z7AA 1FUTA 2Z6BA 5AIGA 3AHWA 2OCTA 2K3DA 1EQKA 3IJEB 2CKFB 1RNBA 1TFKA 1FGRA 2GBWB 1GY6A 1TU5A 1I3FA 4HJLB 3G8ZA 3L0RA 1X1WA 5CK6A 3SOAA 3OW22 1GOUA 1DMNA 2XH9A 4HVNA 2KF4A 4IIAA 1IK3A 1QJGA 4LMIA 3UNLA 1LOYA 3CNMA 3CCM3 1BSAA 1BNGA 4HM2B 1O7GB 2CG0A 2XSHB 1IVWA 1MOLA 5G2GA 3STDA 3RNTA 1TRPA 3KSED 3IPTA 3G6E3 1RN1A 1RN4A 3S29A 2OQEC 1G0TA 1N5PA 3DGOA 1Q9EA 4CDLA 1VQ93 2I9WA 3BNEA 1UCIA 1WTHA 2R4IA 3B4OA 3S27A 2M7OA 1JV2B 2C4BA 2CW9A 6STDA 5AEUB 3F7XA 1Q40B 4N6LA 5EEOA 1B3SA 5DRVA 1W7CA 3S5CA 3WHOA 5JPUA 1K734 1K9M4 3V92A 1N9EA 1FGQA 5LC7A 5GSPA 2UX0A 3KSPA 4BTYA 1W6GA 1UCLA 2GXFA 4JF8A 3DGNA 4N6MA 1SPUA 2YFLB 2QIYA 1Q40A 2RGQA 3AHSA 3SLUA 1RTUA 2FNQA 3OWUA 3WMDA 1YJN3 2FGTA 5ELUA 4R4KA 2L4VA 1IT8A 1ULIB 1L5GB 3ALAA 2XRXB 1BSBA 5BU4A 5STDA 5HOHA 4N6TA 2KCDA 1MWTA 3K5TA 3S28A 3CC23 1RLSA 2BMRB 3BB9A 3D5IA 3FH1A 4R80A 3FKAA 3BU4A 3EN1B 2XF3A 3FG4A 2STDA 2YFIB 3CPOA 3DM8A 1SQWA 1LVNA 2BT3A 4OVMA 4X2OA 2W03A 1NO3A 4N6UA 2LQVA 1LQMB 1O7HB 1DETA 3TDGA 4BTXA 1JRQA 3SXXA 3F9SA 4K1VA 1RN7A 3LTAA 4MMYB 3NQZA 2RSXA 1JKGB 1SJWA 3PGBA 3KFQC 3LMLA 3NX0A 3OWSA 1NWWA 4WFOA 3RDEA 3X40A 1VQ43 1OHSA 2IUKA 3NBJA 1V57A 3F7SA 3JUMA 4MMZB 4KFDA 5BVBA 3KIIA 3MPHA 1I3IA 2CIUA 2CFWA 1MWSA 4BIRA 5BXQA 3G713 1IQXA 4G1MB 3LH4A 3F40A 1VZZA 1BUJA 5D81A 4R9KA 1TUHA 3CCU3 1T3BA 5IG5A 2HMLB 2RBIA 1TJDA 3OX9A 2W9PA 1EKMA 1STDA 1YVBI 2P09A 3NBRA 4LZIA 1FA3A 3MYTA 5M1AA 2GEXA 3H51A 3DH2A 1I70A 2RFRA 3M8CA 7STDA 2W2CA 3EF8A 4LGQA 1STFI 1W2ZA 4WHAA 4H3UA 2XGNA 1OH0A 4AKZA 2BNGA 3D3LA 4GL6A 4J9AA 1VQL3 1BNSA 5HGRA 4XB5A 1OHPA 3E99A 2P05A 1BRSA 1GMQA 3GWRA 4R9LA 2W56A 4NHFA 1JNQA 3V98A 1A67A 3J7Yd 2ZL8A 3F14A 1YHQ3 1BAOA 1Q42A 1YGEA 5AIFA 3CCR3 1FW7A 1V74A 2F5WA 9RNTA 4HKVB 4KFEA 5AYSC 1UDII 3FGYA 3MSOA 1BSDA 1IVVA 1RRLA 2IMJA 1VQP3 4OK0A 3CCJ3 4K90B 2CFLA 1A2VA 1A2PA 1AY7A 2BMQB 3EQQB 4WP5A 4RZMA 1W6CA 4OUQA 3ZG5A 3SVAA 2QA43 3CC73 3DGMA 3BNBA 5IG3A 3GAXA 1GOYA 3WR2A 4PEJA 1KSIA 3EBTA 4WWUC 1M9GA 1B2UA 4HM3B 4CCVA 4J5KA 1AR0A 3GZXB 1GMPA 4L8PA 3X3ZA 2LYXA 2CWUA 4AKYA 2PZVA 1KWIA 1ZS7A 4AEQA 1I8VA 8CHOA 1UI8A 2W56B 1W5ZA 2B1XB 3BLZA 2H0HA 5JPPA 2P38A 2UUGC 4EXRA 1JKGA 4CJNA 3LTCA 1E3RA 4HZ9B 4HM8B 1O7PB 2OQEA 2Y73A 1GD4A 4I5QA 2P0MA 3VGNA 1EG9B 2Y74A 2WO0A 1G96A 1OGXA 1NNVA 2GSPA 3I0YA 1MWUA 1UUVB 2P0XA 3GZRA 4O2HA 1HKXA 1AVLA 1I2EA 1OCVA 1VQM3 1N9JA 1KQS2 8RNTA 2AADA 3Q3FA 1SARA 2IYJA 3HI7A 1Y4KA 3K0ZA 1IVXA 2WOFA 3U1WA 3RGAA 5JBSA 1EUIC 3LOYA 4LEHA 2CWVA 2JDIH 1BNJA 2OWPA 6RNTA 1QVG2 5RNTA 1VQQA 1MGRA 1GYBA 1ZGXA 4FCZA 3MWZA 2XSOB 5A0OB 1D6UA 1IYYA 1FGMA 4NREA 1OF5A 2V1LA 3Q90A 3PS8A 3DGYA 4XBYA 1WNHA 3N9HA 4Q53A 5IG0A 3SYUA 1QALA 2E2VA 1GSPA 1TRQA 1FZUA 3HIGA 3MG3A 4RBNA 1W2B2 2GU1A 1GS3A 1FGOA 3WODG 4K61A 3BNDA 4GSPA 1BNEA 2W04A 3CD63 1YNVX 2HOHA 4FCJA 1UCKA 5IG4A 1TIJA 1ISKA 4HM6B 1S723 2AAEA 4HZBB 4ILFA 2FXTA 1RGHA 2BMOB 2KXGA 4IT7A 2UGIA 1R4CA 7RNTA 1TTOA 1CQSA 4RNTA 1YGWA 1M1XB 2Q07A 2ZHXB 3G0KA 4XDWA 1YI23 2YFJB 4KT3B 1JBSA 1QAFA 2PNCA 3QK9A 3UB1A 4QWTA 3UL6A 4HM4B 5KP1A 1LNHA 3NBBA 4KVHA 2YX9A 4FMAA 4N6OB 3GZYB 2C11A 1N8QA 3T8UA 1N5HA 3PCRA 3V99A 4EBGA 3ECFA 3FF0A 4TX4A 3CCQ3 5ELJA 1RMSA 2CWTA 4CPKA 1ROAA 1BSEA 3A5EA 2C10A 1X1XA 1HU9A 2E2TA 5G1KA 3UL5A 1RCLA 1PU4A 3LYGA 2BU4A 1B2XA 3LXUX 4HM5B 1DVDA 1OPYA 3G16A 1M904 5AEWB 1O7WB 5CXOA 3LT9A 3Q2PA 1NJI4 1PYLA 1CYVA 2B24B 1RGEA 1WQLB 1BNIA 3CC43 2OTJ3 4L8OA 4HM0B 2XFSA 1RGCA 1ROVA 1RJOA 3HX8A 3O8YA 1LOVA 1FYSA 3ER7A 1FGTA 4FMBA 4L7KA 5D83A 5BIRA 1I2FA 3MHEA 1IV9A 1DMMA 3JVCA 4ZM8A 3JUOA 4WYKB 1A2KA 3HK4A 3FG3A 3FZWA 2CX1A 4FR9A 3OXAA 4HM7B 3UJMA 2HMNB 1DE3A 1UCJA 1DYUA 1LOXA 3K9MC 1K8A4 1AV4A 1RHLA 3B7CA 1TP6A 3MG1A 1X1YA 2F98A 4EV5A 5FGOA 5IEPA 2A15A 3LTDA 4KFFA 2IUJA 5IEOA 1US1A 5D82A 3QRDA 1QAKA 4EW5A 5DREA 2BO9B 1BVIA 2MF7A 3CNXA 4RNZA 1E97A 1RGLA 3DUKA 1DMQA 3PCSA 3F8HA 4HYZA 1LXEA 5CLKA 2CFKA 1NB5I 1C7HA 5CF1A 2F99A 3HIIA 1BGSA 3K63A 1JJ22 3MKIA 1BRJA 2W0QA 1ULJB 1Q7HA 4IPBA 3CPW2 3ZFZA 4I4KA 1JZDA 5IENA 3LTBA 1BRKA 2WGOA 3URPA 2H0GA 3Q1CA 5M19A 3EX9A 4J8TA 2CFDA 3NHXA 3FG1A 4BU4A 4U13A 1JN5B 4XBTA 3PZWA 4N6V0 1BNFA 3HZPA 1MWRA 2HMOB 2CHCA 1FUWA 3OV4A 3U97A 2CX0A 2ML6A 3D4AA 1MGWA 1K41A 3NQYA 4ORLA 3I563 1YVSA 1W4NA 3H3HA 4H61A 4HM1B 1BOXA 1B2SA 1GD3A 1I2GA 3D79A 1YJW3 1F8NA 2HMJB 1YIJ3 1RGGA 1BANA 1OGZA 1AVKA 1S5AA 2IA7A 5EQLA 3G4S3 5CF2A 1J2BA 4LSOA 1O7MB 2O3OA 1I0VA 3NM7A 4XBXA 5AI1A 4HAAA 4XM4A 3PXMA 1OHOA 1T2IA 2F86B 5M18A 1PY3A 3NXJA 2KF6A 2CG1A 3LT8A 3WOEB 5IERA 1D6YA 1T5YA 3AMOB 4N6NB 1BNRA 1MNLA 3X3YA 4K1UA 5LC6A 3AGNA 3OWYA 3NUVA 4JRFA 2F5MA 1JB4A 1UGHI 1LQGC 2RNTA 4FMCA 1U5OA 3D5GA 2OOVA 3FCSB 5AYRB 5I97A 1RGFA 1R4YA 3EBYA 1RSNA 2QEX3 2W6JH 4MMXB 3EHCA 3VF1A 3X41A 1O7NB 2H0IA 2ML5A 1JB5A 2XFTA 1ZO2A 4GHOA 3GSPA 1M1K4 1LRAA 1UUGB 2F4YA 3B8LA 1DVCA 2K0MA 2JQ5A 4GB5A 1B27A 3BNCA 1JN5A 3VSYA 1CEWI 1LNIA
chains in the Genus database with same CATH topology
1I3FA 1RGAA 1RGCA 1A2PA 1AY7A 1X1WA 5BIRA 1LOVA 1FYSA 6GSPA 1GOUA 2KF3A 2KF4A 3KCHA 1I2FA 1LOYA 1BSAA 1BNGA 1GOYA 2KF5A 3WR2A 1LOWA 1B2UA 1DE3A 4J5KA 3RNTA 1GMPA 1TRPA 1UCJA 1RN1A 1RN4A 1RDSA 1I8VA 1Q9EA 2F56A 1RHLA 1UCIA 1B20A 2ZA4A 2C4BA 1X1YA 1X1UA 1B3SA 1BRNL 3WHOA 1BVIA 5GSPA 1HYFA 1RGLA 1UCLA 3AGOA 1BIRA 4HOHA 1AQZA 1RCKA 1BGSA 3AHSA 1RTUA 1BRJA 2GSPA 3HOHA 1JBRA 2KAAA 1BU4A 1BSBA 5BU4A 1B21A 1I2EA 1BRHA 5HOHA 8RNTA 2AADA 1BRKA 3Q3FA 3URPA 1SARA 7GSPA 1HZ1A 1RLSA 4BU4A 1G02A 3D5IA 1B2ZA 1GOVA 3BU4A 6RNTA 1BNJA 1BNFA 1LNIA 3BIRA 5RNTA 1MGRA 1ZGXA 3D4AA 1DETA 1IYYA 1MGWA 3DGYA 1YVSA 3SYUA 1FUSA 1BOXA 1B2SA 1GSPA 1I2GA 1FZUA 1TRQA 1CH0A 1JBTA 1RGGA 1BANA 4GSPA 1BNEA 1I3IA 1YNVX 4BIRA 2HOHA 1UCKA 2AAEA 1I0VA 1BUJA 1RGHA 7RNTA 4HAAA 1TTOA 2BIRA 1T2IA 1GMRA 2RBIA 4RNTA 1I0XA 1PY3A 1YGWA 2KF6A 1T2HA 1RNTA 2SARA 1JBSA 4J5GA 3DH2A 1BNRA 1I70A 3AGNA 2F5MA 2RNTA 3D5GA 1B2MA 1BNSA 1RGFA 1BRSA 1GMQA 1R4YA 1RSNA 1RGKA 1RMSA 1BRGA 1BSCA 1BSEA 3A5EA 1BRIA 1X1XA 4GHOA 3GSPA 1C54A 1BAOA 1LRAA 1RCLA 1FW7A 1FUTA 2BU4A 1B2XA 2F4YA 9RNTA 2F5WA 3AHWA 1B27A 1BSDA 1RNBA 1PYLA 1RGEA 1BNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3F A;  1RGA A;  1RGC A;  1A2P A;  1AY7 A;  1X1W A;  5BIR A;  1LOV A;  1FYS A;  6GSP A;  1GOU A;  2KF3 A;  2KF4 A;  3KCH A;  1I2F A;  1LOY A;  1BSA A;  1BNG A;  1GOY A;  2KF5 A;  3WR2 A;  1LOW A;  1B2U A;  1DE3 A;  4J5K A;  3RNT A;  1GMP A;  1TRP A;  1UCJ A;  1RN1 A;  1RN4 A;  1RDS A;  1I8V A;  1Q9E A;  2F56 A;  1RHL A;  1UCI A;  1B20 A;  2ZA4 A;  2C4B A;  1X1Y A;  1X1U A;  1B3S A;  1BRN L;  3WHO A;  1BVI A;  5GSP A;  1HYF A;  1RGL A;  1UCL A;  3AGO A;  1BIR A;  4HOH A;  1AQZ A;  1RCK A;  1BGS A;  3AHS A;  1RTU A;  1BRJ A;  2GSP A;  3HOH A;  1JBR A;  2KAA A;  1BU4 A;  1BSB A;  5BU4 A;  1B21 A;  1I2E A;  1BRH A;  5HOH A;  8RNT A;  2AAD A;  1BRK A;  3Q3F A;  3URP A;  1SAR A;  7GSP A;  1HZ1 A;  1RLS A;  4BU4 A;  1G02 A;  3D5I A;  1B2Z A;  1GOV A;  3BU4 A;  6RNT A;  1BNJ A;  1BNF A;  1LNI A;  3BIR A;  5RNT A;  1MGR A;  1ZGX A;  3D4A A;  1DET A;  1IYY A;  1MGW A;  3DGY A;  1YVS A;  3SYU A;  1FUS A;  1BOX A;  1B2S A;  1GSP A;  1I2G A;  1FZU A;  1TRQ A;  1CH0 A;  1JBT A;  1RGG A;  1BAN A;  4GSP A;  1BNE A;  1I3I A;  1YNV X;  4BIR A;  2HOH A;  1UCK A;  2AAE A;  1I0V A;  1BUJ A;  1RGH A;  7RNT A;  4HAA A;  1TTO A;  2BIR A;  1T2I A;  1GMR A;  2RBI A;  4RNT A;  1I0X A;  1PY3 A;  1YGW A;  2KF6 A;  1T2H A;  1RNT A;  2SAR A;  1JBS A;  4J5G A;  3DH2 A;  1BNR A;  1I70 A;  3AGN A;  2F5M A;  2RNT A;  3D5G A;  1B2M A;  1BNS A;  1RGF A;  1BRS A;  1GMQ A;  1R4Y A;  1RSN A;  1RGK A;  1RMS A;  1BRG A;  1BSC A;  1BSE A;  3A5E A;  1BRI A;  1X1X A;  4GHO A;  3GSP A;  1C54 A;  1BAO A;  1LRA A;  1RCL A;  1FW7 A;  1FUT A;  2BU4 A;  1B2X A;  2F4Y A;  9RNT A;  2F5W A;  3AHW A;  1B27 A;  1BSD A;  1RNB A;  1PYL A;  1RGE A;  1BNI A; 
#chains in the Genus database with same CATH topology
 1Q86 4;  1QVF 2;  1WMN A;  1RGA A;  5TGN A;  6GSP A;  2WOH A;  3I55 3;  1IDP A;  2KF3 A;  3KCH A;  3GRD A;  4WYK A;  5KP4 A;  1V58 A;  3F8X A;  1IQ8 A;  1GY7 A;  2XR8 B;  3KE7 A;  2KF5 A;  1LOW A;  1ZX2 A;  3IMA B;  4O8S A;  4RNY A;  1PFP A;  1NB3 I;  1RDS A;  2GBX B;  4O3V A;  2HMM B;  3X3X A;  3FLJ A;  2F56 A;  2WGQ A;  5AIH A;  1B20 A;  4HBR A;  2ZA4 A;  1ASK A;  3SED A;  2L1S A;  3CU3 A;  1X1U A;  1VQ8 3;  1OUN A;  1UGI A;  1UW1 A;  2Z77 A;  4NPB A;  1BRN L;  3CCV 3;  3NM2 A;  5AII A;  4LYL B;  3JUP A;  3WOF B;  2CK3 H;  2D1W A;  3EB8 A;  4FMD A;  1JZO A;  1HYF A;  2CC3 A;  3AGO A;  1BIR A;  1E3V A;  2RCD A;  1AQZ A;  1RCK A;  2HMK B;  4HOH A;  3CXC 2;  2INX A;  3AMO A;  2CH9 A;  3SX1 A;  2GEY A;  1A90 A;  1VQ6 3;  4STD A;  3HOH A;  3DGL A;  1JBR A;  2KAA A;  1KD1 4;  1BU4 A;  3EE1 A;  4DKI A;  1VQN 3;  1W02 A;  1B21 A;  1BRH A;  1IV7 A;  2KRT A;  1EEJ A;  2SBL A;  3EJV A;  1YJ9 3;  3N54 B;  1IVU A;  3LZA A;  3T0U A;  7GSP A;  1VQK 3;  4BTW A;  3B4P A;  1WMP A;  1HZ1 A;  1W01 A;  2IY2 A;  2K54 A;  5EVH A;  4MEI A;  4BL3 A;  2GU3 A;  1G02 A;  4MJD A;  1B2Z A;  3RGR A;  1GOV A;  1Z1S A;  3A76 A;  3N8B A;  2QGU A;  2MC8 A;  2ZDJ A;  3BIR A;  5IW9 A;  1NU3 A;  5G1L A;  1Q82 4;  3ROB A;  1VQO 3;  1TFO A;  3CCE 3;  1CYU A;  2O9U X;  3SOY A;  1KC8 4;  1FUS A;  4O02 B;  3CME 3;  2OOV C;  3JUQ A;  3CCS 3;  2R41 A;  3JUN A;  1W00 A;  2Z76 A;  1CH0 A;  1SIH A;  3MG2 A;  3FF2 A;  1JBT A;  1IU7 A;  1SII A;  1Q7Y 4;  5IF6 A;  1VQ5 3;  1GY5 A;  1OAC A;  3CCL 3;  3K7C A;  1N8R 4;  3KN4 A;  4EYC A;  3S67 A;  1IQY A;  3D9R A;  3GZB A;  4N3V A;  1NDO B;  4BL2 A;  1Q81 4;  5FW5 A;  2BIR A;  2XGL A;  4FCM A;  4R1K A;  1GMR A;  1UUW B;  1IT7 A;  1I0X A;  3T8N A;  1RRH A;  1T2H A;  2W9Q A;  3KZT A;  2D42 A;  3DXO A;  1RNT A;  3NV0 B;  4XDV A;  3WA3 A;  2SAR A;  3PYJ A;  3WDG B;  3KKG A;  3FSD A;  4J5G A;  1WMO A;  1EA2 A;  1W6Y A;  5KP3 A;  2OTL 3;  1K28 A;  2CFG A;  4EV2 A;  1RKY A;  3DY5 A;  1BUQ A;  3EC9 A;  3DMC A;  3X42 A;  1B2M A;  1JB2 A;  3NV0 A;  3CMA 3;  4X2H A;  1D6Z A;  2E2U A;  2XEP A;  4EC6 A;  1VQ7 3;  1U8C B;  1QMA A;  3EN8 A;  3ZG0 A;  1RGK A;  2BHM A;  3WA2 X;  2J8X B;  1YIT 3;  1UI7 A;  3DZL A;  1BRG A;  1BSC A;  1C54 A;  1BRI A;  1OF5 B;  4KZ1 A;  2Z7A A;  1FUT A;  2Z6B A;  5AIG A;  3AHW A;  2OCT A;  2K3D A;  1EQK A;  3IJE B;  2CKF B;  1RNB A;  1TFK A;  1FGR A;  2GBW B;  1GY6 A;  1TU5 A;  1I3F A;  4HJL B;  3G8Z A;  3L0R A;  1X1W A;  5CK6 A;  3SOA A;  3OW2 2;  1GOU A;  1DMN A;  2XH9 A;  4HVN A;  2KF4 A;  4IIA A;  1IK3 A;  1QJG A;  4LMI A;  3UNL A;  1LOY A;  3CNM A;  3CCM 3;  1BSA A;  1BNG A;  4HM2 B;  1O7G B;  2CG0 A;  2XSH B;  1IVW A;  1MOL A;  5G2G A;  3STD A;  3RNT A;  1TRP A;  3KSE D;  3IPT A;  3G6E 3;  1RN1 A;  1RN4 A;  3S29 A;  2OQE C;  1G0T A;  1N5P A;  3DGO A;  1Q9E A;  4CDL A;  1VQ9 3;  2I9W A;  3BNE A;  1UCI A;  1WTH A;  2R4I A;  3B4O A;  3S27 A;  2M7O A;  1JV2 B;  2C4B A;  2CW9 A;  6STD A;  5AEU B;  3F7X A;  1Q40 B;  4N6L A;  5EEO A;  1B3S A;  5DRV A;  1W7C A;  3S5C A;  3WHO A;  5JPU A;  1K73 4;  1K9M 4;  3V92 A;  1N9E A;  1FGQ A;  5LC7 A;  5GSP A;  2UX0 A;  3KSP A;  4BTY A;  1W6G A;  1UCL A;  2GXF A;  4JF8 A;  3DGN A;  4N6M A;  1SPU A;  2YFL B;  2QIY A;  1Q40 A;  2RGQ A;  3AHS A;  3SLU A;  1RTU A;  2FNQ A;  3OWU A;  3WMD A;  1YJN 3;  2FGT A;  5ELU A;  4R4K A;  2L4V A;  1IT8 A;  1ULI B;  1L5G B;  3ALA A;  2XRX B;  1BSB A;  5BU4 A;  5STD A;  5HOH A;  4N6T A;  2KCD A;  1MWT A;  3K5T A;  3S28 A;  3CC2 3;  1RLS A;  2BMR B;  3BB9 A;  3D5I A;  3FH1 A;  4R80 A;  3FKA A;  3BU4 A;  3EN1 B;  2XF3 A;  3FG4 A;  2STD A;  2YFI B;  3CPO A;  3DM8 A;  1SQW A;  1LVN A;  2BT3 A;  4OVM A;  4X2O A;  2W03 A;  1NO3 A;  4N6U A;  2LQV A;  1LQM B;  1O7H B;  1DET A;  3TDG A;  4BTX A;  1JRQ A;  3SXX A;  3F9S A;  4K1V A;  1RN7 A;  3LTA A;  4MMY B;  3NQZ A;  2RSX A;  1JKG B;  1SJW A;  3PGB A;  3KFQ C;  3LML A;  3NX0 A;  3OWS A;  1NWW A;  4WFO A;  3RDE A;  3X40 A;  1VQ4 3;  1OHS A;  2IUK A;  3NBJ A;  1V57 A;  3F7S A;  3JUM A;  4MMZ B;  4KFD A;  5BVB A;  3KII A;  3MPH A;  1I3I A;  2CIU A;  2CFW A;  1MWS A;  4BIR A;  5BXQ A;  3G71 3;  1IQX A;  4G1M B;  3LH4 A;  3F40 A;  1VZZ A;  1BUJ A;  5D81 A;  4R9K A;  1TUH A;  3CCU 3;  1T3B A;  5IG5 A;  2HML B;  2RBI A;  1TJD A;  3OX9 A;  2W9P A;  1EKM A;  1STD A;  1YVB I;  2P09 A;  3NBR A;  4LZI A;  1FA3 A;  3MYT A;  5M1A A;  2GEX A;  3H51 A;  3DH2 A;  1I70 A;  2RFR A;  3M8C A;  7STD A;  2W2C A;  3EF8 A;  4LGQ A;  1STF I;  1W2Z A;  4WHA A;  4H3U A;  2XGN A;  1OH0 A;  4AKZ A;  2BNG A;  3D3L A;  4GL6 A;  4J9A A;  1VQL 3;  1BNS A;  5HGR A;  4XB5 A;  1OHP A;  3E99 A;  2P05 A;  1BRS A;  1GMQ A;  3GWR A;  4R9L A;  2W56 A;  4NHF A;  1JNQ A;  3V98 A;  1A67 A;  3J7Y d;  2ZL8 A;  3F14 A;  1YHQ 3;  1BAO A;  1Q42 A;  1YGE A;  5AIF A;  3CCR 3;  1FW7 A;  1V74 A;  2F5W A;  9RNT A;  4HKV B;  4KFE A;  5AYS C;  1UDI I;  3FGY A;  3MSO A;  1BSD A;  1IVV A;  1RRL A;  2IMJ A;  1VQP 3;  4OK0 A;  3CCJ 3;  4K90 B;  2CFL A;  1A2V A;  1A2P A;  1AY7 A;  2BMQ B;  3EQQ B;  4WP5 A;  4RZM A;  1W6C A;  4OUQ A;  3ZG5 A;  3SVA A;  2QA4 3;  3CC7 3;  3DGM A;  3BNB A;  5IG3 A;  3GAX A;  1GOY A;  3WR2 A;  4PEJ A;  1KSI A;  3EBT A;  4WWU C;  1M9G A;  1B2U A;  4HM3 B;  4CCV A;  4J5K A;  1AR0 A;  3GZX B;  1GMP A;  4L8P A;  3X3Z A;  2LYX A;  2CWU A;  4AKY A;  2PZV A;  1KWI A;  1ZS7 A;  4AEQ A;  1I8V A;  8CHO A;  1UI8 A;  2W56 B;  1W5Z A;  2B1X B;  3BLZ A;  2H0H A;  5JPP A;  2P38 A;  2UUG C;  4EXR A;  1JKG A;  4CJN A;  3LTC A;  1E3R A;  4HZ9 B;  4HM8 B;  1O7P B;  2OQE A;  2Y73 A;  1GD4 A;  4I5Q A;  2P0M A;  3VGN A;  1EG9 B;  2Y74 A;  2WO0 A;  1G96 A;  1OGX A;  1NNV A;  2GSP A;  3I0Y A;  1MWU A;  1UUV B;  2P0X A;  3GZR A;  4O2H A;  1HKX A;  1AVL A;  1I2E A;  1OCV A;  1VQM 3;  1N9J A;  1KQS 2;  8RNT A;  2AAD A;  3Q3F A;  1SAR A;  2IYJ A;  3HI7 A;  1Y4K A;  3K0Z A;  1IVX A;  2WOF A;  3U1W A;  3RGA A;  5JBS A;  1EUI C;  3LOY A;  4LEH A;  2CWV A;  2JDI H;  1BNJ A;  2OWP A;  6RNT A;  1QVG 2;  5RNT A;  1VQQ A;  1MGR A;  1GYB A;  1ZGX A;  4FCZ A;  3MWZ A;  2XSO B;  5A0O B;  1D6U A;  1IYY A;  1FGM A;  4NRE A;  1OF5 A;  2V1L A;  3Q90 A;  3PS8 A;  3DGY A;  4XBY A;  1WNH A;  3N9H A;  4Q53 A;  5IG0 A;  3SYU A;  1QAL A;  2E2V A;  1GSP A;  1TRQ A;  1FZU A;  3HIG A;  3MG3 A;  4RBN A;  1W2B 2;  2GU1 A;  1GS3 A;  1FGO A;  3WOD G;  4K61 A;  3BND A;  4GSP A;  1BNE A;  2W04 A;  3CD6 3;  1YNV X;  2HOH A;  4FCJ A;  1UCK A;  5IG4 A;  1TIJ A;  1ISK A;  4HM6 B;  1S72 3;  2AAE A;  4HZB B;  4ILF A;  2FXT A;  1RGH A;  2BMO B;  2KXG A;  4IT7 A;  2UGI A;  1R4C A;  7RNT A;  1TTO A;  1CQS A;  4RNT A;  1YGW A;  1M1X B;  2Q07 A;  2ZHX B;  3G0K A;  4XDW A;  1YI2 3;  2YFJ B;  4KT3 B;  1JBS A;  1QAF A;  2PNC A;  3QK9 A;  3UB1 A;  4QWT A;  3UL6 A;  4HM4 B;  5KP1 A;  1LNH A;  3NBB A;  4KVH A;  2YX9 A;  4FMA A;  4N6O B;  3GZY B;  2C11 A;  1N8Q A;  3T8U A;  1N5H A;  3PCR A;  3V99 A;  4EBG A;  3ECF A;  3FF0 A;  4TX4 A;  3CCQ 3;  5ELJ A;  1RMS A;  2CWT A;  4CPK A;  1ROA A;  1BSE A;  3A5E A;  2C10 A;  1X1X A;  1HU9 A;  2E2T A;  5G1K A;  3UL5 A;  1RCL A;  1PU4 A;  3LYG A;  2BU4 A;  1B2X A;  3LXU X;  4HM5 B;  1DVD A;  1OPY A;  3G16 A;  1M90 4;  5AEW B;  1O7W B;  5CXO A;  3LT9 A;  3Q2P A;  1NJI 4;  1PYL A;  1CYV A;  2B24 B;  1RGE A;  1WQL B;  1BNI A;  3CC4 3;  2OTJ 3;  4L8O A;  4HM0 B;  2XFS A;  1RGC A;  1ROV A;  1RJO A;  3HX8 A;  3O8Y A;  1LOV A;  1FYS A;  3ER7 A;  1FGT A;  4FMB A;  4L7K A;  5D83 A;  5BIR A;  1I2F A;  3MHE A;  1IV9 A;  1DMM A;  3JVC A;  4ZM8 A;  3JUO A;  4WYK B;  1A2K A;  3HK4 A;  3FG3 A;  3FZW A;  2CX1 A;  4FR9 A;  3OXA A;  4HM7 B;  3UJM A;  2HMN B;  1DE3 A;  1UCJ A;  1DYU A;  1LOX A;  3K9M C;  1K8A 4;  1AV4 A;  1RHL A;  3B7C A;  1TP6 A;  3MG1 A;  1X1Y A;  2F98 A;  4EV5 A;  5FGO A;  5IEP A;  2A15 A;  3LTD A;  4KFF A;  2IUJ A;  5IEO A;  1US1 A;  5D82 A;  3QRD A;  1QAK A;  4EW5 A;  5DRE A;  2BO9 B;  1BVI A;  2MF7 A;  3CNX A;  4RNZ A;  1E97 A;  1RGL A;  3DUK A;  1DMQ A;  3PCS A;  3F8H A;  4HYZ A;  1LXE A;  5CLK A;  2CFK A;  1NB5 I;  1C7H A;  5CF1 A;  2F99 A;  3HII A;  1BGS A;  3K63 A;  1JJ2 2;  3MKI A;  1BRJ A;  2W0Q A;  1ULJ B;  1Q7H A;  4IPB A;  3CPW 2;  3ZFZ A;  4I4K A;  1JZD A;  5IEN A;  3LTB A;  1BRK A;  2WGO A;  3URP A;  2H0G A;  3Q1C A;  5M19 A;  3EX9 A;  4J8T A;  2CFD A;  3NHX A;  3FG1 A;  4BU4 A;  4U13 A;  1JN5 B;  4XBT A;  3PZW A;  4N6V 0;  1BNF A;  3HZP A;  1MWR A;  2HMO B;  2CHC A;  1FUW A;  3OV4 A;  3U97 A;  2CX0 A;  2ML6 A;  3D4A A;  1MGW A;  1K41 A;  3NQY A;  4ORL A;  3I56 3;  1YVS A;  1W4N A;  3H3H A;  4H61 A;  4HM1 B;  1BOX A;  1B2S A;  1GD3 A;  1I2G A;  3D79 A;  1YJW 3;  1F8N A;  2HMJ B;  1YIJ 3;  1RGG A;  1BAN A;  1OGZ A;  1AVK A;  1S5A A;  2IA7 A;  5EQL A;  3G4S 3;  5CF2 A;  1J2B A;  4LSO A;  1O7M B;  2O3O A;  1I0V A;  3NM7 A;  4XBX A;  5AI1 A;  4HAA A;  4XM4 A;  3PXM A;  1OHO A;  1T2I A;  2F86 B;  5M18 A;  1PY3 A;  3NXJ A;  2KF6 A;  2CG1 A;  3LT8 A;  3WOE B;  5IER A;  1D6Y A;  1T5Y A;  3AMO B;  4N6N B;  1BNR A;  1MNL A;  3X3Y A;  4K1U A;  5LC6 A;  3AGN A;  3OWY A;  3NUV A;  4JRF A;  2F5M A;  1JB4 A;  1UGH I;  1LQG C;  2RNT A;  4FMC A;  1U5O A;  3D5G A;  2OOV A;  3FCS B;  5AYR B;  5I97 A;  1RGF A;  1R4Y A;  3EBY A;  1RSN A;  2QEX 3;  2W6J H;  4MMX B;  3EHC A;  3VF1 A;  3X41 A;  1O7N B;  2H0I A;  2ML5 A;  1JB5 A;  2XFT A;  1ZO2 A;  4GHO A;  3GSP A;  1M1K 4;  1LRA A;  1UUG B;  2F4Y A;  3B8L A;  1DVC A;  2K0M A;  2JQ5 A;  4GB5 A;  1B27 A;  3BNC A;  1JN5 A;  3VSY A;  1CEW I;  1LNI A; 
#chains in the Genus database with same CATH homology
 1I3F A;  1RGA A;  1RGC A;  1A2P A;  1AY7 A;  1X1W A;  5BIR A;  1LOV A;  1FYS A;  6GSP A;  1GOU A;  2KF3 A;  2KF4 A;  3KCH A;  1I2F A;  1LOY A;  1BSA A;  1BNG A;  1GOY A;  2KF5 A;  3WR2 A;  1LOW A;  1B2U A;  1DE3 A;  4J5K A;  3RNT A;  1GMP A;  1TRP A;  1UCJ A;  1RN1 A;  1RN4 A;  1RDS A;  1I8V A;  1Q9E A;  2F56 A;  1RHL A;  1UCI A;  1B20 A;  2ZA4 A;  2C4B A;  1X1Y A;  1X1U A;  1B3S A;  1BRN L;  3WHO A;  1BVI A;  5GSP A;  1HYF A;  1RGL A;  1UCL A;  3AGO A;  1BIR A;  4HOH A;  1AQZ A;  1RCK A;  1BGS A;  3AHS A;  1RTU A;  1BRJ A;  2GSP A;  3HOH A;  1JBR A;  2KAA A;  1BU4 A;  1BSB A;  5BU4 A;  1B21 A;  1I2E A;  1BRH A;  5HOH A;  8RNT A;  2AAD A;  1BRK A;  3Q3F A;  3URP A;  1SAR A;  7GSP A;  1HZ1 A;  1RLS A;  4BU4 A;  1G02 A;  3D5I A;  1B2Z A;  1GOV A;  3BU4 A;  6RNT A;  1BNJ A;  1BNF A;  1LNI A;  3BIR A;  5RNT A;  1MGR A;  1ZGX A;  3D4A A;  1DET A;  1IYY A;  1MGW A;  3DGY A;  1YVS A;  3SYU A;  1FUS A;  1BOX A;  1B2S A;  1GSP A;  1I2G A;  1FZU A;  1TRQ A;  1CH0 A;  1JBT A;  1RGG A;  1BAN A;  4GSP A;  1BNE A;  1I3I A;  1YNV X;  4BIR A;  2HOH A;  1UCK A;  2AAE A;  1I0V A;  1BUJ A;  1RGH A;  7RNT A;  4HAA A;  1TTO A;  2BIR A;  1T2I A;  1GMR A;  2RBI A;  4RNT A;  1I0X A;  1PY3 A;  1YGW A;  2KF6 A;  1T2H A;  1RNT A;  2SAR A;  1JBS A;  4J5G A;  3DH2 A;  1BNR A;  1I70 A;  3AGN A;  2F5M A;  2RNT A;  3D5G A;  1B2M A;  1BNS A;  1RGF A;  1BRS A;  1GMQ A;  1R4Y A;  1RSN A;  1RGK A;  1RMS A;  1BRG A;  1BSC A;  1BSE A;  3A5E A;  1BRI A;  1X1X A;  4GHO A;  3GSP A;  1C54 A;  1BAO A;  1LRA A;  1RCL A;  1FW7 A;  1FUT A;  2BU4 A;  1B2X A;  2F4Y A;  9RNT A;  2F5W A;  3AHW A;  1B27 A;  1BSD A;  1RNB A;  1PYL A;  1RGE A;  1BNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...