4GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 7 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 4gspA00
1X1UA 1RHLA 1Q9EA 1I2EA 1BRKA 1B2ZA 1B27A 1I70A 1DE3A 1GOYA 1I2FA 1LNIA 6RNTA 1BSEA 1BRNL 1UCKA 3DH2A 1FUSA 1I8VA 1RGKA 1BNRA 3D5IA 1JBTA 1BANA 1PYLA 3AHWA 1YVSA 1X1WA 1ZGXA 3SYUA 1TTOA 2ZA4A 1AY7A 4BIRA 4GHOA 2F56A 2AAEA 3RNTA 1BNGA 1X1XA 1PY3A 1GMQA 2F5WA 3GSPA 1B2SA 1TRPA 1BVIA 1BSCA 1LOVA 1RGCA 2KF6A 1GOVA 3WHOA 1B2UA 3HOHA 1BOXA 3AGNA 1FYSA 3BU4A 2C4BA 1IYYA 4BU4A 3Q3FA 1JBRA 1GOUA 1BNIA 1BSDA 2RBIA 5BU4A 1B3SA 2BU4A 1BU4A 8RNTA 1AQZA 1I3FA 1RCLA 1UCLA 1GMRA 1RLSA 1RGFA 1BNSA 1RN4A 1RGGA 1RNBA 4HOHA 1LRAA 4GSPA 1BRIA 1A2PA 3URPA 1RTUA 3DGYA 7RNTA 2SARA 1I2GA 1JBSA 1GMPA 4J5KA 1RSNA 1I0XA 1T2IA 2BIRA 1FUTA 3AGOA 1B20A 1HYFA 1MGRA 2KF3A 3D5GA 1B21A 1BIRA 1B2XA 1RGEA 1LOWA 5HOHA 1RGAA 1BRGA 5RNTA 1RMSA 1RGHA 1C54A 5BIRA 2AADA 1RCKA 2KF5A 9RNTA 4J5GA 1SARA 3KCHA 1BRJA 1HZ1A 4HAAA 2F4YA 1G02A 2KAAA 1R4YA 1BGSA 1BSBA 1LOYA 1YNVX 2F5MA 1BRSA 1I3IA 1B2MA 1MGWA 7GSPA 1FW7A 3AHSA 1RN1A 1T2HA 1YGWA 1FZUA 1RGLA 2HOHA 1CH0A 1I0VA 1RDSA 1BNJA 2KF4A 1BUJA 2RNTA 1X1YA 4RNTA 1BNFA 3A5EA 1BAOA 6GSPA 1BRHA 3WR2A 3BIRA 1TRQA 1DETA 1UCIA 3D4AA 1RNTA 1BSAA 1BNEA 5GSPA 2GSPA 1GSPA 1UCJA
chains in the Genus database with same CATH superfamily
4I5QA 2GU1A 2OOVC 2PZVA 2W9QA 1V57A 1FGMA 2FXTA 1I2EA 1BRKA 1I70A 5AEUB 1DE3A 1I2FA 1LNIA 2XGNA 1FA3A 1F8NA 3S67A 3S28A 1VQN3 1V74A 2CFKA 2L4VA 2R4IA 3DH2A 3N9HA 2BT3A 1S5AA 2BHMA 3ECFA 1TIJA 4OUQA 2CKFB 1NNVA 1STFI 4HZBB 4U13A 2Q07A 2OCTA 5CF2A 3NBJA 3CXC2 1YJ93 4MMYB 2K3DA 1IK3A 1GYBA 3H3HA 1YVSA 3CCM3 4IPBA 4MJDA 2GBWB 4BIRA 1NO3A 1CYUA 2P09A 2W04A 1OPYA 1ZX2A 1IQ8A 5KP3A 2CK3H 2HMOB 2JDIH 4L7KA 4IT7A 3V92A 1KQS2 1X1XA 1WMNA 2J8XB 3DY5A 1PY3A 1GMQA 1W6YA 3FGYA 3NUVA 4EXRA 4JF8A 3G713 2IMJA 1B2SA 2CG1A 3S29A 3HIGA 4X2OA 5IEOA 3EBYA 2PNCA 3GZBA 1BVIA 1A2VA 1BSCA 1OHOA 1RGCA 1A67A 4FCMA 2V1LA 3HX8A 3HOHA 3K5TA 5HGRA 3OW22 3CC43 2CFGA 2YFIB 4O02B 2C4BA 2H0IA 3Q3FA 1GOUA 3CCU3 1IQXA 4FMAA 2OOVA 1UI7A 1BU4A 1I3FA 1OACA 3UL5A 2BO9B 3CCS3 1D6ZA 3ALAA 5KP1A 4LSOA 4XDVA 1NB3I 1GY6A 1UGHI 1YI23 3K7CA 1BNSA 3I0YA 3DUKA 4R9KA 1DYUA 1PFPA 3FSDA 5I97A 1RKYA 1UW1A 2P38A 3JUQA 3PZWA 4J5KA 4HVNA 2WO0A 4FR9A 1Q40A 1K28A 1LQMB 5JPUA 1G96A 1WNHA 1FUTA 3D5GA 1B20A 1B21A 5STDA 4K1VA 1B2XA 4KFEA 1RGEA 5AYRB 5HOHA 1Q864 1JKGB 1RGHA 4KVHA 3SOAA 1TP6A 2D42A 4WWUC 3G6E3 4XBYA 4IIAA 4XDWA 4BTXA 3Q2PA 3QK9A 1YVBI 3MHEA 5IERA 3HZPA 1G02A 3T8UA 3STDA 1LOYA 2OWPA 3VGNA 3EBTA 1UGIA 2GXFA 2UUGC 3FH1A 3EX9A 3V99A 2CFDA 3KE7A 3HIIA 2XF3A 2MC8A 1EUIC 2OTJ3 4N6MA 4CDLA 1RDSA 3OX9A 4QWTA 1BNJA 2KF4A 4XBXA 1MNLA 2RNTA 4ILFA 4HM4B 1X1YA 3VF1A 4WYKB 1JNQA 3D79A 1VQO3 2P0MA 4WHAA 1ZO2A 1BRHA 1ROVA 1W7CA 2W56B 4XBTA 2GU3A 2GBXB 3AMOA 4AKYA 3F14A 3KFQC 3Q90A 2C10A 2CC3A 5GSPA 1KC84 1TU5A 3D9RA 3CCE3 1GSPA 2H0GA 1JBTA 5AYSC 1IT7A 2CHCA 1QAFA 2W2CA 1Q9EA 4LMIA 4N6NB 3FG1A 4HBRA 1QVG2 4HM0B 3LH4A 6STDA 3LTDA 1NB5I 3F8XA 2IYJA 1BSEA 3UB1A 3SEDA 1SIHA 1TJDA 1UCKA 2LQVA 1FUSA 3ER7A 3G0KA 5ELJA 3NXJA 1RGKA 1JN5A 2LYXA 3S27A 1TFKA 3EB8A 5JBSA 2OTL3 3CNXA 1M9GA 2KRTA 2IUKA 1RN7A 4N6UA 5G1LA 3I563 3CMA3 2RCDA 3FF0A 3KSED 1A90A 1FW7A 1X1WA 1LOXA 1WMOA 2ZA4A 3JUNA 5ELUA 3SYUA 1W2ZA 2QEX3 2WGQA 3S5CA 4FMDA 4X2HA 1LXEA 3GZYB 2P0XA 2F56A 2AAEA 2BMQB 3RNTA 4O2HA 3QRDA 1UUWB 1MWSA 3X40A 1N8R4 1W00A 3GSPA 4EBGA 1O7PB 1M1XB 3CU3A 3GZRA 1N5HA 5M18A 1CYVA 4ORLA 3HI7A 1OF5B 3BU4A 2E2VA 5M19A 2KCDA 3F40A 1YJW3 1W6GA 1Q7HA 4RZMA 4AKZA 3DMCA 1YJN3 1K41A 1BNIA 3J7Yd 2BU4A 4XB5A 1AQZA 5AI1A 3WA3A 4N6LA 1RCLA 1UCLA 2A15A 1GMRA 3MSOA 4HM8B 4R1KA 1MWRA 3CPOA 5AIHA 1RGGA 2B24B 3MPHA 1N9JA 1VQL3 1IT8A 1IVUA 1A2PA 1BRIA 1Z1SA 4NREA 3DGOA 1ISKA 2CG0A 3X41A 1I2GA 1T3BA 3DZLA 4J9AA 1RSNA 1I0XA 1UDII 1ULJB 1FGOA 1UUVB 1T2IA 3JUMA 2BIRA 3AGOA 1MGRA 4O3VA 1OCVA 3GWRA 1NWWA 1G0TA 1IVVA 1RGAA 1JZDA 5BXQA 5RNTA 4L8PA 1DVDA 5BIRA 3LTBA 2AADA 3PCRA 2XGLA 1Q7Y4 3DGMA 2KF5A 3FKAA 1K8A4 3JVCA 4AEQA 2GEXA 1IQYA 4K90B 2Y74A 1BRJA 1HZ1A 1Y4KA 3BB9A 5D82A 2XR8B 2MF7A 4RNZA 4HAAA 5FGOA 2WOHA 5LC7A 3K9MC 1D6UA 2KAAA 4HM3B 2CW9A 2HMKB 4L8OA 4RNYA 4EW5A 3JUPA 3PXMA 5AIIA 4EV5A 1VQ83 1JB4A 1I3IA 3X3YA 3GAXA 1B2MA 1MGWA 1N9EA 1CEWI 1T5YA 2INXA 3NV0B 1T2HA 1US1A 1YGWA 1JZOA 1FZUA 1TFOA 4FCZA 1I0VA 2C11A 1STDA 2BMOB 2CWVA 3OWSA 1YIT3 1W5ZA 3OXAA 2ZHXB 1NU3A 4HM1B 3CME3 3RGRA 1SPUA 2F86B 1OUNA 4RNTA 2QA43 2UX0A 6GSPA 1DMMA 4R9LA 1Q42A 2K0MA 1HU9A 1UCIA 1CQSA 3T8NA 5LC6A 2XSOB 5IF6A 1VQK3 1GY5A 2CH9A 4HKVB 2GSPA 2D1WA 2RSXA 3EN8A 1ULIB 2ZDJA 1X1UA 1N5PA 1RHLA 2ML5A 4K61A 3OWYA 2IY2A 1RRHA 5EVHA 3RGAA 4H3UA 5AIFA 3CD63 1B2ZA 1B27A 1DMNA 1IDPA 3FG4A 3GZXB 3LT8A 4GL6A 1GOYA 1UI8A 4EV2A 1LNHA 4NPBA 2OQEC 2RFRA 1JKGA 3NX0A 2O3OA 3K0ZA 4N3VA 4N6TA 1VQ53 3KN4A 1QMAA 3UJMA 2IA7A 3X42A 1OHSA 2H0HA 3ZG5A 1GS3A 3SXXA 1W4NA 3AHWA 2Y73A 3WMDA 3CCJ3 4I4KA 1MOLA 3AMOB 2W6JH 4KFFA 3UNLA 3NBBA 1EG9B 2SBLA 3GRDA 4JRFA 4EYCA 1FGQA 1E3RA 1BNGA 4R80A 3BNEA 3CCL3 1QVF2 3B7CA 2W9PA 3FLJA 4NHFA 1RRLA 3PCSA 3I553 1TRPA 2FGTA 3N54B 4R4KA 2QGUA 3N8BA 3EC9A 5DRVA 1MWUA 2KF6A 4LEHA 1B2UA 3HK4A 2B1XB 1BOXA 3O8YA 3IMAB 4WYKA 1FYSA 1VZZA 2P05A 3T0UA 1NJI4 2W56A 3CC23 4BU4A 4KT3B 1SIIA 3B4PA 2RBIA 8CHOA 8RNTA 1J2BA 1N8QA 3KZTA 1EKMA 3EJVA 2F99A 1O7NB 1JRQA 3M8CA 3NQYA 3G4S3 1RGFA 1W02A 1RN4A 2CFWA 1RNBA 4HOHA 3EHCA 1LRAA 4BTYA 1LVNA 4GSPA 3NQZA 5IG5A 3X3XA 1W6CA 5CK6A 2CWTA 2YFLB 3URPA 7RNTA 3DGYA 5CF1A 1GY7A 1IVWA 1IV9A 3BLZA 3DXOA 1FGTA 3K63A 1VQ63 1WQLB 1JBSA 4XM4A 1NDOB 4MMXB 5EQLA 1GMPA 1A2KA 7STDA 2XSHB 3FCSB 1HYFA 2KF3A 2HMMB 1FUWA 1LOWA 5AIGA 4HM6B 1YIJ3 1RMSA 3BNCA 2XFTA 2Z7AA 3F7XA 3IPTA 3LOYA 5BVBA 5CLKA 5KP4A 3NM7A 1C54A 2E2UA 3CCV3 1O7GB 1K9M4 1SARA 3LZAA 1VQP3 4G1MB 2K54A 2KXGA 2RGQA 3FF2A 2F4YA 4HM5B 1BGSA 1AVLA 1R4YA 4WP5A 1V58A 2ML6A 2R41A 3X3ZA 2F5MA 1BRSA 3RDEA 1OGXA 4KFDA 1PU4A 4LGQA 4CJNA 4OK0A 1QALA 1GD4A 3AHSA 1OF5A 5D83A 1VQ73 3D3LA 2YFJB 4Q53A 1DVCA 4LZIA 1VQ93 1BNFA 3V98A 1HKXA 4O8SA 1W2B2 4CPKA 1M904 5TGNA 4H61A 4WFOA 1YGEA 1O7HB 3BIRA 2XH9A 1TRQA 4LYLB 5IG0A 1Q814 4DKIA 1SJWA 2CIUA 2HMJB 1L5GB 2HMNB 1RNTA 1VQM3 1BNEA 2BMRB 4OVMA 1UCJA 3G16A 3MYTA 4HM7B 3E99A 5EEOA 3TDGA 1EEJA 1OGZA 1QJGA 1VQ43 4GB5A 4HJLB 4BL3A 3BNDA 1IV7A 6RNTA 2E2TA 1TUHA 3EQQB 3U1WA 5JPPA 3CC73 1BRNL 5D81A 3SLUA 1Q40B 1U8CB 3BNBA 3A76A 3PS8A 5DREA 2F98A 1I8VA 3ROBA 1WMPA 1BNRA 3OV4A 3D5IA 2M7OA 3CCR3 5A0OB 3KIIA 1KWIA 2Z77A 3CNMA 1BANA 2I9WA 1ASKA 1PYLA 3F8HA 4FCJA 1M1K4 1ZGXA 1TTOA 1FGRA 1AY7A 2IUJA 4ZM8A 2QIYA 2STDA 4FMBA 1KD14 3CCQ3 2CWUA 3F7SA 1JJ22 4GHOA 3LMLA 1K734 1GD3A 1MWTA 1W01A 1KSIA 2XFSA 3NV0A 2F5WA 3EE1A 5IG4A 3MWZA 3PYJA 1WTHA 1OHPA 5G1KA 4FMCA 3WOFB 1RJOA 3MG2A 4HM2B 5IW9A 1LOVA 3JUOA 5M1AA 1GOVA 4EC6A 3ZG0A 4BTWA 3AGNA 4RBNA 1U5OA 1OH0A 1IYYA 1JBRA 1BSDA 1E3VA 2CX0A 1B3SA 2ZL8A 4STDA 5BU4A 2YX9A 3DGNA 5FW5A 3PGBA 2Z76A 1E97A 3MKIA 1RLSA 5CXOA 5IEPA 3U97A 1Q824 1JB2A 3NBRA 1RTUA 3FZWA 2SARA 1UUGB 3Q1CA 3F9SA 3LYGA 3LXUX 2WGOA 3WDGB 3WA2X 3OWUA 3LT9A 3DGLA 2FNQA 3B4OA 1AR0A 1BIRA 3MG1A 1D6YA 1BRGA 4KZ1A 3SOYA 3KSPA 4BL2A 1RCKA 1JN5B 9RNTA 4J5GA 4N6V0 4TX4A 1YHQ3 2JQ5A 3KCHA 2UGIA 3EF8A 3DM8A 2CFLA 1R4CA 3L0RA 3LTCA 1VQQA 2WOFA 3UL6A 5IG3A 1AV4A 3WODG 1BSBA 2GEYA 2OQEA 4HZ9B 5AEWB 1YNVX 3NHXA 4J8TA 1IU7A 1S723 2O9UX 3B8LA 7GSPA 4MMZB 1RN1A 1QAKA 1RGLA 1SQWA 2HOHA 1CH0A 1O7WB 4N6OB 3VSYA 3H51A 1BUQA 1C7HA 1AVKA 4MEIA 3WOEB 1IVXA 1BUJA 1DMQA 4HYZA 3KKGA 4PEJA 1O7MB 3A5EA 1LQGC 2W0QA 1BAOA 1JB5A 1ZS7A 2L1SA 2XEPA 4CCVA 3G8ZA 3WR2A 5IENA 1EQKA 3EN1B 3NM2A 2CX1A 1DETA 1JV2B 3LTAA 4K1UA 2HMLB 3CPW2 3MG3A 2Z6BA 3IJEB 3SVAA 2XRXB 3D4AA 5G2GA 3FG3A 3ZFZA 1BSAA 1EA2A 2BNGA 2W03A 3SX1A 3WHOA 1ROAA
chains in the Genus database with same CATH topology
1X1UA 1RHLA 1Q9EA 1I2EA 1BRKA 1B2ZA 1B27A 1I70A 1DE3A 1GOYA 1I2FA 1LNIA 6RNTA 1BSEA 1BRNL 1UCKA 3DH2A 1FUSA 1I8VA 1RGKA 1BNRA 3D5IA 1JBTA 1BANA 1PYLA 3AHWA 1YVSA 1X1WA 1ZGXA 3SYUA 1TTOA 2ZA4A 1AY7A 4BIRA 4GHOA 2F56A 2AAEA 3RNTA 1BNGA 1X1XA 1PY3A 1GMQA 2F5WA 3GSPA 1B2SA 1TRPA 1BVIA 1BSCA 1LOVA 1RGCA 2KF6A 1GOVA 3WHOA 1B2UA 3HOHA 1BOXA 3AGNA 1FYSA 3BU4A 2C4BA 1IYYA 4BU4A 3Q3FA 1JBRA 1GOUA 1BNIA 1BSDA 2RBIA 5BU4A 1B3SA 2BU4A 1BU4A 8RNTA 1AQZA 1I3FA 1RCLA 1UCLA 1GMRA 1RLSA 1RGFA 1BNSA 1RN4A 1RGGA 1RNBA 4HOHA 1LRAA 4GSPA 1BRIA 1A2PA 3URPA 1RTUA 3DGYA 7RNTA 2SARA 1I2GA 1JBSA 1GMPA 4J5KA 1RSNA 1I0XA 1T2IA 2BIRA 1FUTA 3AGOA 1B20A 1HYFA 1MGRA 2KF3A 3D5GA 1B21A 1BIRA 1B2XA 1RGEA 1LOWA 5HOHA 1RGAA 1BRGA 5RNTA 1RMSA 1RGHA 1C54A 5BIRA 2AADA 1RCKA 2KF5A 9RNTA 4J5GA 1SARA 3KCHA 1BRJA 1HZ1A 4HAAA 2F4YA 1G02A 2KAAA 1R4YA 1BGSA 1BSBA 1LOYA 1YNVX 2F5MA 1BRSA 1I3IA 1B2MA 1MGWA 7GSPA 1FW7A 3AHSA 1RN1A 1T2HA 1YGWA 1FZUA 1RGLA 2HOHA 1CH0A 1I0VA 1RDSA 1BNJA 2KF4A 1BUJA 2RNTA 1X1YA 4RNTA 1BNFA 3A5EA 1BAOA 6GSPA 1BRHA 3WR2A 3BIRA 1TRQA 1DETA 1UCIA 3D4AA 1RNTA 1BSAA 1BNEA 5GSPA 2GSPA 1GSPA 1UCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1U A;  1RHL A;  1Q9E A;  1I2E A;  1BRK A;  1B2Z A;  1B27 A;  1I70 A;  1DE3 A;  1GOY A;  1I2F A;  1LNI A;  6RNT A;  1BSE A;  1BRN L;  1UCK A;  3DH2 A;  1FUS A;  1I8V A;  1RGK A;  1BNR A;  3D5I A;  1JBT A;  1BAN A;  1PYL A;  3AHW A;  1YVS A;  1X1W A;  1ZGX A;  3SYU A;  1TTO A;  2ZA4 A;  1AY7 A;  4BIR A;  4GHO A;  2F56 A;  2AAE A;  3RNT A;  1BNG A;  1X1X A;  1PY3 A;  1GMQ A;  2F5W A;  3GSP A;  1B2S A;  1TRP A;  1BVI A;  1BSC A;  1LOV A;  1RGC A;  2KF6 A;  1GOV A;  3WHO A;  1B2U A;  3HOH A;  1BOX A;  3AGN A;  1FYS A;  3BU4 A;  2C4B A;  1IYY A;  4BU4 A;  3Q3F A;  1JBR A;  1GOU A;  1BNI A;  1BSD A;  2RBI A;  5BU4 A;  1B3S A;  2BU4 A;  1BU4 A;  8RNT A;  1AQZ A;  1I3F A;  1RCL A;  1UCL A;  1GMR A;  1RLS A;  1RGF A;  1BNS A;  1RN4 A;  1RGG A;  1RNB A;  4HOH A;  1LRA A;  4GSP A;  1BRI A;  1A2P A;  3URP A;  1RTU A;  3DGY A;  7RNT A;  2SAR A;  1I2G A;  1JBS A;  1GMP A;  4J5K A;  1RSN A;  1I0X A;  1T2I A;  2BIR A;  1FUT A;  3AGO A;  1B20 A;  1HYF A;  1MGR A;  2KF3 A;  3D5G A;  1B21 A;  1BIR A;  1B2X A;  1RGE A;  1LOW A;  5HOH A;  1RGA A;  1BRG A;  5RNT A;  1RMS A;  1RGH A;  1C54 A;  5BIR A;  2AAD A;  1RCK A;  2KF5 A;  9RNT A;  4J5G A;  1SAR A;  3KCH A;  1BRJ A;  1HZ1 A;  4HAA A;  2F4Y A;  1G02 A;  2KAA A;  1R4Y A;  1BGS A;  1BSB A;  1LOY A;  1YNV X;  2F5M A;  1BRS A;  1I3I A;  1B2M A;  1MGW A;  7GSP A;  1FW7 A;  3AHS A;  1RN1 A;  1T2H A;  1YGW A;  1FZU A;  1RGL A;  2HOH A;  1CH0 A;  1I0V A;  1RDS A;  1BNJ A;  2KF4 A;  1BUJ A;  2RNT A;  1X1Y A;  4RNT A;  1BNF A;  3A5E A;  1BAO A;  6GSP A;  1BRH A;  3WR2 A;  3BIR A;  1TRQ A;  1DET A;  1UCI A;  3D4A A;  1RNT A;  1BSA A;  1BNE A;  5GSP A;  2GSP A;  1GSP A;  1UCJ A; 
#chains in the Genus database with same CATH topology
 4I5Q A;  2GU1 A;  2OOV C;  2PZV A;  2W9Q A;  1V57 A;  1FGM A;  2FXT A;  1I2E A;  1BRK A;  1I70 A;  5AEU B;  1DE3 A;  1I2F A;  1LNI A;  2XGN A;  1FA3 A;  1F8N A;  3S67 A;  3S28 A;  1VQN 3;  1V74 A;  2CFK A;  2L4V A;  2R4I A;  3DH2 A;  3N9H A;  2BT3 A;  1S5A A;  2BHM A;  3ECF A;  1TIJ A;  4OUQ A;  2CKF B;  1NNV A;  1STF I;  4HZB B;  4U13 A;  2Q07 A;  2OCT A;  5CF2 A;  3NBJ A;  3CXC 2;  1YJ9 3;  4MMY B;  2K3D A;  1IK3 A;  1GYB A;  3H3H A;  1YVS A;  3CCM 3;  4IPB A;  4MJD A;  2GBW B;  4BIR A;  1NO3 A;  1CYU A;  2P09 A;  2W04 A;  1OPY A;  1ZX2 A;  1IQ8 A;  5KP3 A;  2CK3 H;  2HMO B;  2JDI H;  4L7K A;  4IT7 A;  3V92 A;  1KQS 2;  1X1X A;  1WMN A;  2J8X B;  3DY5 A;  1PY3 A;  1GMQ A;  1W6Y A;  3FGY A;  3NUV A;  4EXR A;  4JF8 A;  3G71 3;  2IMJ A;  1B2S A;  2CG1 A;  3S29 A;  3HIG A;  4X2O A;  5IEO A;  3EBY A;  2PNC A;  3GZB A;  1BVI A;  1A2V A;  1BSC A;  1OHO A;  1RGC A;  1A67 A;  4FCM A;  2V1L A;  3HX8 A;  3HOH A;  3K5T A;  5HGR A;  3OW2 2;  3CC4 3;  2CFG A;  2YFI B;  4O02 B;  2C4B A;  2H0I A;  3Q3F A;  1GOU A;  3CCU 3;  1IQX A;  4FMA A;  2OOV A;  1UI7 A;  1BU4 A;  1I3F A;  1OAC A;  3UL5 A;  2BO9 B;  3CCS 3;  1D6Z A;  3ALA A;  5KP1 A;  4LSO A;  4XDV A;  1NB3 I;  1GY6 A;  1UGH I;  1YI2 3;  3K7C A;  1BNS A;  3I0Y A;  3DUK A;  4R9K A;  1DYU A;  1PFP A;  3FSD A;  5I97 A;  1RKY A;  1UW1 A;  2P38 A;  3JUQ A;  3PZW A;  4J5K A;  4HVN A;  2WO0 A;  4FR9 A;  1Q40 A;  1K28 A;  1LQM B;  5JPU A;  1G96 A;  1WNH A;  1FUT A;  3D5G A;  1B20 A;  1B21 A;  5STD A;  4K1V A;  1B2X A;  4KFE A;  1RGE A;  5AYR B;  5HOH A;  1Q86 4;  1JKG B;  1RGH A;  4KVH A;  3SOA A;  1TP6 A;  2D42 A;  4WWU C;  3G6E 3;  4XBY A;  4IIA A;  4XDW A;  4BTX A;  3Q2P A;  3QK9 A;  1YVB I;  3MHE A;  5IER A;  3HZP A;  1G02 A;  3T8U A;  3STD A;  1LOY A;  2OWP A;  3VGN A;  3EBT A;  1UGI A;  2GXF A;  2UUG C;  3FH1 A;  3EX9 A;  3V99 A;  2CFD A;  3KE7 A;  3HII A;  2XF3 A;  2MC8 A;  1EUI C;  2OTJ 3;  4N6M A;  4CDL A;  1RDS A;  3OX9 A;  4QWT A;  1BNJ A;  2KF4 A;  4XBX A;  1MNL A;  2RNT A;  4ILF A;  4HM4 B;  1X1Y A;  3VF1 A;  4WYK B;  1JNQ A;  3D79 A;  1VQO 3;  2P0M A;  4WHA A;  1ZO2 A;  1BRH A;  1ROV A;  1W7C A;  2W56 B;  4XBT A;  2GU3 A;  2GBX B;  3AMO A;  4AKY A;  3F14 A;  3KFQ C;  3Q90 A;  2C10 A;  2CC3 A;  5GSP A;  1KC8 4;  1TU5 A;  3D9R A;  3CCE 3;  1GSP A;  2H0G A;  1JBT A;  5AYS C;  1IT7 A;  2CHC A;  1QAF A;  2W2C A;  1Q9E A;  4LMI A;  4N6N B;  3FG1 A;  4HBR A;  1QVG 2;  4HM0 B;  3LH4 A;  6STD A;  3LTD A;  1NB5 I;  3F8X A;  2IYJ A;  1BSE A;  3UB1 A;  3SED A;  1SIH A;  1TJD A;  1UCK A;  2LQV A;  1FUS A;  3ER7 A;  3G0K A;  5ELJ A;  3NXJ A;  1RGK A;  1JN5 A;  2LYX A;  3S27 A;  1TFK A;  3EB8 A;  5JBS A;  2OTL 3;  3CNX A;  1M9G A;  2KRT A;  2IUK A;  1RN7 A;  4N6U A;  5G1L A;  3I56 3;  3CMA 3;  2RCD A;  3FF0 A;  3KSE D;  1A90 A;  1FW7 A;  1X1W A;  1LOX A;  1WMO A;  2ZA4 A;  3JUN A;  5ELU A;  3SYU A;  1W2Z A;  2QEX 3;  2WGQ A;  3S5C A;  4FMD A;  4X2H A;  1LXE A;  3GZY B;  2P0X A;  2F56 A;  2AAE A;  2BMQ B;  3RNT A;  4O2H A;  3QRD A;  1UUW B;  1MWS A;  3X40 A;  1N8R 4;  1W00 A;  3GSP A;  4EBG A;  1O7P B;  1M1X B;  3CU3 A;  3GZR A;  1N5H A;  5M18 A;  1CYV A;  4ORL A;  3HI7 A;  1OF5 B;  3BU4 A;  2E2V A;  5M19 A;  2KCD A;  3F40 A;  1YJW 3;  1W6G A;  1Q7H A;  4RZM A;  4AKZ A;  3DMC A;  1YJN 3;  1K41 A;  1BNI A;  3J7Y d;  2BU4 A;  4XB5 A;  1AQZ A;  5AI1 A;  3WA3 A;  4N6L A;  1RCL A;  1UCL A;  2A15 A;  1GMR A;  3MSO A;  4HM8 B;  4R1K A;  1MWR A;  3CPO A;  5AIH A;  1RGG A;  2B24 B;  3MPH A;  1N9J A;  1VQL 3;  1IT8 A;  1IVU A;  1A2P A;  1BRI A;  1Z1S A;  4NRE A;  3DGO A;  1ISK A;  2CG0 A;  3X41 A;  1I2G A;  1T3B A;  3DZL A;  4J9A A;  1RSN A;  1I0X A;  1UDI I;  1ULJ B;  1FGO A;  1UUV B;  1T2I A;  3JUM A;  2BIR A;  3AGO A;  1MGR A;  4O3V A;  1OCV A;  3GWR A;  1NWW A;  1G0T A;  1IVV A;  1RGA A;  1JZD A;  5BXQ A;  5RNT A;  4L8P A;  1DVD A;  5BIR A;  3LTB A;  2AAD A;  3PCR A;  2XGL A;  1Q7Y 4;  3DGM A;  2KF5 A;  3FKA A;  1K8A 4;  3JVC A;  4AEQ A;  2GEX A;  1IQY A;  4K90 B;  2Y74 A;  1BRJ A;  1HZ1 A;  1Y4K A;  3BB9 A;  5D82 A;  2XR8 B;  2MF7 A;  4RNZ A;  4HAA A;  5FGO A;  2WOH A;  5LC7 A;  3K9M C;  1D6U A;  2KAA A;  4HM3 B;  2CW9 A;  2HMK B;  4L8O A;  4RNY A;  4EW5 A;  3JUP A;  3PXM A;  5AII A;  4EV5 A;  1VQ8 3;  1JB4 A;  1I3I A;  3X3Y A;  3GAX A;  1B2M A;  1MGW A;  1N9E A;  1CEW I;  1T5Y A;  2INX A;  3NV0 B;  1T2H A;  1US1 A;  1YGW A;  1JZO A;  1FZU A;  1TFO A;  4FCZ A;  1I0V A;  2C11 A;  1STD A;  2BMO B;  2CWV A;  3OWS A;  1YIT 3;  1W5Z A;  3OXA A;  2ZHX B;  1NU3 A;  4HM1 B;  3CME 3;  3RGR A;  1SPU A;  2F86 B;  1OUN A;  4RNT A;  2QA4 3;  2UX0 A;  6GSP A;  1DMM A;  4R9L A;  1Q42 A;  2K0M A;  1HU9 A;  1UCI A;  1CQS A;  3T8N A;  5LC6 A;  2XSO B;  5IF6 A;  1VQK 3;  1GY5 A;  2CH9 A;  4HKV B;  2GSP A;  2D1W A;  2RSX A;  3EN8 A;  1ULI B;  2ZDJ A;  1X1U A;  1N5P A;  1RHL A;  2ML5 A;  4K61 A;  3OWY A;  2IY2 A;  1RRH A;  5EVH A;  3RGA A;  4H3U A;  5AIF A;  3CD6 3;  1B2Z A;  1B27 A;  1DMN A;  1IDP A;  3FG4 A;  3GZX B;  3LT8 A;  4GL6 A;  1GOY A;  1UI8 A;  4EV2 A;  1LNH A;  4NPB A;  2OQE C;  2RFR A;  1JKG A;  3NX0 A;  2O3O A;  3K0Z A;  4N3V A;  4N6T A;  1VQ5 3;  3KN4 A;  1QMA A;  3UJM A;  2IA7 A;  3X42 A;  1OHS A;  2H0H A;  3ZG5 A;  1GS3 A;  3SXX A;  1W4N A;  3AHW A;  2Y73 A;  3WMD A;  3CCJ 3;  4I4K A;  1MOL A;  3AMO B;  2W6J H;  4KFF A;  3UNL A;  3NBB A;  1EG9 B;  2SBL A;  3GRD A;  4JRF A;  4EYC A;  1FGQ A;  1E3R A;  1BNG A;  4R80 A;  3BNE A;  3CCL 3;  1QVF 2;  3B7C A;  2W9P A;  3FLJ A;  4NHF A;  1RRL A;  3PCS A;  3I55 3;  1TRP A;  2FGT A;  3N54 B;  4R4K A;  2QGU A;  3N8B A;  3EC9 A;  5DRV A;  1MWU A;  2KF6 A;  4LEH A;  1B2U A;  3HK4 A;  2B1X B;  1BOX A;  3O8Y A;  3IMA B;  4WYK A;  1FYS A;  1VZZ A;  2P05 A;  3T0U A;  1NJI 4;  2W56 A;  3CC2 3;  4BU4 A;  4KT3 B;  1SII A;  3B4P A;  2RBI A;  8CHO A;  8RNT A;  1J2B A;  1N8Q A;  3KZT A;  1EKM A;  3EJV A;  2F99 A;  1O7N B;  1JRQ A;  3M8C A;  3NQY A;  3G4S 3;  1RGF A;  1W02 A;  1RN4 A;  2CFW A;  1RNB A;  4HOH A;  3EHC A;  1LRA A;  4BTY A;  1LVN A;  4GSP A;  3NQZ A;  5IG5 A;  3X3X A;  1W6C A;  5CK6 A;  2CWT A;  2YFL B;  3URP A;  7RNT A;  3DGY A;  5CF1 A;  1GY7 A;  1IVW A;  1IV9 A;  3BLZ A;  3DXO A;  1FGT A;  3K63 A;  1VQ6 3;  1WQL B;  1JBS A;  4XM4 A;  1NDO B;  4MMX B;  5EQL A;  1GMP A;  1A2K A;  7STD A;  2XSH B;  3FCS B;  1HYF A;  2KF3 A;  2HMM B;  1FUW A;  1LOW A;  5AIG A;  4HM6 B;  1YIJ 3;  1RMS A;  3BNC A;  2XFT A;  2Z7A A;  3F7X A;  3IPT A;  3LOY A;  5BVB A;  5CLK A;  5KP4 A;  3NM7 A;  1C54 A;  2E2U A;  3CCV 3;  1O7G B;  1K9M 4;  1SAR A;  3LZA A;  1VQP 3;  4G1M B;  2K54 A;  2KXG A;  2RGQ A;  3FF2 A;  2F4Y A;  4HM5 B;  1BGS A;  1AVL A;  1R4Y A;  4WP5 A;  1V58 A;  2ML6 A;  2R41 A;  3X3Z A;  2F5M A;  1BRS A;  3RDE A;  1OGX A;  4KFD A;  1PU4 A;  4LGQ A;  4CJN A;  4OK0 A;  1QAL A;  1GD4 A;  3AHS A;  1OF5 A;  5D83 A;  1VQ7 3;  3D3L A;  2YFJ B;  4Q53 A;  1DVC A;  4LZI A;  1VQ9 3;  1BNF A;  3V98 A;  1HKX A;  4O8S A;  1W2B 2;  4CPK A;  1M90 4;  5TGN A;  4H61 A;  4WFO A;  1YGE A;  1O7H B;  3BIR A;  2XH9 A;  1TRQ A;  4LYL B;  5IG0 A;  1Q81 4;  4DKI A;  1SJW A;  2CIU A;  2HMJ B;  1L5G B;  2HMN B;  1RNT A;  1VQM 3;  1BNE A;  2BMR B;  4OVM A;  1UCJ A;  3G16 A;  3MYT A;  4HM7 B;  3E99 A;  5EEO A;  3TDG A;  1EEJ A;  1OGZ A;  1QJG A;  1VQ4 3;  4GB5 A;  4HJL B;  4BL3 A;  3BND A;  1IV7 A;  6RNT A;  2E2T A;  1TUH A;  3EQQ B;  3U1W A;  5JPP A;  3CC7 3;  1BRN L;  5D81 A;  3SLU A;  1Q40 B;  1U8C B;  3BNB A;  3A76 A;  3PS8 A;  5DRE A;  2F98 A;  1I8V A;  3ROB A;  1WMP A;  1BNR A;  3OV4 A;  3D5I A;  2M7O A;  3CCR 3;  5A0O B;  3KII A;  1KWI A;  2Z77 A;  3CNM A;  1BAN A;  2I9W A;  1ASK A;  1PYL A;  3F8H A;  4FCJ A;  1M1K 4;  1ZGX A;  1TTO A;  1FGR A;  1AY7 A;  2IUJ A;  4ZM8 A;  2QIY A;  2STD A;  4FMB A;  1KD1 4;  3CCQ 3;  2CWU A;  3F7S A;  1JJ2 2;  4GHO A;  3LML A;  1K73 4;  1GD3 A;  1MWT A;  1W01 A;  1KSI A;  2XFS A;  3NV0 A;  2F5W A;  3EE1 A;  5IG4 A;  3MWZ A;  3PYJ A;  1WTH A;  1OHP A;  5G1K A;  4FMC A;  3WOF B;  1RJO A;  3MG2 A;  4HM2 B;  5IW9 A;  1LOV A;  3JUO A;  5M1A A;  1GOV A;  4EC6 A;  3ZG0 A;  4BTW A;  3AGN A;  4RBN A;  1U5O A;  1OH0 A;  1IYY A;  1JBR A;  1BSD A;  1E3V A;  2CX0 A;  1B3S A;  2ZL8 A;  4STD A;  5BU4 A;  2YX9 A;  3DGN A;  5FW5 A;  3PGB A;  2Z76 A;  1E97 A;  3MKI A;  1RLS A;  5CXO A;  5IEP A;  3U97 A;  1Q82 4;  1JB2 A;  3NBR A;  1RTU A;  3FZW A;  2SAR A;  1UUG B;  3Q1C A;  3F9S A;  3LYG A;  3LXU X;  2WGO A;  3WDG B;  3WA2 X;  3OWU A;  3LT9 A;  3DGL A;  2FNQ A;  3B4O A;  1AR0 A;  1BIR A;  3MG1 A;  1D6Y A;  1BRG A;  4KZ1 A;  3SOY A;  3KSP A;  4BL2 A;  1RCK A;  1JN5 B;  9RNT A;  4J5G A;  4N6V 0;  4TX4 A;  1YHQ 3;  2JQ5 A;  3KCH A;  2UGI A;  3EF8 A;  3DM8 A;  2CFL A;  1R4C A;  3L0R A;  3LTC A;  1VQQ A;  2WOF A;  3UL6 A;  5IG3 A;  1AV4 A;  3WOD G;  1BSB A;  2GEY A;  2OQE A;  4HZ9 B;  5AEW B;  1YNV X;  3NHX A;  4J8T A;  1IU7 A;  1S72 3;  2O9U X;  3B8L A;  7GSP A;  4MMZ B;  1RN1 A;  1QAK A;  1RGL A;  1SQW A;  2HOH A;  1CH0 A;  1O7W B;  4N6O B;  3VSY A;  3H51 A;  1BUQ A;  1C7H A;  1AVK A;  4MEI A;  3WOE B;  1IVX A;  1BUJ A;  1DMQ A;  4HYZ A;  3KKG A;  4PEJ A;  1O7M B;  3A5E A;  1LQG C;  2W0Q A;  1BAO A;  1JB5 A;  1ZS7 A;  2L1S A;  2XEP A;  4CCV A;  3G8Z A;  3WR2 A;  5IEN A;  1EQK A;  3EN1 B;  3NM2 A;  2CX1 A;  1DET A;  1JV2 B;  3LTA A;  4K1U A;  2HML B;  3CPW 2;  3MG3 A;  2Z6B A;  3IJE B;  3SVA A;  2XRX B;  3D4A A;  5G2G A;  3FG3 A;  3ZFZ A;  1BSA A;  1EA2 A;  2BNG A;  2W03 A;  3SX1 A;  3WHO A;  1ROA A; 
#chains in the Genus database with same CATH homology
 1X1U A;  1RHL A;  1Q9E A;  1I2E A;  1BRK A;  1B2Z A;  1B27 A;  1I70 A;  1DE3 A;  1GOY A;  1I2F A;  1LNI A;  6RNT A;  1BSE A;  1BRN L;  1UCK A;  3DH2 A;  1FUS A;  1I8V A;  1RGK A;  1BNR A;  3D5I A;  1JBT A;  1BAN A;  1PYL A;  3AHW A;  1YVS A;  1X1W A;  1ZGX A;  3SYU A;  1TTO A;  2ZA4 A;  1AY7 A;  4BIR A;  4GHO A;  2F56 A;  2AAE A;  3RNT A;  1BNG A;  1X1X A;  1PY3 A;  1GMQ A;  2F5W A;  3GSP A;  1B2S A;  1TRP A;  1BVI A;  1BSC A;  1LOV A;  1RGC A;  2KF6 A;  1GOV A;  3WHO A;  1B2U A;  3HOH A;  1BOX A;  3AGN A;  1FYS A;  3BU4 A;  2C4B A;  1IYY A;  4BU4 A;  3Q3F A;  1JBR A;  1GOU A;  1BNI A;  1BSD A;  2RBI A;  5BU4 A;  1B3S A;  2BU4 A;  1BU4 A;  8RNT A;  1AQZ A;  1I3F A;  1RCL A;  1UCL A;  1GMR A;  1RLS A;  1RGF A;  1BNS A;  1RN4 A;  1RGG A;  1RNB A;  4HOH A;  1LRA A;  4GSP A;  1BRI A;  1A2P A;  3URP A;  1RTU A;  3DGY A;  7RNT A;  2SAR A;  1I2G A;  1JBS A;  1GMP A;  4J5K A;  1RSN A;  1I0X A;  1T2I A;  2BIR A;  1FUT A;  3AGO A;  1B20 A;  1HYF A;  1MGR A;  2KF3 A;  3D5G A;  1B21 A;  1BIR A;  1B2X A;  1RGE A;  1LOW A;  5HOH A;  1RGA A;  1BRG A;  5RNT A;  1RMS A;  1RGH A;  1C54 A;  5BIR A;  2AAD A;  1RCK A;  2KF5 A;  9RNT A;  4J5G A;  1SAR A;  3KCH A;  1BRJ A;  1HZ1 A;  4HAA A;  2F4Y A;  1G02 A;  2KAA A;  1R4Y A;  1BGS A;  1BSB A;  1LOY A;  1YNV X;  2F5M A;  1BRS A;  1I3I A;  1B2M A;  1MGW A;  7GSP A;  1FW7 A;  3AHS A;  1RN1 A;  1T2H A;  1YGW A;  1FZU A;  1RGL A;  2HOH A;  1CH0 A;  1I0V A;  1RDS A;  1BNJ A;  2KF4 A;  1BUJ A;  2RNT A;  1X1Y A;  4RNT A;  1BNF A;  3A5E A;  1BAO A;  6GSP A;  1BRH A;  3WR2 A;  3BIR A;  1TRQ A;  1DET A;  1UCI A;  3D4A A;  1RNT A;  1BSA A;  1BNE A;  5GSP A;  2GSP A;  1GSP A;  1UCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...