4GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 7 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4gspA00
1BNGA 1ZGXA 4HOHA 1IYYA 1RGEA 1YNVX 1YVSA 1I3FA 2C4BA 2KF3A 3AGOA 7GSPA 1MGWA 3RNTA 1R4YA 1C54A 2F4YA 1RN4A 1BGSA 1I2EA 1FUSA 1BSCA 1BSBA 1RGGA 1FYSA 1BNFA 1BRSA 1GOYA 1RDSA 1I2GA 1A2PA 1UCKA 1UCLA 1RGHA 1DETA 2F5WA 1JBTA 1TTOA 1FUTA 3GSPA 1B2UA 3AGNA 3BIRA 1RMSA 2KF4A 3URPA 4J5KA 1B27A 2F56A 2KAAA 3DGYA 5BU4A 2ZA4A 3AHWA 1HYFA 7RNTA 1RNBA 1PY3A 1RTUA 1LNIA 4HAAA 1JBSA 1GOUA 1TRPA 1RCLA 1RCKA 3KCHA 1T2IA 1YGWA 3D5GA 1GMPA 1DE3A 1BU4A 1G02A 1FZUA 1BRKA 1FW7A 1T2HA 1SARA 1BIRA 1RN1A 1RGCA 3A5EA 1RSNA 1B21A 1GMRA 1PYLA 2KF5A 1RGLA 1BRNL 3D5IA 4RNTA 8RNTA 1BNSA 3D4AA 6RNTA 1RGAA 1BNRA 1B20A 5HOHA 4GSPA 6GSPA 1AY7A 1BRJA 2AAEA 1GMQA 1AQZA 2BIRA 1BNEA 1BNIA 1X1YA 1B2SA 1HZ1A 3SYUA 4GHOA 3DH2A 1B2MA 1BUJA 1UCIA 1BSAA 1BANA 2F5MA 2KF6A 1RGFA 1B2XA 1X1XA 3WR2A 1JBRA 3Q3FA 1I8VA 1X1UA 3HOHA 4BIRA 1BRIA 1RLSA 1LRAA 1I2FA 1BSEA 2BU4A 2HOHA 1GOVA 2AADA 1I3IA 1LOWA 2GSPA 1MGRA 1BRGA 5GSPA 3BU4A 5RNTA 1I70A 3AHSA 1B2ZA 2SARA 1I0VA 1LOYA 1RNTA 1B3SA 1Q9EA 1LOVA 1UCJA 1BVIA 2RBIA 3WHOA 1I0XA 4J5GA 1X1WA 1BNJA 1BAOA 5BIRA 1RHLA 1CH0A 1GSPA 9RNTA 1BRHA 1BSDA 4BU4A 2RNTA 1TRQA 1BOXA 1RGKA
chains in the Genus database with same CATH superfamily
3SVAA 3CNXA 4IIAA 2XR8B 5M1AA 4HOHA 2INXA 3EF8A 1C7HA 1YNVX 3FG3A 2W04A 1YVSA 2YFIB 5IG0A 4KFFA 4BTYA 2KF3A 5DRVA 4EC6A 2QA43 1JJ22 2CKFB 1MGWA 2XFTA 1ISKA 2PZVA 2W56B 3DGNA 1I2EA 1VQN3 1T3BA 1K28A 1JZOA 3FH1A 3N9HA 4RZMA 1M9GA 2Z77A 4FMBA 3DM8A 3FKAA 4K1VA 1IT7A 1WMNA 1A2PA 3HI7A 3V98A 1JZDA 3ZFZA 1MNLA 2F5WA 4XDWA 4XM4A 2CWTA 5STDA 1STFI 1B2UA 3VF1A 2C11A 3F9SA 3LYGA 5IERA 1OHPA 2IYJA 3UNLA 1U5OA 5IF6A 2YFLB 5JPPA 4XDVA 1F8NA 3URPA 1B27A 2CFGA 3PCSA 4HZ9B 2F56A 2JQ5A 3NBJA 1G96A 3VSYA 1W6CA 3LT9A 1FGTA 4FMCA 3EC9A 1OF5B 4N6OB 1ULJB 2KXGA 1LNIA 1L5GB 2SBLA 1GOUA 1UGHI 2F86B 5I97A 2IUJA 1T2IA 1Q40A 4JRFA 2JDIH 5CF2A 1KC84 3DUKA 1FZUA 3EQQB 3F7SA 1E3RA 3LTBA 1T2HA 1W6GA 4X2OA 1RN1A 1RGCA 1RJOA 1E3VA 1EEJA 1O7HB 3A5EA 3NBRA 2CWVA 1Q7Y4 2E2UA 1UUVB 2KF5A 3X3XA 1BRNL 1BNSA 3T8NA 1NNVA 5AEUB 4BTXA 1BNRA 4CPKA 2OWPA 4XBTA 1S723 1BRJA 1D6YA 1DVCA 1FGOA 3WOEB 3F7XA 1FA3A 1Q824 4N6UA 1EA2A 4H3UA 1W2B2 2XGLA 4R80A 1UI8A 3SYUA 4K61A 3F40A 3RDEA 2W56A 2CHCA 2W6JH 4FMAA 4R1KA 4TX4A 2CFLA 1BANA 3ALAA 3DY5A 2F5MA 2F99A 3PZWA 3S67A 3UB1A 1VQK3 2BMQB 1QAKA 3ER7A 3NV0B 1I8VA 1X1UA 2RSXA 3B4OA 5IEPA 5IEOA 3CPW2 1W5ZA 3BB9A 4BIRA 1RLSA 1GY7A 2J8XB 4NREA 3CCU3 1NB3I 5TGNA 2RCDA 1LOWA 1TJDA 2GSPA 1UUWB 3B7CA 4N6MA 1BRGA 3A76A 5GSPA 2V1LA 1UW1A 1I0VA 1RNTA 1STDA 1JV2B 2XRXB 1A67A 2Y73A 3GRDA 4HM4B 1Q9EA 3AMOB 1V74A 1LOVA 3NM2A 1CQSA 2YX9A 4WHAA 1BVIA 1O7WB 1SPUA 1OHSA 1O7MB 3K9MC 2MC8A 3EHCA 1M1XB 1I0XA 1U8CB 1X1WA 1BNJA 1OF5A 3EN1B 2WGQA 5FGOA 1CH0A 4HBRA 1TU5A 3LH4A 3KFQC 1RN7A 2Z7AA 2RNTA 1V57A 1W00A 4HYZA 3OW22 2BT3A 3WMDA 1SQWA 1BNGA 1ZGXA 2CK3H 2XF3A 1YGEA 2Y74A 3GZXB 3LXUX 1YJ93 4K90B 5BVBA 2ML6A 1QVG2 1JN5B 2PNCA 1N5HA 1I3FA 2C4BA 1QJGA 1LQMB 2CG0A 3G16A 1RRLA 3NQZA 7GSPA 2CG1A 1R4YA 2FXTA 3RNTA 4CCVA 2RGQA 1DMNA 4KZ1A 1SJWA 4JF8A 5ELJA 2Q07A 1MWUA 1BSCA 4R9KA 4AEQA 3FG4A 2F98A 3JUOA 1GOYA 1RDSA 1PFPA 3SLUA 5AIHA 4I4KA 3NM7A 4HM6B 3SXXA 3GSPA 1JBTA 3DGOA 1YJW3 3HIIA 4LGQA 4FCZA 3F14A 3AGNA 1LXEA 1FUWA 3BIRA 2HMLB 1RMSA 3LZAA 1R4CA 3NV0A 1GY6A 2C10A 1NJI4 1N8QA 4N3VA 1TP6A 3AHWA 1Z1SA 3Q2PA 5D83A 3KIIA 1HYFA 2ZHXB 1A2KA 3X3YA 5CK6A 3ZG0A 3D79A 1RNBA 1CYVA 1VQ63 5LC7A 5M19A 1JBSA 3K7CA 1OH0A 1RCKA 5AEWB 3KCHA 1YGWA 2K54A 1SIHA 4MEIA 3D5GA 3AMOA 1G0TA 2XSOB 1BU4A 4MMZB 1DE3A 4K1UA 1BRKA 5AIFA 1NWWA 1Y4KA 4IT7A 3GWRA 3NBBA 3FF2A 3Q90A 4EW5A 1OACA 3D3LA 4CJNA 1HU9A 3E99A 5JBSA 3KKGA 4EBGA 1GMRA 2BMOB 4O2HA 4XB5A 3D5IA 4L8PA 4RNTA 3UL5A 1LOXA 1VQ83 1DVDA 4NPBA 1A2VA 4WWUC 4CDLA 1B20A 3NHXA 3IPTA 5AYRB 2R41A 4H61A 1AY7A 2CFWA 1PU4A 1LNHA 3I0YA 3IMAB 1A90A 1WNHA 2WOFA 4U13A 3LTDA 3S28A 1JN5A 1X1YA 1B2SA 5A0OB 1HZ1A 3OWSA 3MYTA 3UJMA 4FMDA 4GHOA 3SX1A 3MKIA 1ASKA 4FCMA 1UCIA 4Q53A 1CYUA 3SOAA 3CCM3 2KF6A 3G0KA 3CC23 1B2XA 1W7CA 3JUMA 1JBRA 2KCDA 4OUQA 3H51A 4KVHA 2P09A 5DREA 3CCV3 1QMAA 3HOHA 3D9RA 4KT3B 4KFDA 1VQ43 2QGUA 1BSEA 2HOHA 1GOVA 4J8TA 1QVF2 1I3IA 4MMXB 5M18A 1ZS7A 3OX9A 1K734 1DYUA 2CFKA 1I70A 4R9LA 1AVKA 5G1KA 2GBXB 2OQEA 3JUPA 4N6NB 2D42A 3V99A 3LTAA 1GD3A 1UCJA 1UUGB 1QAFA 4MMYB 1O7NB 4WYKB 1IVVA 1TIJA 2CIUA 4FCJA 1YIJ3 4XBYA 3DGMA 1LVNA 1N9JA 3FLJA 3MG1A 4J5GA 1W02A 1BAOA 3HZPA 4HVNA 3GAXA 1GSPA 1UI7A 1YVBI 1BRHA 3G713 2GXFA 1GY5A 1VQ73 5CXOA 1Q7HA 1BSDA 1WMOA 2XGNA 3TDGA 2UUGC 3F8XA 3OV4A 1V58A 5CLKA 1OPYA 1QALA 2OTJ3 4IPBA 1IK3A 4HM7B 3PXMA 4HM5B 3S29A 3FSDA 1WMPA 3UL6A 3ZG5A 5IG4A 2H0IA 3WODG 4O3VA 1BGSA 1FUSA 1JNQA 3F8HA 3NX0A 1YIT3 2M7OA 2HMJB 1IT8A 1BNFA 1ZO2A 1AR0A 3CCL3 1BRSA 1GD4A 1OGZA 3CU3A 1UCLA 1RGHA 3L0RA 1CEWI 4EYCA 2CW9A 5KP3A 3RGAA 1VQM3 2HMMB 3HX8A 2W2CA 1NB5I 4LYLB 3JVCA 2RFRA 3DXOA 1ROAA 3B4PA 4J9AA 2STDA 4HM2B 2ZDJA 2KF4A 3JUNA 1JB5A 1JB2A 1GS3A 1ULIB 3IJEB 2HMNB 3KE7A 4J5KA 1KSIA 4BTWA 5CF1A 1M1K4 2KAAA 3M8CA 5AI1A 1EQKA 1VQ53 3LMLA 4HM1B 1TUHA 3LTCA 3CMA3 2D1WA 2E2VA 4HAAA 4LEHA 2ML5A 1RCLA 2XSHB 3G4S3 1GMPA 3KN4A 3ROBA 1G02A 3CPOA 2CH9A 1OGXA 2P0MA 4WYKA 5KP1A 4EV5A 2GBWB 4AKZA 2IY2A 6STDA 1RSNA 2HMOB 3DGLA 3NXJA 3OXAA 4EV2A 4HJLB 1PYLA 2FNQA 1EKMA 3X3ZA 1TFKA 8RNTA 1N9EA 2W9PA 3FG1A 3D4AA 2IA7A 1W2ZA 4HKVB 4R4KA 3WDGB 1OUNA 1ZX2A 3MWZA 3OWUA 3NUVA 5HOHA 1VQL3 1IV9A 3HIGA 4HZBB 1GMQA 1K9M4 1AQZA 2OCTA 4STDA 5FW5A 4DKIA 3CME3 1VQQA 3MG2A 2QEX3 3FF0A 3WA3A 3VGNA 3V92A 1IVWA 4ZM8A 1MWTA 3DH2A 1N5PA 4G1MB 3PCRA 1ROVA 2L4VA 1BUJA 3BLZA 1DMQA 2YFJB 1RGFA 1WTHA 1X1XA 3WR2A 2GU3A 2P05A 3EBYA 5IG5A 1BRIA 2BU4A 1YI23 1NO3A 2E2TA 2AADA 4HM0B 3CC43 2Z6BA 1W6YA 3CD63 3BU4A 1IVXA 3KZTA 5LC6A 1D6ZA 5RNTA 3SEDA 3AHSA 1B2ZA 3FZWA 2W03A 4ILFA 3X42A 4N6V0 5JPUA 4HM3B 2OTL3 3N54B 3U97A 3QK9A 5BXQA 4KFEA 2A15A 1US1A 1DMMA 2RBIA 3T8UA 2B24B 1UDII 1WQLB 3I563 1EUIC 1JKGB 3HK4A 3N8BA 3SOYA 3GZYB 4I5QA 4GL6A 2H0GA 2WO0A 1O7GB 2HMKB 1S5AA 5AYSC 3T0UA 4O02B 1TRQA 3QRDA 1O7PB 1BOXA 2BNGA 1BUQA 1IQXA 2H0HA 2K3DA 3GZBA 3O8YA 3BNEA 1IYYA 1RGEA 1IQ8A 1GYBA 1MWRA 3AGOA 2UX0A 1AV4A 3RGRA 4LSOA 1C54A 2LYXA 1JB4A 2F4YA 1RN4A 1TFOA 1RKYA 3KSED 2CFDA 5EQLA 3EX9A 1FGMA 4RNZA 1BSBA 1RGGA 4RBNA 4N6TA 1FYSA 5IW9A 1KD14 1N8R4 1J2BA 2WGOA 2K0MA 1I2GA 3EN8A 3H3HA 1UCKA 2BO9B 1DETA 3MSOA 3PS8A 2OOVA 3G6E3 3PYJA 1TTOA 1FUTA 3CXC2 1EG9B 3CC73 4MJDA 1IQYA 3K63A 3FGYA 3MPHA 3NQYA 3FCSB 4RNYA 3STDA 3BNCA 1OHOA 1YHQ3 4LMIA 3K5TA 5EEOA 7STDA 1M904 3DGYA 3PGBA 5BU4A 4QWTA 2Z76A 2ZA4A 3DZLA 3WOFB 4N6LA 4HM8B 5EVHA 7RNTA 3U1WA 1PY3A 1RTUA 3GZRA 1IU7A 4FR9A 1Q814 1UGIA 1SIIA 3JUQA 1TRPA 2O3OA 4XBXA 1Q864 2CX1A 3KSPA 4BL3A 2XEPA 3BNDA 3CCR3 1KQS2 2OQEC 3EJVA 3EB8A 3CCE3 4GB5A 5D82A 1VQO3 3S27A 1FW7A 1SARA 1IV7A 1K41A 1BIRA 4WP5A 4O8SA 1T5YA 1B21A 1JKGA 2W9QA 1JRQA 1RGLA 3K0ZA 2BHMA 2P0XA 2P38A 4OK0A 6RNTA 1RGAA 1OCVA 3MG3A 3J7Yd 1Q42A 2B1XB 2L1SA 3CCJ3 2OOVC 4GSPA 5KP4A 2FGTA 5D81A 6GSPA 2CWUA 1MWSA 3G8ZA 3WA2X 2AAEA 1IDPA 1FGQA 2GU1A 2ZL8A 5IENA 2BIRA 1BNEA 1BNIA 4ORLA 1RRHA 2GEYA 4LZIA 1VQP3 4BL2A 3MHEA 1B2MA 1BSAA 5AIIA 1W01A 1E97A 1HKXA 3EBTA 4AKYA 1VQ93 2I9WA 5AIGA 5HGRA 3LT8A 2W0QA 3Q3FA 2UGIA 1LQGC 3CNMA 1K8A4 2IMJA 1LRAA 1I2FA 1W4NA 2CC3A 3ECFA 3LOYA 3X40A 3CCS3 4OVMA 5ELUA 2WOHA 2LQVA 4L8OA 4WFOA 8CHOA 1MGRA 2CX0A 3OWYA 5G1LA 4NHFA 4L7KA 2R4IA 2SARA 1LOYA 2IUKA 5IG3A 5G2GA 1AVLA 1Q40B 2XFSA 3S5CA 3CCQ3 1B3SA 1YJN3 3EE1A 2QIYA 3X41A 3DMCA 4PEJA 1NDOB 2BMRB 1FGRA 3WHOA 2XH9A 1IVUA 2GEXA 1VZZA 2KRTA 1D6UA 2O9UX 5BIRA 4X2HA 1KWIA 1RHLA 3B8LA 3BNBA 9RNTA 4EXRA 1MOLA 1NU3A 2MF7A 4BU4A 3I553 3Q1CA 1RGKA
chains in the Genus database with same CATH topology
1BNGA 1ZGXA 4HOHA 1IYYA 1RGEA 1YNVX 1YVSA 1I3FA 2C4BA 2KF3A 3AGOA 7GSPA 1MGWA 3RNTA 1R4YA 1C54A 2F4YA 1RN4A 1BGSA 1I2EA 1FUSA 1BSCA 1BSBA 1RGGA 1FYSA 1BNFA 1BRSA 1GOYA 1RDSA 1I2GA 1A2PA 1UCKA 1UCLA 1RGHA 1DETA 2F5WA 1JBTA 1TTOA 1FUTA 3GSPA 1B2UA 3AGNA 3BIRA 1RMSA 2KF4A 3URPA 4J5KA 1B27A 2F56A 2KAAA 3DGYA 5BU4A 2ZA4A 3AHWA 1HYFA 7RNTA 1RNBA 1PY3A 1RTUA 1LNIA 4HAAA 1JBSA 1GOUA 1TRPA 1RCLA 1RCKA 3KCHA 1T2IA 1YGWA 3D5GA 1GMPA 1DE3A 1BU4A 1G02A 1FZUA 1BRKA 1FW7A 1T2HA 1SARA 1BIRA 1RN1A 1RGCA 3A5EA 1RSNA 1B21A 1GMRA 1PYLA 2KF5A 1RGLA 1BRNL 3D5IA 4RNTA 8RNTA 1BNSA 3D4AA 6RNTA 1RGAA 1BNRA 1B20A 5HOHA 4GSPA 6GSPA 1AY7A 1BRJA 2AAEA 1GMQA 1AQZA 2BIRA 1BNEA 1BNIA 1X1YA 1B2SA 1HZ1A 3SYUA 4GHOA 3DH2A 1B2MA 1BUJA 1UCIA 1BSAA 1BANA 2F5MA 2KF6A 1RGFA 1B2XA 1X1XA 3WR2A 1JBRA 3Q3FA 1I8VA 1X1UA 3HOHA 4BIRA 1BRIA 1RLSA 1LRAA 1I2FA 1BSEA 2BU4A 2HOHA 1GOVA 2AADA 1I3IA 1LOWA 2GSPA 1MGRA 1BRGA 5GSPA 3BU4A 5RNTA 1I70A 3AHSA 1B2ZA 2SARA 1I0VA 1LOYA 1RNTA 1B3SA 1Q9EA 1LOVA 1UCJA 1BVIA 2RBIA 3WHOA 1I0XA 4J5GA 1X1WA 1BNJA 1BAOA 5BIRA 1RHLA 1CH0A 1GSPA 9RNTA 1BRHA 1BSDA 4BU4A 2RNTA 1TRQA 1BOXA 1RGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNG A;  1ZGX A;  4HOH A;  1IYY A;  1RGE A;  1YNV X;  1YVS A;  1I3F A;  2C4B A;  2KF3 A;  3AGO A;  7GSP A;  1MGW A;  3RNT A;  1R4Y A;  1C54 A;  2F4Y A;  1RN4 A;  1BGS A;  1I2E A;  1FUS A;  1BSC A;  1BSB A;  1RGG A;  1FYS A;  1BNF A;  1BRS A;  1GOY A;  1RDS A;  1I2G A;  1A2P A;  1UCK A;  1UCL A;  1RGH A;  1DET A;  2F5W A;  1JBT A;  1TTO A;  1FUT A;  3GSP A;  1B2U A;  3AGN A;  3BIR A;  1RMS A;  2KF4 A;  3URP A;  4J5K A;  1B27 A;  2F56 A;  2KAA A;  3DGY A;  5BU4 A;  2ZA4 A;  3AHW A;  1HYF A;  7RNT A;  1RNB A;  1PY3 A;  1RTU A;  1LNI A;  4HAA A;  1JBS A;  1GOU A;  1TRP A;  1RCL A;  1RCK A;  3KCH A;  1T2I A;  1YGW A;  3D5G A;  1GMP A;  1DE3 A;  1BU4 A;  1G02 A;  1FZU A;  1BRK A;  1FW7 A;  1T2H A;  1SAR A;  1BIR A;  1RN1 A;  1RGC A;  3A5E A;  1RSN A;  1B21 A;  1GMR A;  1PYL A;  2KF5 A;  1RGL A;  1BRN L;  3D5I A;  4RNT A;  8RNT A;  1BNS A;  3D4A A;  6RNT A;  1RGA A;  1BNR A;  1B20 A;  5HOH A;  4GSP A;  6GSP A;  1AY7 A;  1BRJ A;  2AAE A;  1GMQ A;  1AQZ A;  2BIR A;  1BNE A;  1BNI A;  1X1Y A;  1B2S A;  1HZ1 A;  3SYU A;  4GHO A;  3DH2 A;  1B2M A;  1BUJ A;  1UCI A;  1BSA A;  1BAN A;  2F5M A;  2KF6 A;  1RGF A;  1B2X A;  1X1X A;  3WR2 A;  1JBR A;  3Q3F A;  1I8V A;  1X1U A;  3HOH A;  4BIR A;  1BRI A;  1RLS A;  1LRA A;  1I2F A;  1BSE A;  2BU4 A;  2HOH A;  1GOV A;  2AAD A;  1I3I A;  1LOW A;  2GSP A;  1MGR A;  1BRG A;  5GSP A;  3BU4 A;  5RNT A;  1I70 A;  3AHS A;  1B2Z A;  2SAR A;  1I0V A;  1LOY A;  1RNT A;  1B3S A;  1Q9E A;  1LOV A;  1UCJ A;  1BVI A;  2RBI A;  3WHO A;  1I0X A;  4J5G A;  1X1W A;  1BNJ A;  1BAO A;  5BIR A;  1RHL A;  1CH0 A;  1GSP A;  9RNT A;  1BRH A;  1BSD A;  4BU4 A;  2RNT A;  1TRQ A;  1BOX A;  1RGK A; 
#chains in the Genus database with same CATH topology
 3SVA A;  3CNX A;  4IIA A;  2XR8 B;  5M1A A;  4HOH A;  2INX A;  3EF8 A;  1C7H A;  1YNV X;  3FG3 A;  2W04 A;  1YVS A;  2YFI B;  5IG0 A;  4KFF A;  4BTY A;  2KF3 A;  5DRV A;  4EC6 A;  2QA4 3;  1JJ2 2;  2CKF B;  1MGW A;  2XFT A;  1ISK A;  2PZV A;  2W56 B;  3DGN A;  1I2E A;  1VQN 3;  1T3B A;  1K28 A;  1JZO A;  3FH1 A;  3N9H A;  4RZM A;  1M9G A;  2Z77 A;  4FMB A;  3DM8 A;  3FKA A;  4K1V A;  1IT7 A;  1WMN A;  1A2P A;  3HI7 A;  3V98 A;  1JZD A;  3ZFZ A;  1MNL A;  2F5W A;  4XDW A;  4XM4 A;  2CWT A;  5STD A;  1STF I;  1B2U A;  3VF1 A;  2C11 A;  3F9S A;  3LYG A;  5IER A;  1OHP A;  2IYJ A;  3UNL A;  1U5O A;  5IF6 A;  2YFL B;  5JPP A;  4XDV A;  1F8N A;  3URP A;  1B27 A;  2CFG A;  3PCS A;  4HZ9 B;  2F56 A;  2JQ5 A;  3NBJ A;  1G96 A;  3VSY A;  1W6C A;  3LT9 A;  1FGT A;  4FMC A;  3EC9 A;  1OF5 B;  4N6O B;  1ULJ B;  2KXG A;  1LNI A;  1L5G B;  2SBL A;  1GOU A;  1UGH I;  2F86 B;  5I97 A;  2IUJ A;  1T2I A;  1Q40 A;  4JRF A;  2JDI H;  5CF2 A;  1KC8 4;  3DUK A;  1FZU A;  3EQQ B;  3F7S A;  1E3R A;  3LTB A;  1T2H A;  1W6G A;  4X2O A;  1RN1 A;  1RGC A;  1RJO A;  1E3V A;  1EEJ A;  1O7H B;  3A5E A;  3NBR A;  2CWV A;  1Q7Y 4;  2E2U A;  1UUV B;  2KF5 A;  3X3X A;  1BRN L;  1BNS A;  3T8N A;  1NNV A;  5AEU B;  4BTX A;  1BNR A;  4CPK A;  2OWP A;  4XBT A;  1S72 3;  1BRJ A;  1D6Y A;  1DVC A;  1FGO A;  3WOE B;  3F7X A;  1FA3 A;  1Q82 4;  4N6U A;  1EA2 A;  4H3U A;  1W2B 2;  2XGL A;  4R80 A;  1UI8 A;  3SYU A;  4K61 A;  3F40 A;  3RDE A;  2W56 A;  2CHC A;  2W6J H;  4FMA A;  4R1K A;  4TX4 A;  2CFL A;  1BAN A;  3ALA A;  3DY5 A;  2F5M A;  2F99 A;  3PZW A;  3S67 A;  3UB1 A;  1VQK 3;  2BMQ B;  1QAK A;  3ER7 A;  3NV0 B;  1I8V A;  1X1U A;  2RSX A;  3B4O A;  5IEP A;  5IEO A;  3CPW 2;  1W5Z A;  3BB9 A;  4BIR A;  1RLS A;  1GY7 A;  2J8X B;  4NRE A;  3CCU 3;  1NB3 I;  5TGN A;  2RCD A;  1LOW A;  1TJD A;  2GSP A;  1UUW B;  3B7C A;  4N6M A;  1BRG A;  3A76 A;  5GSP A;  2V1L A;  1UW1 A;  1I0V A;  1RNT A;  1STD A;  1JV2 B;  2XRX B;  1A67 A;  2Y73 A;  3GRD A;  4HM4 B;  1Q9E A;  3AMO B;  1V74 A;  1LOV A;  3NM2 A;  1CQS A;  2YX9 A;  4WHA A;  1BVI A;  1O7W B;  1SPU A;  1OHS A;  1O7M B;  3K9M C;  2MC8 A;  3EHC A;  1M1X B;  1I0X A;  1U8C B;  1X1W A;  1BNJ A;  1OF5 A;  3EN1 B;  2WGQ A;  5FGO A;  1CH0 A;  4HBR A;  1TU5 A;  3LH4 A;  3KFQ C;  1RN7 A;  2Z7A A;  2RNT A;  1V57 A;  1W00 A;  4HYZ A;  3OW2 2;  2BT3 A;  3WMD A;  1SQW A;  1BNG A;  1ZGX A;  2CK3 H;  2XF3 A;  1YGE A;  2Y74 A;  3GZX B;  3LXU X;  1YJ9 3;  4K90 B;  5BVB A;  2ML6 A;  1QVG 2;  1JN5 B;  2PNC A;  1N5H A;  1I3F A;  2C4B A;  1QJG A;  1LQM B;  2CG0 A;  3G16 A;  1RRL A;  3NQZ A;  7GSP A;  2CG1 A;  1R4Y A;  2FXT A;  3RNT A;  4CCV A;  2RGQ A;  1DMN A;  4KZ1 A;  1SJW A;  4JF8 A;  5ELJ A;  2Q07 A;  1MWU A;  1BSC A;  4R9K A;  4AEQ A;  3FG4 A;  2F98 A;  3JUO A;  1GOY A;  1RDS A;  1PFP A;  3SLU A;  5AIH A;  4I4K A;  3NM7 A;  4HM6 B;  3SXX A;  3GSP A;  1JBT A;  3DGO A;  1YJW 3;  3HII A;  4LGQ A;  4FCZ A;  3F14 A;  3AGN A;  1LXE A;  1FUW A;  3BIR A;  2HML B;  1RMS A;  3LZA A;  1R4C A;  3NV0 A;  1GY6 A;  2C10 A;  1NJI 4;  1N8Q A;  4N3V A;  1TP6 A;  3AHW A;  1Z1S A;  3Q2P A;  5D83 A;  3KII A;  1HYF A;  2ZHX B;  1A2K A;  3X3Y A;  5CK6 A;  3ZG0 A;  3D79 A;  1RNB A;  1CYV A;  1VQ6 3;  5LC7 A;  5M19 A;  1JBS A;  3K7C A;  1OH0 A;  1RCK A;  5AEW B;  3KCH A;  1YGW A;  2K54 A;  1SIH A;  4MEI A;  3D5G A;  3AMO A;  1G0T A;  2XSO B;  1BU4 A;  4MMZ B;  1DE3 A;  4K1U A;  1BRK A;  5AIF A;  1NWW A;  1Y4K A;  4IT7 A;  3GWR A;  3NBB A;  3FF2 A;  3Q90 A;  4EW5 A;  1OAC A;  3D3L A;  4CJN A;  1HU9 A;  3E99 A;  5JBS A;  3KKG A;  4EBG A;  1GMR A;  2BMO B;  4O2H A;  4XB5 A;  3D5I A;  4L8P A;  4RNT A;  3UL5 A;  1LOX A;  1VQ8 3;  1DVD A;  4NPB A;  1A2V A;  4WWU C;  4CDL A;  1B20 A;  3NHX A;  3IPT A;  5AYR B;  2R41 A;  4H61 A;  1AY7 A;  2CFW A;  1PU4 A;  1LNH A;  3I0Y A;  3IMA B;  1A90 A;  1WNH A;  2WOF A;  4U13 A;  3LTD A;  3S28 A;  1JN5 A;  1X1Y A;  1B2S A;  5A0O B;  1HZ1 A;  3OWS A;  3MYT A;  3UJM A;  4FMD A;  4GHO A;  3SX1 A;  3MKI A;  1ASK A;  4FCM A;  1UCI A;  4Q53 A;  1CYU A;  3SOA A;  3CCM 3;  2KF6 A;  3G0K A;  3CC2 3;  1B2X A;  1W7C A;  3JUM A;  1JBR A;  2KCD A;  4OUQ A;  3H51 A;  4KVH A;  2P09 A;  5DRE A;  3CCV 3;  1QMA A;  3HOH A;  3D9R A;  4KT3 B;  4KFD A;  1VQ4 3;  2QGU A;  1BSE A;  2HOH A;  1GOV A;  4J8T A;  1QVF 2;  1I3I A;  4MMX B;  5M18 A;  1ZS7 A;  3OX9 A;  1K73 4;  1DYU A;  2CFK A;  1I70 A;  4R9L A;  1AVK A;  5G1K A;  2GBX B;  2OQE A;  3JUP A;  4N6N B;  2D42 A;  3V99 A;  3LTA A;  1GD3 A;  1UCJ A;  1UUG B;  1QAF A;  4MMY B;  1O7N B;  4WYK B;  1IVV A;  1TIJ A;  2CIU A;  4FCJ A;  1YIJ 3;  4XBY A;  3DGM A;  1LVN A;  1N9J A;  3FLJ A;  3MG1 A;  4J5G A;  1W02 A;  1BAO A;  3HZP A;  4HVN A;  3GAX A;  1GSP A;  1UI7 A;  1YVB I;  1BRH A;  3G71 3;  2GXF A;  1GY5 A;  1VQ7 3;  5CXO A;  1Q7H A;  1BSD A;  1WMO A;  2XGN A;  3TDG A;  2UUG C;  3F8X A;  3OV4 A;  1V58 A;  5CLK A;  1OPY A;  1QAL A;  2OTJ 3;  4IPB A;  1IK3 A;  4HM7 B;  3PXM A;  4HM5 B;  3S29 A;  3FSD A;  1WMP A;  3UL6 A;  3ZG5 A;  5IG4 A;  2H0I A;  3WOD G;  4O3V A;  1BGS A;  1FUS A;  1JNQ A;  3F8H A;  3NX0 A;  1YIT 3;  2M7O A;  2HMJ B;  1IT8 A;  1BNF A;  1ZO2 A;  1AR0 A;  3CCL 3;  1BRS A;  1GD4 A;  1OGZ A;  3CU3 A;  1UCL A;  1RGH A;  3L0R A;  1CEW I;  4EYC A;  2CW9 A;  5KP3 A;  3RGA A;  1VQM 3;  2HMM B;  3HX8 A;  2W2C A;  1NB5 I;  4LYL B;  3JVC A;  2RFR A;  3DXO A;  1ROA A;  3B4P A;  4J9A A;  2STD A;  4HM2 B;  2ZDJ A;  2KF4 A;  3JUN A;  1JB5 A;  1JB2 A;  1GS3 A;  1ULI B;  3IJE B;  2HMN B;  3KE7 A;  4J5K A;  1KSI A;  4BTW A;  5CF1 A;  1M1K 4;  2KAA A;  3M8C A;  5AI1 A;  1EQK A;  1VQ5 3;  3LML A;  4HM1 B;  1TUH A;  3LTC A;  3CMA 3;  2D1W A;  2E2V A;  4HAA A;  4LEH A;  2ML5 A;  1RCL A;  2XSH B;  3G4S 3;  1GMP A;  3KN4 A;  3ROB A;  1G02 A;  3CPO A;  2CH9 A;  1OGX A;  2P0M A;  4WYK A;  5KP1 A;  4EV5 A;  2GBW B;  4AKZ A;  2IY2 A;  6STD A;  1RSN A;  2HMO B;  3DGL A;  3NXJ A;  3OXA A;  4EV2 A;  4HJL B;  1PYL A;  2FNQ A;  1EKM A;  3X3Z A;  1TFK A;  8RNT A;  1N9E A;  2W9P A;  3FG1 A;  3D4A A;  2IA7 A;  1W2Z A;  4HKV B;  4R4K A;  3WDG B;  1OUN A;  1ZX2 A;  3MWZ A;  3OWU A;  3NUV A;  5HOH A;  1VQL 3;  1IV9 A;  3HIG A;  4HZB B;  1GMQ A;  1K9M 4;  1AQZ A;  2OCT A;  4STD A;  5FW5 A;  4DKI A;  3CME 3;  1VQQ A;  3MG2 A;  2QEX 3;  3FF0 A;  3WA3 A;  3VGN A;  3V92 A;  1IVW A;  4ZM8 A;  1MWT A;  3DH2 A;  1N5P A;  4G1M B;  3PCR A;  1ROV A;  2L4V A;  1BUJ A;  3BLZ A;  1DMQ A;  2YFJ B;  1RGF A;  1WTH A;  1X1X A;  3WR2 A;  2GU3 A;  2P05 A;  3EBY A;  5IG5 A;  1BRI A;  2BU4 A;  1YI2 3;  1NO3 A;  2E2T A;  2AAD A;  4HM0 B;  3CC4 3;  2Z6B A;  1W6Y A;  3CD6 3;  3BU4 A;  1IVX A;  3KZT A;  5LC6 A;  1D6Z A;  5RNT A;  3SED A;  3AHS A;  1B2Z A;  3FZW A;  2W03 A;  4ILF A;  3X42 A;  4N6V 0;  5JPU A;  4HM3 B;  2OTL 3;  3N54 B;  3U97 A;  3QK9 A;  5BXQ A;  4KFE A;  2A15 A;  1US1 A;  1DMM A;  2RBI A;  3T8U A;  2B24 B;  1UDI I;  1WQL B;  3I56 3;  1EUI C;  1JKG B;  3HK4 A;  3N8B A;  3SOY A;  3GZY B;  4I5Q A;  4GL6 A;  2H0G A;  2WO0 A;  1O7G B;  2HMK B;  1S5A A;  5AYS C;  3T0U A;  4O02 B;  1TRQ A;  3QRD A;  1O7P B;  1BOX A;  2BNG A;  1BUQ A;  1IQX A;  2H0H A;  2K3D A;  3GZB A;  3O8Y A;  3BNE A;  1IYY A;  1RGE A;  1IQ8 A;  1GYB A;  1MWR A;  3AGO A;  2UX0 A;  1AV4 A;  3RGR A;  4LSO A;  1C54 A;  2LYX A;  1JB4 A;  2F4Y A;  1RN4 A;  1TFO A;  1RKY A;  3KSE D;  2CFD A;  5EQL A;  3EX9 A;  1FGM A;  4RNZ A;  1BSB A;  1RGG A;  4RBN A;  4N6T A;  1FYS A;  5IW9 A;  1KD1 4;  1N8R 4;  1J2B A;  2WGO A;  2K0M A;  1I2G A;  3EN8 A;  3H3H A;  1UCK A;  2BO9 B;  1DET A;  3MSO A;  3PS8 A;  2OOV A;  3G6E 3;  3PYJ A;  1TTO A;  1FUT A;  3CXC 2;  1EG9 B;  3CC7 3;  4MJD A;  1IQY A;  3K63 A;  3FGY A;  3MPH A;  3NQY A;  3FCS B;  4RNY A;  3STD A;  3BNC A;  1OHO A;  1YHQ 3;  4LMI A;  3K5T A;  5EEO A;  7STD A;  1M90 4;  3DGY A;  3PGB A;  5BU4 A;  4QWT A;  2Z76 A;  2ZA4 A;  3DZL A;  3WOF B;  4N6L A;  4HM8 B;  5EVH A;  7RNT A;  3U1W A;  1PY3 A;  1RTU A;  3GZR A;  1IU7 A;  4FR9 A;  1Q81 4;  1UGI A;  1SII A;  3JUQ A;  1TRP A;  2O3O A;  4XBX A;  1Q86 4;  2CX1 A;  3KSP A;  4BL3 A;  2XEP A;  3BND A;  3CCR 3;  1KQS 2;  2OQE C;  3EJV A;  3EB8 A;  3CCE 3;  4GB5 A;  5D82 A;  1VQO 3;  3S27 A;  1FW7 A;  1SAR A;  1IV7 A;  1K41 A;  1BIR A;  4WP5 A;  4O8S A;  1T5Y A;  1B21 A;  1JKG A;  2W9Q A;  1JRQ A;  1RGL A;  3K0Z A;  2BHM A;  2P0X A;  2P38 A;  4OK0 A;  6RNT A;  1RGA A;  1OCV A;  3MG3 A;  3J7Y d;  1Q42 A;  2B1X B;  2L1S A;  3CCJ 3;  2OOV C;  4GSP A;  5KP4 A;  2FGT A;  5D81 A;  6GSP A;  2CWU A;  1MWS A;  3G8Z A;  3WA2 X;  2AAE A;  1IDP A;  1FGQ A;  2GU1 A;  2ZL8 A;  5IEN A;  2BIR A;  1BNE A;  1BNI A;  4ORL A;  1RRH A;  2GEY A;  4LZI A;  1VQP 3;  4BL2 A;  3MHE A;  1B2M A;  1BSA A;  5AII A;  1W01 A;  1E97 A;  1HKX A;  3EBT A;  4AKY A;  1VQ9 3;  2I9W A;  5AIG A;  5HGR A;  3LT8 A;  2W0Q A;  3Q3F A;  2UGI A;  1LQG C;  3CNM A;  1K8A 4;  2IMJ A;  1LRA A;  1I2F A;  1W4N A;  2CC3 A;  3ECF A;  3LOY A;  3X40 A;  3CCS 3;  4OVM A;  5ELU A;  2WOH A;  2LQV A;  4L8O A;  4WFO A;  8CHO A;  1MGR A;  2CX0 A;  3OWY A;  5G1L A;  4NHF A;  4L7K A;  2R4I A;  2SAR A;  1LOY A;  2IUK A;  5IG3 A;  5G2G A;  1AVL A;  1Q40 B;  2XFS A;  3S5C A;  3CCQ 3;  1B3S A;  1YJN 3;  3EE1 A;  2QIY A;  3X41 A;  3DMC A;  4PEJ A;  1NDO B;  2BMR B;  1FGR A;  3WHO A;  2XH9 A;  1IVU A;  2GEX A;  1VZZ A;  2KRT A;  1D6U A;  2O9U X;  5BIR A;  4X2H A;  1KWI A;  1RHL A;  3B8L A;  3BNB A;  9RNT A;  4EXR A;  1MOL A;  1NU3 A;  2MF7 A;  4BU4 A;  3I55 3;  3Q1C A;  1RGK A; 
#chains in the Genus database with same CATH homology
 1BNG A;  1ZGX A;  4HOH A;  1IYY A;  1RGE A;  1YNV X;  1YVS A;  1I3F A;  2C4B A;  2KF3 A;  3AGO A;  7GSP A;  1MGW A;  3RNT A;  1R4Y A;  1C54 A;  2F4Y A;  1RN4 A;  1BGS A;  1I2E A;  1FUS A;  1BSC A;  1BSB A;  1RGG A;  1FYS A;  1BNF A;  1BRS A;  1GOY A;  1RDS A;  1I2G A;  1A2P A;  1UCK A;  1UCL A;  1RGH A;  1DET A;  2F5W A;  1JBT A;  1TTO A;  1FUT A;  3GSP A;  1B2U A;  3AGN A;  3BIR A;  1RMS A;  2KF4 A;  3URP A;  4J5K A;  1B27 A;  2F56 A;  2KAA A;  3DGY A;  5BU4 A;  2ZA4 A;  3AHW A;  1HYF A;  7RNT A;  1RNB A;  1PY3 A;  1RTU A;  1LNI A;  4HAA A;  1JBS A;  1GOU A;  1TRP A;  1RCL A;  1RCK A;  3KCH A;  1T2I A;  1YGW A;  3D5G A;  1GMP A;  1DE3 A;  1BU4 A;  1G02 A;  1FZU A;  1BRK A;  1FW7 A;  1T2H A;  1SAR A;  1BIR A;  1RN1 A;  1RGC A;  3A5E A;  1RSN A;  1B21 A;  1GMR A;  1PYL A;  2KF5 A;  1RGL A;  1BRN L;  3D5I A;  4RNT A;  8RNT A;  1BNS A;  3D4A A;  6RNT A;  1RGA A;  1BNR A;  1B20 A;  5HOH A;  4GSP A;  6GSP A;  1AY7 A;  1BRJ A;  2AAE A;  1GMQ A;  1AQZ A;  2BIR A;  1BNE A;  1BNI A;  1X1Y A;  1B2S A;  1HZ1 A;  3SYU A;  4GHO A;  3DH2 A;  1B2M A;  1BUJ A;  1UCI A;  1BSA A;  1BAN A;  2F5M A;  2KF6 A;  1RGF A;  1B2X A;  1X1X A;  3WR2 A;  1JBR A;  3Q3F A;  1I8V A;  1X1U A;  3HOH A;  4BIR A;  1BRI A;  1RLS A;  1LRA A;  1I2F A;  1BSE A;  2BU4 A;  2HOH A;  1GOV A;  2AAD A;  1I3I A;  1LOW A;  2GSP A;  1MGR A;  1BRG A;  5GSP A;  3BU4 A;  5RNT A;  1I70 A;  3AHS A;  1B2Z A;  2SAR A;  1I0V A;  1LOY A;  1RNT A;  1B3S A;  1Q9E A;  1LOV A;  1UCJ A;  1BVI A;  2RBI A;  3WHO A;  1I0X A;  4J5G A;  1X1W A;  1BNJ A;  1BAO A;  5BIR A;  1RHL A;  1CH0 A;  1GSP A;  9RNT A;  1BRH A;  1BSD A;  4BU4 A;  2RNT A;  1TRQ A;  1BOX A;  1RGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...