4GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 7 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4gspA00
1RTUA 1LOVA 2RNTA 1AY7A 1MGRA 1RCLA 1BUJA 1BSEA 3WR2A 1BOXA 5GSPA 1A2PA 1RGHA 4BIRA 3DH2A 3SYUA 1BNSA 3D4AA 1R4YA 1UCJA 1RGFA 2HOHA 1I2EA 1HYFA 1I3FA 1RN1A 1HZ1A 1TRQA 6RNTA 1JBRA 1BNJA 1GSPA 1ZGXA 1JBTA 1RDSA 2BIRA 3AHWA 1BRNL 1B2MA 1BRHA 1G02A 3AHSA 1FW7A 1RGCA 8RNTA 1FYSA 2F56A 4GHOA 1BNIA 1RN4A 1IYYA 1RLSA 1BRJA 1B2UA 1T2HA 3BU4A 9RNTA 4BU4A 2KAAA 1UCIA 1FUTA 1B21A 1X1WA 1YGWA 4GSPA 1RGAA 1I0VA 1X1UA 1LRAA 1GOVA 1BSDA 2ZA4A 1B27A 2GSPA 1UCKA 2F5MA 4HAAA 2AAEA 3D5GA 1RGKA 1RGGA 7GSPA 1BNGA 1I8VA 2KF3A 1CH0A 1B20A 3Q3FA 1BNFA 2KF4A 4J5KA 1BGSA 2RBIA 1BVIA 3KCHA 3A5EA 1BNRA 1DE3A 1BRKA 1UCLA 1I2GA 3URPA 5HOHA 1BSAA 1FUSA 1SARA 1X1XA 1X1YA 1Q9EA 1YVSA 2AADA 3AGOA 1LNIA 1BRGA 4HOHA 1RNBA 2SARA 1GMQA 1BANA 1RGLA 1I0XA 2F5WA 2BU4A 1I70A 1PY3A 1B2XA 5BU4A 1RGEA 3DGYA 1DETA 5BIRA 4J5GA 1B2ZA 1B3SA 1BNEA 2KF5A 1BRSA 1GMRA 5RNTA 1T2IA 3HOHA 1GOYA 1LOWA 1BIRA 3GSPA 3RNTA 1JBSA 2F4YA 1AQZA 1RHLA 1I3IA 1RSNA 7RNTA 3D5IA 1PYLA 1TTOA 1B2SA 3AGNA 2C4BA 1RCKA 1LOYA 4RNTA 1C54A 3WHOA 1RNTA 1RMSA 1BRIA 3BIRA 1GOUA 1I2FA 2KF6A 1YNVX 1BSBA 1GMPA 1MGWA 1BU4A 6GSPA 1FZUA 1TRPA 1BAOA 1BSCA
chains in the Genus database with same CATH superfamily
1E3RA 1QAFA 2HMKB 3DUKA 3F7SA 1AY7A 5IERA 3EBYA 1OHSA 1AVKA 3F14A 2GEXA 4HM6B 4LSOA 1DVCA 3WR2A 1BOXA 3OV4A 2W0QA 2XFSA 2IUJA 2GU3A 4XBXA 1R4YA 5BXQA 3B4OA 1UCJA 3MKIA 2P38A 4LGQA 1HYFA 1MOLA 1JBRA 3F9SA 3WA3A 2IUKA 4AEQA 1JBTA 2Q07A 4HM2B 3NUVA 3HIIA 5ELUA 3FZWA 1Q40A 4N6TA 3FG1A 2GXFA 5AEWB 3G16A 2OOVA 3EB8A 3QRDA 1G02A 1FW7A 1FYSA 2XSHB 2F56A 4GHOA 3WODG 1LVNA 1T5YA 1WMOA 1V57A 3IPTA 1IYYA 2XEPA 2LYXA 3PCRA 3ZFZA 4R4KA 2B24B 2CK3H 4O3VA 1U8CB 4AKZA 2GU1A 2CWVA 4RBNA 4WFOA 3JUPA 5M1AA 1UCIA 1IQYA 1FUTA 1X1WA 2BNGA 1RGAA 1Q814 1ISKA 4O02B 3KE7A 4XDWA 5KP3A 3EN1B 3FF0A 1BSDA 3OX9A 5TGNA 1VQ83 3U97A 8CHOA 4LYLB 1DMMA 1Q824 2J8XB 3FG3A 2E2VA 7GSPA 2Z7AA 3B8LA 1ROVA 3LTCA 3E99A 2R4IA 3BB9A 5CF2A 1CH0A 2CX1A 3OWYA 2WOFA 1UGIA 4N6V0 4JRFA 5IG4A 2YX9A 4X2OA 2KF4A 4WHAA 1TP6A 4HM1B 3RGRA 1BGSA 1WNHA 4WWUC 1VQK3 3NX0A 3A5EA 2C10A 3KKGA 3Q2PA 1HU9A 1BRKA 2Y74A 5HOHA 5DREA 1ZX2A 1BRGA 5IW9A 3CXC2 2SARA 3CCS3 4K90B 1O7GB 1GY7A 4OK0A 1YIT3 2GBXB 3CC43 1B2XA 1VQ53 3WDGB 3LT8A 2CWTA 5BIRA 2PNCA 3O8YA 1B2ZA 3HX8A 4J5GA 5KP1A 1US1A 2XF3A 1JN5B 1BNEA 1VQ43 3KZTA 4RNYA 2CKFB 4IT7A 4IIAA 4RNZA 2UUGC 1GMRA 1OUNA 1NJI4 1TIJA 1T2IA 1OPYA 5D82A 2ML6A 1T3BA 3JUMA 3RNTA 1FGRA 2Z77A 1EUIC 3ZG5A 1RSNA 3LTDA 3D5IA 1Q7HA 1RRLA 2XH9A 3FGYA 1MWSA 3TDGA 4HKVB 3PCSA 3AGNA 4EV2A 1N8R4 3SEDA 1C54A 4KFEA 4WYKB 5AYRB 3WMDA 5IEOA 3WHOA 1RNTA 4N6LA 1VQ63 2STDA 1I2FA 2KF6A 4XBYA 1LQGC 2CX0A 2L1SA 3LMLA 1MGWA 1IVVA 3G6E3 2OTL3 1BU4A 1MWTA 3N54B 1TRPA 1JKGB 1SJWA 3HZPA 2JDIH 1SIHA 2HMNB 2XGNA 5AEUB 7STDA 1VQP3 3X3YA 2FXTA 2JQ5A 2QA43 1RCLA 1BUJA 1OCVA 3EQQB 4EBGA 2LQVA 1LNHA 3CU3A 1A2PA 1RGHA 5M19A 3SYUA 3CCL3 1OHPA 1VQ73 4H61A 1BNSA 1AVLA 1WMNA 2GEYA 1N5PA 4N6NB 1KD14 4N6OB 1UDII 3NQZA 1TRQA 3IMAB 1YJ93 2E2UA 3NM2A 4GL6A 2CFGA 1L5GB 3K5TA 1UUWB 1A90A 3UNLA 3JUQA 3RDEA 5BVBA 3DM8A 5IF6A 2O9UX 3CPW2 3FH1A 1BRNL 2UX0A 1W6GA 1V58A 2WOHA 3N9HA 4NREA 2QGUA 3AHSA 1FA3A 1RGCA 3M8CA 3ROBA 4EXRA 3NHXA 4XDVA 3CD63 2CG0A 1AR0A 1RN4A 1RLSA 1IV9A 1D6UA 1TJDA 1BRJA 3KSPA 4BL2A 2HMLB 4AKYA 1CYVA 4Q53A 3GZYB 1FGMA 2XSOB 1JZOA 4BU4A 3MG1A 1OH0A 3EE1A 4HM3B 4GSPA 2CWUA 3NV0A 1YIJ3 4HZBB 5G1KA 1PU4A 2A15A 1LRAA 1GOVA 3B7CA 3AMOA 1N9JA 2ZL8A 4FMDA 3HI7A 1UCKA 3CCE3 4HAAA 2BMRB 1RGKA 2GBWB 3DGOA 1RGGA 3DGLA 1OGXA 4BTXA 1I8VA 2KF3A 3HK4A 1STDA 1MWUA 1EKMA 3CCR3 2CG1A 2M7OA 4I5QA 3GZBA 3NM7A 1O7MB 3IJEB 1UI7A 1JV2B 1BNRA 1D6YA 1UUGB 1SIIA 4K1UA 4X2HA 1UW1A 1BSAA 1SARA 1X1XA 1X1YA 1N9EA 2KRTA 2AADA 3LZAA 1RNBA 4RZMA 1RKYA 1KQS2 2OQEC 2W56A 2W6JH 4J8TA 5CLKA 3CME3 2F5WA 2BU4A 5BU4A 3MYTA 1N5HA 1DVDA 2HMMB 4IPBA 1S5AA 3KN4A 1BUQA 1IT8A 2IMJA 1UUVB 2KF5A 1JZDA 1O7PB 4LEHA 5STDA 1BRSA 3GZRA 3OXAA 1QAKA 1K734 2OTJ3 3EHCA 4L8PA 4BTYA 1SPUA 4FMAA 2C11A 1WMPA 3SXXA 1DMQA 1YI23 1JRQA 2CFKA 2E2TA 1E97A 1W4NA 7RNTA 2MF7A 1FGOA 3H3HA 4MJDA 1STFI 3UB1A 1K9M4 3FF2A 1ZS7A 5G2GA 1DMNA 1JB5A 2CFLA 3MWZA 3V98A 1GYBA 4MEIA 3BIRA 3UL5A 1GOUA 1AV4A 3VF1A 2CH9A 1Q40B 3UL6A 3MG3A 1BSBA 3PGBA 1W01A 6GSPA 3WOEB 2W04A 2BMOB 1ROAA 1BSCA 4CJNA 1RRHA 6RNTA 3ER7A 4FCZA 2RNTA 3NXJA 2YFJB 4JF8A 1Y4KA 3WOFB 1S723 1Q42A 1GD4A 3EC9A 1GY5A 2F99A 1IDPA 3L0RA 3D3LA 4KZ1A 1OF5B 2CFWA 2W2CA 5EEOA 4BIRA 1W02A 3D4AA 3ALAA 4K1VA 1PFPA 1WTHA 4WP5A 1RGFA 5FGOA 2ZDJA 4J9AA 5FW5A 2RCDA 3K63A 1VQQA 3N8BA 1I3FA 1K28A 1RN1A 3NBRA 4CDLA 2K3DA 3DGNA 2P05A 1Q864 3NQYA 3NBJA 1V74A 1A2VA 2BIRA 1LXEA 1JB2A 3AHWA 3BNBA 3HIGA 2CFDA 1NNVA 4NHFA 4R9KA 2P0MA 2IY2A 3F8HA 3VGNA 1W6CA 1O7HB 3FG4A 1K8A4 1QVF2 5CK6A 5AIIA 1FGTA 3BNDA 3S28A 5JBSA 1VQN3 4QWTA 3FKAA 3X42A 1B2UA 4EYCA 4K61A 3I563 1T2HA 2CC3A 2KXGA 1F8NA 2RFRA 3BU4A 3CCU3 2ML5A 4L8OA 1QMAA 3LTBA 4H3UA 1OGZA 3A76A 4I4KA 1JNQA 1M904 1YGWA 2BT3A 1KWIA 2Z6BA 1IVXA 3MG2A 4TX4A 2IA7A 1I0VA 1W7CA 1X1UA 5JPUA 2QEX3 4HM4B 2K0MA 3LH4A 1B27A 1ULJB 3JUOA 1EQKA 4HM5B 3BNEA 3CNXA 2O3OA 3K0ZA 3LXUX 2AAEA 2CHCA 1W2ZA 3OWSA 4OVMA 2OCTA 4EC6A 3K7CA 3PYJA 5AIGA 2H0GA 4ZM8A 3CNMA 4NPBA 1IVUA 1BNFA 3CCQ3 4N6MA 1C7HA 2YFLB 5I97A 3DZLA 5EVHA 1E3VA 1BVIA 3S29A 2W9QA 1NO3A 3KCHA 4BTWA 6STDA 1GY6A 1DE3A 1CYUA 1I2GA 1UI8A 2D1WA 1KSIA 3AGOA 1Q9EA 1JJ22 4XB5A 2D42A 1LNIA 2BO9B 5AIHA 3I553 4O8SA 1GMQA 3OWUA 4GB5A 1TUHA 1TU5A 1I70A 3Q1CA 1MNLA 3F8XA 3PS8A 4STDA 1DETA 5EQLA 4FR9A 2RSXA 2XR8B 2MC8A 3STDA 4CCVA 1B3SA 3FCSB 1M1K4 3LT9A 5IENA 1YVBI 1KC84 3SVAA 5RNTA 4HYZA 1G0TA 3CPOA 1GOYA 2I9WA 3HOHA 3DMCA 3DGMA 1GS3A 1W6YA 3CMA3 1JBSA 2CIUA 3MHEA 5KP4A 1YGEA 1I3IA 3S5CA 4HJLB 5AIFA 5G1LA 5CF1A 1NU3A 2QIYA 1TTOA 2V1LA 3EF8A 3BNCA 1B2SA 1VQ93 4FCMA 4KFFA 3GZXB 3OW22 1IU7A 2C4BA 2WO0A 1LOYA 2RGQA 3GWRA 1W00A 3T0UA 1RMSA 2XGLA 4MMYB 2P09A 1D6ZA 3G8ZA 1G96A 1YNVX 4EV5A 1TFKA 1JN5A 4KFDA 2R41A 3CCV3 3X3XA 1CEWI 1FZUA 3MSOA 1FGQA 4MMXB 4BL3A 4OUQA 1MWRA 1ZO2A 3F7XA 1EG9B 1LOVA 1RTUA 1MGRA 2HMOB 3SOAA 1DYUA 1EEJA 3CCM3 1BSEA 4R9LA 1JB4A 3V92A 1M1XB 5HGRA 1OF5A 5GSPA 3T8NA 3JVCA 3KSED 2XRXB 4R1KA 1YHQ3 1VQL3 1U5OA 3DH2A 5AYSC 2W03A 1IV7A 4CPKA 5D81A 4ORLA 1OHOA 4LMIA 3NV0B 2Y73A 2INXA 1IT7A 2HOHA 3CC73 3PZWA 4XBTA 1I2EA 5IG0A 1HZ1A 2KCDA 2L4VA 4HM0B 4WYKA 1BNJA 1GSPA 1SQWA 1ZGXA 1RDSA 2BHMA 3AMOB 3DY5A 3NBBA 4HBRA 2OQEA 3T8UA 1R4CA 1ULIB 3ZG0A 1YJN3 2Z76A 5LC7A 4PEJA 1EA2A 3V99A 2K54A 4ILFA 4N6UA 3EJVA 4HM8B 1BRHA 3LTAA 3Q90A 3X3ZA 1JKGA 1M9GA 4G1MB 8RNTA 5LC6A 1IK3A 2H0HA 1BNIA 2W9PA 4O2HA 3CCJ3 1IQXA 3K9MC 3MPHA 5D83A 1OACA 1WQLB 2WGOA 4XM4A 3G4S3 5ELJA 2F98A 2FNQA 5AI1A 2OWPA 1IQ8A 4EW5A 3X41A 4MMZB 9RNTA 1VZZA 3D9RA 2KAAA 3FSDA 3EBTA 1B21A 4L7KA 2FGTA 5DRVA 1NB5I 1LQMB 2W56B 3LOYA 1N8QA 2P0XA 2ZA4A 2GSPA 2SBLA 3H51A 2F5MA 4FMCA 5M18A 3WA2X 1A2KA 5IG5A 3EX9A 3D5GA 1BNGA 1RN7A 3PXMA 4U13A 3J7Yd 1CQSA 1W5ZA 1B20A 3GRDA 3Q3FA 3X40A 3U1WA 3SOYA 1TFOA 1Z1SA 4J5KA 4KT3B 2RBIA 3B4PA 3KIIA 3I0YA 5A0OB 5IEPA 1UCLA 3URPA 3RGAA 1Q7Y4 1FUSA 3VSYA 1YVSA 3FLJA 3DXOA 3ECFA 3KFQC 4HOHA 2ZHXB 1NWWA 2B1XB 4FMBA 2IYJA 1BANA 1RGLA 1VQO3 1I0XA 1PY3A 1LOXA 1O7WB 4HZ9B 1RGEA 2XFTA 3DGYA 2CW9A 1NB3I 4KVHA 4LZIA 3G0KA 2F86B 3UJMA 3S27A 4DKIA 1RJOA 3S67A 3SX1A 1QVG2 3G713 1LOWA 1J2BA 1BIRA 3GSPA 2UGIA 3QK9A 2F4YA 1HKXA 3SLUA 3LYGA 1AQZA 1RHLA 1UGHI 2H0IA 3JUNA 5CXOA 1W2B2 1YJW3 2WGQA 4R80A 1PYLA 3BLZA 4HVNA 1NDOB 5JPPA 1FUWA 4N3VA 1GD3A 1IVWA 2PZVA 4HM7B 3GAXA 1O7NB 1RCKA 3D79A 4RNTA 1BRIA 1QALA 5IG3A 2YFIB 3F40A 1VQM3 1K41A 2OOVC 1QJGA 1GMPA 2HMJB 3CC23 1A67A 3EN8A 1ASKA 2BMQB 4FCJA 1BAOA 1B2MA
chains in the Genus database with same CATH topology
1RTUA 1LOVA 2RNTA 1AY7A 1MGRA 1RCLA 1BUJA 1BSEA 3WR2A 1BOXA 5GSPA 1A2PA 1RGHA 4BIRA 3DH2A 3SYUA 1BNSA 3D4AA 1R4YA 1UCJA 1RGFA 2HOHA 1I2EA 1HYFA 1I3FA 1RN1A 1HZ1A 1TRQA 6RNTA 1JBRA 1BNJA 1GSPA 1ZGXA 1JBTA 1RDSA 2BIRA 3AHWA 1BRNL 1B2MA 1BRHA 1G02A 3AHSA 1FW7A 1RGCA 8RNTA 1FYSA 2F56A 4GHOA 1BNIA 1RN4A 1IYYA 1RLSA 1BRJA 1B2UA 1T2HA 3BU4A 9RNTA 4BU4A 2KAAA 1UCIA 1FUTA 1B21A 1X1WA 1YGWA 4GSPA 1RGAA 1I0VA 1X1UA 1LRAA 1GOVA 1BSDA 2ZA4A 1B27A 2GSPA 1UCKA 2F5MA 4HAAA 2AAEA 3D5GA 1RGKA 1RGGA 7GSPA 1BNGA 1I8VA 2KF3A 1CH0A 1B20A 3Q3FA 1BNFA 2KF4A 4J5KA 1BGSA 2RBIA 1BVIA 3KCHA 3A5EA 1BNRA 1DE3A 1BRKA 1UCLA 1I2GA 3URPA 5HOHA 1BSAA 1FUSA 1SARA 1X1XA 1X1YA 1Q9EA 1YVSA 2AADA 3AGOA 1LNIA 1BRGA 4HOHA 1RNBA 2SARA 1GMQA 1BANA 1RGLA 1I0XA 2F5WA 2BU4A 1I70A 1PY3A 1B2XA 5BU4A 1RGEA 3DGYA 1DETA 5BIRA 4J5GA 1B2ZA 1B3SA 1BNEA 2KF5A 1BRSA 1GMRA 5RNTA 1T2IA 3HOHA 1GOYA 1LOWA 1BIRA 3GSPA 3RNTA 1JBSA 2F4YA 1AQZA 1RHLA 1I3IA 1RSNA 7RNTA 3D5IA 1PYLA 1TTOA 1B2SA 3AGNA 2C4BA 1RCKA 1LOYA 4RNTA 1C54A 3WHOA 1RNTA 1RMSA 1BRIA 3BIRA 1GOUA 1I2FA 2KF6A 1YNVX 1BSBA 1GMPA 1MGWA 1BU4A 6GSPA 1FZUA 1TRPA 1BAOA 1BSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTU A;  1LOV A;  2RNT A;  1AY7 A;  1MGR A;  1RCL A;  1BUJ A;  1BSE A;  3WR2 A;  1BOX A;  5GSP A;  1A2P A;  1RGH A;  4BIR A;  3DH2 A;  3SYU A;  1BNS A;  3D4A A;  1R4Y A;  1UCJ A;  1RGF A;  2HOH A;  1I2E A;  1HYF A;  1I3F A;  1RN1 A;  1HZ1 A;  1TRQ A;  6RNT A;  1JBR A;  1BNJ A;  1GSP A;  1ZGX A;  1JBT A;  1RDS A;  2BIR A;  3AHW A;  1BRN L;  1B2M A;  1BRH A;  1G02 A;  3AHS A;  1FW7 A;  1RGC A;  8RNT A;  1FYS A;  2F56 A;  4GHO A;  1BNI A;  1RN4 A;  1IYY A;  1RLS A;  1BRJ A;  1B2U A;  1T2H A;  3BU4 A;  9RNT A;  4BU4 A;  2KAA A;  1UCI A;  1FUT A;  1B21 A;  1X1W A;  1YGW A;  4GSP A;  1RGA A;  1I0V A;  1X1U A;  1LRA A;  1GOV A;  1BSD A;  2ZA4 A;  1B27 A;  2GSP A;  1UCK A;  2F5M A;  4HAA A;  2AAE A;  3D5G A;  1RGK A;  1RGG A;  7GSP A;  1BNG A;  1I8V A;  2KF3 A;  1CH0 A;  1B20 A;  3Q3F A;  1BNF A;  2KF4 A;  4J5K A;  1BGS A;  2RBI A;  1BVI A;  3KCH A;  3A5E A;  1BNR A;  1DE3 A;  1BRK A;  1UCL A;  1I2G A;  3URP A;  5HOH A;  1BSA A;  1FUS A;  1SAR A;  1X1X A;  1X1Y A;  1Q9E A;  1YVS A;  2AAD A;  3AGO A;  1LNI A;  1BRG A;  4HOH A;  1RNB A;  2SAR A;  1GMQ A;  1BAN A;  1RGL A;  1I0X A;  2F5W A;  2BU4 A;  1I70 A;  1PY3 A;  1B2X A;  5BU4 A;  1RGE A;  3DGY A;  1DET A;  5BIR A;  4J5G A;  1B2Z A;  1B3S A;  1BNE A;  2KF5 A;  1BRS A;  1GMR A;  5RNT A;  1T2I A;  3HOH A;  1GOY A;  1LOW A;  1BIR A;  3GSP A;  3RNT A;  1JBS A;  2F4Y A;  1AQZ A;  1RHL A;  1I3I A;  1RSN A;  7RNT A;  3D5I A;  1PYL A;  1TTO A;  1B2S A;  3AGN A;  2C4B A;  1RCK A;  1LOY A;  4RNT A;  1C54 A;  3WHO A;  1RNT A;  1RMS A;  1BRI A;  3BIR A;  1GOU A;  1I2F A;  2KF6 A;  1YNV X;  1BSB A;  1GMP A;  1MGW A;  1BU4 A;  6GSP A;  1FZU A;  1TRP A;  1BAO A;  1BSC A; 
#chains in the Genus database with same CATH topology
 1E3R A;  1QAF A;  2HMK B;  3DUK A;  3F7S A;  1AY7 A;  5IER A;  3EBY A;  1OHS A;  1AVK A;  3F14 A;  2GEX A;  4HM6 B;  4LSO A;  1DVC A;  3WR2 A;  1BOX A;  3OV4 A;  2W0Q A;  2XFS A;  2IUJ A;  2GU3 A;  4XBX A;  1R4Y A;  5BXQ A;  3B4O A;  1UCJ A;  3MKI A;  2P38 A;  4LGQ A;  1HYF A;  1MOL A;  1JBR A;  3F9S A;  3WA3 A;  2IUK A;  4AEQ A;  1JBT A;  2Q07 A;  4HM2 B;  3NUV A;  3HII A;  5ELU A;  3FZW A;  1Q40 A;  4N6T A;  3FG1 A;  2GXF A;  5AEW B;  3G16 A;  2OOV A;  3EB8 A;  3QRD A;  1G02 A;  1FW7 A;  1FYS A;  2XSH B;  2F56 A;  4GHO A;  3WOD G;  1LVN A;  1T5Y A;  1WMO A;  1V57 A;  3IPT A;  1IYY A;  2XEP A;  2LYX A;  3PCR A;  3ZFZ A;  4R4K A;  2B24 B;  2CK3 H;  4O3V A;  1U8C B;  4AKZ A;  2GU1 A;  2CWV A;  4RBN A;  4WFO A;  3JUP A;  5M1A A;  1UCI A;  1IQY A;  1FUT A;  1X1W A;  2BNG A;  1RGA A;  1Q81 4;  1ISK A;  4O02 B;  3KE7 A;  4XDW A;  5KP3 A;  3EN1 B;  3FF0 A;  1BSD A;  3OX9 A;  5TGN A;  1VQ8 3;  3U97 A;  8CHO A;  4LYL B;  1DMM A;  1Q82 4;  2J8X B;  3FG3 A;  2E2V A;  7GSP A;  2Z7A A;  3B8L A;  1ROV A;  3LTC A;  3E99 A;  2R4I A;  3BB9 A;  5CF2 A;  1CH0 A;  2CX1 A;  3OWY A;  2WOF A;  1UGI A;  4N6V 0;  4JRF A;  5IG4 A;  2YX9 A;  4X2O A;  2KF4 A;  4WHA A;  1TP6 A;  4HM1 B;  3RGR A;  1BGS A;  1WNH A;  4WWU C;  1VQK 3;  3NX0 A;  3A5E A;  2C10 A;  3KKG A;  3Q2P A;  1HU9 A;  1BRK A;  2Y74 A;  5HOH A;  5DRE A;  1ZX2 A;  1BRG A;  5IW9 A;  3CXC 2;  2SAR A;  3CCS 3;  4K90 B;  1O7G B;  1GY7 A;  4OK0 A;  1YIT 3;  2GBX B;  3CC4 3;  1B2X A;  1VQ5 3;  3WDG B;  3LT8 A;  2CWT A;  5BIR A;  2PNC A;  3O8Y A;  1B2Z A;  3HX8 A;  4J5G A;  5KP1 A;  1US1 A;  2XF3 A;  1JN5 B;  1BNE A;  1VQ4 3;  3KZT A;  4RNY A;  2CKF B;  4IT7 A;  4IIA A;  4RNZ A;  2UUG C;  1GMR A;  1OUN A;  1NJI 4;  1TIJ A;  1T2I A;  1OPY A;  5D82 A;  2ML6 A;  1T3B A;  3JUM A;  3RNT A;  1FGR A;  2Z77 A;  1EUI C;  3ZG5 A;  1RSN A;  3LTD A;  3D5I A;  1Q7H A;  1RRL A;  2XH9 A;  3FGY A;  1MWS A;  3TDG A;  4HKV B;  3PCS A;  3AGN A;  4EV2 A;  1N8R 4;  3SED A;  1C54 A;  4KFE A;  4WYK B;  5AYR B;  3WMD A;  5IEO A;  3WHO A;  1RNT A;  4N6L A;  1VQ6 3;  2STD A;  1I2F A;  2KF6 A;  4XBY A;  1LQG C;  2CX0 A;  2L1S A;  3LML A;  1MGW A;  1IVV A;  3G6E 3;  2OTL 3;  1BU4 A;  1MWT A;  3N54 B;  1TRP A;  1JKG B;  1SJW A;  3HZP A;  2JDI H;  1SIH A;  2HMN B;  2XGN A;  5AEU B;  7STD A;  1VQP 3;  3X3Y A;  2FXT A;  2JQ5 A;  2QA4 3;  1RCL A;  1BUJ A;  1OCV A;  3EQQ B;  4EBG A;  2LQV A;  1LNH A;  3CU3 A;  1A2P A;  1RGH A;  5M19 A;  3SYU A;  3CCL 3;  1OHP A;  1VQ7 3;  4H61 A;  1BNS A;  1AVL A;  1WMN A;  2GEY A;  1N5P A;  4N6N B;  1KD1 4;  4N6O B;  1UDI I;  3NQZ A;  1TRQ A;  3IMA B;  1YJ9 3;  2E2U A;  3NM2 A;  4GL6 A;  2CFG A;  1L5G B;  3K5T A;  1UUW B;  1A90 A;  3UNL A;  3JUQ A;  3RDE A;  5BVB A;  3DM8 A;  5IF6 A;  2O9U X;  3CPW 2;  3FH1 A;  1BRN L;  2UX0 A;  1W6G A;  1V58 A;  2WOH A;  3N9H A;  4NRE A;  2QGU A;  3AHS A;  1FA3 A;  1RGC A;  3M8C A;  3ROB A;  4EXR A;  3NHX A;  4XDV A;  3CD6 3;  2CG0 A;  1AR0 A;  1RN4 A;  1RLS A;  1IV9 A;  1D6U A;  1TJD A;  1BRJ A;  3KSP A;  4BL2 A;  2HML B;  4AKY A;  1CYV A;  4Q53 A;  3GZY B;  1FGM A;  2XSO B;  1JZO A;  4BU4 A;  3MG1 A;  1OH0 A;  3EE1 A;  4HM3 B;  4GSP A;  2CWU A;  3NV0 A;  1YIJ 3;  4HZB B;  5G1K A;  1PU4 A;  2A15 A;  1LRA A;  1GOV A;  3B7C A;  3AMO A;  1N9J A;  2ZL8 A;  4FMD A;  3HI7 A;  1UCK A;  3CCE 3;  4HAA A;  2BMR B;  1RGK A;  2GBW B;  3DGO A;  1RGG A;  3DGL A;  1OGX A;  4BTX A;  1I8V A;  2KF3 A;  3HK4 A;  1STD A;  1MWU A;  1EKM A;  3CCR 3;  2CG1 A;  2M7O A;  4I5Q A;  3GZB A;  3NM7 A;  1O7M B;  3IJE B;  1UI7 A;  1JV2 B;  1BNR A;  1D6Y A;  1UUG B;  1SII A;  4K1U A;  4X2H A;  1UW1 A;  1BSA A;  1SAR A;  1X1X A;  1X1Y A;  1N9E A;  2KRT A;  2AAD A;  3LZA A;  1RNB A;  4RZM A;  1RKY A;  1KQS 2;  2OQE C;  2W56 A;  2W6J H;  4J8T A;  5CLK A;  3CME 3;  2F5W A;  2BU4 A;  5BU4 A;  3MYT A;  1N5H A;  1DVD A;  2HMM B;  4IPB A;  1S5A A;  3KN4 A;  1BUQ A;  1IT8 A;  2IMJ A;  1UUV B;  2KF5 A;  1JZD A;  1O7P B;  4LEH A;  5STD A;  1BRS A;  3GZR A;  3OXA A;  1QAK A;  1K73 4;  2OTJ 3;  3EHC A;  4L8P A;  4BTY A;  1SPU A;  4FMA A;  2C11 A;  1WMP A;  3SXX A;  1DMQ A;  1YI2 3;  1JRQ A;  2CFK A;  2E2T A;  1E97 A;  1W4N A;  7RNT A;  2MF7 A;  1FGO A;  3H3H A;  4MJD A;  1STF I;  3UB1 A;  1K9M 4;  3FF2 A;  1ZS7 A;  5G2G A;  1DMN A;  1JB5 A;  2CFL A;  3MWZ A;  3V98 A;  1GYB A;  4MEI A;  3BIR A;  3UL5 A;  1GOU A;  1AV4 A;  3VF1 A;  2CH9 A;  1Q40 B;  3UL6 A;  3MG3 A;  1BSB A;  3PGB A;  1W01 A;  6GSP A;  3WOE B;  2W04 A;  2BMO B;  1ROA A;  1BSC A;  4CJN A;  1RRH A;  6RNT A;  3ER7 A;  4FCZ A;  2RNT A;  3NXJ A;  2YFJ B;  4JF8 A;  1Y4K A;  3WOF B;  1S72 3;  1Q42 A;  1GD4 A;  3EC9 A;  1GY5 A;  2F99 A;  1IDP A;  3L0R A;  3D3L A;  4KZ1 A;  1OF5 B;  2CFW A;  2W2C A;  5EEO A;  4BIR A;  1W02 A;  3D4A A;  3ALA A;  4K1V A;  1PFP A;  1WTH A;  4WP5 A;  1RGF A;  5FGO A;  2ZDJ A;  4J9A A;  5FW5 A;  2RCD A;  3K63 A;  1VQQ A;  3N8B A;  1I3F A;  1K28 A;  1RN1 A;  3NBR A;  4CDL A;  2K3D A;  3DGN A;  2P05 A;  1Q86 4;  3NQY A;  3NBJ A;  1V74 A;  1A2V A;  2BIR A;  1LXE A;  1JB2 A;  3AHW A;  3BNB A;  3HIG A;  2CFD A;  1NNV A;  4NHF A;  4R9K A;  2P0M A;  2IY2 A;  3F8H A;  3VGN A;  1W6C A;  1O7H B;  3FG4 A;  1K8A 4;  1QVF 2;  5CK6 A;  5AII A;  1FGT A;  3BND A;  3S28 A;  5JBS A;  1VQN 3;  4QWT A;  3FKA A;  3X42 A;  1B2U A;  4EYC A;  4K61 A;  3I56 3;  1T2H A;  2CC3 A;  2KXG A;  1F8N A;  2RFR A;  3BU4 A;  3CCU 3;  2ML5 A;  4L8O A;  1QMA A;  3LTB A;  4H3U A;  1OGZ A;  3A76 A;  4I4K A;  1JNQ A;  1M90 4;  1YGW A;  2BT3 A;  1KWI A;  2Z6B A;  1IVX A;  3MG2 A;  4TX4 A;  2IA7 A;  1I0V A;  1W7C A;  1X1U A;  5JPU A;  2QEX 3;  4HM4 B;  2K0M A;  3LH4 A;  1B27 A;  1ULJ B;  3JUO A;  1EQK A;  4HM5 B;  3BNE A;  3CNX A;  2O3O A;  3K0Z A;  3LXU X;  2AAE A;  2CHC A;  1W2Z A;  3OWS A;  4OVM A;  2OCT A;  4EC6 A;  3K7C A;  3PYJ A;  5AIG A;  2H0G A;  4ZM8 A;  3CNM A;  4NPB A;  1IVU A;  1BNF A;  3CCQ 3;  4N6M A;  1C7H A;  2YFL B;  5I97 A;  3DZL A;  5EVH A;  1E3V A;  1BVI A;  3S29 A;  2W9Q A;  1NO3 A;  3KCH A;  4BTW A;  6STD A;  1GY6 A;  1DE3 A;  1CYU A;  1I2G A;  1UI8 A;  2D1W A;  1KSI A;  3AGO A;  1Q9E A;  1JJ2 2;  4XB5 A;  2D42 A;  1LNI A;  2BO9 B;  5AIH A;  3I55 3;  4O8S A;  1GMQ A;  3OWU A;  4GB5 A;  1TUH A;  1TU5 A;  1I70 A;  3Q1C A;  1MNL A;  3F8X A;  3PS8 A;  4STD A;  1DET A;  5EQL A;  4FR9 A;  2RSX A;  2XR8 B;  2MC8 A;  3STD A;  4CCV A;  1B3S A;  3FCS B;  1M1K 4;  3LT9 A;  5IEN A;  1YVB I;  1KC8 4;  3SVA A;  5RNT A;  4HYZ A;  1G0T A;  3CPO A;  1GOY A;  2I9W A;  3HOH A;  3DMC A;  3DGM A;  1GS3 A;  1W6Y A;  3CMA 3;  1JBS A;  2CIU A;  3MHE A;  5KP4 A;  1YGE A;  1I3I A;  3S5C A;  4HJL B;  5AIF A;  5G1L A;  5CF1 A;  1NU3 A;  2QIY A;  1TTO A;  2V1L A;  3EF8 A;  3BNC A;  1B2S A;  1VQ9 3;  4FCM A;  4KFF A;  3GZX B;  3OW2 2;  1IU7 A;  2C4B A;  2WO0 A;  1LOY A;  2RGQ A;  3GWR A;  1W00 A;  3T0U A;  1RMS A;  2XGL A;  4MMY B;  2P09 A;  1D6Z A;  3G8Z A;  1G96 A;  1YNV X;  4EV5 A;  1TFK A;  1JN5 A;  4KFD A;  2R41 A;  3CCV 3;  3X3X A;  1CEW I;  1FZU A;  3MSO A;  1FGQ A;  4MMX B;  4BL3 A;  4OUQ A;  1MWR A;  1ZO2 A;  3F7X A;  1EG9 B;  1LOV A;  1RTU A;  1MGR A;  2HMO B;  3SOA A;  1DYU A;  1EEJ A;  3CCM 3;  1BSE A;  4R9L A;  1JB4 A;  3V92 A;  1M1X B;  5HGR A;  1OF5 A;  5GSP A;  3T8N A;  3JVC A;  3KSE D;  2XRX B;  4R1K A;  1YHQ 3;  1VQL 3;  1U5O A;  3DH2 A;  5AYS C;  2W03 A;  1IV7 A;  4CPK A;  5D81 A;  4ORL A;  1OHO A;  4LMI A;  3NV0 B;  2Y73 A;  2INX A;  1IT7 A;  2HOH A;  3CC7 3;  3PZW A;  4XBT A;  1I2E A;  5IG0 A;  1HZ1 A;  2KCD A;  2L4V A;  4HM0 B;  4WYK A;  1BNJ A;  1GSP A;  1SQW A;  1ZGX A;  1RDS A;  2BHM A;  3AMO B;  3DY5 A;  3NBB A;  4HBR A;  2OQE A;  3T8U A;  1R4C A;  1ULI B;  3ZG0 A;  1YJN 3;  2Z76 A;  5LC7 A;  4PEJ A;  1EA2 A;  3V99 A;  2K54 A;  4ILF A;  4N6U A;  3EJV A;  4HM8 B;  1BRH A;  3LTA A;  3Q90 A;  3X3Z A;  1JKG A;  1M9G A;  4G1M B;  8RNT A;  5LC6 A;  1IK3 A;  2H0H A;  1BNI A;  2W9P A;  4O2H A;  3CCJ 3;  1IQX A;  3K9M C;  3MPH A;  5D83 A;  1OAC A;  1WQL B;  2WGO A;  4XM4 A;  3G4S 3;  5ELJ A;  2F98 A;  2FNQ A;  5AI1 A;  2OWP A;  1IQ8 A;  4EW5 A;  3X41 A;  4MMZ B;  9RNT A;  1VZZ A;  3D9R A;  2KAA A;  3FSD A;  3EBT A;  1B21 A;  4L7K A;  2FGT A;  5DRV A;  1NB5 I;  1LQM B;  2W56 B;  3LOY A;  1N8Q A;  2P0X A;  2ZA4 A;  2GSP A;  2SBL A;  3H51 A;  2F5M A;  4FMC A;  5M18 A;  3WA2 X;  1A2K A;  5IG5 A;  3EX9 A;  3D5G A;  1BNG A;  1RN7 A;  3PXM A;  4U13 A;  3J7Y d;  1CQS A;  1W5Z A;  1B20 A;  3GRD A;  3Q3F A;  3X40 A;  3U1W A;  3SOY A;  1TFO A;  1Z1S A;  4J5K A;  4KT3 B;  2RBI A;  3B4P A;  3KII A;  3I0Y A;  5A0O B;  5IEP A;  1UCL A;  3URP A;  3RGA A;  1Q7Y 4;  1FUS A;  3VSY A;  1YVS A;  3FLJ A;  3DXO A;  3ECF A;  3KFQ C;  4HOH A;  2ZHX B;  1NWW A;  2B1X B;  4FMB A;  2IYJ A;  1BAN A;  1RGL A;  1VQO 3;  1I0X A;  1PY3 A;  1LOX A;  1O7W B;  4HZ9 B;  1RGE A;  2XFT A;  3DGY A;  2CW9 A;  1NB3 I;  4KVH A;  4LZI A;  3G0K A;  2F86 B;  3UJM A;  3S27 A;  4DKI A;  1RJO A;  3S67 A;  3SX1 A;  1QVG 2;  3G71 3;  1LOW A;  1J2B A;  1BIR A;  3GSP A;  2UGI A;  3QK9 A;  2F4Y A;  1HKX A;  3SLU A;  3LYG A;  1AQZ A;  1RHL A;  1UGH I;  2H0I A;  3JUN A;  5CXO A;  1W2B 2;  1YJW 3;  2WGQ A;  4R80 A;  1PYL A;  3BLZ A;  4HVN A;  1NDO B;  5JPP A;  1FUW A;  4N3V A;  1GD3 A;  1IVW A;  2PZV A;  4HM7 B;  3GAX A;  1O7N B;  1RCK A;  3D79 A;  4RNT A;  1BRI A;  1QAL A;  5IG3 A;  2YFI B;  3F40 A;  1VQM 3;  1K41 A;  2OOV C;  1QJG A;  1GMP A;  2HMJ B;  3CC2 3;  1A67 A;  3EN8 A;  1ASK A;  2BMQ B;  4FCJ A;  1BAO A;  1B2M A; 
#chains in the Genus database with same CATH homology
 1RTU A;  1LOV A;  2RNT A;  1AY7 A;  1MGR A;  1RCL A;  1BUJ A;  1BSE A;  3WR2 A;  1BOX A;  5GSP A;  1A2P A;  1RGH A;  4BIR A;  3DH2 A;  3SYU A;  1BNS A;  3D4A A;  1R4Y A;  1UCJ A;  1RGF A;  2HOH A;  1I2E A;  1HYF A;  1I3F A;  1RN1 A;  1HZ1 A;  1TRQ A;  6RNT A;  1JBR A;  1BNJ A;  1GSP A;  1ZGX A;  1JBT A;  1RDS A;  2BIR A;  3AHW A;  1BRN L;  1B2M A;  1BRH A;  1G02 A;  3AHS A;  1FW7 A;  1RGC A;  8RNT A;  1FYS A;  2F56 A;  4GHO A;  1BNI A;  1RN4 A;  1IYY A;  1RLS A;  1BRJ A;  1B2U A;  1T2H A;  3BU4 A;  9RNT A;  4BU4 A;  2KAA A;  1UCI A;  1FUT A;  1B21 A;  1X1W A;  1YGW A;  4GSP A;  1RGA A;  1I0V A;  1X1U A;  1LRA A;  1GOV A;  1BSD A;  2ZA4 A;  1B27 A;  2GSP A;  1UCK A;  2F5M A;  4HAA A;  2AAE A;  3D5G A;  1RGK A;  1RGG A;  7GSP A;  1BNG A;  1I8V A;  2KF3 A;  1CH0 A;  1B20 A;  3Q3F A;  1BNF A;  2KF4 A;  4J5K A;  1BGS A;  2RBI A;  1BVI A;  3KCH A;  3A5E A;  1BNR A;  1DE3 A;  1BRK A;  1UCL A;  1I2G A;  3URP A;  5HOH A;  1BSA A;  1FUS A;  1SAR A;  1X1X A;  1X1Y A;  1Q9E A;  1YVS A;  2AAD A;  3AGO A;  1LNI A;  1BRG A;  4HOH A;  1RNB A;  2SAR A;  1GMQ A;  1BAN A;  1RGL A;  1I0X A;  2F5W A;  2BU4 A;  1I70 A;  1PY3 A;  1B2X A;  5BU4 A;  1RGE A;  3DGY A;  1DET A;  5BIR A;  4J5G A;  1B2Z A;  1B3S A;  1BNE A;  2KF5 A;  1BRS A;  1GMR A;  5RNT A;  1T2I A;  3HOH A;  1GOY A;  1LOW A;  1BIR A;  3GSP A;  3RNT A;  1JBS A;  2F4Y A;  1AQZ A;  1RHL A;  1I3I A;  1RSN A;  7RNT A;  3D5I A;  1PYL A;  1TTO A;  1B2S A;  3AGN A;  2C4B A;  1RCK A;  1LOY A;  4RNT A;  1C54 A;  3WHO A;  1RNT A;  1RMS A;  1BRI A;  3BIR A;  1GOU A;  1I2F A;  2KF6 A;  1YNV X;  1BSB A;  1GMP A;  1MGW A;  1BU4 A;  6GSP A;  1FZU A;  1TRP A;  1BAO A;  1BSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...