4GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 7 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4gspA00
1BSBA 1Q9EA 1FW7A 1RMSA 1UCIA 1YGWA 1LOYA 1YNVX 1AY7A 1BNIA 1BANA 1JBTA 1B27A 1BRHA 2GSPA 1T2IA 1TRPA 1BNRA 2HOHA 1RN4A 3AGOA 1BRJA 1UCKA 3BIRA 1X1XA 1LNIA 4BU4A 3D5GA 2BIRA 1B21A 1I2FA 3WHOA 1BVIA 1I0XA 4HAAA 1LRAA 1AQZA 1TRQA 3AHWA 1RSNA 1BNEA 2RBIA 1RNBA 1PY3A 2F4YA 1RDSA 3DH2A 3Q3FA 1RGFA 2F5WA 1B3SA 1RTUA 1UCJA 6GSPA 1I2GA 2AAEA 1BRIA 1MGWA 1BNSA 5GSPA 1I8VA 3BU4A 2ZA4A 1FZUA 2KF4A 2AADA 1I0VA 1GOVA 1JBSA 4HOHA 1BRNL 1BSEA 1BU4A 1B2ZA 1BNJA 1RCKA 1RGHA 1T2HA 1C54A 2KAAA 3D5IA 1UCLA 1BIRA 1BSAA 1PYLA 2F56A 4J5GA 5HOHA 3URPA 1RGKA 1RGAA 1BRSA 1DETA 1FYSA 7GSPA 2C4BA 1RGEA 1B2XA 2F5MA 2KF6A 1I2EA 1LOWA 1B20A 1BNGA 2KF3A 7RNTA 1RNTA 1RGLA 4GSPA 1G02A 1DE3A 3GSPA 1BSDA 3WR2A 1RLSA 3SYUA 3DGYA 1GMQA 1IYYA 1RGCA 1R4YA 1CH0A 1I3IA 1LOVA 1FUTA 1X1WA 1RN1A 1BGSA 1FUSA 1JBRA 1YVSA 1GSPA 1GMRA 1I3FA 5BIRA 1BRKA 1MGRA 1RCLA 1B2SA 1GOUA 4BIRA 2BU4A 1TTOA 3A5EA 4RNTA 3HOHA 1RHLA 3KCHA 1B2MA 1X1YA 2KF5A 5BU4A 1BOXA 1SARA 2SARA 3D4AA 1BSCA 1RGGA 1BAOA 4GHOA 1BNFA 1GOYA 1BUJA 2RNTA 1X1UA 1HZ1A 1HYFA 5RNTA 1ZGXA 8RNTA 1I70A 4J5KA 3AHSA 3RNTA 1B2UA 3AGNA 1A2PA 1BRGA 1GMPA 9RNTA 6RNTA
chains in the Genus database with same CATH superfamily
3G16A 4J8TA 2H0IA 3SOYA 5IG3A 2PNCA 1UCIA 2XR8B 4HKVB 2C11A 4N6MA 1WMOA 3UL5A 1LOYA 5IG0A 1BNIA 1NO3A 4WP5A 1B27A 1IVWA 3OWYA 3U1WA 1T2IA 1TRPA 3ER7A 1TFKA 4OUQA 3G0KA 1A67A 1BNRA 3AGOA 5IEOA 2HMJB 1YJN3 1ASKA 1LNIA 5DRVA 3SEDA 4CDLA 1IK3A 3D5GA 4NHFA 2BIRA 3EQQB 3CC43 1IT8A 2FGTA 3DGLA 4PEJA 1FGOA 3Q1CA 2BHMA 1LRAA 2OTL3 1AQZA 3CCJ3 3AHWA 3MSOA 4STDA 1AR0A 2L4VA 1O7NB 1JV2B 1OH0A 3Q3FA 2F5WA 1EKMA 1IU7A 1NWWA 1RTUA 2CFGA 2H0HA 3VF1A 4XBTA 3HIGA 2JDIH 1WQLB 1MGWA 5AIFA 3CC73 3JUQA 1GD4A 1BNSA 1K41A 1I8VA 1T3BA 2CFLA 5KP4A 2ZA4A 1IQXA 2J8XB 1EEJA 2CIUA 2W6JH 4EC6A 1VQP3 3NBJA 1BSEA 2BT3A 2KRTA 1YVBI 3F7XA 5JBSA 2ML6A 3K63A 1RGHA 1LOXA 5FGOA 1N9EA 4HYZA 1UCLA 5HGRA 1PYLA 1SQWA 1YIJ3 3URPA 2K0MA 2HMNB 2OQEA 3CPW2 4ZM8A 1FYSA 7GSPA 2C4BA 2ZL8A 3KSED 4OK0A 3WMDA 1B2XA 1KC84 1LOWA 3FLJA 3LXUX 3WA2X 2O9UX 5IG5A 1BNGA 1JKGA 1ZO2A 4HVNA 1YJW3 1W2B2 3CME3 3EF8A 3RGRA 1JRQA 2KCDA 3EX9A 1MWTA 3X3YA 5LC6A 3T8UA 6STDA 2WOFA 1BSDA 4KVHA 3OV4A 3G4S3 3K5TA 1QAKA 2XGLA 5AIIA 3V98A 4RBNA 1I3IA 3H51A 3EE1A 8CHOA 1NB5I 2XGNA 4HJLB 3E99A 5JPUA 1YVSA 4ORLA 4N6UA 2B24B 1GSPA 4I4KA 4JRFA 5BIRA 5G1KA 4LGQA 1S723 3S67A 2FXTA 1Q814 3BNEA 1BRKA 4AKZA 1GY5A 3B8LA 4O8SA 1W02A 1O7PB 5A0OB 4G1MB 1FGQA 4XB5A 1RCLA 2QIYA 3QRDA 5D83A 3MKIA 4N3VA 2W2CA 5BXQA 5G2GA 1OACA 3KCHA 1M1XB 3D79A 3CCU3 1EG9B 1Y4KA 2PZVA 3A76A 3OWSA 2KF5A 4MMZB 4R9KA 5BU4A 1FA3A 1SARA 2SARA 5IEPA 1RGGA 2IUJA 3HI7A 3DGOA 3UB1A 1BAOA 3B4OA 3GRDA 3GZYB 3U97A 1GOYA 2RNTA 1X1UA 5IW9A 1FGMA 4HM2B 1Q7Y4 2CX1A 4FCJA 5RNTA 1D6YA 2P05A 5AIGA 3GWRA 1I70A 3STDA 3FH1A 4WHAA 1GS3A 1ULIB 1LQMB 1AVLA 2HMKB 3AGNA 1G96A 1UGHI 3OW22 1M904 3FZWA 2CK3H 1UI7A 4EXRA 2C10A 1L5GB 2K54A 2O3OA 1GY7A 2XSHB 1AY7A 3V99A 1N8R4 1AVKA 3LT8A 1GYBA 4EBGA 4N6TA 1W5ZA 1VQ63 2HOHA 4TX4A 1TJDA 3KKGA 4O3VA 1UCKA 3K9MC 3BIRA 4FCMA 1YHQ3 4XBXA 2BMOB 4FMBA 1Z1SA 4RZMA 5AYRB 3HX8A 3J7Yd 3RGAA 3I563 1UUWB 1B21A 2CG0A 4FR9A 2W0QA 4K90B 3CPOA 4WWUC 5FW5A 1BVIA 2R4IA 2CX0A 1TRQA 1UGIA 2WGQA 3EHCA 2OCTA 2H0GA 3MG2A 5EVHA 1BNEA 2D1WA 2RBIA 4MJDA 1VQM3 1K9M4 1RNBA 3LH4A 1RDSA 1W7CA 4BL3A 3DH2A 3OXAA 3FG1A 2Z7AA 1FGRA 3PS8A 1I2GA 2AAEA 4H61A 3EJVA 3MYTA 2CG1A 1RRHA 1C7HA 2K3DA 4O2HA 5GSPA 2HMMB 3BU4A 4HM0B 1W4NA 1UUVB 2AADA 1VZZA 1I0VA 1GOVA 1QMAA 1JZDA 1JBSA 2RCDA 3CC23 1A90A 2LYXA 4L8OA 2F98A 2XH9A 1WNHA 2RFRA 3UNLA 1RCKA 3GAXA 1G0TA 5AEUB 1T2HA 3X3ZA 1C54A 2KAAA 1Q7HA 2E2VA 3SXXA 1BIRA 2CWVA 3NM7A 4J5GA 1D6ZA 4KFEA 1DYUA 2BMQB 3LTCA 5HOHA 3BLZA 3ECFA 2XFTA 3CCE3 4WFOA 1RGEA 1I2EA 3DMCA 1WMPA 2KF3A 2Z6BA 3HZPA 3DGMA 3F14A 1OF5B 3FCSB 3JUNA 1WTHA 3F8HA 2L1SA 3LZAA 1G02A 1DE3A 2QGUA 5ELUA 1DVCA 4K1UA 2R41A 1RLSA 3SYUA 3JUPA 4H3UA 4MMYB 1VQL3 2YX9A 1RGCA 1STFI 1OHSA 2WO0A 3CD63 1X1WA 1FUTA 3MWZA 3GZBA 1RN1A 3KIIA 3VSYA 1FUSA 2OOVA 2JQ5A 1K28A 1MOLA 1JB4A 1O7MB 1S5AA 4RNZA 4XBYA 2XSOB 1I3FA 4O02B 4X2HA 3ZG5A 2Z76A 1MNLA 4J9AA 4MMXB 1CYVA 3IPTA 1W6CA 3F7SA 1AV4A 2CHCA 3SOAA 4WYKB 3DY5A 1N5PA 4K1VA 5STDA 3EN8A 2CFDA 2CWUA 2KXGA 4KT3B 1ULJB 2BU4A 1US1A 3ZFZA 3A5EA 4L7KA 2MF7A 5CF1A 3N9HA 1JNQA 3X41A 1QAFA 1B2MA 3F40A 1OCVA 3KSPA 3OX9A 2I9WA 1BOXA 2W56B 1O7WB 1N8QA 4HM3B 1BSCA 3CU3A 5CLKA 4EV5A 4FCZA 3NBBA 4GHOA 1BNFA 1W00A 2IY2A 4IT7A 1K734 1Q40B 2QEX3 1QVF2 3DUKA 1MWUA 1NU3A 1OHOA 1ZGXA 1V74A 2P38A 4DKIA 8RNTA 1B2UA 4X2OA 3JVCA 4HZBB 1A2PA 3BNBA 9RNTA 6RNTA 1IVXA 1Q9EA 4R9LA 1FW7A 4BTYA 4MEIA 3NM2A 4QWTA 1VQO3 1YGWA 1O7GB 1EA2A 4N6NB 1EQKA 4AKYA 2OTJ3 1E97A 2GSPA 3FG3A 3KN4A 1RN4A 3BB9A 3FGYA 1BRJA 3SVAA 1SIHA 1X1XA 4KFDA 5KP3A 1YIT3 1LVNA 2MC8A 2OQEC 2CFKA 1PU4A 1W2ZA 1A2KA 3H3HA 1E3VA 1GD3A 3WHOA 1I0XA 2W04A 4HAAA 2IYJA 1VQ93 1W6GA 5AYSC 4N6OB 1CYUA 1RSNA 2YFJB 4Q53A 1T5YA 2F4YA 5KP1A 1HU9A 1OGXA 4LYLB 1KSIA 5AEWB 3N8BA 1GY6A 1OF5A 1RGFA 3NQZA 4FMAA 1B3SA 5CF2A 4EW5A 1RJOA 4RNYA 3JUOA 1BRIA 1CEWI 1HKXA 1F8NA 3L0RA 1IDPA 2BMRB 4KZ1A 3I0YA 4LSOA 2LQVA 2GBWB 2GEYA 2XRXB 4FMDA 4I5QA 5BVBA 1NNVA 2CFWA 2KF4A 2W9QA 1M1K4 1BRNL 2P0XA 1UI8A 5DREA 1FGTA 3EN1B 3S28A 3WDGB 1DMQA 1SJWA 2ZDJA 1BU4A 4EYCA 1IV7A 3FG4A 3PGBA 1BNJA 1IV9A 1Q42A 1LXEA 1O7HB 3D5IA 1CQSA 4R1KA 3JUMA 3WA3A 1ISKA 1DVDA 1RGKA 4NREA 2Y73A 3WOEB 1D6UA 1UW1A 1JB2A 1ROVA 2F86B 3HIIA 4JF8A 1VQN3 2KF6A 3CMA3 3S29A 1SIIA 3NBRA 3MPHA 3S5CA 5EQLA 7RNTA 3UJMA 1VQK3 1VQ53 1RNTA 2HMLB 2W56A 1IQ8A 4GSPA 1UDII 3PZWA 3GSPA 3CCM3 3EB8A 3LOYA 1STDA 1GMQA 4U13A 1IYYA 1LOVA 3FKAA 3ZG0A 1Q40A 2CW9A 3LT9A 1BGSA 1NB3I 4R80A 4R4KA 1OGZA 2E2UA 3Q90A 2GBXB 3IMAB 5CK6A 3O8YA 1GMRA 3PCRA 5M1AA 1N5HA 5TGNA 4OVMA 2FNQA 1FUWA 5D81A 3ROBA 3DXOA 1OPYA 3VGNA 3B7CA 1MGRA 3NHXA 4EV2A 1B2SA 1VQQA 1GOUA 1TU5A 3NV0B 4IPBA 4AEQA 1YGEA 4HBRA 3AMOB 3CXC2 1TTOA 4RNTA 5AIHA 3F8XA 5M18A 1QALA 4BL2A 1MWRA 3M8CA 3K0ZA 4GL6A 1J2BA 4XDWA 4L8PA 3CCV3 2INXA 2P09A 1QVG2 2BNGA 3B4PA 3G8ZA 3MG1A 1RN7A 3X3XA 3SLUA 2WGOA 1HZ1A 1HYFA 4GB5A 4ILFA 5EEOA 1W6YA 2CWTA 3AHSA 1V57A 1BRGA 1YI23 4HM7B 4XM4A 2XF3A 2Y74A 1BSBA 5IG4A 1RMSA 1VQ83 2ML5A 3BNCA 1YNVX 1EUIC 3BNDA 1KQS2 1BANA 1LNHA 1RKYA 1JBTA 3D3LA 1BRHA 1TIJA 1JB5A 3KFQC 2CKFB 3FF2A 2F99A 3DGNA 3DM8A 5LC7A 3WODG 1VQ43 4BU4A 2XEPA 5I97A 3GZXB 2GEXA 1Q864 2YFLB 1I2FA 2ZHXB 4N6V0 3LTDA 3LTAA 4CCVA 2YFIB 1PFPA 1DMMA 3RDEA 3LMLA 1ZS7A 1JN5B 3QK9A 4CPKA 4LMIA 1PY3A 1IVVA 1NJI4 2XFSA 1ROAA 1VQ73 1UCJA 1U8CB 6GSPA 2SBLA 3S27A 5IENA 5D82A 3CCL3 4K61A 7STDA 2OOVC 2IA7A 1WMNA 3T0UA 4BTWA 2W9PA 1FZUA 1TFOA 2Q07A 3Q2PA 5G1LA 4HOHA 4BTXA 3NX0A 3DZLA 4LZIA 1B2ZA 3K7CA 3X42A 3NXJA 4HM6B 4KFFA 2GU3A 3KE7A 3G713 1W01A 2Z77A 1KWIA 4HM1B 1BSAA 2F56A 4FMCA 5AI1A 2A15A 3CNMA 4N6LA 3IJEB 1RGAA 1JJ22 1BRSA 1MWSA 3FSDA 1IT7A 1DETA 1TP6A 3NV0A 2W03A 2HMOB 3LYGA 1Q824 3EBYA 3AMOA 2F5MA 5IF6A 1B20A 2CH9A 2B1XB 1SPUA 3MG3A 3CCS3 2CC3A 5CXOA 1NDOB 1RGLA 2UGIA 3LTBA 2IUKA 3ALAA 2E2TA 3WR2A 3DGYA 1RRLA 3CCQ3 2UX0A 3TDGA 1R4YA 1CH0A 1QJGA 2UUGC 1M9GA 3EC9A 3NQYA 3WOFB 4NPBA 1JBRA 1LQGC 1IQYA 3PYJA 5ELJA 3T8NA 4IIAA 2M7OA 2V1LA 3GZRA 2GU1A 2D42A 1YJ93 5IERA 1DMNA 5JPPA 1KD14 4WYKA 1OHPA 1K8A4 3V92A 3SX1A 3CCR3 5M19A 2OWPA 3X40A 1UUGB 3HK4A 3I553 4BIRA 1R4CA 3PXMA 3HOHA 1RHLA 4HM5B 4XDVA 1JKGB 1IVUA 1BUQA 4HM4B 1X1YA 3D9RA 3F9SA 3KZTA 1U5OA 1E3RA 1V58A 3EBTA 2STDA 3D4AA 3G6E3 4LEHA 1N9JA 1ZX2A 2P0MA 2BO9B 4HZ9B 3FF0A 1JZOA 2RGQA 3CNXA 1BUJA 2GXFA 1JN5A 4CJNA 1OUNA 2IMJA 3UL6A 2RSXA 4J5KA 3RNTA 2WOHA 3OWUA 4HM8B 2QA43 3N54B 1GMPA 1TUHA 3MHEA 3PCSA 1A2VA 3NUVA
chains in the Genus database with same CATH topology
1BSBA 1Q9EA 1FW7A 1RMSA 1UCIA 1YGWA 1LOYA 1YNVX 1AY7A 1BNIA 1BANA 1JBTA 1B27A 1BRHA 2GSPA 1T2IA 1TRPA 1BNRA 2HOHA 1RN4A 3AGOA 1BRJA 1UCKA 3BIRA 1X1XA 1LNIA 4BU4A 3D5GA 2BIRA 1B21A 1I2FA 3WHOA 1BVIA 1I0XA 4HAAA 1LRAA 1AQZA 1TRQA 3AHWA 1RSNA 1BNEA 2RBIA 1RNBA 1PY3A 2F4YA 1RDSA 3DH2A 3Q3FA 1RGFA 2F5WA 1B3SA 1RTUA 1UCJA 6GSPA 1I2GA 2AAEA 1BRIA 1MGWA 1BNSA 5GSPA 1I8VA 3BU4A 2ZA4A 1FZUA 2KF4A 2AADA 1I0VA 1GOVA 1JBSA 4HOHA 1BRNL 1BSEA 1BU4A 1B2ZA 1BNJA 1RCKA 1RGHA 1T2HA 1C54A 2KAAA 3D5IA 1UCLA 1BIRA 1BSAA 1PYLA 2F56A 4J5GA 5HOHA 3URPA 1RGKA 1RGAA 1BRSA 1DETA 1FYSA 7GSPA 2C4BA 1RGEA 1B2XA 2F5MA 2KF6A 1I2EA 1LOWA 1B20A 1BNGA 2KF3A 7RNTA 1RNTA 1RGLA 4GSPA 1G02A 1DE3A 3GSPA 1BSDA 3WR2A 1RLSA 3SYUA 3DGYA 1GMQA 1IYYA 1RGCA 1R4YA 1CH0A 1I3IA 1LOVA 1FUTA 1X1WA 1RN1A 1BGSA 1FUSA 1JBRA 1YVSA 1GSPA 1GMRA 1I3FA 5BIRA 1BRKA 1MGRA 1RCLA 1B2SA 1GOUA 4BIRA 2BU4A 1TTOA 3A5EA 4RNTA 3HOHA 1RHLA 3KCHA 1B2MA 1X1YA 2KF5A 5BU4A 1BOXA 1SARA 2SARA 3D4AA 1BSCA 1RGGA 1BAOA 4GHOA 1BNFA 1GOYA 1BUJA 2RNTA 1X1UA 1HZ1A 1HYFA 5RNTA 1ZGXA 8RNTA 1I70A 4J5KA 3AHSA 3RNTA 1B2UA 3AGNA 1A2PA 1BRGA 1GMPA 9RNTA 6RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSB A;  1Q9E A;  1FW7 A;  1RMS A;  1UCI A;  1YGW A;  1LOY A;  1YNV X;  1AY7 A;  1BNI A;  1BAN A;  1JBT A;  1B27 A;  1BRH A;  2GSP A;  1T2I A;  1TRP A;  1BNR A;  2HOH A;  1RN4 A;  3AGO A;  1BRJ A;  1UCK A;  3BIR A;  1X1X A;  1LNI A;  4BU4 A;  3D5G A;  2BIR A;  1B21 A;  1I2F A;  3WHO A;  1BVI A;  1I0X A;  4HAA A;  1LRA A;  1AQZ A;  1TRQ A;  3AHW A;  1RSN A;  1BNE A;  2RBI A;  1RNB A;  1PY3 A;  2F4Y A;  1RDS A;  3DH2 A;  3Q3F A;  1RGF A;  2F5W A;  1B3S A;  1RTU A;  1UCJ A;  6GSP A;  1I2G A;  2AAE A;  1BRI A;  1MGW A;  1BNS A;  5GSP A;  1I8V A;  3BU4 A;  2ZA4 A;  1FZU A;  2KF4 A;  2AAD A;  1I0V A;  1GOV A;  1JBS A;  4HOH A;  1BRN L;  1BSE A;  1BU4 A;  1B2Z A;  1BNJ A;  1RCK A;  1RGH A;  1T2H A;  1C54 A;  2KAA A;  3D5I A;  1UCL A;  1BIR A;  1BSA A;  1PYL A;  2F56 A;  4J5G A;  5HOH A;  3URP A;  1RGK A;  1RGA A;  1BRS A;  1DET A;  1FYS A;  7GSP A;  2C4B A;  1RGE A;  1B2X A;  2F5M A;  2KF6 A;  1I2E A;  1LOW A;  1B20 A;  1BNG A;  2KF3 A;  7RNT A;  1RNT A;  1RGL A;  4GSP A;  1G02 A;  1DE3 A;  3GSP A;  1BSD A;  3WR2 A;  1RLS A;  3SYU A;  3DGY A;  1GMQ A;  1IYY A;  1RGC A;  1R4Y A;  1CH0 A;  1I3I A;  1LOV A;  1FUT A;  1X1W A;  1RN1 A;  1BGS A;  1FUS A;  1JBR A;  1YVS A;  1GSP A;  1GMR A;  1I3F A;  5BIR A;  1BRK A;  1MGR A;  1RCL A;  1B2S A;  1GOU A;  4BIR A;  2BU4 A;  1TTO A;  3A5E A;  4RNT A;  3HOH A;  1RHL A;  3KCH A;  1B2M A;  1X1Y A;  2KF5 A;  5BU4 A;  1BOX A;  1SAR A;  2SAR A;  3D4A A;  1BSC A;  1RGG A;  1BAO A;  4GHO A;  1BNF A;  1GOY A;  1BUJ A;  2RNT A;  1X1U A;  1HZ1 A;  1HYF A;  5RNT A;  1ZGX A;  8RNT A;  1I70 A;  4J5K A;  3AHS A;  3RNT A;  1B2U A;  3AGN A;  1A2P A;  1BRG A;  1GMP A;  9RNT A;  6RNT A; 
#chains in the Genus database with same CATH topology
 3G16 A;  4J8T A;  2H0I A;  3SOY A;  5IG3 A;  2PNC A;  1UCI A;  2XR8 B;  4HKV B;  2C11 A;  4N6M A;  1WMO A;  3UL5 A;  1LOY A;  5IG0 A;  1BNI A;  1NO3 A;  4WP5 A;  1B27 A;  1IVW A;  3OWY A;  3U1W A;  1T2I A;  1TRP A;  3ER7 A;  1TFK A;  4OUQ A;  3G0K A;  1A67 A;  1BNR A;  3AGO A;  5IEO A;  2HMJ B;  1YJN 3;  1ASK A;  1LNI A;  5DRV A;  3SED A;  4CDL A;  1IK3 A;  3D5G A;  4NHF A;  2BIR A;  3EQQ B;  3CC4 3;  1IT8 A;  2FGT A;  3DGL A;  4PEJ A;  1FGO A;  3Q1C A;  2BHM A;  1LRA A;  2OTL 3;  1AQZ A;  3CCJ 3;  3AHW A;  3MSO A;  4STD A;  1AR0 A;  2L4V A;  1O7N B;  1JV2 B;  1OH0 A;  3Q3F A;  2F5W A;  1EKM A;  1IU7 A;  1NWW A;  1RTU A;  2CFG A;  2H0H A;  3VF1 A;  4XBT A;  3HIG A;  2JDI H;  1WQL B;  1MGW A;  5AIF A;  3CC7 3;  3JUQ A;  1GD4 A;  1BNS A;  1K41 A;  1I8V A;  1T3B A;  2CFL A;  5KP4 A;  2ZA4 A;  1IQX A;  2J8X B;  1EEJ A;  2CIU A;  2W6J H;  4EC6 A;  1VQP 3;  3NBJ A;  1BSE A;  2BT3 A;  2KRT A;  1YVB I;  3F7X A;  5JBS A;  2ML6 A;  3K63 A;  1RGH A;  1LOX A;  5FGO A;  1N9E A;  4HYZ A;  1UCL A;  5HGR A;  1PYL A;  1SQW A;  1YIJ 3;  3URP A;  2K0M A;  2HMN B;  2OQE A;  3CPW 2;  4ZM8 A;  1FYS A;  7GSP A;  2C4B A;  2ZL8 A;  3KSE D;  4OK0 A;  3WMD A;  1B2X A;  1KC8 4;  1LOW A;  3FLJ A;  3LXU X;  3WA2 X;  2O9U X;  5IG5 A;  1BNG A;  1JKG A;  1ZO2 A;  4HVN A;  1YJW 3;  1W2B 2;  3CME 3;  3EF8 A;  3RGR A;  1JRQ A;  2KCD A;  3EX9 A;  1MWT A;  3X3Y A;  5LC6 A;  3T8U A;  6STD A;  2WOF A;  1BSD A;  4KVH A;  3OV4 A;  3G4S 3;  3K5T A;  1QAK A;  2XGL A;  5AII A;  3V98 A;  4RBN A;  1I3I A;  3H51 A;  3EE1 A;  8CHO A;  1NB5 I;  2XGN A;  4HJL B;  3E99 A;  5JPU A;  1YVS A;  4ORL A;  4N6U A;  2B24 B;  1GSP A;  4I4K A;  4JRF A;  5BIR A;  5G1K A;  4LGQ A;  1S72 3;  3S67 A;  2FXT A;  1Q81 4;  3BNE A;  1BRK A;  4AKZ A;  1GY5 A;  3B8L A;  4O8S A;  1W02 A;  1O7P B;  5A0O B;  4G1M B;  1FGQ A;  4XB5 A;  1RCL A;  2QIY A;  3QRD A;  5D83 A;  3MKI A;  4N3V A;  2W2C A;  5BXQ A;  5G2G A;  1OAC A;  3KCH A;  1M1X B;  3D79 A;  3CCU 3;  1EG9 B;  1Y4K A;  2PZV A;  3A76 A;  3OWS A;  2KF5 A;  4MMZ B;  4R9K A;  5BU4 A;  1FA3 A;  1SAR A;  2SAR A;  5IEP A;  1RGG A;  2IUJ A;  3HI7 A;  3DGO A;  3UB1 A;  1BAO A;  3B4O A;  3GRD A;  3GZY B;  3U97 A;  1GOY A;  2RNT A;  1X1U A;  5IW9 A;  1FGM A;  4HM2 B;  1Q7Y 4;  2CX1 A;  4FCJ A;  5RNT A;  1D6Y A;  2P05 A;  5AIG A;  3GWR A;  1I70 A;  3STD A;  3FH1 A;  4WHA A;  1GS3 A;  1ULI B;  1LQM B;  1AVL A;  2HMK B;  3AGN A;  1G96 A;  1UGH I;  3OW2 2;  1M90 4;  3FZW A;  2CK3 H;  1UI7 A;  4EXR A;  2C10 A;  1L5G B;  2K54 A;  2O3O A;  1GY7 A;  2XSH B;  1AY7 A;  3V99 A;  1N8R 4;  1AVK A;  3LT8 A;  1GYB A;  4EBG A;  4N6T A;  1W5Z A;  1VQ6 3;  2HOH A;  4TX4 A;  1TJD A;  3KKG A;  4O3V A;  1UCK A;  3K9M C;  3BIR A;  4FCM A;  1YHQ 3;  4XBX A;  2BMO B;  4FMB A;  1Z1S A;  4RZM A;  5AYR B;  3HX8 A;  3J7Y d;  3RGA A;  3I56 3;  1UUW B;  1B21 A;  2CG0 A;  4FR9 A;  2W0Q A;  4K90 B;  3CPO A;  4WWU C;  5FW5 A;  1BVI A;  2R4I A;  2CX0 A;  1TRQ A;  1UGI A;  2WGQ A;  3EHC A;  2OCT A;  2H0G A;  3MG2 A;  5EVH A;  1BNE A;  2D1W A;  2RBI A;  4MJD A;  1VQM 3;  1K9M 4;  1RNB A;  3LH4 A;  1RDS A;  1W7C A;  4BL3 A;  3DH2 A;  3OXA A;  3FG1 A;  2Z7A A;  1FGR A;  3PS8 A;  1I2G A;  2AAE A;  4H61 A;  3EJV A;  3MYT A;  2CG1 A;  1RRH A;  1C7H A;  2K3D A;  4O2H A;  5GSP A;  2HMM B;  3BU4 A;  4HM0 B;  1W4N A;  1UUV B;  2AAD A;  1VZZ A;  1I0V A;  1GOV A;  1QMA A;  1JZD A;  1JBS A;  2RCD A;  3CC2 3;  1A90 A;  2LYX A;  4L8O A;  2F98 A;  2XH9 A;  1WNH A;  2RFR A;  3UNL A;  1RCK A;  3GAX A;  1G0T A;  5AEU B;  1T2H A;  3X3Z A;  1C54 A;  2KAA A;  1Q7H A;  2E2V A;  3SXX A;  1BIR A;  2CWV A;  3NM7 A;  4J5G A;  1D6Z A;  4KFE A;  1DYU A;  2BMQ B;  3LTC A;  5HOH A;  3BLZ A;  3ECF A;  2XFT A;  3CCE 3;  4WFO A;  1RGE A;  1I2E A;  3DMC A;  1WMP A;  2KF3 A;  2Z6B A;  3HZP A;  3DGM A;  3F14 A;  1OF5 B;  3FCS B;  3JUN A;  1WTH A;  3F8H A;  2L1S A;  3LZA A;  1G02 A;  1DE3 A;  2QGU A;  5ELU A;  1DVC A;  4K1U A;  2R41 A;  1RLS A;  3SYU A;  3JUP A;  4H3U A;  4MMY B;  1VQL 3;  2YX9 A;  1RGC A;  1STF I;  1OHS A;  2WO0 A;  3CD6 3;  1X1W A;  1FUT A;  3MWZ A;  3GZB A;  1RN1 A;  3KII A;  3VSY A;  1FUS A;  2OOV A;  2JQ5 A;  1K28 A;  1MOL A;  1JB4 A;  1O7M B;  1S5A A;  4RNZ A;  4XBY A;  2XSO B;  1I3F A;  4O02 B;  4X2H A;  3ZG5 A;  2Z76 A;  1MNL A;  4J9A A;  4MMX B;  1CYV A;  3IPT A;  1W6C A;  3F7S A;  1AV4 A;  2CHC A;  3SOA A;  4WYK B;  3DY5 A;  1N5P A;  4K1V A;  5STD A;  3EN8 A;  2CFD A;  2CWU A;  2KXG A;  4KT3 B;  1ULJ B;  2BU4 A;  1US1 A;  3ZFZ A;  3A5E A;  4L7K A;  2MF7 A;  5CF1 A;  3N9H A;  1JNQ A;  3X41 A;  1QAF A;  1B2M A;  3F40 A;  1OCV A;  3KSP A;  3OX9 A;  2I9W A;  1BOX A;  2W56 B;  1O7W B;  1N8Q A;  4HM3 B;  1BSC A;  3CU3 A;  5CLK A;  4EV5 A;  4FCZ A;  3NBB A;  4GHO A;  1BNF A;  1W00 A;  2IY2 A;  4IT7 A;  1K73 4;  1Q40 B;  2QEX 3;  1QVF 2;  3DUK A;  1MWU A;  1NU3 A;  1OHO A;  1ZGX A;  1V74 A;  2P38 A;  4DKI A;  8RNT A;  1B2U A;  4X2O A;  3JVC A;  4HZB B;  1A2P A;  3BNB A;  9RNT A;  6RNT A;  1IVX A;  1Q9E A;  4R9L A;  1FW7 A;  4BTY A;  4MEI A;  3NM2 A;  4QWT A;  1VQO 3;  1YGW A;  1O7G B;  1EA2 A;  4N6N B;  1EQK A;  4AKY A;  2OTJ 3;  1E97 A;  2GSP A;  3FG3 A;  3KN4 A;  1RN4 A;  3BB9 A;  3FGY A;  1BRJ A;  3SVA A;  1SIH A;  1X1X A;  4KFD A;  5KP3 A;  1YIT 3;  1LVN A;  2MC8 A;  2OQE C;  2CFK A;  1PU4 A;  1W2Z A;  1A2K A;  3H3H A;  1E3V A;  1GD3 A;  3WHO A;  1I0X A;  2W04 A;  4HAA A;  2IYJ A;  1VQ9 3;  1W6G A;  5AYS C;  4N6O B;  1CYU A;  1RSN A;  2YFJ B;  4Q53 A;  1T5Y A;  2F4Y A;  5KP1 A;  1HU9 A;  1OGX A;  4LYL B;  1KSI A;  5AEW B;  3N8B A;  1GY6 A;  1OF5 A;  1RGF A;  3NQZ A;  4FMA A;  1B3S A;  5CF2 A;  4EW5 A;  1RJO A;  4RNY A;  3JUO A;  1BRI A;  1CEW I;  1HKX A;  1F8N A;  3L0R A;  1IDP A;  2BMR B;  4KZ1 A;  3I0Y A;  4LSO A;  2LQV A;  2GBW B;  2GEY A;  2XRX B;  4FMD A;  4I5Q A;  5BVB A;  1NNV A;  2CFW A;  2KF4 A;  2W9Q A;  1M1K 4;  1BRN L;  2P0X A;  1UI8 A;  5DRE A;  1FGT A;  3EN1 B;  3S28 A;  3WDG B;  1DMQ A;  1SJW A;  2ZDJ A;  1BU4 A;  4EYC A;  1IV7 A;  3FG4 A;  3PGB A;  1BNJ A;  1IV9 A;  1Q42 A;  1LXE A;  1O7H B;  3D5I A;  1CQS A;  4R1K A;  3JUM A;  3WA3 A;  1ISK A;  1DVD A;  1RGK A;  4NRE A;  2Y73 A;  3WOE B;  1D6U A;  1UW1 A;  1JB2 A;  1ROV A;  2F86 B;  3HII A;  4JF8 A;  1VQN 3;  2KF6 A;  3CMA 3;  3S29 A;  1SII A;  3NBR A;  3MPH A;  3S5C A;  5EQL A;  7RNT A;  3UJM A;  1VQK 3;  1VQ5 3;  1RNT A;  2HML B;  2W56 A;  1IQ8 A;  4GSP A;  1UDI I;  3PZW A;  3GSP A;  3CCM 3;  3EB8 A;  3LOY A;  1STD A;  1GMQ A;  4U13 A;  1IYY A;  1LOV A;  3FKA A;  3ZG0 A;  1Q40 A;  2CW9 A;  3LT9 A;  1BGS A;  1NB3 I;  4R80 A;  4R4K A;  1OGZ A;  2E2U A;  3Q90 A;  2GBX B;  3IMA B;  5CK6 A;  3O8Y A;  1GMR A;  3PCR A;  5M1A A;  1N5H A;  5TGN A;  4OVM A;  2FNQ A;  1FUW A;  5D81 A;  3ROB A;  3DXO A;  1OPY A;  3VGN A;  3B7C A;  1MGR A;  3NHX A;  4EV2 A;  1B2S A;  1VQQ A;  1GOU A;  1TU5 A;  3NV0 B;  4IPB A;  4AEQ A;  1YGE A;  4HBR A;  3AMO B;  3CXC 2;  1TTO A;  4RNT A;  5AIH A;  3F8X A;  5M18 A;  1QAL A;  4BL2 A;  1MWR A;  3M8C A;  3K0Z A;  4GL6 A;  1J2B A;  4XDW A;  4L8P A;  3CCV 3;  2INX A;  2P09 A;  1QVG 2;  2BNG A;  3B4P A;  3G8Z A;  3MG1 A;  1RN7 A;  3X3X A;  3SLU A;  2WGO A;  1HZ1 A;  1HYF A;  4GB5 A;  4ILF A;  5EEO A;  1W6Y A;  2CWT A;  3AHS A;  1V57 A;  1BRG A;  1YI2 3;  4HM7 B;  4XM4 A;  2XF3 A;  2Y74 A;  1BSB A;  5IG4 A;  1RMS A;  1VQ8 3;  2ML5 A;  3BNC A;  1YNV X;  1EUI C;  3BND A;  1KQS 2;  1BAN A;  1LNH A;  1RKY A;  1JBT A;  3D3L A;  1BRH A;  1TIJ A;  1JB5 A;  3KFQ C;  2CKF B;  3FF2 A;  2F99 A;  3DGN A;  3DM8 A;  5LC7 A;  3WOD G;  1VQ4 3;  4BU4 A;  2XEP A;  5I97 A;  3GZX B;  2GEX A;  1Q86 4;  2YFL B;  1I2F A;  2ZHX B;  4N6V 0;  3LTD A;  3LTA A;  4CCV A;  2YFI B;  1PFP A;  1DMM A;  3RDE A;  3LML A;  1ZS7 A;  1JN5 B;  3QK9 A;  4CPK A;  4LMI A;  1PY3 A;  1IVV A;  1NJI 4;  2XFS A;  1ROA A;  1VQ7 3;  1UCJ A;  1U8C B;  6GSP A;  2SBL A;  3S27 A;  5IEN A;  5D82 A;  3CCL 3;  4K61 A;  7STD A;  2OOV C;  2IA7 A;  1WMN A;  3T0U A;  4BTW A;  2W9P A;  1FZU A;  1TFO A;  2Q07 A;  3Q2P A;  5G1L A;  4HOH A;  4BTX A;  3NX0 A;  3DZL A;  4LZI A;  1B2Z A;  3K7C A;  3X42 A;  3NXJ A;  4HM6 B;  4KFF A;  2GU3 A;  3KE7 A;  3G71 3;  1W01 A;  2Z77 A;  1KWI A;  4HM1 B;  1BSA A;  2F56 A;  4FMC A;  5AI1 A;  2A15 A;  3CNM A;  4N6L A;  3IJE B;  1RGA A;  1JJ2 2;  1BRS A;  1MWS A;  3FSD A;  1IT7 A;  1DET A;  1TP6 A;  3NV0 A;  2W03 A;  2HMO B;  3LYG A;  1Q82 4;  3EBY A;  3AMO A;  2F5M A;  5IF6 A;  1B20 A;  2CH9 A;  2B1X B;  1SPU A;  3MG3 A;  3CCS 3;  2CC3 A;  5CXO A;  1NDO B;  1RGL A;  2UGI A;  3LTB A;  2IUK A;  3ALA A;  2E2T A;  3WR2 A;  3DGY A;  1RRL A;  3CCQ 3;  2UX0 A;  3TDG A;  1R4Y A;  1CH0 A;  1QJG A;  2UUG C;  1M9G A;  3EC9 A;  3NQY A;  3WOF B;  4NPB A;  1JBR A;  1LQG C;  1IQY A;  3PYJ A;  5ELJ A;  3T8N A;  4IIA A;  2M7O A;  2V1L A;  3GZR A;  2GU1 A;  2D42 A;  1YJ9 3;  5IER A;  1DMN A;  5JPP A;  1KD1 4;  4WYK A;  1OHP A;  1K8A 4;  3V92 A;  3SX1 A;  3CCR 3;  5M19 A;  2OWP A;  3X40 A;  1UUG B;  3HK4 A;  3I55 3;  4BIR A;  1R4C A;  3PXM A;  3HOH A;  1RHL A;  4HM5 B;  4XDV A;  1JKG B;  1IVU A;  1BUQ A;  4HM4 B;  1X1Y A;  3D9R A;  3F9S A;  3KZT A;  1U5O A;  1E3R A;  1V58 A;  3EBT A;  2STD A;  3D4A A;  3G6E 3;  4LEH A;  1N9J A;  1ZX2 A;  2P0M A;  2BO9 B;  4HZ9 B;  3FF0 A;  1JZO A;  2RGQ A;  3CNX A;  1BUJ A;  2GXF A;  1JN5 A;  4CJN A;  1OUN A;  2IMJ A;  3UL6 A;  2RSX A;  4J5K A;  3RNT A;  2WOH A;  3OWU A;  4HM8 B;  2QA4 3;  3N54 B;  1GMP A;  1TUH A;  3MHE A;  3PCS A;  1A2V A;  3NUV A; 
#chains in the Genus database with same CATH homology
 1BSB A;  1Q9E A;  1FW7 A;  1RMS A;  1UCI A;  1YGW A;  1LOY A;  1YNV X;  1AY7 A;  1BNI A;  1BAN A;  1JBT A;  1B27 A;  1BRH A;  2GSP A;  1T2I A;  1TRP A;  1BNR A;  2HOH A;  1RN4 A;  3AGO A;  1BRJ A;  1UCK A;  3BIR A;  1X1X A;  1LNI A;  4BU4 A;  3D5G A;  2BIR A;  1B21 A;  1I2F A;  3WHO A;  1BVI A;  1I0X A;  4HAA A;  1LRA A;  1AQZ A;  1TRQ A;  3AHW A;  1RSN A;  1BNE A;  2RBI A;  1RNB A;  1PY3 A;  2F4Y A;  1RDS A;  3DH2 A;  3Q3F A;  1RGF A;  2F5W A;  1B3S A;  1RTU A;  1UCJ A;  6GSP A;  1I2G A;  2AAE A;  1BRI A;  1MGW A;  1BNS A;  5GSP A;  1I8V A;  3BU4 A;  2ZA4 A;  1FZU A;  2KF4 A;  2AAD A;  1I0V A;  1GOV A;  1JBS A;  4HOH A;  1BRN L;  1BSE A;  1BU4 A;  1B2Z A;  1BNJ A;  1RCK A;  1RGH A;  1T2H A;  1C54 A;  2KAA A;  3D5I A;  1UCL A;  1BIR A;  1BSA A;  1PYL A;  2F56 A;  4J5G A;  5HOH A;  3URP A;  1RGK A;  1RGA A;  1BRS A;  1DET A;  1FYS A;  7GSP A;  2C4B A;  1RGE A;  1B2X A;  2F5M A;  2KF6 A;  1I2E A;  1LOW A;  1B20 A;  1BNG A;  2KF3 A;  7RNT A;  1RNT A;  1RGL A;  4GSP A;  1G02 A;  1DE3 A;  3GSP A;  1BSD A;  3WR2 A;  1RLS A;  3SYU A;  3DGY A;  1GMQ A;  1IYY A;  1RGC A;  1R4Y A;  1CH0 A;  1I3I A;  1LOV A;  1FUT A;  1X1W A;  1RN1 A;  1BGS A;  1FUS A;  1JBR A;  1YVS A;  1GSP A;  1GMR A;  1I3F A;  5BIR A;  1BRK A;  1MGR A;  1RCL A;  1B2S A;  1GOU A;  4BIR A;  2BU4 A;  1TTO A;  3A5E A;  4RNT A;  3HOH A;  1RHL A;  3KCH A;  1B2M A;  1X1Y A;  2KF5 A;  5BU4 A;  1BOX A;  1SAR A;  2SAR A;  3D4A A;  1BSC A;  1RGG A;  1BAO A;  4GHO A;  1BNF A;  1GOY A;  1BUJ A;  2RNT A;  1X1U A;  1HZ1 A;  1HYF A;  5RNT A;  1ZGX A;  8RNT A;  1I70 A;  4J5K A;  3AHS A;  3RNT A;  1B2U A;  3AGN A;  1A2P A;  1BRG A;  1GMP A;  9RNT A;  6RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...