1O7GB

Naphthalene 1,2-dioxygenase with naphthalene bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7gB00
1Z1SA 3G8ZA 3DUKA 4XDWA 1ASKA 1GY6A 1OHPA 5AEUB 3MKIA 3GWRA 5CLKA 2QGUA 3RGAA 4XBTA 4R9LA 2UX0A 1O7GB 3DZLA 3JUOA 1ULJB 5AIIA 3FGYA 3NUVA 4HM7B 1GYBA 3MG3A 5TGNA 5EVHA 3FH1A 4H3UA 1O7WB 1JN5B 1JB2A 3NHXA 3OV4A 1EG9B 1W01A 4LGQA 4STDA 1Q40B 3NV0B 5STDA 2GEXA 2GBXB 3SEDA 5KP3A 3G16A 1IDPA 1Q40A 4HM3B 3VSYA 5D83A 3D9RA 5BXQA 3MYTA 4L8PA 3GZYB 5CF1A 1UUWB 1OGXA 5IG0A 3NBRA 3UJMA 2XR8B 3F40A 2RGQA 3B4PA 3KKGA 1U5OA 4Q53A 1OHOA 5AEWB 3K0ZA 4CDLA 1E3RA 4LEHA 1O7PB 3EF8A 2IMJA 2R4IA 6STDA 1VZZA 2W2CA 1TUHA 1DMQA 5KP4A 3F7SA 2RFRA 3DMCA 3MG1A 5JPUA 4WYKA 3T8NA 4WWUC 3EJVA 4U13A 1SJWA 2BNGA 4GB5A 3NM2A 3STDA 3S5CA 3I0YA 1QJGA 2PZVA 4KVHA 4N3VA 1OGZA 1W02A 3SOYA 3LYGA 2OWPA 3DM8A 2K54A 3JUQA 3KSPA 3BLZA 4RZMA 3HZPA 1NU3A 3KZTA 4HM8B 3BB9A 4L7KA 4HJLB 1ZX2A 3FF0A 2CHCA 4XBYA 3DXOA 3B8LA 5IG3A 4R1KA 7STDA 3A76A 5FW5A 1JB5A 1OH0A 1C7HA 1STDA 1Q42A 4HM0B 5IEOA 2Z76A 5AIGA 1E97A 1JN5A 1HKXA 3FSDA 4J8TA 2GBWB 1W00A 3MSOA 1AR0A 3B7CA 2JQ5A 3EN8A 3NV0A 1EA2A 1O7MB 4I4KA 2BMOB 1O7HB 5AIHA 3F7XA 1OPYA 2HMLB 2STDA 3JUNA 1E3VA 3FLJA 2YFIB 3ER7A 1GY5A 3WMDA 1WQLB 4HZ9B 3EQQB 3EC9A 2RCDA 5IG4A 1OHSA 1OF5B 4R9KA 1NDOB 3ECFA 4XM4A 3GZBA 1DMNA 1JKGB 3F8HA 5IERA 3EBTA 1CQSA 3EBYA 4HKVB 4K1UA 2CKFB 1GS3A 3FF2A 2B1XB 4J9AA 3FKAA 2HMJB 1JKGA 1DMMA 3M8CA 2F98A 3B4OA 1ISKA 5DRVA 3CNMA 4XDVA 3GZXB 5IG5A 2BMRB 1S5AA 3F8XA 3IPTA 1BUQA 3NXJA 3OXAA 3HX8A 2HMNB 1A2KA 2GXFA 4HM6B 3F14A 3H3HA 4MJDA 3JUMA 3RGRA 1TP6A 3Q90A 3EN1B 3ROBA 3GZRA 1O7NB 4HM2B 5JPPA 2XRXB 4HM4B 5KP1A 3K7CA 3EHCA 1ZO2A 4FCJA 4X2HA 8CHOA 5BVBA 2B24B 1QMAA 4ORLA 4WP5A 2HMKB 1UUVB 4XB5A 2QIYA 5CK6A 3OWSA 1JB4A 3UNLA 2GEYA 4IIAA 4HM5B 3OX9A 5CF2A 5D82A 3H51A 5AI1A 1W6YA 3SOAA 3MHEA 5AIFA 2F86B 4OUQA 3KE7A 4L8OA 1OCVA 3T8UA 1GY7A 2HMOB 2XSHB 1K41A 5DREA 4X2OA 2Z7AA 3LZAA 4HZBB 2HMMB 4PEJA 5CXOA 2BMQB 3E99A 2XSOB 2YFLB 2A15A 1ULIB 3CPOA 3HK4A 1OF5A 5IF6A 3FZWA 5G2GA 5HGRA 2Z77A 4K1VA 4LMIA 3JUPA 3EX9A 2F99A 3VGNA 5IEPA 3F9SA 4OVMA 4WYKB 3GRDA 3CU3A 4XBXA 2YFJB 3CNXA 3OWYA 5IENA 3OWUA 1OUNA 4FCMA 3MG2A 2INXA 4HVNA 1NWWA 3G0KA 2I9WA 4HM1B 5D81A
chains in the Genus database with same CATH superfamily
1UGIA 2LQVA 3NM7A 1MNLA 2CWTA 1U8CB 1BNGA 1Z1SA 5ELUA 2CK3H 3G8ZA 1LOVA 1K8A4 1I70A 3BIRA 1AVKA 3DUKA 1NB5I 4XDWA 1SPUA 1US1A 1ASKA 1GY6A 1OHPA 5AEUB 3FG4A 3MKIA 3BNCA 3GWRA 5CLKA 2QGUA 3RGAA 4XBTA 3CCL3 4R9LA 2BHMA 4EYCA 3WOFB 1I0VA 3WODG 1T2HA 2UX0A 3BU4A 1Q824 4CJNA 1BU4A 1Q814 3LT9A 3KFQC 2XEPA 2W9QA 1N5PA 2K0MA 1O7GB 1VQM3 3ALAA 3AMOB 4BTWA 1BUJA 7GSPA 3DZLA 3JUOA 2HOHA 1ULJB 1CH0A 5AIIA 3FGYA 1FA3A 1LOWA 1DETA 3DGMA 3D79A 1AY7A 1RGKA 3NUVA 1BIRA 2WGOA 3PGBA 4HM7B 1MWUA 4MEIA 1IVXA 3V98A 1GYBA 3MG3A 2IY2A 5TGNA 5EVHA 1BRHA 3FH1A 4O02B 4H3UA 1N9EA 3PYJA 4R80A 1O7WB 4IPBA 1PU4A 1NO3A 1HU9A 1BSDA 1KSIA 1JN5B 3D5IA 3SYUA 3NBBA 1VQN3 1M9GA 2FNQA 4MMZB 1JB2A 3NHXA 3OV4A 3S29A 1BANA 1WMNA 1VQL3 2OOVC 3DGYA 1I0XA 2JDIH 1EG9B 3PCRA 1W01A 3HIIA 2XFSA 4LGQA 5LC6A 4STDA 5A0OB 1Q40B 4KFDA 3NV0B 3QK9A 4N6LA 2O3OA 2CX0A 1QAKA 5STDA 3HIGA 3WDGB 1NJI4 1IVUA 2GEXA 2IUKA 3MPHA 2GBXB 2ZDJA 3SEDA 5KP3A 1C54A 4BTYA 3G16A 2C4BA 1BSEA 1IDPA 1Q40A 4HM3B 1SIIA 3VSYA 1UUGB 1LVNA 3O8YA 5D83A 1F8NA 3D9RA 1DVCA 1Q864 5BXQA 3PZWA 1IT8A 3MYTA 2CFDA 4L8PA 2KF4A 4BU4A 1R4CA 1JV2B 2R41A 2V1LA 3DGNA 2KRTA 3N9HA 3GZYB 2KXGA 5CF1A 1UUWB 1T2IA 1OGXA 2KCDA 1LNIA 5IG0A 3CPW2 1AQZA 3NBRA 1QVF2 1FZUA 2P05A 4N6TA 2M7OA 3UJMA 2XR8B 3F40A 2RGQA 2XGLA 3B4PA 3UB1A 3KKGA 1U5OA 4Q53A 1OHOA 1AVLA 2F5WA 2Q07A 4FMAA 5LC7A 3ZG5A 1B2ZA 1TRQA 3AHSA 5AEWB 1YVSA 3K0ZA 4CDLA 1E3RA 4LEHA 1RNBA 2CG1A 4J5KA 3NX0A 1O7PB 3EF8A 2IMJA 2R4IA 6STDA 2W04A 3S67A 1A67A 1UCIA 1PY3A 1LQMB 1VZZA 2W2CA 4EC6A 4BIRA 2Y73A 1TUHA 5GSPA 1ZS7A 1DMQA 3S27A 1TJDA 1TFKA 5KP4A 1MWSA 2GU1A 3GSPA 2UUGC 2Z6BA 3CCE3 1YHQ3 3F7SA 2RFRA 2CWVA 1DYUA 3DMCA 1VQK3 1MOLA 1JBTA 1BSAA 1LXEA 4MMYB 1LQGC 1MWRA 1ROVA 2LYXA 3MG1A 7RNTA 1TFOA 4K61A 5JPUA 4WYKA 1B3SA 1GOYA 3T8NA 3Q1CA 1WMPA 4MMXB 4WWUC 2KF6A 3EJVA 3CME3 4U13A 1STFI 1SJWA 1CEWI 3U1WA 1B2UA 2BNGA 2XF3A 4GB5A 1M1K4 3SLUA 1T3BA 3NM2A 3STDA 1DVDA 3KIIA 3S5CA 1FGTA 1TTOA 2W0QA 1M1XB 3D5GA 3EE1A 4HAAA 2Y74A 5RNTA 3I0YA 1BNJA 2UGIA 1EQKA 1QJGA 2PZVA 1UCKA 3UL5A 3Q2PA 2J8XB 3IJEB 4QWTA 4KVHA 4N3VA 4AKZA 3AHWA 1OGZA 1BRIA 1D6ZA 1RHLA 2W56B 1QVG2 1GSPA 1VQ63 1W02A 1PFPA 3SVAA 3DGOA 1MGWA 2KF3A 3SOYA 3LYGA 1SARA 1LNHA 2OWPA 3LT8A 3DM8A 2K54A 3GAXA 1K734 1RGEA 3JUQA 5JBSA 3KSPA 1N8R4 1KC84 3BLZA 4RZMA 4GHOA 1R4YA 5G1LA 4O2HA 3IMAB 3HZPA 1BSBA 2K3DA 1NU3A 3KZTA 1SQWA 4HM8B 3BB9A 4L7KA 3Q3FA 2ZA4A 4N6MA 4CCVA 3X40A 5BU4A 1GD4A 2YX9A 1K28A 1RTUA 1X1XA 4HJLB 4WFOA 1UI7A 3AMOA 1ZX2A 3FF0A 2CHCA 4XBYA 1B27A 1GMRA 3DXOA 1IVVA 3B8LA 1BGSA 5IG3A 1EEJA 4R1KA 7STDA 3A76A 3I563 5FW5A 1JB5A 1OH0A 1C7HA 5ELJA 3WR2A 3CCV3 1STDA 3K9MC 1Q42A 2C10A 4BL2A 2MF7A 3D3LA 4NHFA 4HM0B 5IEOA 1UI8A 1FGOA 2Z76A 1FYSA 2W03A 5AIGA 1E97A 5BIRA 1JN5A 2L4VA 1HKXA 3FSDA 3X3YA 4J8TA 2F56A 3S28A 1RRHA 2GBWB 1FGMA 3BNBA 1YJN3 4G1MB 2WO0A 3CCM3 1W00A 4J5GA 3MSOA 1AR0A 1N8QA 1RGCA 1QAFA 3B7CA 3CCQ3 1BNIA 2CWUA 2JQ5A 2OQEC 3EN8A 1EA2A 3NV0A 5AYSC 1VQ73 1JBSA 1BRNL 1BVIA 1O7MB 4I4KA 3UL6A 2BMOB 4R4KA 1IQYA 1O7HB 5AIHA 1OACA 1FUWA 3NQZA 3X3ZA 4BTXA 1RLSA 2P0XA 3F7XA 1IV7A 1OPYA 3K63A 2HMLB 1W5ZA 1HZ1A 4LZIA 1PYLA 2STDA 3JUNA 3PXMA 4NREA 4OK0A 1E3VA 1JZDA 1WNHA 3LOYA 2GU3A 3FLJA 3ZG0A 2YFIB 3ER7A 1GY5A 1SIHA 3EB8A 4H61A 3WMDA 2CH9A 5IW9A 4KT3B 4N6UA 4BL3A 1WQLB 2W9PA 3EQQB 3EC9A 4HZ9B 1ROAA 2RCDA 1JBRA 1TIJA 1BNRA 2WOFA 1IQXA 1B2MA 2CC3A 5IG4A 3LTBA 1EKMA 1OHSA 4EXRA 1W2B2 1OF5B 4R9KA 1B21A 1RN1A 3G6E3 2CW9A 1EUIC 1X1WA 3LH4A 1NDOB 2O9UX 1LRAA 1RN7A 2OQEA 3ECFA 4RBNA 1IV9A 4HYZA 3D4AA 1RNTA 4XM4A 1A90A 2F4YA 1JNQA 3GZBA 1DMNA 4EBGA 2BIRA 1JKGB 1CYUA 1MGRA 3A5EA 3F8HA 2ML6A 3WA3A 3WOEB 5IERA 3EBTA 1CQSA 3EBYA 4HKVB 2XGNA 4K1UA 2CKFB 1GS3A 5G1KA 1DE3A 3FF2A 3LTDA 2B1XB 4J9AA 3SXXA 3FKAA 2HMJB 1JKGA 3K5TA 1DMMA 2ZL8A 3AGOA 3M8CA 1YGEA 2CFWA 2F98A 4FMCA 4FMBA 3B4OA 1I2EA 2SARA 1ISKA 5DRVA 3I553 3CNMA 4XDVA 3GZXB 3QRDA 2AAEA 4O3VA 1A2PA 2WOHA 2BMRB 5IG5A 4N6OB 1BNEA 1S5AA 3F8XA 3FCSB 3IPTA 5AYRB 1BUQA 2QEX3 1D6UA 3NXJA 1A2VA 1JJ22 1VQ83 3OXAA 3CCS3 4CPKA 1VQP3 1TRPA 3HX8A 1UW1A 2HMNB 1A2KA 4WHAA 2GXFA 8RNTA 5I97A 3CC43 1Q7HA 1K9M4 1YVBI 4HM6B 2OCTA 1WMOA 3F14A 3CCU3 3HOHA 2CX1A 3H3HA 1UCJA 4JRFA 3J7Yd 3T0UA 2FXTA 3KCHA 3PS8A 4MJDA 1J2BA 3JUMA 2D42A 2MC8A 1M904 3RGRA 1TP6A 3VF1A 3URPA 3Q90A 1FGRA 2KF5A 1I2FA 3EN1B 3NQYA 2ZHXB 5EEOA 1IVWA 1LOYA 2IUJA 3GZRA 3ROBA 3OW22 1O7NB 2P38A 1UDII 4HM2B 4HOHA 5JPPA 2XRXB 1CYVA 2BT3A 3LTCA 4HM4B 2PNCA 4LSOA 4RNTA 2BU4A 4K90B 4EV5A 1YIT3 1W6GA 2W56A 3K7CA 5KP1A 1FGQA 3EHCA 1ZO2A 4FCJA 4X2HA 3X3XA 8CHOA 1RJOA 4ZM8A 2RBIA 1W7CA 1VQ93 1YI23 1RCLA 5BVBA 1X1YA 9RNTA 1AV4A 4FR9A 4TX4A 4ILFA 2KAAA 2SBLA 4NPBA 1LOXA 2B24B 1D6YA 1T5YA 1I3FA 1RGLA 1MWTA 1UGHI 6RNTA 1B2XA 1QMAA 4ORLA 2H0GA 3JVCA 4WP5A 2IA7A 4FMDA 2XH9A 2HMKB 4KZ1A 1BSCA 3SX1A 1JRQA 1UUVB 1VQ43 2CFGA 3RNTA 1BRKA 2XFTA 4XB5A 1BNSA 2QIYA 5CK6A 3KSED 3OWSA 3V99A 1V57A 3LMLA 3L0RA 1JB4A 1FUSA 3UNLA 1W2ZA 2GEYA 3BNDA 1G0TA 4IIAA 4HM5B 5M1AA 3OX9A 5CF2A 4KFFA 3HI7A 5D82A 3H51A 3U97A 3CMA3 3CCR3 1GMPA 5AI1A 4LYLB 3CC23 1W6YA 1BNFA 1FW7A 3SOAA 3MHEA 1GOUA 2W6JH 5AIFA 1RGFA 2F86B 3BNEA 4OUQA 3KE7A 2E2TA 1B2SA 4L8OA 1RN4A 3DGLA 1ZGXA 1OCVA 4EW5A 3RDEA 3X41A 3T8UA 1Q7Y4 2RNTA 1GY7A 2HMOB 1L5GB 1RGHA 4I5QA 1G96A 3G4S3 2XSHB 4RNYA 1K41A 5FGOA 1NNVA 5DREA 4X2OA 2Z7AA 3LZAA 5M19A 3CD63 4AKYA 4HZBB 1IQ8A 1KWIA 2HMMB 3FG3A 4PEJA 4AEQA 1W6CA 1RDSA 5CXOA 2L1SA 2ML5A 2BMQB 3ZFZA 3N8BA 3E99A 4RNZA 1YJ93 3V92A 2XSOB 2YFLB 2A15A 3MWZA 4HBRA 1ULIB 3FG1A 1YNVX 3CPOA 3HK4A 1S723 1IK3A 5HOHA 2H0HA 4O8SA 1QALA 2QA43 3G713 2IYJA 4FCZA 2OOVA 2P0MA 4GSPA 1VQO3 1OF5A 4JF8A 1FUTA 5IF6A 3FZWA 3DY5A 5G2GA 5HGRA 2OTL3 1I2GA 2Z77A 1IT7A 1YGWA 1WTHA 1IYYA 2H0IA 4K1VA 4LMIA 1JZOA 2RSXA 2OTJ3 1RMSA 1HYFA 2D1WA 2F5MA 1X1UA 3PCSA 1RKYA 1N5HA 1G02A 3AGNA 1RGAA 1VQQA 3JUPA 1YJW3 3WA2X 3EX9A 1GD3A 5EQLA 3X42A 2CIUA 2F99A 1BAOA 3NBJA 2AADA 1VQ53 1GOVA 2E2UA 2WGQA 1GMQA 3VGNA 5M18A 2BO9B 1RRLA 2GSPA 5IEPA 2FGTA 3CCJ3 3F9SA 1IU7A 1Q9EA 2CFLA 2C11A 4OVMA 1TU5A 1W4NA 2CG0A 6GSPA 4WYKB 1Y4KA 3GRDA 3DH2A 3WHOA 1KD14 3CU3A 1BRJA 4N6NB 2CFKA 4XBXA 2P09A 4DKIA 4N6V0 1BRGA 3N54B 4EV2A 1RGGA 2YFJB 3CNXA 3OWYA 3LTAA 3OWUA 5IENA 2E2VA 3KN4A 1OUNA 3CC73 1I8VA 3CXC2 1BRSA 4FCMA 1RCKA 3MG2A 1RSNA 2INXA 4IT7A 4KFEA 1V74A 4HVNA 1NWWA 3G0KA 1YIJ3 1UCLA 1N9JA 2I9WA 1BOXA 4GL6A 1B20A 1KQS2 3LXUX 4HM1B 1I3IA 3TDGA 5D81A 1NB3I 1V58A
chains in the Genus database with same CATH topology
3NM7A 2LQVA 1MNLA 2CWTA 1U8CB 1Z1SA 5ELUA 2CK3H 3G8ZA 1K8A4 1AVKA 3DUKA 1NB5I 4XDWA 1SPUA 1US1A 1ASKA 1GY6A 1OHPA 5AEUB 3FG4A 3MKIA 3BNCA 3GWRA 5CLKA 2QGUA 3RGAA 4XBTA 3CCL3 4R9LA 2BHMA 4EYCA 3WOFB 3WODG 2UX0A 1Q824 1Q814 3LT9A 3KFQC 2XEPA 2W9QA 1N5PA 2K0MA 1O7GB 1VQM3 3ALAA 3AMOB 4BTWA 3DZLA 3JUOA 1ULJB 5AIIA 3FGYA 3DGMA 3NUVA 2WGOA 3PGBA 4HM7B 4MEIA 3V98A 1IVXA 1GYBA 3MG3A 5TGNA 5EVHA 3FH1A 4O02B 4H3UA 1N9EA 3PYJA 4R80A 1O7WB 4IPBA 1PU4A 1NO3A 1HU9A 1KSIA 1JN5B 3NBBA 1VQN3 1M9GA 2FNQA 4MMZB 1JB2A 3NHXA 3OV4A 3S29A 1WMNA 1VQL3 2OOVC 2JDIH 1EG9B 3PCRA 1W01A 3HIIA 2XFSA 4LGQA 5LC6A 4STDA 5A0OB 1Q40B 4KFDA 3NV0B 3QK9A 4N6LA 2O3OA 1QAKA 5STDA 3HIGA 3WDGB 1NJI4 1IVUA 2GEXA 2IUKA 3MPHA 2GBXB 2ZDJA 3SEDA 5KP3A 4BTYA 3G16A 1IDPA 1Q40A 4HM3B 1SIIA 3VSYA 1LVNA 3O8YA 5D83A 1F8NA 3D9RA 1DVCA 1Q864 5BXQA 3PZWA 1IT8A 3MYTA 2CFDA 4L8PA 1R4CA 1JV2B 2V1LA 3DGNA 3N9HA 2KRTA 3GZYB 2KXGA 5CF1A 1UUWB 1OGXA 2KCDA 3CPW2 5IG0A 3NBRA 1QVF2 2P05A 4N6TA 2M7OA 3UJMA 2XR8B 3F40A 2RGQA 2XGLA 3B4PA 3UB1A 3KKGA 1U5OA 4Q53A 1OHOA 1AVLA 2Q07A 4FMAA 5LC7A 5AEWB 3K0ZA 4CDLA 1E3RA 4LEHA 2CG1A 3NX0A 1O7PB 3EF8A 2IMJA 2R4IA 6STDA 2W04A 3S67A 1A67A 1VZZA 2W2CA 4EC6A 2Y73A 1TUHA 1DMQA 3S27A 1TFKA 5KP4A 2GU1A 2Z6BA 3CCE3 1YHQ3 3F7SA 2RFRA 2CWVA 1DYUA 3DMCA 1VQK3 1MOLA 1LXEA 4MMYB 1ROVA 2LYXA 3MG1A 1TFOA 4K61A 5JPUA 4WYKA 3T8NA 3Q1CA 1WMPA 4MMXB 4WWUC 3EJVA 3CME3 4U13A 1STFI 1SJWA 1CEWI 3U1WA 2BNGA 2XF3A 4GB5A 1M1K4 3SLUA 3NM2A 3STDA 1DVDA 3KIIA 3S5CA 1FGTA 2W0QA 1M1XB 3EE1A 2Y74A 3I0YA 1EQKA 1QJGA 2PZVA 3UL5A 3Q2PA 3IJEB 4QWTA 4KVHA 4N3VA 4AKZA 1OGZA 1D6ZA 2W56B 1QVG2 1VQ63 1PFPA 1W02A 3SVAA 3DGOA 3SOYA 3LYGA 1LNHA 2OWPA 3LT8A 3DM8A 2K54A 3GAXA 1K734 3JUQA 5JBSA 3KSPA 1N8R4 1KC84 3BLZA 4RZMA 4O2HA 3IMAB 3HZPA 1NU3A 3KZTA 1SQWA 4HM8B 3BB9A 4L7KA 4N6MA 4CCVA 3X40A 1GD4A 2YX9A 1K28A 4WFOA 4HJLB 1UI7A 3AMOA 1ZX2A 3FF0A 2CHCA 4XBYA 3DXOA 1IVVA 3B8LA 5IG3A 4R1KA 7STDA 3A76A 3I563 5FW5A 1JB5A 1OH0A 1C7HA 5ELJA 3CCV3 1STDA 3K9MC 1Q42A 2C10A 2MF7A 3D3LA 4NHFA 4HM0B 5IEOA 1UI8A 1FGOA 2Z76A 2W03A 5AIGA 1E97A 1JN5A 2L4VA 1HKXA 3FSDA 3X3YA 4J8TA 3S28A 1RRHA 2GBWB 1FGMA 3BNBA 1YJN3 4G1MB 2WO0A 3CCM3 1W00A 3MSOA 1AR0A 1N8QA 1QAFA 3B7CA 3CCQ3 2OQEC 2CWUA 2JQ5A 3EN8A 3NV0A 1EA2A 5AYSC 1VQ73 1FA3A 1O7MB 4I4KA 3UL6A 2BMOB 4R4KA 1IQYA 1O7HB 5AIHA 1OACA 1FUWA 3NQZA 3X3ZA 4BTXA 2P0XA 3F7XA 1IV7A 1OPYA 3K63A 2HMLB 1W5ZA 4LZIA 2STDA 3JUNA 3PXMA 4NREA 4OK0A 1E3VA 1WNHA 3LOYA 2GU3A 3FLJA 2YFIB 3ER7A 1GY5A 1SIHA 3EB8A 4H61A 3WMDA 2CH9A 5IW9A 4N6UA 1WQLB 2W9PA 3EQQB 3EC9A 4HZ9B 1ROAA 2RCDA 1TIJA 2WOFA 1IQXA 2CC3A 5IG4A 3LTBA 1EKMA 1OHSA 4EXRA 1W2B2 1OF5B 4R9KA 3G6E3 2CW9A 3LH4A 1NDOB 2O9UX 1RN7A 2OQEA 3ECFA 4RBNA 1IV9A 4HYZA 4XM4A 1A90A 1JNQA 3GZBA 1DMNA 4EBGA 1JKGB 1CYUA 3F8HA 2ML6A 3WA3A 3WOEB 5IERA 3EBTA 1CQSA 3EBYA 4HKVB 2XGNA 4K1UA 2CKFB 1GS3A 3FF2A 3LTDA 2B1XB 4J9AA 3SXXA 3FKAA 2HMJB 1JKGA 3K5TA 1DMMA 2ZL8A 3M8CA 1YGEA 2CFWA 2F98A 4FMCA 4FMBA 3B4OA 1ISKA 5DRVA 3I553 3CNMA 4XDVA 3GZXB 3QRDA 4O3VA 2WOHA 5IG5A 2BMRB 4N6OB 1S5AA 3F8XA 3FCSB 3IPTA 5AYRB 1BUQA 2QEX3 1D6UA 3NXJA 1A2VA 1JJ22 1VQ83 3OXAA 3CCS3 1VQP3 3HX8A 1UW1A 2HMNB 1A2KA 4WHAA 2GXFA 3CC43 5I97A 1K9M4 1YVBI 4HM6B 2OCTA 1WMOA 3F14A 3CCU3 3H3HA 4JRFA 3J7Yd 3T0UA 2FXTA 3PS8A 4MJDA 1J2BA 3JUMA 2D42A 2MC8A 1M904 3RGRA 1TP6A 3VF1A 3Q90A 1FGRA 3NQYA 3EN1B 5EEOA 2IUJA 3ROBA 1IVWA 3OW22 3GZRA 1O7NB 2P38A 4HM2B 5JPPA 2XRXB 1CYVA 2BT3A 3LTCA 4HM4B 2PNCA 4LSOA 4K90B 4EV5A 1YIT3 1W6GA 2W56A 3K7CA 5KP1A 1FGQA 3EHCA 1ZO2A 4FCJA 4X2HA 3X3XA 8CHOA 1RJOA 4ZM8A 1VQ93 1W7CA 1YI23 5BVBA 1AV4A 4FR9A 4TX4A 2SBLA 1LOXA 2B24B 1D6YA 1T5YA 1QMAA 4ORLA 3JVCA 4WP5A 2IA7A 4FMDA 2XH9A 2HMKB 4KZ1A 3SX1A 1JRQA 1UUVB 1VQ43 2CFGA 2XFTA 4XB5A 2QIYA 5CK6A 3KSED 3OWSA 3V99A 3LMLA 3L0RA 1JB4A 3UNLA 1W2ZA 2GEYA 3BNDA 4IIAA 4HM5B 3OX9A 5CF2A 4KFFA 3HI7A 5D82A 3H51A 3U97A 3CMA3 3CCR3 5AI1A 3CC23 1W6YA 3SOAA 3MHEA 5AIFA 2W6JH 2F86B 3BNEA 4OUQA 3KE7A 2E2TA 4L8OA 3DGLA 1OCVA 3RDEA 3X41A 3T8UA 1Q7Y4 1GY7A 2HMOB 1L5GB 1G96A 3G4S3 2XSHB 4RNYA 1K41A 5FGOA 5DREA 4X2OA 2Z7AA 3LZAA 3CD63 4AKYA 4HZBB 1IQ8A 1KWIA 2HMMB 3FG3A 4PEJA 4AEQA 1W6CA 5CXOA 2ML5A 2BMQB 1YJ93 3N8BA 3E99A 4RNZA 3V92A 2XSOB 2YFLB 2A15A 3MWZA 4HBRA 1ULIB 3FG1A 3CPOA 3HK4A 1S723 1IK3A 4O8SA 1QALA 2QA43 3G713 4FCZA 2OOVA 2P0MA 1VQO3 1OF5A 4JF8A 5IF6A 3FZWA 3DY5A 5G2GA 5HGRA 2OTL3 2Z77A 1IT7A 1WTHA 4K1VA 4LMIA 2OTJ3 2RSXA 2D1WA 3PCSA 1RKYA 1N5HA 3JUPA 1YJW3 3WA2X 3EX9A 1GD3A 5EQLA 3X42A 2CIUA 2F99A 3NBJA 1VQ53 2E2UA 2WGQA 3VGNA 2BO9B 1RRLA 5IEPA 2FGTA 3CCJ3 3F9SA 1IU7A 2CFLA 2C11A 4OVMA 1TU5A 1W4NA 2CG0A 4WYKB 1Y4KA 3GRDA 1KD14 3CU3A 4N6NB 2CFKA 4XBXA 2P09A 4N6V0 3N54B 4EV2A 2YFJB 3CNXA 3OWYA 5IENA 3LTAA 3OWUA 2E2VA 3KN4A 1OUNA 3CC73 3CXC2 4FCMA 3MG2A 4IT7A 2INXA 4KFEA 1V74A 4HVNA 1NWWA 3G0KA 1YIJ3 1N9JA 2I9WA 4GL6A 1KQS2 3LXUX 4HM1B 3TDGA 5D81A 1NB3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1S A;  3G8Z A;  3DUK A;  4XDW A;  1ASK A;  1GY6 A;  1OHP A;  5AEU B;  3MKI A;  3GWR A;  5CLK A;  2QGU A;  3RGA A;  4XBT A;  4R9L A;  2UX0 A;  1O7G B;  3DZL A;  3JUO A;  1ULJ B;  5AII A;  3FGY A;  3NUV A;  4HM7 B;  1GYB A;  3MG3 A;  5TGN A;  5EVH A;  3FH1 A;  4H3U A;  1O7W B;  1JN5 B;  1JB2 A;  3NHX A;  3OV4 A;  1EG9 B;  1W01 A;  4LGQ A;  4STD A;  1Q40 B;  3NV0 B;  5STD A;  2GEX A;  2GBX B;  3SED A;  5KP3 A;  3G16 A;  1IDP A;  1Q40 A;  4HM3 B;  3VSY A;  5D83 A;  3D9R A;  5BXQ A;  3MYT A;  4L8P A;  3GZY B;  5CF1 A;  1UUW B;  1OGX A;  5IG0 A;  3NBR A;  3UJM A;  2XR8 B;  3F40 A;  2RGQ A;  3B4P A;  3KKG A;  1U5O A;  4Q53 A;  1OHO A;  5AEW B;  3K0Z A;  4CDL A;  1E3R A;  4LEH A;  1O7P B;  3EF8 A;  2IMJ A;  2R4I A;  6STD A;  1VZZ A;  2W2C A;  1TUH A;  1DMQ A;  5KP4 A;  3F7S A;  2RFR A;  3DMC A;  3MG1 A;  5JPU A;  4WYK A;  3T8N A;  4WWU C;  3EJV A;  4U13 A;  1SJW A;  2BNG A;  4GB5 A;  3NM2 A;  3STD A;  3S5C A;  3I0Y A;  1QJG A;  2PZV A;  4KVH A;  4N3V A;  1OGZ A;  1W02 A;  3SOY A;  3LYG A;  2OWP A;  3DM8 A;  2K54 A;  3JUQ A;  3KSP A;  3BLZ A;  4RZM A;  3HZP A;  1NU3 A;  3KZT A;  4HM8 B;  3BB9 A;  4L7K A;  4HJL B;  1ZX2 A;  3FF0 A;  2CHC A;  4XBY A;  3DXO A;  3B8L A;  5IG3 A;  4R1K A;  7STD A;  3A76 A;  5FW5 A;  1JB5 A;  1OH0 A;  1C7H A;  1STD A;  1Q42 A;  4HM0 B;  5IEO A;  2Z76 A;  5AIG A;  1E97 A;  1JN5 A;  1HKX A;  3FSD A;  4J8T A;  2GBW B;  1W00 A;  3MSO A;  1AR0 A;  3B7C A;  2JQ5 A;  3EN8 A;  3NV0 A;  1EA2 A;  1O7M B;  4I4K A;  2BMO B;  1O7H B;  5AIH A;  3F7X A;  1OPY A;  2HML B;  2STD A;  3JUN A;  1E3V A;  3FLJ A;  2YFI B;  3ER7 A;  1GY5 A;  3WMD A;  1WQL B;  4HZ9 B;  3EQQ B;  3EC9 A;  2RCD A;  5IG4 A;  1OHS A;  1OF5 B;  4R9K A;  1NDO B;  3ECF A;  4XM4 A;  3GZB A;  1DMN A;  1JKG B;  3F8H A;  5IER A;  3EBT A;  1CQS A;  3EBY A;  4HKV B;  4K1U A;  2CKF B;  1GS3 A;  3FF2 A;  2B1X B;  4J9A A;  3FKA A;  2HMJ B;  1JKG A;  1DMM A;  3M8C A;  2F98 A;  3B4O A;  1ISK A;  5DRV A;  3CNM A;  4XDV A;  3GZX B;  5IG5 A;  2BMR B;  1S5A A;  3F8X A;  3IPT A;  1BUQ A;  3NXJ A;  3OXA A;  3HX8 A;  2HMN B;  1A2K A;  2GXF A;  4HM6 B;  3F14 A;  3H3H A;  4MJD A;  3JUM A;  3RGR A;  1TP6 A;  3Q90 A;  3EN1 B;  3ROB A;  3GZR A;  1O7N B;  4HM2 B;  5JPP A;  2XRX B;  4HM4 B;  5KP1 A;  3K7C A;  3EHC A;  1ZO2 A;  4FCJ A;  4X2H A;  8CHO A;  5BVB A;  2B24 B;  1QMA A;  4ORL A;  4WP5 A;  2HMK B;  1UUV B;  4XB5 A;  2QIY A;  5CK6 A;  3OWS A;  1JB4 A;  3UNL A;  2GEY A;  4IIA A;  4HM5 B;  3OX9 A;  5CF2 A;  5D82 A;  3H51 A;  5AI1 A;  1W6Y A;  3SOA A;  3MHE A;  5AIF A;  2F86 B;  4OUQ A;  3KE7 A;  4L8O A;  1OCV A;  3T8U A;  1GY7 A;  2HMO B;  2XSH B;  1K41 A;  5DRE A;  4X2O A;  2Z7A A;  3LZA A;  4HZB B;  2HMM B;  4PEJ A;  5CXO A;  2BMQ B;  3E99 A;  2XSO B;  2YFL B;  2A15 A;  1ULI B;  3CPO A;  3HK4 A;  1OF5 A;  5IF6 A;  3FZW A;  5G2G A;  5HGR A;  2Z77 A;  4K1V A;  4LMI A;  3JUP A;  3EX9 A;  2F99 A;  3VGN A;  5IEP A;  3F9S A;  4OVM A;  4WYK B;  3GRD A;  3CU3 A;  4XBX A;  2YFJ B;  3CNX A;  3OWY A;  5IEN A;  3OWU A;  1OUN A;  4FCM A;  3MG2 A;  2INX A;  4HVN A;  1NWW A;  3G0K A;  2I9W A;  4HM1 B;  5D81 A; 
#chains in the Genus database with same CATH topology
 1UGI A;  2LQV A;  3NM7 A;  1MNL A;  2CWT A;  1U8C B;  1BNG A;  1Z1S A;  5ELU A;  2CK3 H;  3G8Z A;  1LOV A;  1K8A 4;  1I70 A;  3BIR A;  1AVK A;  3DUK A;  1NB5 I;  4XDW A;  1SPU A;  1US1 A;  1ASK A;  1GY6 A;  1OHP A;  5AEU B;  3FG4 A;  3MKI A;  3BNC A;  3GWR A;  5CLK A;  2QGU A;  3RGA A;  4XBT A;  3CCL 3;  4R9L A;  2BHM A;  4EYC A;  3WOF B;  1I0V A;  3WOD G;  1T2H A;  2UX0 A;  3BU4 A;  1Q82 4;  4CJN A;  1BU4 A;  1Q81 4;  3LT9 A;  3KFQ C;  2XEP A;  2W9Q A;  1N5P A;  2K0M A;  1O7G B;  1VQM 3;  3ALA A;  3AMO B;  4BTW A;  1BUJ A;  7GSP A;  3DZL A;  3JUO A;  2HOH A;  1ULJ B;  1CH0 A;  5AII A;  3FGY A;  1FA3 A;  1LOW A;  1DET A;  3DGM A;  3D79 A;  1AY7 A;  1RGK A;  3NUV A;  1BIR A;  2WGO A;  3PGB A;  4HM7 B;  1MWU A;  4MEI A;  1IVX A;  3V98 A;  1GYB A;  3MG3 A;  2IY2 A;  5TGN A;  5EVH A;  1BRH A;  3FH1 A;  4O02 B;  4H3U A;  1N9E A;  3PYJ A;  4R80 A;  1O7W B;  4IPB A;  1PU4 A;  1NO3 A;  1HU9 A;  1BSD A;  1KSI A;  1JN5 B;  3D5I A;  3SYU A;  3NBB A;  1VQN 3;  1M9G A;  2FNQ A;  4MMZ B;  1JB2 A;  3NHX A;  3OV4 A;  3S29 A;  1BAN A;  1WMN A;  1VQL 3;  2OOV C;  3DGY A;  1I0X A;  2JDI H;  1EG9 B;  3PCR A;  1W01 A;  3HII A;  2XFS A;  4LGQ A;  5LC6 A;  4STD A;  5A0O B;  1Q40 B;  4KFD A;  3NV0 B;  3QK9 A;  4N6L A;  2O3O A;  2CX0 A;  1QAK A;  5STD A;  3HIG A;  3WDG B;  1NJI 4;  1IVU A;  2GEX A;  2IUK A;  3MPH A;  2GBX B;  2ZDJ A;  3SED A;  5KP3 A;  1C54 A;  4BTY A;  3G16 A;  2C4B A;  1BSE A;  1IDP A;  1Q40 A;  4HM3 B;  1SII A;  3VSY A;  1UUG B;  1LVN A;  3O8Y A;  5D83 A;  1F8N A;  3D9R A;  1DVC A;  1Q86 4;  5BXQ A;  3PZW A;  1IT8 A;  3MYT A;  2CFD A;  4L8P A;  2KF4 A;  4BU4 A;  1R4C A;  1JV2 B;  2R41 A;  2V1L A;  3DGN A;  2KRT A;  3N9H A;  3GZY B;  2KXG A;  5CF1 A;  1UUW B;  1T2I A;  1OGX A;  2KCD A;  1LNI A;  5IG0 A;  3CPW 2;  1AQZ A;  3NBR A;  1QVF 2;  1FZU A;  2P05 A;  4N6T A;  2M7O A;  3UJM A;  2XR8 B;  3F40 A;  2RGQ A;  2XGL A;  3B4P A;  3UB1 A;  3KKG A;  1U5O A;  4Q53 A;  1OHO A;  1AVL A;  2F5W A;  2Q07 A;  4FMA A;  5LC7 A;  3ZG5 A;  1B2Z A;  1TRQ A;  3AHS A;  5AEW B;  1YVS A;  3K0Z A;  4CDL A;  1E3R A;  4LEH A;  1RNB A;  2CG1 A;  4J5K A;  3NX0 A;  1O7P B;  3EF8 A;  2IMJ A;  2R4I A;  6STD A;  2W04 A;  3S67 A;  1A67 A;  1UCI A;  1PY3 A;  1LQM B;  1VZZ A;  2W2C A;  4EC6 A;  4BIR A;  2Y73 A;  1TUH A;  5GSP A;  1ZS7 A;  1DMQ A;  3S27 A;  1TJD A;  1TFK A;  5KP4 A;  1MWS A;  2GU1 A;  3GSP A;  2UUG C;  2Z6B A;  3CCE 3;  1YHQ 3;  3F7S A;  2RFR A;  2CWV A;  1DYU A;  3DMC A;  1VQK 3;  1MOL A;  1JBT A;  1BSA A;  1LXE A;  4MMY B;  1LQG C;  1MWR A;  1ROV A;  2LYX A;  3MG1 A;  7RNT A;  1TFO A;  4K61 A;  5JPU A;  4WYK A;  1B3S A;  1GOY A;  3T8N A;  3Q1C A;  1WMP A;  4MMX B;  4WWU C;  2KF6 A;  3EJV A;  3CME 3;  4U13 A;  1STF I;  1SJW A;  1CEW I;  3U1W A;  1B2U A;  2BNG A;  2XF3 A;  4GB5 A;  1M1K 4;  3SLU A;  1T3B A;  3NM2 A;  3STD A;  1DVD A;  3KII A;  3S5C A;  1FGT A;  1TTO A;  2W0Q A;  1M1X B;  3D5G A;  3EE1 A;  4HAA A;  2Y74 A;  5RNT A;  3I0Y A;  1BNJ A;  2UGI A;  1EQK A;  1QJG A;  2PZV A;  1UCK A;  3UL5 A;  3Q2P A;  2J8X B;  3IJE B;  4QWT A;  4KVH A;  4N3V A;  4AKZ A;  3AHW A;  1OGZ A;  1BRI A;  1D6Z A;  1RHL A;  2W56 B;  1QVG 2;  1GSP A;  1VQ6 3;  1W02 A;  1PFP A;  3SVA A;  3DGO A;  1MGW A;  2KF3 A;  3SOY A;  3LYG A;  1SAR A;  1LNH A;  2OWP A;  3LT8 A;  3DM8 A;  2K54 A;  3GAX A;  1K73 4;  1RGE A;  3JUQ A;  5JBS A;  3KSP A;  1N8R 4;  1KC8 4;  3BLZ A;  4RZM A;  4GHO A;  1R4Y A;  5G1L A;  4O2H A;  3IMA B;  3HZP A;  1BSB A;  2K3D A;  1NU3 A;  3KZT A;  1SQW A;  4HM8 B;  3BB9 A;  4L7K A;  3Q3F A;  2ZA4 A;  4N6M A;  4CCV A;  3X40 A;  5BU4 A;  1GD4 A;  2YX9 A;  1K28 A;  1RTU A;  1X1X A;  4HJL B;  4WFO A;  1UI7 A;  3AMO A;  1ZX2 A;  3FF0 A;  2CHC A;  4XBY A;  1B27 A;  1GMR A;  3DXO A;  1IVV A;  3B8L A;  1BGS A;  5IG3 A;  1EEJ A;  4R1K A;  7STD A;  3A76 A;  3I56 3;  5FW5 A;  1JB5 A;  1OH0 A;  1C7H A;  5ELJ A;  3WR2 A;  3CCV 3;  1STD A;  3K9M C;  1Q42 A;  2C10 A;  4BL2 A;  2MF7 A;  3D3L A;  4NHF A;  4HM0 B;  5IEO A;  1UI8 A;  1FGO A;  2Z76 A;  1FYS A;  2W03 A;  5AIG A;  1E97 A;  5BIR A;  1JN5 A;  2L4V A;  1HKX A;  3FSD A;  3X3Y A;  4J8T A;  2F56 A;  3S28 A;  1RRH A;  2GBW B;  1FGM A;  3BNB A;  1YJN 3;  4G1M B;  2WO0 A;  3CCM 3;  1W00 A;  4J5G A;  3MSO A;  1AR0 A;  1N8Q A;  1RGC A;  1QAF A;  3B7C A;  3CCQ 3;  1BNI A;  2CWU A;  2JQ5 A;  2OQE C;  3EN8 A;  1EA2 A;  3NV0 A;  5AYS C;  1VQ7 3;  1JBS A;  1BRN L;  1BVI A;  1O7M B;  4I4K A;  3UL6 A;  2BMO B;  4R4K A;  1IQY A;  1O7H B;  5AIH A;  1OAC A;  1FUW A;  3NQZ A;  3X3Z A;  4BTX A;  1RLS A;  2P0X A;  3F7X A;  1IV7 A;  1OPY A;  3K63 A;  2HML B;  1W5Z A;  1HZ1 A;  4LZI A;  1PYL A;  2STD A;  3JUN A;  3PXM A;  4NRE A;  4OK0 A;  1E3V A;  1JZD A;  1WNH A;  3LOY A;  2GU3 A;  3FLJ A;  3ZG0 A;  2YFI B;  3ER7 A;  1GY5 A;  1SIH A;  3EB8 A;  4H61 A;  3WMD A;  2CH9 A;  5IW9 A;  4KT3 B;  4N6U A;  4BL3 A;  1WQL B;  2W9P A;  3EQQ B;  3EC9 A;  4HZ9 B;  1ROA A;  2RCD A;  1JBR A;  1TIJ A;  1BNR A;  2WOF A;  1IQX A;  1B2M A;  2CC3 A;  5IG4 A;  3LTB A;  1EKM A;  1OHS A;  4EXR A;  1W2B 2;  1OF5 B;  4R9K A;  1B21 A;  1RN1 A;  3G6E 3;  2CW9 A;  1EUI C;  1X1W A;  3LH4 A;  1NDO B;  2O9U X;  1LRA A;  1RN7 A;  2OQE A;  3ECF A;  4RBN A;  1IV9 A;  4HYZ A;  3D4A A;  1RNT A;  4XM4 A;  1A90 A;  2F4Y A;  1JNQ A;  3GZB A;  1DMN A;  4EBG A;  2BIR A;  1JKG B;  1CYU A;  1MGR A;  3A5E A;  3F8H A;  2ML6 A;  3WA3 A;  3WOE B;  5IER A;  3EBT A;  1CQS A;  3EBY A;  4HKV B;  2XGN A;  4K1U A;  2CKF B;  1GS3 A;  5G1K A;  1DE3 A;  3FF2 A;  3LTD A;  2B1X B;  4J9A A;  3SXX A;  3FKA A;  2HMJ B;  1JKG A;  3K5T A;  1DMM A;  2ZL8 A;  3AGO A;  3M8C A;  1YGE A;  2CFW A;  2F98 A;  4FMC A;  4FMB A;  3B4O A;  1I2E A;  2SAR A;  1ISK A;  5DRV A;  3I55 3;  3CNM A;  4XDV A;  3GZX B;  3QRD A;  2AAE A;  4O3V A;  1A2P A;  2WOH A;  2BMR B;  5IG5 A;  4N6O B;  1BNE A;  1S5A A;  3F8X A;  3FCS B;  3IPT A;  5AYR B;  1BUQ A;  2QEX 3;  1D6U A;  3NXJ A;  1A2V A;  1JJ2 2;  1VQ8 3;  3OXA A;  3CCS 3;  4CPK A;  1VQP 3;  1TRP A;  3HX8 A;  1UW1 A;  2HMN B;  1A2K A;  4WHA A;  2GXF A;  8RNT A;  5I97 A;  3CC4 3;  1Q7H A;  1K9M 4;  1YVB I;  4HM6 B;  2OCT A;  1WMO A;  3F14 A;  3CCU 3;  3HOH A;  2CX1 A;  3H3H A;  1UCJ A;  4JRF A;  3J7Y d;  3T0U A;  2FXT A;  3KCH A;  3PS8 A;  4MJD A;  1J2B A;  3JUM A;  2D42 A;  2MC8 A;  1M90 4;  3RGR A;  1TP6 A;  3VF1 A;  3URP A;  3Q90 A;  1FGR A;  2KF5 A;  1I2F A;  3EN1 B;  3NQY A;  2ZHX B;  5EEO A;  1IVW A;  1LOY A;  2IUJ A;  3GZR A;  3ROB A;  3OW2 2;  1O7N B;  2P38 A;  1UDI I;  4HM2 B;  4HOH A;  5JPP A;  2XRX B;  1CYV A;  2BT3 A;  3LTC A;  4HM4 B;  2PNC A;  4LSO A;  4RNT A;  2BU4 A;  4K90 B;  4EV5 A;  1YIT 3;  1W6G A;  2W56 A;  3K7C A;  5KP1 A;  1FGQ A;  3EHC A;  1ZO2 A;  4FCJ A;  4X2H A;  3X3X A;  8CHO A;  1RJO A;  4ZM8 A;  2RBI A;  1W7C A;  1VQ9 3;  1YI2 3;  1RCL A;  5BVB A;  1X1Y A;  9RNT A;  1AV4 A;  4FR9 A;  4TX4 A;  4ILF A;  2KAA A;  2SBL A;  4NPB A;  1LOX A;  2B24 B;  1D6Y A;  1T5Y A;  1I3F A;  1RGL A;  1MWT A;  1UGH I;  6RNT A;  1B2X A;  1QMA A;  4ORL A;  2H0G A;  3JVC A;  4WP5 A;  2IA7 A;  4FMD A;  2XH9 A;  2HMK B;  4KZ1 A;  1BSC A;  3SX1 A;  1JRQ A;  1UUV B;  1VQ4 3;  2CFG A;  3RNT A;  1BRK A;  2XFT A;  4XB5 A;  1BNS A;  2QIY A;  5CK6 A;  3KSE D;  3OWS A;  3V99 A;  1V57 A;  3LML A;  3L0R A;  1JB4 A;  1FUS A;  3UNL A;  1W2Z A;  2GEY A;  3BND A;  1G0T A;  4IIA A;  4HM5 B;  5M1A A;  3OX9 A;  5CF2 A;  4KFF A;  3HI7 A;  5D82 A;  3H51 A;  3U97 A;  3CMA 3;  3CCR 3;  1GMP A;  5AI1 A;  4LYL B;  3CC2 3;  1W6Y A;  1BNF A;  1FW7 A;  3SOA A;  3MHE A;  1GOU A;  2W6J H;  5AIF A;  1RGF A;  2F86 B;  3BNE A;  4OUQ A;  3KE7 A;  2E2T A;  1B2S A;  4L8O A;  1RN4 A;  3DGL A;  1ZGX A;  1OCV A;  4EW5 A;  3RDE A;  3X41 A;  3T8U A;  1Q7Y 4;  2RNT A;  1GY7 A;  2HMO B;  1L5G B;  1RGH A;  4I5Q A;  1G96 A;  3G4S 3;  2XSH B;  4RNY A;  1K41 A;  5FGO A;  1NNV A;  5DRE A;  4X2O A;  2Z7A A;  3LZA A;  5M19 A;  3CD6 3;  4AKY A;  4HZB B;  1IQ8 A;  1KWI A;  2HMM B;  3FG3 A;  4PEJ A;  4AEQ A;  1W6C A;  1RDS A;  5CXO A;  2L1S A;  2ML5 A;  2BMQ B;  3ZFZ A;  3N8B A;  3E99 A;  4RNZ A;  1YJ9 3;  3V92 A;  2XSO B;  2YFL B;  2A15 A;  3MWZ A;  4HBR A;  1ULI B;  3FG1 A;  1YNV X;  3CPO A;  3HK4 A;  1S72 3;  1IK3 A;  5HOH A;  2H0H A;  4O8S A;  1QAL A;  2QA4 3;  3G71 3;  2IYJ A;  4FCZ A;  2OOV A;  2P0M A;  4GSP A;  1VQO 3;  1OF5 A;  4JF8 A;  1FUT A;  5IF6 A;  3FZW A;  3DY5 A;  5G2G A;  5HGR A;  2OTL 3;  1I2G A;  2Z77 A;  1IT7 A;  1YGW A;  1WTH A;  1IYY A;  2H0I A;  4K1V A;  4LMI A;  1JZO A;  2RSX A;  2OTJ 3;  1RMS A;  1HYF A;  2D1W A;  2F5M A;  1X1U A;  3PCS A;  1RKY A;  1N5H A;  1G02 A;  3AGN A;  1RGA A;  1VQQ A;  3JUP A;  1YJW 3;  3WA2 X;  3EX9 A;  1GD3 A;  5EQL A;  3X42 A;  2CIU A;  2F99 A;  1BAO A;  3NBJ A;  2AAD A;  1VQ5 3;  1GOV A;  2E2U A;  2WGQ A;  1GMQ A;  3VGN A;  5M18 A;  2BO9 B;  1RRL A;  2GSP A;  5IEP A;  2FGT A;  3CCJ 3;  3F9S A;  1IU7 A;  1Q9E A;  2CFL A;  2C11 A;  4OVM A;  1TU5 A;  1W4N A;  2CG0 A;  6GSP A;  4WYK B;  1Y4K A;  3GRD A;  3DH2 A;  3WHO A;  1KD1 4;  3CU3 A;  1BRJ A;  4N6N B;  2CFK A;  4XBX A;  2P09 A;  4DKI A;  4N6V 0;  1BRG A;  3N54 B;  4EV2 A;  1RGG A;  2YFJ B;  3CNX A;  3OWY A;  3LTA A;  3OWU A;  5IEN A;  2E2V A;  3KN4 A;  1OUN A;  3CC7 3;  1I8V A;  3CXC 2;  1BRS A;  4FCM A;  1RCK A;  3MG2 A;  1RSN A;  2INX A;  4IT7 A;  4KFE A;  1V74 A;  4HVN A;  1NWW A;  3G0K A;  1YIJ 3;  1UCL A;  1N9J A;  2I9W A;  1BOX A;  4GL6 A;  1B20 A;  1KQS 2;  3LXU X;  4HM1 B;  1I3I A;  3TDG A;  5D81 A;  1NB3 I;  1V58 A; 
#chains in the Genus database with same CATH homology
 3NM7 A;  2LQV A;  1MNL A;  2CWT A;  1U8C B;  1Z1S A;  5ELU A;  2CK3 H;  3G8Z A;  1K8A 4;  1AVK A;  3DUK A;  1NB5 I;  4XDW A;  1SPU A;  1US1 A;  1ASK A;  1GY6 A;  1OHP A;  5AEU B;  3FG4 A;  3MKI A;  3BNC A;  3GWR A;  5CLK A;  2QGU A;  3RGA A;  4XBT A;  3CCL 3;  4R9L A;  2BHM A;  4EYC A;  3WOF B;  3WOD G;  2UX0 A;  1Q82 4;  1Q81 4;  3LT9 A;  3KFQ C;  2XEP A;  2W9Q A;  1N5P A;  2K0M A;  1O7G B;  1VQM 3;  3ALA A;  3AMO B;  4BTW A;  3DZL A;  3JUO A;  1ULJ B;  5AII A;  3FGY A;  3DGM A;  3NUV A;  2WGO A;  3PGB A;  4HM7 B;  4MEI A;  3V98 A;  1IVX A;  1GYB A;  3MG3 A;  5TGN A;  5EVH A;  3FH1 A;  4O02 B;  4H3U A;  1N9E A;  3PYJ A;  4R80 A;  1O7W B;  4IPB A;  1PU4 A;  1NO3 A;  1HU9 A;  1KSI A;  1JN5 B;  3NBB A;  1VQN 3;  1M9G A;  2FNQ A;  4MMZ B;  1JB2 A;  3NHX A;  3OV4 A;  3S29 A;  1WMN A;  1VQL 3;  2OOV C;  2JDI H;  1EG9 B;  3PCR A;  1W01 A;  3HII A;  2XFS A;  4LGQ A;  5LC6 A;  4STD A;  5A0O B;  1Q40 B;  4KFD A;  3NV0 B;  3QK9 A;  4N6L A;  2O3O A;  1QAK A;  5STD A;  3HIG A;  3WDG B;  1NJI 4;  1IVU A;  2GEX A;  2IUK A;  3MPH A;  2GBX B;  2ZDJ A;  3SED A;  5KP3 A;  4BTY A;  3G16 A;  1IDP A;  1Q40 A;  4HM3 B;  1SII A;  3VSY A;  1LVN A;  3O8Y A;  5D83 A;  1F8N A;  3D9R A;  1DVC A;  1Q86 4;  5BXQ A;  3PZW A;  1IT8 A;  3MYT A;  2CFD A;  4L8P A;  1R4C A;  1JV2 B;  2V1L A;  3DGN A;  3N9H A;  2KRT A;  3GZY B;  2KXG A;  5CF1 A;  1UUW B;  1OGX A;  2KCD A;  3CPW 2;  5IG0 A;  3NBR A;  1QVF 2;  2P05 A;  4N6T A;  2M7O A;  3UJM A;  2XR8 B;  3F40 A;  2RGQ A;  2XGL A;  3B4P A;  3UB1 A;  3KKG A;  1U5O A;  4Q53 A;  1OHO A;  1AVL A;  2Q07 A;  4FMA A;  5LC7 A;  5AEW B;  3K0Z A;  4CDL A;  1E3R A;  4LEH A;  2CG1 A;  3NX0 A;  1O7P B;  3EF8 A;  2IMJ A;  2R4I A;  6STD A;  2W04 A;  3S67 A;  1A67 A;  1VZZ A;  2W2C A;  4EC6 A;  2Y73 A;  1TUH A;  1DMQ A;  3S27 A;  1TFK A;  5KP4 A;  2GU1 A;  2Z6B A;  3CCE 3;  1YHQ 3;  3F7S A;  2RFR A;  2CWV A;  1DYU A;  3DMC A;  1VQK 3;  1MOL A;  1LXE A;  4MMY B;  1ROV A;  2LYX A;  3MG1 A;  1TFO A;  4K61 A;  5JPU A;  4WYK A;  3T8N A;  3Q1C A;  1WMP A;  4MMX B;  4WWU C;  3EJV A;  3CME 3;  4U13 A;  1STF I;  1SJW A;  1CEW I;  3U1W A;  2BNG A;  2XF3 A;  4GB5 A;  1M1K 4;  3SLU A;  3NM2 A;  3STD A;  1DVD A;  3KII A;  3S5C A;  1FGT A;  2W0Q A;  1M1X B;  3EE1 A;  2Y74 A;  3I0Y A;  1EQK A;  1QJG A;  2PZV A;  3UL5 A;  3Q2P A;  3IJE B;  4QWT A;  4KVH A;  4N3V A;  4AKZ A;  1OGZ A;  1D6Z A;  2W56 B;  1QVG 2;  1VQ6 3;  1PFP A;  1W02 A;  3SVA A;  3DGO A;  3SOY A;  3LYG A;  1LNH A;  2OWP A;  3LT8 A;  3DM8 A;  2K54 A;  3GAX A;  1K73 4;  3JUQ A;  5JBS A;  3KSP A;  1N8R 4;  1KC8 4;  3BLZ A;  4RZM A;  4O2H A;  3IMA B;  3HZP A;  1NU3 A;  3KZT A;  1SQW A;  4HM8 B;  3BB9 A;  4L7K A;  4N6M A;  4CCV A;  3X40 A;  1GD4 A;  2YX9 A;  1K28 A;  4WFO A;  4HJL B;  1UI7 A;  3AMO A;  1ZX2 A;  3FF0 A;  2CHC A;  4XBY A;  3DXO A;  1IVV A;  3B8L A;  5IG3 A;  4R1K A;  7STD A;  3A76 A;  3I56 3;  5FW5 A;  1JB5 A;  1OH0 A;  1C7H A;  5ELJ A;  3CCV 3;  1STD A;  3K9M C;  1Q42 A;  2C10 A;  2MF7 A;  3D3L A;  4NHF A;  4HM0 B;  5IEO A;  1UI8 A;  1FGO A;  2Z76 A;  2W03 A;  5AIG A;  1E97 A;  1JN5 A;  2L4V A;  1HKX A;  3FSD A;  3X3Y A;  4J8T A;  3S28 A;  1RRH A;  2GBW B;  1FGM A;  3BNB A;  1YJN 3;  4G1M B;  2WO0 A;  3CCM 3;  1W00 A;  3MSO A;  1AR0 A;  1N8Q A;  1QAF A;  3B7C A;  3CCQ 3;  2OQE C;  2CWU A;  2JQ5 A;  3EN8 A;  3NV0 A;  1EA2 A;  5AYS C;  1VQ7 3;  1FA3 A;  1O7M B;  4I4K A;  3UL6 A;  2BMO B;  4R4K A;  1IQY A;  1O7H B;  5AIH A;  1OAC A;  1FUW A;  3NQZ A;  3X3Z A;  4BTX A;  2P0X A;  3F7X A;  1IV7 A;  1OPY A;  3K63 A;  2HML B;  1W5Z A;  4LZI A;  2STD A;  3JUN A;  3PXM A;  4NRE A;  4OK0 A;  1E3V A;  1WNH A;  3LOY A;  2GU3 A;  3FLJ A;  2YFI B;  3ER7 A;  1GY5 A;  1SIH A;  3EB8 A;  4H61 A;  3WMD A;  2CH9 A;  5IW9 A;  4N6U A;  1WQL B;  2W9P A;  3EQQ B;  3EC9 A;  4HZ9 B;  1ROA A;  2RCD A;  1TIJ A;  2WOF A;  1IQX A;  2CC3 A;  5IG4 A;  3LTB A;  1EKM A;  1OHS A;  4EXR A;  1W2B 2;  1OF5 B;  4R9K A;  3G6E 3;  2CW9 A;  3LH4 A;  1NDO B;  2O9U X;  1RN7 A;  2OQE A;  3ECF A;  4RBN A;  1IV9 A;  4HYZ A;  4XM4 A;  1A90 A;  1JNQ A;  3GZB A;  1DMN A;  4EBG A;  1JKG B;  1CYU A;  3F8H A;  2ML6 A;  3WA3 A;  3WOE B;  5IER A;  3EBT A;  1CQS A;  3EBY A;  4HKV B;  2XGN A;  4K1U A;  2CKF B;  1GS3 A;  3FF2 A;  3LTD A;  2B1X B;  4J9A A;  3SXX A;  3FKA A;  2HMJ B;  1JKG A;  3K5T A;  1DMM A;  2ZL8 A;  3M8C A;  1YGE A;  2CFW A;  2F98 A;  4FMC A;  4FMB A;  3B4O A;  1ISK A;  5DRV A;  3I55 3;  3CNM A;  4XDV A;  3GZX B;  3QRD A;  4O3V A;  2WOH A;  5IG5 A;  2BMR B;  4N6O B;  1S5A A;  3F8X A;  3FCS B;  3IPT A;  5AYR B;  1BUQ A;  2QEX 3;  1D6U A;  3NXJ A;  1A2V A;  1JJ2 2;  1VQ8 3;  3OXA A;  3CCS 3;  1VQP 3;  3HX8 A;  1UW1 A;  2HMN B;  1A2K A;  4WHA A;  2GXF A;  3CC4 3;  5I97 A;  1K9M 4;  1YVB I;  4HM6 B;  2OCT A;  1WMO A;  3F14 A;  3CCU 3;  3H3H A;  4JRF A;  3J7Y d;  3T0U A;  2FXT A;  3PS8 A;  4MJD A;  1J2B A;  3JUM A;  2D42 A;  2MC8 A;  1M90 4;  3RGR A;  1TP6 A;  3VF1 A;  3Q90 A;  1FGR A;  3NQY A;  3EN1 B;  5EEO A;  2IUJ A;  3ROB A;  1IVW A;  3OW2 2;  3GZR A;  1O7N B;  2P38 A;  4HM2 B;  5JPP A;  2XRX B;  1CYV A;  2BT3 A;  3LTC A;  4HM4 B;  2PNC A;  4LSO A;  4K90 B;  4EV5 A;  1YIT 3;  1W6G A;  2W56 A;  3K7C A;  5KP1 A;  1FGQ A;  3EHC A;  1ZO2 A;  4FCJ A;  4X2H A;  3X3X A;  8CHO A;  1RJO A;  4ZM8 A;  1VQ9 3;  1W7C A;  1YI2 3;  5BVB A;  1AV4 A;  4FR9 A;  4TX4 A;  2SBL A;  1LOX A;  2B24 B;  1D6Y A;  1T5Y A;  1QMA A;  4ORL A;  3JVC A;  4WP5 A;  2IA7 A;  4FMD A;  2XH9 A;  2HMK B;  4KZ1 A;  3SX1 A;  1JRQ A;  1UUV B;  1VQ4 3;  2CFG A;  2XFT A;  4XB5 A;  2QIY A;  5CK6 A;  3KSE D;  3OWS A;  3V99 A;  3LML A;  3L0R A;  1JB4 A;  3UNL A;  1W2Z A;  2GEY A;  3BND A;  4IIA A;  4HM5 B;  3OX9 A;  5CF2 A;  4KFF A;  3HI7 A;  5D82 A;  3H51 A;  3U97 A;  3CMA 3;  3CCR 3;  5AI1 A;  3CC2 3;  1W6Y A;  3SOA A;  3MHE A;  5AIF A;  2W6J H;  2F86 B;  3BNE A;  4OUQ A;  3KE7 A;  2E2T A;  4L8O A;  3DGL A;  1OCV A;  3RDE A;  3X41 A;  3T8U A;  1Q7Y 4;  1GY7 A;  2HMO B;  1L5G B;  1G96 A;  3G4S 3;  2XSH B;  4RNY A;  1K41 A;  5FGO A;  5DRE A;  4X2O A;  2Z7A A;  3LZA A;  3CD6 3;  4AKY A;  4HZB B;  1IQ8 A;  1KWI A;  2HMM B;  3FG3 A;  4PEJ A;  4AEQ A;  1W6C A;  5CXO A;  2ML5 A;  2BMQ B;  1YJ9 3;  3N8B A;  3E99 A;  4RNZ A;  3V92 A;  2XSO B;  2YFL B;  2A15 A;  3MWZ A;  4HBR A;  1ULI B;  3FG1 A;  3CPO A;  3HK4 A;  1S72 3;  1IK3 A;  4O8S A;  1QAL A;  2QA4 3;  3G71 3;  4FCZ A;  2OOV A;  2P0M A;  1VQO 3;  1OF5 A;  4JF8 A;  5IF6 A;  3FZW A;  3DY5 A;  5G2G A;  5HGR A;  2OTL 3;  2Z77 A;  1IT7 A;  1WTH A;  4K1V A;  4LMI A;  2OTJ 3;  2RSX A;  2D1W A;  3PCS A;  1RKY A;  1N5H A;  3JUP A;  1YJW 3;  3WA2 X;  3EX9 A;  1GD3 A;  5EQL A;  3X42 A;  2CIU A;  2F99 A;  3NBJ A;  1VQ5 3;  2E2U A;  2WGQ A;  3VGN A;  2BO9 B;  1RRL A;  5IEP A;  2FGT A;  3CCJ 3;  3F9S A;  1IU7 A;  2CFL A;  2C11 A;  4OVM A;  1TU5 A;  1W4N A;  2CG0 A;  4WYK B;  1Y4K A;  3GRD A;  1KD1 4;  3CU3 A;  4N6N B;  2CFK A;  4XBX A;  2P09 A;  4N6V 0;  3N54 B;  4EV2 A;  2YFJ B;  3CNX A;  3OWY A;  5IEN A;  3LTA A;  3OWU A;  2E2V A;  3KN4 A;  1OUN A;  3CC7 3;  3CXC 2;  4FCM A;  3MG2 A;  4IT7 A;  2INX A;  4KFE A;  1V74 A;  4HVN A;  1NWW A;  3G0K A;  1YIJ 3;  1N9J A;  2I9W A;  4GL6 A;  1KQS 2;  3LXU X;  4HM1 B;  3TDG A;  5D81 A;  1NB3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...