1O7GB

Naphthalene 1,2-dioxygenase with naphthalene bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7gB00
4FCJA 3OX9A 2R4IA 5IENA 2F99A 4GB5A 1GY5A 2HMKB 4R9KA 1DMMA 3FSDA 1W01A 3JUQA 3B4PA 3DMCA 4OUQA 5IERA 3FF0A 3FLJA 3F40A 2BMOB 3G8ZA 1O7PB 4XDWA 2HMMB 4LGQA 3FKAA 1K41A 3MG3A 2JQ5A 4HM6B 4KVHA 3NM2A 3OWYA 1Q40B 4XBYA 3KSPA 2YFJB 4WP5A 3GRDA 2Z76A 1JN5A 3LZAA 3F8XA 3G0KA 5CXOA 4N3VA 1UUVB 3CNMA 3T8NA 2IMJA 2STDA 3KZTA 3NBRA 1AR0A 2K54A 1OHOA 1OHSA 4X2OA 4R9LA 1JKGB 1O7WB 5IG4A 5KP4A 2F98A 5JPPA 4ORLA 3VSYA 4OVMA 1OH0A 5D83A 4HJLB 3GZXB 5AEWB 1ULIB 1O7MB 1JB5A 7STDA 3FZWA 5KP1A 1E3VA 3FF2A 3HK4A 1C7HA 4WYKB 1DMQA 3EF8A 4XBXA 3KE7A 3MG2A 1GY7A 1JB2A 5D81A 4K1VA 5AIGA 4XB5A 3OWSA 1STDA 5JPUA 4HM1B 5AI1A 1A2KA 2BMRB 4XM4A 4I4KA 5AIHA 5KP3A 3D9RA 2B1XB 4X2HA 3E99A 3STDA 5IEPA 5CF2A 5DRVA 1SJWA 2UX0A 5STDA 3CPOA 5FW5A 5BXQA 8CHOA 1JB4A 1OF5A 5AEUB 1ZX2A 2BMQB 4MJDA 3JUPA 2I9WA 3GZYB 5IG5A 2BNGA 3EQQB 3H51A 4K1UA 2HMJB 1ZO2A 4HM7B 3KKGA 3JUOA 4J9AA 2RGQA 1QJGA 2GXFA 4HM3B 3B8LA 4HZ9B 3F8HA 3FH1A 3DUKA 4J8TA 1W00A 1VZZA 2INXA 2YFLB 3NV0A 1O7HB 3A76A 3SOYA 2CHCA 2GEXA 1WQLB 4L7KA 5IF6A 3GWRA 4STDA 1GS3A 2W2CA 3EHCA 5BVBA 4HM5B 2HMOB 1GYBA 5CF1A 3F7XA 1ISKA 1EG9B 3JUMA 4HVNA 4RZMA 3GZBA 4U13A 4IIAA 1Q40A 3CU3A 1NDOB 3BLZA 3S5CA 3K0ZA 2B24B 3ER7A 5G2GA 5IEOA 3H3HA 4PEJA 5HGRA 1NU3A 4HM0B 1HKXA 1E97A 1JKGA 4XDVA 3OXAA 4HZBB 3HX8A 3UNLA 5CLKA 3MHEA 3EC9A 1TUHA 5EVHA 2Z7AA 2OWPA 1UUWB 4L8OA 3CNXA 3GZRA 3I0YA 1JN5B 3ROBA 3SOAA 3OWUA 5AIFA 3OV4A 3ECFA 3RGRA 4XBTA 3NV0B 2QIYA 3RGAA 4CDLA 2QGUA 4WYKA 4LEHA 2F86B 5D82A 3WMDA 3JUNA 1W02A 4WWUC 3UJMA 3EX9A 2XSHB 3DM8A 3B4OA 3F7SA 3LYGA 4R1KA 1Z1SA 4FCMA 2RCDA 1E3RA 4L8PA 1EA2A 3BB9A 5DREA 1QMAA 3NUVA 1S5AA 5IG3A 5TGNA 1O7GB 2XR8B 4HKVB 2GEYA 1GY6A 3MYTA 1OUNA 3HZPA 2PZVA 3DZLA 2GBWB 3EBTA 3EN1B 3EBYA 5IG0A 2HMLB 1OGZA 1NWWA 1U5OA 4Q53A 1ASKA 1OCVA 2Z77A 2HMNB 2RFRA 3MKIA 3M8CA 4HM4B 1ULJB 2XRXB 3VGNA 1DMNA 3F14A 3NHXA 3EN8A 4H3UA 1IDPA 3T8UA 5CK6A 1OHPA 6STDA 3IPTA 4HM8B 2CKFB 1CQSA 1OF5B 2GBXB 5AIIA 1O7NB 3EJVA 3G16A 3F9SA 3MSOA 1OGXA 3MG1A 3SEDA 4LMIA 1OPYA 1W6YA 2XSOB 3B7CA 3NXJA 2A15A 3Q90A 1TP6A 4HM2B 1Q42A 3FGYA 3DXOA 1BUQA 3K7CA 2YFIB
chains in the Genus database with same CATH superfamily
1BSCA 4FCJA 1WMPA 1VQP3 1LQMB 1RMSA 1I3FA 4WFOA 1TFKA 3UL6A 4N6UA 1Q7Y4 3OX9A 2R4IA 2P38A 2F56A 1N5HA 1SARA 1BUJA 5IENA 1IVWA 1IU7A 3CCE3 2F99A 4GB5A 1GY5A 2Y73A 2HMKB 4N6V0 4R9KA 1DMMA 3FSDA 2WOFA 3G6E3 4KFEA 3LMLA 1IYYA 1RJOA 1W01A 4CPKA 3SYUA 3JUQA 3PCSA 1RGLA 4MMZB 3B4PA 1EUIC 1VQN3 3DMCA 4OUQA 2JDIH 1SPUA 1GOYA 5IERA 1T3BA 1BSBA 3FF0A 4N6LA 1X1XA 3AGNA 3JVCA 1GOUA 3FLJA 3F40A 3L0RA 4GSPA 2P0MA 2BMOB 3G8ZA 2C10A 2WOHA 4BU4A 1O7PB 3K5TA 4XDWA 1RHLA 1MGRA 2HMMB 3DGYA 4LGQA 4BTWA 1BVIA 4R80A 3S27A 1D6YA 3FKAA 1LRAA 3D5IA 2W56A 3CXC2 1K41A 2MF7A 3MG3A 5AYRB 1UCKA 2JQ5A 4HM6B 4KVHA 1MWSA 3DGMA 3HIGA 3NM2A 1RDSA 3NX0A 4JRFA 5M19A 1YIJ3 1IQYA 2RBIA 3OWYA 3ZG5A 1Q40B 4XBYA 3N8BA 3KSPA 4IT7A 2YFJB 1I2FA 1BNRA 4TX4A 4WP5A 1UW1A 3BIRA 2Z76A 3GRDA 1LXEA 3S28A 4K90B 5A0OB 1DE3A 1RGEA 2ZL8A 3KSED 1JN5A 3DGLA 3LZAA 1MOLA 4N6TA 4WHAA 1B2SA 3F8XA 4FMAA 1PY3A 1YVSA 3G0KA 1BNFA 5CXOA 4N3VA 1UUVB 3CNMA 2KF4A 4O2HA 2IMJA 2STDA 3KZTA 2H0IA 3T8NA 3NBRA 1AR0A 1DVCA 1VQO3 4KT3B 1B2UA 1N9JA 2K54A 4EBGA 1BRHA 1OHOA 1OHSA 1GMQA 4JF8A 3PZWA 2MC8A 2W03A 1JJ22 1AY7A 4KFFA 2ML5A 4X2OA 1MWRA 3LTDA 4RNTA 3GAXA 1FGTA 1IVUA 4R9LA 3SVAA 1JKGB 1O7WB 1BNGA 3RDEA 5IG4A 5KP4A 1RN4A 1RNBA 1MWUA 2F98A 5JPPA 1FGQA 2CG1A 4LZIA 3IJEB 3NBJA 4ORLA 1IVXA 3VSYA 4OVMA 4EW5A 4FMDA 3I553 1FGMA 1Y4KA 1K28A 1OH0A 3HIIA 2K0MA 2F4YA 4N6NB 1DETA 5D83A 3MWZA 2XH9A 1M1XB 1NJI4 1BNEA 2KXGA 3X3XA 1M1K4 1MGWA 4HJLB 2XF3A 3LT8A 1SIIA 2XEPA 4HOHA 2CW9A 1KD14 1PFPA 3GZXB 1CYUA 1V74A 1OACA 2H0HA 3AMOA 3WOFB 5AEWB 1ULIB 1O7MB 3CCL3 1JB5A 2AADA 7STDA 3FZWA 5KP1A 1E3VA 1YJ93 3BU4A 4MMXB 1BANA 1Q7HA 1W2ZA 1GD4A 1US1A 1FUTA 4BIRA 3FF2A 3HK4A 4KFDA 1C7HA 2E2TA 1RGCA 4WYKB 1WMNA 4G1MB 1DMQA 1GSPA 2J8XB 3EF8A 4XBXA 3G4S3 2BHMA 1BRJA 3KE7A 1YIT3 2L4VA 1FGOA 3FG4A 1GD3A 1YVBI 1GY7A 3MG2A 5HOHA 1EEJA 5LC6A 1JB2A 5D81A 4K1VA 5AIGA 1QAKA 4XB5A 1JNQA 2BT3A 2ZHXB 1N8QA 1VQM3 4O02B 3CCQ3 2C4BA 4KZ1A 1MWTA 3OWSA 2E2UA 1B2ZA 1STDA 3SLUA 3S29A 5JPUA 4HM1B 5AI1A 1A2KA 3G713 2BMRB 3CCJ3 2CWUA 1JZDA 3LXUX 1X1YA 2V1LA 4XM4A 3S67A 3PXMA 4I4KA 5AIHA 5KP3A 1YGWA 3AHSA 3D9RA 2B1XB 4O8SA 3E99A 4X2HA 3WA2X 1BSAA 2GU3A 3CCS3 1YI23 3STDA 1UDII 4MEIA 5BU4A 1Q824 1B2MA 2CIUA 2W9PA 5IEPA 1IT8A 4RNZA 5CF2A 1S723 5DRVA 5LC7A 1SJWA 2UX0A 1T2IA 4RNYA 5STDA 1VQK3 3CPOA 1CH0A 1FUWA 2M7OA 1BNIA 5FW5A 5BXQA 8CHOA 1JB4A 1OF5A 3A5EA 4FCZA 4CJNA 5AEUB 1I2GA 1ZX2A 2BMQB 4K61A 4MJDA 3JUPA 1RGFA 2I9WA 1QVF2 4BTXA 1LVNA 1NNVA 2ML6A 3GZYB 3EB8A 5IG5A 4BTYA 2BNGA 2Y74A 2ZDJA 3EQQB 1VQ83 3H51A 4K1UA 2HMJB 1M904 1ZO2A 2D1WA 4HM7B 3CC43 3HOHA 1NO3A 1T2HA 1DVDA 2D42A 3FG1A 3KKGA 4CCVA 2QEX3 2C11A 3I563 1G0TA 2L1SA 1NB5I 3JUOA 3CME3 4J9AA 2RGQA 1QJGA 1VQ73 1TRPA 1ZGXA 1X1UA 2GXFA 2O9UX 3KIIA 4HM3B 1BU4A 1JRQA 1RRLA 2OQEC 1RN1A 2IY2A 3K9MC 3B8LA 4HZ9B 2LYXA 2CX1A 3F8HA 3QRDA 3FH1A 1HU9A 3DUKA 1HZ1A 2KAAA 1K8A4 1VQ43 4LYLB 4J8TA 3PCRA 3T0UA 1RGHA 4EYCA 3NBBA 1W00A 1VZZA 1A2PA 2XGLA 2E2VA 2INXA 3D4AA 2YFLB 3NV0A 1IV9A 1O7HB 1UI8A 7RNTA 1FGRA 3A76A 3SOYA 1LOVA 1I70A 1QALA 2CHCA 1W2B2 2GEXA 2SARA 2LQVA 1UUGB 4NPBA 1WQLB 1M9GA 1STFI 1DYUA 1YGEA 4L7KA 4QWTA 5IF6A 3GWRA 4STDA 1GS3A 2W2CA 1PYLA 1RNTA 3EHCA 5EEOA 1GMPA 2WGOA 1G02A 1B20A 5BVBA 4MMYB 1F8NA 2WO0A 4HM5B 2HMOB 9RNTA 1GYBA 1Q9EA 3BNEA 2CG0A 4H61A 5CF1A 3WHOA 3D79A 3F7XA 4AKZA 2H0GA 1WTHA 1D6ZA 1RCLA 2HOHA 1BRNL 1ISKA 1EG9B 4GL6A 2CWTA 3V92A 3JUMA 3Q3FA 5ELJA 4HVNA 1UCJA 3V99A 1RTUA 1LNIA 2CX0A 4RZMA 2OTJ3 3EE1A 4N6OB 1CEWI 4BL3A 1JBSA 1FZUA 2UGIA 3NM7A 3GZBA 4U13A 1X1WA 1KC84 3K7CA 3CCU3 3D5GA 4IIAA 1Q40A 3CC23 1C54A 1IV7A 4FMBA 3CU3A 1FYSA 1NDOB 1YJN3 5FGOA 2IUJA 1JBRA 2IYJA 3ZG0A 1RKYA 2CFDA 1W7CA 1PU4A 1W5ZA 3BLZA 3S5CA 2R41A 1UCLA 3K0ZA 3URPA 3J7Yd 2B24B 3BNDA 3ER7A 3LTCA 3X41A 5G2GA 5IEOA 2W6JH 3WA3A 6GSPA 4AEQA 1K9M4 1SQWA 3H3HA 4PEJA 2YX9A 2KF3A 3WODG 3DGOA 1Q814 1I3IA 1NU3A 1UGHI 1TJDA 4HM0B 5HGRA 1GOVA 1HKXA 1A67A 1E97A 3X3YA 1JKGA 3D3LA 4FMCA 4XDVA 1KSIA 1LNHA 3AHWA 3OXAA 1QAFA 1RCKA 2W56B 5GSPA 1VQ93 4HZBB 3OW22 3HX8A 3UNLA 5CLKA 4EV2A 1RGAA 3FCSB 1VQL3 1CYVA 1W6CA 3EC9A 3MHEA 1TUHA 5EVHA 2Z7AA 2OTL3 4OK0A 1BNJA 2OWPA 2PNCA 1UUWB 3UB1A 4ZM8A 2W0QA 3ALAA 3TDGA 2BO9B 1T5YA 4L8OA 3MPHA 3CNXA 3GZRA 3I0YA 1V57A 2RNTA 1KQS2 1BOXA 3LH4A 1JN5B 5EQLA 2BU4A 3ROBA 3WDGB 1EQKA 1JZOA 2ZA4A 1BIRA 1W4NA 3SOAA 1VQQA 2WGQA 3OWUA 5AIFA 3FG3A 1JBTA 1JV2B 2OCTA 3ECFA 3OV4A 3QK9A 2OOVA 3RGRA 2CC3A 4XBTA 3NV0B 1B2XA 2QIYA 3RGAA 1UCIA 4CDLA 1BRGA 1TTOA 1LOYA 2QGUA 2P0XA 1IVVA 2OQEA 4NREA 5BIRA 1D6UA 3LTBA 1EKMA 3WOEB 1B27A 4WYKA 4LEHA 3LT9A 3RNTA 2Z6BA 4I5QA 3AGOA 2F86B 2GSPA 1N8R4 5D82A 3WMDA 3JUNA 2AAEA 1IT7A 1MNLA 3HI7A 1BRKA 2P09A 2Q07A 2OOVC 3CCR3 3IMAB 5RNTA 3U97A 1AVKA 1YJW3 1HYFA 4J5KA 4ILFA 2W9QA 3EX9A 1G96A 3KN4A 2F5MA 2XSHB 3B4OA 3DM8A 3F7SA 3LYGA 4R1KA 2FNQA 4EC6A 5I97A 5IW9A 2FXTA 1Z1SA 1RSNA 4FCMA 4IPBA 5G1KA 2RCDA 1E3RA 3PYJA 1BGSA 4L8PA 1EA2A 3BB9A 3X42A 5DREA 3X40A 1QMAA 3AMOB 4HAAA 1GMRA 1V58A 4R4KA 1FW7A 2XFSA 3CPW2 1IK3A 3KCHA 2QA43 3CD63 1FUSA 1FA3A 1VQ63 3LOYA 4HBRA 3NUVA 1S5AA 4J5GA 4BL2A 5IG3A 1W6GA 1VQ53 5TGNA 1RRHA 2SBLA 3KFQC 3X3ZA 1O7GB 1TRQA 2XR8B 4HKVB 2GEYA 2XGNA 1GY6A 1I0VA 1SIHA 2CWVA 3MYTA 1OUNA 1TIJA 1BAOA 2CH9A 3HZPA 2PZVA 2XFTA 3SXXA 3GSPA 4RBNA 5JBSA 3DZLA 7GSPA 2CFLA 2GBWB 3EBTA 1TU5A 2P05A 6RNTA 2GU1A 3EN1B 3UJMA 2W04A 3EBYA 5IG0A 2HMLB 1N9EA 1K734 3N54B 3V98A 1UI7A 1OGZA 1AVLA 2O3OA 1BSDA 1NWWA 1U5OA 1LQGC 1AV4A 4GHOA 3WR2A 3CC73 2CFKA 4Q53A 3O8YA 1NB3I 1ASKA 1OCVA 8RNTA 2Z77A 1LOXA 2HMNB 1RLSA 1ZS7A 2RFRA 2CFGA 3MKIA 4O3VA 3N9HA 3M8CA 1TFOA 1I2EA 4HM4B 1ULJB 1IQXA 2XRXB 3VGNA 1WNHA 2IUKA 5ELUA 1DMNA 3F14A 3NHXA 4FR9A 4HYZA 1I0XA 1BNSA 1IQ8A 3EN8A 3CMA3 1RGGA 2K3DA 2BIRA 4DKIA 2FGTA 4H3UA 1QVG2 1IDPA 1ROAA 5CK6A 1UGIA 3T8UA 4EV5A 2KF5A 1OHPA 3DH2A 3SX1A 6STDA 3PGBA 3IPTA 1RN7A 3U1WA 3DGNA 4HM8B 1RGKA 3BNCA 5M18A 1R4YA 2CKFB 1KWIA 1CQSA 3BNBA 1OF5B 4WWUC 5AYSC 1LOWA 4NHFA 1I8VA 2GBXB 1B3SA 3CCV3 2KF6A 4LSOA 1YNVX 1A2VA 2CFWA 5AIIA 1O7NB 4N6MA 1BRSA 2KRTA 3Q1CA 3EJVA 3G16A 3F9SA 1YHQ3 1WMOA 3MSOA 3K63A 1OGXA 1BSEA 3MG1A 5M1AA 3SEDA 3DY5A 1A90A 3Q2PA 4LMIA 1J2BA 1OPYA 2CK3H 2F5WA 2KCDA 1W6YA 1N5PA 3NQYA 1R4CA 1ROVA 3NQZA 1B21A 2XSOB 3B7CA 3UL5A 2RSXA 1U8CB 3NXJA 2A15A 3Q90A 1TP6A 4HM2B 1L5GB 2UUGC 5G1LA 1Q42A 3LTAA 3FGYA 3DXOA 4AKYA 1BRIA 3PS8A 3ZFZA 4EXRA 3CCM3 1BUQA 1Q864 1AQZA 3VF1A 1W02A 2YFIB 2IA7A
chains in the Genus database with same CATH topology
4FCJA 1WMPA 1VQP3 4WFOA 1TFKA 3UL6A 4N6UA 1Q7Y4 3OX9A 2R4IA 2P38A 1N5HA 5IENA 1IVWA 1IU7A 3CCE3 2F99A 4GB5A 1GY5A 2Y73A 2HMKB 4N6V0 4R9KA 1DMMA 3FSDA 2WOFA 3G6E3 4KFEA 3LMLA 1RJOA 1W01A 3JUQA 3PCSA 4MMZB 3B4PA 1VQN3 3DMCA 4OUQA 2JDIH 1SPUA 5IERA 3FF0A 4N6LA 3JVCA 3FLJA 3F40A 3L0RA 2P0MA 2BMOB 3G8ZA 2C10A 2WOHA 1O7PB 3K5TA 4XDWA 2HMMB 4LGQA 4BTWA 4R80A 3S27A 1D6YA 3FKAA 2W56A 3CXC2 1K41A 2MF7A 3MG3A 5AYRB 2JQ5A 4HM6B 4KVHA 3DGMA 3HIGA 3NM2A 3NX0A 1YIJ3 4JRFA 1IQYA 3OWYA 1Q40B 4XBYA 3N8BA 3KSPA 4IT7A 2YFJB 4TX4A 4WP5A 1UW1A 3GRDA 2Z76A 3S28A 1LXEA 4K90B 5A0OB 2ZL8A 3KSED 1JN5A 3DGLA 3LZAA 1MOLA 4N6TA 4WHAA 3F8XA 4FMAA 3G0KA 5CXOA 4N3VA 1UUVB 3CNMA 4O2HA 3T8NA 2IMJA 2STDA 3KZTA 3NBRA 1AR0A 1DVCA 1VQO3 4EBGA 1N9JA 2K54A 1OHOA 1OHSA 4JF8A 3PZWA 2MC8A 2W03A 1JJ22 4KFFA 2ML5A 4X2OA 3LTDA 3GAXA 1FGTA 1IVUA 4R9LA 3SVAA 1JKGB 1O7WB 3RDEA 5IG4A 5KP4A 2F98A 5JPPA 1FGQA 2CG1A 4LZIA 3IJEB 3NBJA 4ORLA 1IVXA 3VSYA 4OVMA 3I553 4FMDA 1FGMA 1Y4KA 1K28A 1OH0A 3HIIA 2K0MA 4N6NB 5D83A 3MWZA 2XH9A 1M1XB 1NJI4 3X3XA 2KXGA 1M1K4 4HJLB 2XF3A 3LT8A 1SIIA 2XEPA 2CW9A 1KD14 1PFPA 3GZXB 1CYUA 1V74A 1OACA 3AMOA 3WOFB 5AEWB 1ULIB 1O7MB 3CCL3 1JB5A 7STDA 3FZWA 5KP1A 1E3VA 1YJ93 4MMXB 1W2ZA 1GD4A 1US1A 3FF2A 3HK4A 4KFDA 1C7HA 2E2TA 4WYKB 1WMNA 4G1MB 1DMQA 3EF8A 4XBXA 3G4S3 2BHMA 3KE7A 1YIT3 2L4VA 1FGOA 3FG4A 1GD3A 1YVBI 1GY7A 3MG2A 5LC6A 1JB2A 5D81A 4K1VA 5AIGA 1QAKA 4XB5A 1JNQA 2BT3A 1N8QA 1VQM3 4O02B 3CCQ3 4KZ1A 3OWSA 2E2UA 1STDA 3SLUA 3S29A 5JPUA 4HM1B 5AI1A 1A2KA 3G713 2BMRB 3CCJ3 2CWUA 3LXUX 2V1LA 4XM4A 3S67A 3PXMA 4I4KA 5AIHA 5KP3A 3D9RA 2B1XB 4O8SA 3E99A 4X2HA 3WA2X 2GU3A 3CCS3 1YI23 1Q824 3STDA 4MEIA 2CIUA 2W9PA 5IEPA 1IT8A 4RNZA 5CF2A 1S723 5DRVA 5LC7A 1SJWA 2UX0A 4RNYA 5STDA 1VQK3 3CPOA 1FUWA 2M7OA 5FW5A 5BXQA 8CHOA 1JB4A 1OF5A 4FCZA 5AEUB 1ZX2A 2BMQB 4K61A 4MJDA 3JUPA 2I9WA 1QVF2 4BTXA 1LVNA 3GZYB 2ML6A 5IG5A 3EB8A 4BTYA 2BNGA 2Y74A 2ZDJA 3EQQB 1VQ83 3H51A 4K1UA 2HMJB 1M904 1ZO2A 2D1WA 4HM7B 3CC43 1NO3A 1DVDA 2D42A 3FG1A 3KKGA 4CCVA 2QEX3 2C11A 3I563 1NB5I 3JUOA 3CME3 4J9AA 2RGQA 1QJGA 1VQ73 2GXFA 2O9UX 3KIIA 4HM3B 1JRQA 1RRLA 2OQEC 3K9MC 3B8LA 4HZ9B 2LYXA 3F8HA 3QRDA 3FH1A 1HU9A 3DUKA 1K8A4 1VQ43 4J8TA 3PCRA 3T0UA 4EYCA 3NBBA 1W00A 1VZZA 2XGLA 2E2VA 2INXA 2YFLB 3NV0A 1IV9A 1O7HB 1UI8A 1FGRA 3A76A 3SOYA 1QALA 2CHCA 1W2B2 2GEXA 2LQVA 1WQLB 1M9GA 1STFI 1DYUA 1YGEA 4L7KA 4QWTA 5IF6A 3GWRA 4STDA 1GS3A 2W2CA 3EHCA 5EEOA 2WGOA 5BVBA 4MMYB 2WO0A 1F8NA 4HM5B 2HMOB 1GYBA 3BNEA 2CG0A 4H61A 5CF1A 3F7XA 4AKZA 1WTHA 1D6ZA 1ISKA 1EG9B 4GL6A 2CWTA 3V92A 3JUMA 3V99A 5ELJA 4HVNA 4RZMA 2OTJ3 3EE1A 4N6OB 1CEWI 3NM7A 3GZBA 4U13A 1KC84 3K7CA 3CCU3 4IIAA 1Q40A 3CC23 1IV7A 4FMBA 3CU3A 1NDOB 1YJN3 5FGOA 2IUJA 1RKYA 2CFDA 1W7CA 1PU4A 1W5ZA 3BLZA 3S5CA 3K0ZA 3J7Yd 2B24B 3BNDA 3ER7A 3LTCA 3X41A 5G2GA 5IEOA 2W6JH 3WA3A 4AEQA 1K9M4 1SQWA 3H3HA 4PEJA 2YX9A 3WODG 3DGOA 1Q814 5HGRA 1NU3A 1A67A 4HM0B 1HKXA 1E97A 3X3YA 1JKGA 3D3LA 4FMCA 4XDVA 1KSIA 1LNHA 3OXAA 1QAFA 2W56B 1VQ93 4HZBB 3OW22 3HX8A 3UNLA 5CLKA 4EV2A 1VQL3 3FCSB 1CYVA 1W6CA 3EC9A 3MHEA 1TUHA 5EVHA 2Z7AA 2OTL3 4OK0A 2OWPA 2PNCA 1UUWB 3UB1A 4ZM8A 2W0QA 3ALAA 3TDGA 2BO9B 1T5YA 4L8OA 3MPHA 3CNXA 3GZRA 3I0YA 1KQS2 3LH4A 1JN5B 5EQLA 3ROBA 3WDGB 1EQKA 1W4NA 3SOAA 2WGQA 3OWUA 5AIFA 3FG3A 1JV2B 2OCTA 3ECFA 3OV4A 3QK9A 2OOVA 3RGRA 2CC3A 4XBTA 3NV0B 2QIYA 3RGAA 4CDLA 2QGUA 2P0XA 1IVVA 2OQEA 4NREA 1D6UA 3LTBA 1EKMA 3WOEB 4WYKA 4LEHA 3LT9A 2Z6BA 2F86B 1N8R4 5D82A 3WMDA 3JUNA 1MNLA 1IT7A 3HI7A 2P09A 2Q07A 1W02A 2OOVC 3CCR3 3IMAB 3U97A 1AVKA 1YJW3 2W9QA 3EX9A 1G96A 3KN4A 2XSHB 3DM8A 3B4OA 3F7SA 3LYGA 4R1KA 3UJMA 2FNQA 4EC6A 5I97A 5IW9A 2FXTA 1Z1SA 4IPBA 4FCMA 2RCDA 1E3RA 3PYJA 4L8PA 1EA2A 3BB9A 3X42A 5DREA 3X40A 1QMAA 3AMOB 4R4KA 2XFSA 3CPW2 1IK3A 2QA43 3CD63 1FA3A 1VQ63 3LOYA 4HBRA 3NUVA 1S5AA 1VQ53 5IG3A 1W6GA 5TGNA 1RRHA 2SBLA 3KFQC 3X3ZA 1O7GB 2XR8B 4HKVB 2GEYA 2XGNA 1GY6A 1SIHA 2CWVA 3MYTA 1OUNA 1TIJA 2CH9A 3HZPA 2PZVA 2XFTA 3SXXA 4RBNA 5JBSA 3DZLA 2CFLA 2GBWB 3EBTA 1TU5A 2P05A 2GU1A 3EN1B 2W04A 3EBYA 5IG0A 2HMLB 1N9EA 1K734 3N54B 3V98A 1UI7A 1OGZA 1AVLA 2O3OA 1NWWA 1U5OA 1AV4A 3CC73 2CFKA 4Q53A 3O8YA 1NB3I 1ASKA 1OCVA 2Z77A 1LOXA 2HMNB 2RFRA 2CFGA 3MKIA 4O3VA 3N9HA 3M8CA 1TFOA 4HM4B 1ULJB 1IQXA 2XRXB 3VGNA 1WNHA 2IUKA 5ELUA 1DMNA 3F14A 3NHXA 4FR9A 4HYZA 3EN8A 1IQ8A 3CMA3 2FGTA 4H3UA 1QVG2 1IDPA 1ROAA 5CK6A 3T8UA 4EV5A 1OHPA 3SX1A 6STDA 3PGBA 3IPTA 1RN7A 3U1WA 3DGNA 4HM8B 3BNCA 2CKFB 1KWIA 1CQSA 3BNBA 1OF5B 4WWUC 5AYSC 4NHFA 3CCV3 4LSOA 1A2VA 2CFWA 5AIIA 1O7NB 4N6MA 2KRTA 3Q1CA 3EJVA 3G16A 3F9SA 1YHQ3 1WMOA 3MSOA 3K63A 1OGXA 3MG1A 3SEDA 1A90A 3DY5A 3Q2PA 4LMIA 1J2BA 1OPYA 2CK3H 2KCDA 1W6YA 1N5PA 3NQYA 1R4CA 1ROVA 3NQZA 2XSOB 3B7CA 3UL5A 2RSXA 1U8CB 3NXJA 2A15A 3Q90A 1TP6A 4HM2B 1L5GB 1Q42A 3LTAA 3FGYA 3DXOA 4AKYA 3PS8A 4EXRA 3CCM3 1BUQA 1Q864 3VF1A 2GBXB 2YFIB 2IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCJ A;  3OX9 A;  2R4I A;  5IEN A;  2F99 A;  4GB5 A;  1GY5 A;  2HMK B;  4R9K A;  1DMM A;  3FSD A;  1W01 A;  3JUQ A;  3B4P A;  3DMC A;  4OUQ A;  5IER A;  3FF0 A;  3FLJ A;  3F40 A;  2BMO B;  3G8Z A;  1O7P B;  4XDW A;  2HMM B;  4LGQ A;  3FKA A;  1K41 A;  3MG3 A;  2JQ5 A;  4HM6 B;  4KVH A;  3NM2 A;  3OWY A;  1Q40 B;  4XBY A;  3KSP A;  2YFJ B;  4WP5 A;  3GRD A;  2Z76 A;  1JN5 A;  3LZA A;  3F8X A;  3G0K A;  5CXO A;  4N3V A;  1UUV B;  3CNM A;  3T8N A;  2IMJ A;  2STD A;  3KZT A;  3NBR A;  1AR0 A;  2K54 A;  1OHO A;  1OHS A;  4X2O A;  4R9L A;  1JKG B;  1O7W B;  5IG4 A;  5KP4 A;  2F98 A;  5JPP A;  4ORL A;  3VSY A;  4OVM A;  1OH0 A;  5D83 A;  4HJL B;  3GZX B;  5AEW B;  1ULI B;  1O7M B;  1JB5 A;  7STD A;  3FZW A;  5KP1 A;  1E3V A;  3FF2 A;  3HK4 A;  1C7H A;  4WYK B;  1DMQ A;  3EF8 A;  4XBX A;  3KE7 A;  3MG2 A;  1GY7 A;  1JB2 A;  5D81 A;  4K1V A;  5AIG A;  4XB5 A;  3OWS A;  1STD A;  5JPU A;  4HM1 B;  5AI1 A;  1A2K A;  2BMR B;  4XM4 A;  4I4K A;  5AIH A;  5KP3 A;  3D9R A;  2B1X B;  4X2H A;  3E99 A;  3STD A;  5IEP A;  5CF2 A;  5DRV A;  1SJW A;  2UX0 A;  5STD A;  3CPO A;  5FW5 A;  5BXQ A;  8CHO A;  1JB4 A;  1OF5 A;  5AEU B;  1ZX2 A;  2BMQ B;  4MJD A;  3JUP A;  2I9W A;  3GZY B;  5IG5 A;  2BNG A;  3EQQ B;  3H51 A;  4K1U A;  2HMJ B;  1ZO2 A;  4HM7 B;  3KKG A;  3JUO A;  4J9A A;  2RGQ A;  1QJG A;  2GXF A;  4HM3 B;  3B8L A;  4HZ9 B;  3F8H A;  3FH1 A;  3DUK A;  4J8T A;  1W00 A;  1VZZ A;  2INX A;  2YFL B;  3NV0 A;  1O7H B;  3A76 A;  3SOY A;  2CHC A;  2GEX A;  1WQL B;  4L7K A;  5IF6 A;  3GWR A;  4STD A;  1GS3 A;  2W2C A;  3EHC A;  5BVB A;  4HM5 B;  2HMO B;  1GYB A;  5CF1 A;  3F7X A;  1ISK A;  1EG9 B;  3JUM A;  4HVN A;  4RZM A;  3GZB A;  4U13 A;  4IIA A;  1Q40 A;  3CU3 A;  1NDO B;  3BLZ A;  3S5C A;  3K0Z A;  2B24 B;  3ER7 A;  5G2G A;  5IEO A;  3H3H A;  4PEJ A;  5HGR A;  1NU3 A;  4HM0 B;  1HKX A;  1E97 A;  1JKG A;  4XDV A;  3OXA A;  4HZB B;  3HX8 A;  3UNL A;  5CLK A;  3MHE A;  3EC9 A;  1TUH A;  5EVH A;  2Z7A A;  2OWP A;  1UUW B;  4L8O A;  3CNX A;  3GZR A;  3I0Y A;  1JN5 B;  3ROB A;  3SOA A;  3OWU A;  5AIF A;  3OV4 A;  3ECF A;  3RGR A;  4XBT A;  3NV0 B;  2QIY A;  3RGA A;  4CDL A;  2QGU A;  4WYK A;  4LEH A;  2F86 B;  5D82 A;  3WMD A;  3JUN A;  1W02 A;  4WWU C;  3UJM A;  3EX9 A;  2XSH B;  3DM8 A;  3B4O A;  3F7S A;  3LYG A;  4R1K A;  1Z1S A;  4FCM A;  2RCD A;  1E3R A;  4L8P A;  1EA2 A;  3BB9 A;  5DRE A;  1QMA A;  3NUV A;  1S5A A;  5IG3 A;  5TGN A;  1O7G B;  2XR8 B;  4HKV B;  2GEY A;  1GY6 A;  3MYT A;  1OUN A;  3HZP A;  2PZV A;  3DZL A;  2GBW B;  3EBT A;  3EN1 B;  3EBY A;  5IG0 A;  2HML B;  1OGZ A;  1NWW A;  1U5O A;  4Q53 A;  1ASK A;  1OCV A;  2Z77 A;  2HMN B;  2RFR A;  3MKI A;  3M8C A;  4HM4 B;  1ULJ B;  2XRX B;  3VGN A;  1DMN A;  3F14 A;  3NHX A;  3EN8 A;  4H3U A;  1IDP A;  3T8U A;  5CK6 A;  1OHP A;  6STD A;  3IPT A;  4HM8 B;  2CKF B;  1CQS A;  1OF5 B;  2GBX B;  5AII A;  1O7N B;  3EJV A;  3G16 A;  3F9S A;  3MSO A;  1OGX A;  3MG1 A;  3SED A;  4LMI A;  1OPY A;  1W6Y A;  2XSO B;  3B7C A;  3NXJ A;  2A15 A;  3Q90 A;  1TP6 A;  4HM2 B;  1Q42 A;  3FGY A;  3DXO A;  1BUQ A;  3K7C A;  2YFI B; 
#chains in the Genus database with same CATH topology
 1BSC A;  4FCJ A;  1WMP A;  1VQP 3;  1LQM B;  1RMS A;  1I3F A;  4WFO A;  1TFK A;  3UL6 A;  4N6U A;  1Q7Y 4;  3OX9 A;  2R4I A;  2P38 A;  2F56 A;  1N5H A;  1SAR A;  1BUJ A;  5IEN A;  1IVW A;  1IU7 A;  3CCE 3;  2F99 A;  4GB5 A;  1GY5 A;  2Y73 A;  2HMK B;  4N6V 0;  4R9K A;  1DMM A;  3FSD A;  2WOF A;  3G6E 3;  4KFE A;  3LML A;  1IYY A;  1RJO A;  1W01 A;  4CPK A;  3SYU A;  3JUQ A;  3PCS A;  1RGL A;  4MMZ B;  3B4P A;  1EUI C;  1VQN 3;  3DMC A;  4OUQ A;  2JDI H;  1SPU A;  1GOY A;  5IER A;  1T3B A;  1BSB A;  3FF0 A;  4N6L A;  1X1X A;  3AGN A;  3JVC A;  1GOU A;  3FLJ A;  3F40 A;  3L0R A;  4GSP A;  2P0M A;  2BMO B;  3G8Z A;  2C10 A;  2WOH A;  4BU4 A;  1O7P B;  3K5T A;  4XDW A;  1RHL A;  1MGR A;  2HMM B;  3DGY A;  4LGQ A;  4BTW A;  1BVI A;  4R80 A;  3S27 A;  1D6Y A;  3FKA A;  1LRA A;  3D5I A;  2W56 A;  3CXC 2;  1K41 A;  2MF7 A;  3MG3 A;  5AYR B;  1UCK A;  2JQ5 A;  4HM6 B;  4KVH A;  1MWS A;  3DGM A;  3HIG A;  3NM2 A;  1RDS A;  3NX0 A;  4JRF A;  5M19 A;  1YIJ 3;  1IQY A;  2RBI A;  3OWY A;  3ZG5 A;  1Q40 B;  4XBY A;  3N8B A;  3KSP A;  4IT7 A;  2YFJ B;  1I2F A;  1BNR A;  4TX4 A;  4WP5 A;  1UW1 A;  3BIR A;  2Z76 A;  3GRD A;  1LXE A;  3S28 A;  4K90 B;  5A0O B;  1DE3 A;  1RGE A;  2ZL8 A;  3KSE D;  1JN5 A;  3DGL A;  3LZA A;  1MOL A;  4N6T A;  4WHA A;  1B2S A;  3F8X A;  4FMA A;  1PY3 A;  1YVS A;  3G0K A;  1BNF A;  5CXO A;  4N3V A;  1UUV B;  3CNM A;  2KF4 A;  4O2H A;  2IMJ A;  2STD A;  3KZT A;  2H0I A;  3T8N A;  3NBR A;  1AR0 A;  1DVC A;  1VQO 3;  4KT3 B;  1B2U A;  1N9J A;  2K54 A;  4EBG A;  1BRH A;  1OHO A;  1OHS A;  1GMQ A;  4JF8 A;  3PZW A;  2MC8 A;  2W03 A;  1JJ2 2;  1AY7 A;  4KFF A;  2ML5 A;  4X2O A;  1MWR A;  3LTD A;  4RNT A;  3GAX A;  1FGT A;  1IVU A;  4R9L A;  3SVA A;  1JKG B;  1O7W B;  1BNG A;  3RDE A;  5IG4 A;  5KP4 A;  1RN4 A;  1RNB A;  1MWU A;  2F98 A;  5JPP A;  1FGQ A;  2CG1 A;  4LZI A;  3IJE B;  3NBJ A;  4ORL A;  1IVX A;  3VSY A;  4OVM A;  4EW5 A;  4FMD A;  3I55 3;  1FGM A;  1Y4K A;  1K28 A;  1OH0 A;  3HII A;  2K0M A;  2F4Y A;  4N6N B;  1DET A;  5D83 A;  3MWZ A;  2XH9 A;  1M1X B;  1NJI 4;  1BNE A;  2KXG A;  3X3X A;  1M1K 4;  1MGW A;  4HJL B;  2XF3 A;  3LT8 A;  1SII A;  2XEP A;  4HOH A;  2CW9 A;  1KD1 4;  1PFP A;  3GZX B;  1CYU A;  1V74 A;  1OAC A;  2H0H A;  3AMO A;  3WOF B;  5AEW B;  1ULI B;  1O7M B;  3CCL 3;  1JB5 A;  2AAD A;  7STD A;  3FZW A;  5KP1 A;  1E3V A;  1YJ9 3;  3BU4 A;  4MMX B;  1BAN A;  1Q7H A;  1W2Z A;  1GD4 A;  1US1 A;  1FUT A;  4BIR A;  3FF2 A;  3HK4 A;  4KFD A;  1C7H A;  2E2T A;  1RGC A;  4WYK B;  1WMN A;  4G1M B;  1DMQ A;  1GSP A;  2J8X B;  3EF8 A;  4XBX A;  3G4S 3;  2BHM A;  1BRJ A;  3KE7 A;  1YIT 3;  2L4V A;  1FGO A;  3FG4 A;  1GD3 A;  1YVB I;  1GY7 A;  3MG2 A;  5HOH A;  1EEJ A;  5LC6 A;  1JB2 A;  5D81 A;  4K1V A;  5AIG A;  1QAK A;  4XB5 A;  1JNQ A;  2BT3 A;  2ZHX B;  1N8Q A;  1VQM 3;  4O02 B;  3CCQ 3;  2C4B A;  4KZ1 A;  1MWT A;  3OWS A;  2E2U A;  1B2Z A;  1STD A;  3SLU A;  3S29 A;  5JPU A;  4HM1 B;  5AI1 A;  1A2K A;  3G71 3;  2BMR B;  3CCJ 3;  2CWU A;  1JZD A;  3LXU X;  1X1Y A;  2V1L A;  4XM4 A;  3S67 A;  3PXM A;  4I4K A;  5AIH A;  5KP3 A;  1YGW A;  3AHS A;  3D9R A;  2B1X B;  4O8S A;  3E99 A;  4X2H A;  3WA2 X;  1BSA A;  2GU3 A;  3CCS 3;  1YI2 3;  3STD A;  1UDI I;  4MEI A;  5BU4 A;  1Q82 4;  1B2M A;  2CIU A;  2W9P A;  5IEP A;  1IT8 A;  4RNZ A;  5CF2 A;  1S72 3;  5DRV A;  5LC7 A;  1SJW A;  2UX0 A;  1T2I A;  4RNY A;  5STD A;  1VQK 3;  3CPO A;  1CH0 A;  1FUW A;  2M7O A;  1BNI A;  5FW5 A;  5BXQ A;  8CHO A;  1JB4 A;  1OF5 A;  3A5E A;  4FCZ A;  4CJN A;  5AEU B;  1I2G A;  1ZX2 A;  2BMQ B;  4K61 A;  4MJD A;  3JUP A;  1RGF A;  2I9W A;  1QVF 2;  4BTX A;  1LVN A;  1NNV A;  2ML6 A;  3GZY B;  3EB8 A;  5IG5 A;  4BTY A;  2BNG A;  2Y74 A;  2ZDJ A;  3EQQ B;  1VQ8 3;  3H51 A;  4K1U A;  2HMJ B;  1M90 4;  1ZO2 A;  2D1W A;  4HM7 B;  3CC4 3;  3HOH A;  1NO3 A;  1T2H A;  1DVD A;  2D42 A;  3FG1 A;  3KKG A;  4CCV A;  2QEX 3;  2C11 A;  3I56 3;  1G0T A;  2L1S A;  1NB5 I;  3JUO A;  3CME 3;  4J9A A;  2RGQ A;  1QJG A;  1VQ7 3;  1TRP A;  1ZGX A;  1X1U A;  2GXF A;  2O9U X;  3KII A;  4HM3 B;  1BU4 A;  1JRQ A;  1RRL A;  2OQE C;  1RN1 A;  2IY2 A;  3K9M C;  3B8L A;  4HZ9 B;  2LYX A;  2CX1 A;  3F8H A;  3QRD A;  3FH1 A;  1HU9 A;  3DUK A;  1HZ1 A;  2KAA A;  1K8A 4;  1VQ4 3;  4LYL B;  4J8T A;  3PCR A;  3T0U A;  1RGH A;  4EYC A;  3NBB A;  1W00 A;  1VZZ A;  1A2P A;  2XGL A;  2E2V A;  2INX A;  3D4A A;  2YFL B;  3NV0 A;  1IV9 A;  1O7H B;  1UI8 A;  7RNT A;  1FGR A;  3A76 A;  3SOY A;  1LOV A;  1I70 A;  1QAL A;  2CHC A;  1W2B 2;  2GEX A;  2SAR A;  2LQV A;  1UUG B;  4NPB A;  1WQL B;  1M9G A;  1STF I;  1DYU A;  1YGE A;  4L7K A;  4QWT A;  5IF6 A;  3GWR A;  4STD A;  1GS3 A;  2W2C A;  1PYL A;  1RNT A;  3EHC A;  5EEO A;  1GMP A;  2WGO A;  1G02 A;  1B20 A;  5BVB A;  4MMY B;  1F8N A;  2WO0 A;  4HM5 B;  2HMO B;  9RNT A;  1GYB A;  1Q9E A;  3BNE A;  2CG0 A;  4H61 A;  5CF1 A;  3WHO A;  3D79 A;  3F7X A;  4AKZ A;  2H0G A;  1WTH A;  1D6Z A;  1RCL A;  2HOH A;  1BRN L;  1ISK A;  1EG9 B;  4GL6 A;  2CWT A;  3V92 A;  3JUM A;  3Q3F A;  5ELJ A;  4HVN A;  1UCJ A;  3V99 A;  1RTU A;  1LNI A;  2CX0 A;  4RZM A;  2OTJ 3;  3EE1 A;  4N6O B;  1CEW I;  4BL3 A;  1JBS A;  1FZU A;  2UGI A;  3NM7 A;  3GZB A;  4U13 A;  1X1W A;  1KC8 4;  3K7C A;  3CCU 3;  3D5G A;  4IIA A;  1Q40 A;  3CC2 3;  1C54 A;  1IV7 A;  4FMB A;  3CU3 A;  1FYS A;  1NDO B;  1YJN 3;  5FGO A;  2IUJ A;  1JBR A;  2IYJ A;  3ZG0 A;  1RKY A;  2CFD A;  1W7C A;  1PU4 A;  1W5Z A;  3BLZ A;  3S5C A;  2R41 A;  1UCL A;  3K0Z A;  3URP A;  3J7Y d;  2B24 B;  3BND A;  3ER7 A;  3LTC A;  3X41 A;  5G2G A;  5IEO A;  2W6J H;  3WA3 A;  6GSP A;  4AEQ A;  1K9M 4;  1SQW A;  3H3H A;  4PEJ A;  2YX9 A;  2KF3 A;  3WOD G;  3DGO A;  1Q81 4;  1I3I A;  1NU3 A;  1UGH I;  1TJD A;  4HM0 B;  5HGR A;  1GOV A;  1HKX A;  1A67 A;  1E97 A;  3X3Y A;  1JKG A;  3D3L A;  4FMC A;  4XDV A;  1KSI A;  1LNH A;  3AHW A;  3OXA A;  1QAF A;  1RCK A;  2W56 B;  5GSP A;  1VQ9 3;  4HZB B;  3OW2 2;  3HX8 A;  3UNL A;  5CLK A;  4EV2 A;  1RGA A;  3FCS B;  1VQL 3;  1CYV A;  1W6C A;  3EC9 A;  3MHE A;  1TUH A;  5EVH A;  2Z7A A;  2OTL 3;  4OK0 A;  1BNJ A;  2OWP A;  2PNC A;  1UUW B;  3UB1 A;  4ZM8 A;  2W0Q A;  3ALA A;  3TDG A;  2BO9 B;  1T5Y A;  4L8O A;  3MPH A;  3CNX A;  3GZR A;  3I0Y A;  1V57 A;  2RNT A;  1KQS 2;  1BOX A;  3LH4 A;  1JN5 B;  5EQL A;  2BU4 A;  3ROB A;  3WDG B;  1EQK A;  1JZO A;  2ZA4 A;  1BIR A;  1W4N A;  3SOA A;  1VQQ A;  2WGQ A;  3OWU A;  5AIF A;  3FG3 A;  1JBT A;  1JV2 B;  2OCT A;  3ECF A;  3OV4 A;  3QK9 A;  2OOV A;  3RGR A;  2CC3 A;  4XBT A;  3NV0 B;  1B2X A;  2QIY A;  3RGA A;  1UCI A;  4CDL A;  1BRG A;  1TTO A;  1LOY A;  2QGU A;  2P0X A;  1IVV A;  2OQE A;  4NRE A;  5BIR A;  1D6U A;  3LTB A;  1EKM A;  3WOE B;  1B27 A;  4WYK A;  4LEH A;  3LT9 A;  3RNT A;  2Z6B A;  4I5Q A;  3AGO A;  2F86 B;  2GSP A;  1N8R 4;  5D82 A;  3WMD A;  3JUN A;  2AAE A;  1IT7 A;  1MNL A;  3HI7 A;  1BRK A;  2P09 A;  2Q07 A;  2OOV C;  3CCR 3;  3IMA B;  5RNT A;  3U97 A;  1AVK A;  1YJW 3;  1HYF A;  4J5K A;  4ILF A;  2W9Q A;  3EX9 A;  1G96 A;  3KN4 A;  2F5M A;  2XSH B;  3B4O A;  3DM8 A;  3F7S A;  3LYG A;  4R1K A;  2FNQ A;  4EC6 A;  5I97 A;  5IW9 A;  2FXT A;  1Z1S A;  1RSN A;  4FCM A;  4IPB A;  5G1K A;  2RCD A;  1E3R A;  3PYJ A;  1BGS A;  4L8P A;  1EA2 A;  3BB9 A;  3X42 A;  5DRE A;  3X40 A;  1QMA A;  3AMO B;  4HAA A;  1GMR A;  1V58 A;  4R4K A;  1FW7 A;  2XFS A;  3CPW 2;  1IK3 A;  3KCH A;  2QA4 3;  3CD6 3;  1FUS A;  1FA3 A;  1VQ6 3;  3LOY A;  4HBR A;  3NUV A;  1S5A A;  4J5G A;  4BL2 A;  5IG3 A;  1W6G A;  1VQ5 3;  5TGN A;  1RRH A;  2SBL A;  3KFQ C;  3X3Z A;  1O7G B;  1TRQ A;  2XR8 B;  4HKV B;  2GEY A;  2XGN A;  1GY6 A;  1I0V A;  1SIH A;  2CWV A;  3MYT A;  1OUN A;  1TIJ A;  1BAO A;  2CH9 A;  3HZP A;  2PZV A;  2XFT A;  3SXX A;  3GSP A;  4RBN A;  5JBS A;  3DZL A;  7GSP A;  2CFL A;  2GBW B;  3EBT A;  1TU5 A;  2P05 A;  6RNT A;  2GU1 A;  3EN1 B;  3UJM A;  2W04 A;  3EBY A;  5IG0 A;  2HML B;  1N9E A;  1K73 4;  3N54 B;  3V98 A;  1UI7 A;  1OGZ A;  1AVL A;  2O3O A;  1BSD A;  1NWW A;  1U5O A;  1LQG C;  1AV4 A;  4GHO A;  3WR2 A;  3CC7 3;  2CFK A;  4Q53 A;  3O8Y A;  1NB3 I;  1ASK A;  1OCV A;  8RNT A;  2Z77 A;  1LOX A;  2HMN B;  1RLS A;  1ZS7 A;  2RFR A;  2CFG A;  3MKI A;  4O3V A;  3N9H A;  3M8C A;  1TFO A;  1I2E A;  4HM4 B;  1ULJ B;  1IQX A;  2XRX B;  3VGN A;  1WNH A;  2IUK A;  5ELU A;  1DMN A;  3F14 A;  3NHX A;  4FR9 A;  4HYZ A;  1I0X A;  1BNS A;  1IQ8 A;  3EN8 A;  3CMA 3;  1RGG A;  2K3D A;  2BIR A;  4DKI A;  2FGT A;  4H3U A;  1QVG 2;  1IDP A;  1ROA A;  5CK6 A;  1UGI A;  3T8U A;  4EV5 A;  2KF5 A;  1OHP A;  3DH2 A;  3SX1 A;  6STD A;  3PGB A;  3IPT A;  1RN7 A;  3U1W A;  3DGN A;  4HM8 B;  1RGK A;  3BNC A;  5M18 A;  1R4Y A;  2CKF B;  1KWI A;  1CQS A;  3BNB A;  1OF5 B;  4WWU C;  5AYS C;  1LOW A;  4NHF A;  1I8V A;  2GBX B;  1B3S A;  3CCV 3;  2KF6 A;  4LSO A;  1YNV X;  1A2V A;  2CFW A;  5AII A;  1O7N B;  4N6M A;  1BRS A;  2KRT A;  3Q1C A;  3EJV A;  3G16 A;  3F9S A;  1YHQ 3;  1WMO A;  3MSO A;  3K63 A;  1OGX A;  1BSE A;  3MG1 A;  5M1A A;  3SED A;  3DY5 A;  1A90 A;  3Q2P A;  4LMI A;  1J2B A;  1OPY A;  2CK3 H;  2F5W A;  2KCD A;  1W6Y A;  1N5P A;  3NQY A;  1R4C A;  1ROV A;  3NQZ A;  1B21 A;  2XSO B;  3B7C A;  3UL5 A;  2RSX A;  1U8C B;  3NXJ A;  2A15 A;  3Q90 A;  1TP6 A;  4HM2 B;  1L5G B;  2UUG C;  5G1L A;  1Q42 A;  3LTA A;  3FGY A;  3DXO A;  4AKY A;  1BRI A;  3PS8 A;  3ZFZ A;  4EXR A;  3CCM 3;  1BUQ A;  1Q86 4;  1AQZ A;  3VF1 A;  1W02 A;  2YFI B;  2IA7 A; 
#chains in the Genus database with same CATH homology
 4FCJ A;  1WMP A;  1VQP 3;  4WFO A;  1TFK A;  3UL6 A;  4N6U A;  1Q7Y 4;  3OX9 A;  2R4I A;  2P38 A;  1N5H A;  5IEN A;  1IVW A;  1IU7 A;  3CCE 3;  2F99 A;  4GB5 A;  1GY5 A;  2Y73 A;  2HMK B;  4N6V 0;  4R9K A;  1DMM A;  3FSD A;  2WOF A;  3G6E 3;  4KFE A;  3LML A;  1RJO A;  1W01 A;  3JUQ A;  3PCS A;  4MMZ B;  3B4P A;  1VQN 3;  3DMC A;  4OUQ A;  2JDI H;  1SPU A;  5IER A;  3FF0 A;  4N6L A;  3JVC A;  3FLJ A;  3F40 A;  3L0R A;  2P0M A;  2BMO B;  3G8Z A;  2C10 A;  2WOH A;  1O7P B;  3K5T A;  4XDW A;  2HMM B;  4LGQ A;  4BTW A;  4R80 A;  3S27 A;  1D6Y A;  3FKA A;  2W56 A;  3CXC 2;  1K41 A;  2MF7 A;  3MG3 A;  5AYR B;  2JQ5 A;  4HM6 B;  4KVH A;  3DGM A;  3HIG A;  3NM2 A;  3NX0 A;  1YIJ 3;  4JRF A;  1IQY A;  3OWY A;  1Q40 B;  4XBY A;  3N8B A;  3KSP A;  4IT7 A;  2YFJ B;  4TX4 A;  4WP5 A;  1UW1 A;  3GRD A;  2Z76 A;  3S28 A;  1LXE A;  4K90 B;  5A0O B;  2ZL8 A;  3KSE D;  1JN5 A;  3DGL A;  3LZA A;  1MOL A;  4N6T A;  4WHA A;  3F8X A;  4FMA A;  3G0K A;  5CXO A;  4N3V A;  1UUV B;  3CNM A;  4O2H A;  3T8N A;  2IMJ A;  2STD A;  3KZT A;  3NBR A;  1AR0 A;  1DVC A;  1VQO 3;  4EBG A;  1N9J A;  2K54 A;  1OHO A;  1OHS A;  4JF8 A;  3PZW A;  2MC8 A;  2W03 A;  1JJ2 2;  4KFF A;  2ML5 A;  4X2O A;  3LTD A;  3GAX A;  1FGT A;  1IVU A;  4R9L A;  3SVA A;  1JKG B;  1O7W B;  3RDE A;  5IG4 A;  5KP4 A;  2F98 A;  5JPP A;  1FGQ A;  2CG1 A;  4LZI A;  3IJE B;  3NBJ A;  4ORL A;  1IVX A;  3VSY A;  4OVM A;  3I55 3;  4FMD A;  1FGM A;  1Y4K A;  1K28 A;  1OH0 A;  3HII A;  2K0M A;  4N6N B;  5D83 A;  3MWZ A;  2XH9 A;  1M1X B;  1NJI 4;  3X3X A;  2KXG A;  1M1K 4;  4HJL B;  2XF3 A;  3LT8 A;  1SII A;  2XEP A;  2CW9 A;  1KD1 4;  1PFP A;  3GZX B;  1CYU A;  1V74 A;  1OAC A;  3AMO A;  3WOF B;  5AEW B;  1ULI B;  1O7M B;  3CCL 3;  1JB5 A;  7STD A;  3FZW A;  5KP1 A;  1E3V A;  1YJ9 3;  4MMX B;  1W2Z A;  1GD4 A;  1US1 A;  3FF2 A;  3HK4 A;  4KFD A;  1C7H A;  2E2T A;  4WYK B;  1WMN A;  4G1M B;  1DMQ A;  3EF8 A;  4XBX A;  3G4S 3;  2BHM A;  3KE7 A;  1YIT 3;  2L4V A;  1FGO A;  3FG4 A;  1GD3 A;  1YVB I;  1GY7 A;  3MG2 A;  5LC6 A;  1JB2 A;  5D81 A;  4K1V A;  5AIG A;  1QAK A;  4XB5 A;  1JNQ A;  2BT3 A;  1N8Q A;  1VQM 3;  4O02 B;  3CCQ 3;  4KZ1 A;  3OWS A;  2E2U A;  1STD A;  3SLU A;  3S29 A;  5JPU A;  4HM1 B;  5AI1 A;  1A2K A;  3G71 3;  2BMR B;  3CCJ 3;  2CWU A;  3LXU X;  2V1L A;  4XM4 A;  3S67 A;  3PXM A;  4I4K A;  5AIH A;  5KP3 A;  3D9R A;  2B1X B;  4O8S A;  3E99 A;  4X2H A;  3WA2 X;  2GU3 A;  3CCS 3;  1YI2 3;  1Q82 4;  3STD A;  4MEI A;  2CIU A;  2W9P A;  5IEP A;  1IT8 A;  4RNZ A;  5CF2 A;  1S72 3;  5DRV A;  5LC7 A;  1SJW A;  2UX0 A;  4RNY A;  5STD A;  1VQK 3;  3CPO A;  1FUW A;  2M7O A;  5FW5 A;  5BXQ A;  8CHO A;  1JB4 A;  1OF5 A;  4FCZ A;  5AEU B;  1ZX2 A;  2BMQ B;  4K61 A;  4MJD A;  3JUP A;  2I9W A;  1QVF 2;  4BTX A;  1LVN A;  3GZY B;  2ML6 A;  5IG5 A;  3EB8 A;  4BTY A;  2BNG A;  2Y74 A;  2ZDJ A;  3EQQ B;  1VQ8 3;  3H51 A;  4K1U A;  2HMJ B;  1M90 4;  1ZO2 A;  2D1W A;  4HM7 B;  3CC4 3;  1NO3 A;  1DVD A;  2D42 A;  3FG1 A;  3KKG A;  4CCV A;  2QEX 3;  2C11 A;  3I56 3;  1NB5 I;  3JUO A;  3CME 3;  4J9A A;  2RGQ A;  1QJG A;  1VQ7 3;  2GXF A;  2O9U X;  3KII A;  4HM3 B;  1JRQ A;  1RRL A;  2OQE C;  3K9M C;  3B8L A;  4HZ9 B;  2LYX A;  3F8H A;  3QRD A;  3FH1 A;  1HU9 A;  3DUK A;  1K8A 4;  1VQ4 3;  4J8T A;  3PCR A;  3T0U A;  4EYC A;  3NBB A;  1W00 A;  1VZZ A;  2XGL A;  2E2V A;  2INX A;  2YFL B;  3NV0 A;  1IV9 A;  1O7H B;  1UI8 A;  1FGR A;  3A76 A;  3SOY A;  1QAL A;  2CHC A;  1W2B 2;  2GEX A;  2LQV A;  1WQL B;  1M9G A;  1STF I;  1DYU A;  1YGE A;  4L7K A;  4QWT A;  5IF6 A;  3GWR A;  4STD A;  1GS3 A;  2W2C A;  3EHC A;  5EEO A;  2WGO A;  5BVB A;  4MMY B;  2WO0 A;  1F8N A;  4HM5 B;  2HMO B;  1GYB A;  3BNE A;  2CG0 A;  4H61 A;  5CF1 A;  3F7X A;  4AKZ A;  1WTH A;  1D6Z A;  1ISK A;  1EG9 B;  4GL6 A;  2CWT A;  3V92 A;  3JUM A;  3V99 A;  5ELJ A;  4HVN A;  4RZM A;  2OTJ 3;  3EE1 A;  4N6O B;  1CEW I;  3NM7 A;  3GZB A;  4U13 A;  1KC8 4;  3K7C A;  3CCU 3;  4IIA A;  1Q40 A;  3CC2 3;  1IV7 A;  4FMB A;  3CU3 A;  1NDO B;  1YJN 3;  5FGO A;  2IUJ A;  1RKY A;  2CFD A;  1W7C A;  1PU4 A;  1W5Z A;  3BLZ A;  3S5C A;  3K0Z A;  3J7Y d;  2B24 B;  3BND A;  3ER7 A;  3LTC A;  3X41 A;  5G2G A;  5IEO A;  2W6J H;  3WA3 A;  4AEQ A;  1K9M 4;  1SQW A;  3H3H A;  4PEJ A;  2YX9 A;  3WOD G;  3DGO A;  1Q81 4;  5HGR A;  1NU3 A;  1A67 A;  4HM0 B;  1HKX A;  1E97 A;  3X3Y A;  1JKG A;  3D3L A;  4FMC A;  4XDV A;  1KSI A;  1LNH A;  3OXA A;  1QAF A;  2W56 B;  1VQ9 3;  4HZB B;  3OW2 2;  3HX8 A;  3UNL A;  5CLK A;  4EV2 A;  1VQL 3;  3FCS B;  1CYV A;  1W6C A;  3EC9 A;  3MHE A;  1TUH A;  5EVH A;  2Z7A A;  2OTL 3;  4OK0 A;  2OWP A;  2PNC A;  1UUW B;  3UB1 A;  4ZM8 A;  2W0Q A;  3ALA A;  3TDG A;  2BO9 B;  1T5Y A;  4L8O A;  3MPH A;  3CNX A;  3GZR A;  3I0Y A;  1KQS 2;  3LH4 A;  1JN5 B;  5EQL A;  3ROB A;  3WDG B;  1EQK A;  1W4N A;  3SOA A;  2WGQ A;  3OWU A;  5AIF A;  3FG3 A;  1JV2 B;  2OCT A;  3ECF A;  3OV4 A;  3QK9 A;  2OOV A;  3RGR A;  2CC3 A;  4XBT A;  3NV0 B;  2QIY A;  3RGA A;  4CDL A;  2QGU A;  2P0X A;  1IVV A;  2OQE A;  4NRE A;  1D6U A;  3LTB A;  1EKM A;  3WOE B;  4WYK A;  4LEH A;  3LT9 A;  2Z6B A;  2F86 B;  1N8R 4;  5D82 A;  3WMD A;  3JUN A;  1MNL A;  1IT7 A;  3HI7 A;  2P09 A;  2Q07 A;  1W02 A;  2OOV C;  3CCR 3;  3IMA B;  3U97 A;  1AVK A;  1YJW 3;  2W9Q A;  3EX9 A;  1G96 A;  3KN4 A;  2XSH B;  3DM8 A;  3B4O A;  3F7S A;  3LYG A;  4R1K A;  3UJM A;  2FNQ A;  4EC6 A;  5I97 A;  5IW9 A;  2FXT A;  1Z1S A;  4IPB A;  4FCM A;  2RCD A;  1E3R A;  3PYJ A;  4L8P A;  1EA2 A;  3BB9 A;  3X42 A;  5DRE A;  3X40 A;  1QMA A;  3AMO B;  4R4K A;  2XFS A;  3CPW 2;  1IK3 A;  2QA4 3;  3CD6 3;  1FA3 A;  1VQ6 3;  3LOY A;  4HBR A;  3NUV A;  1S5A A;  1VQ5 3;  5IG3 A;  1W6G A;  5TGN A;  1RRH A;  2SBL A;  3KFQ C;  3X3Z A;  1O7G B;  2XR8 B;  4HKV B;  2GEY A;  2XGN A;  1GY6 A;  1SIH A;  2CWV A;  3MYT A;  1OUN A;  1TIJ A;  2CH9 A;  3HZP A;  2PZV A;  2XFT A;  3SXX A;  4RBN A;  5JBS A;  3DZL A;  2CFL A;  2GBW B;  3EBT A;  1TU5 A;  2P05 A;  2GU1 A;  3EN1 B;  2W04 A;  3EBY A;  5IG0 A;  2HML B;  1N9E A;  1K73 4;  3N54 B;  3V98 A;  1UI7 A;  1OGZ A;  1AVL A;  2O3O A;  1NWW A;  1U5O A;  1AV4 A;  3CC7 3;  2CFK A;  4Q53 A;  3O8Y A;  1NB3 I;  1ASK A;  1OCV A;  2Z77 A;  1LOX A;  2HMN B;  2RFR A;  2CFG A;  3MKI A;  4O3V A;  3N9H A;  3M8C A;  1TFO A;  4HM4 B;  1ULJ B;  1IQX A;  2XRX B;  3VGN A;  1WNH A;  2IUK A;  5ELU A;  1DMN A;  3F14 A;  3NHX A;  4FR9 A;  4HYZ A;  3EN8 A;  1IQ8 A;  3CMA 3;  2FGT A;  4H3U A;  1QVG 2;  1IDP A;  1ROA A;  5CK6 A;  3T8U A;  4EV5 A;  1OHP A;  3SX1 A;  6STD A;  3PGB A;  3IPT A;  1RN7 A;  3U1W A;  3DGN A;  4HM8 B;  3BNC A;  2CKF B;  1KWI A;  1CQS A;  3BNB A;  1OF5 B;  4WWU C;  5AYS C;  4NHF A;  3CCV 3;  4LSO A;  1A2V A;  2CFW A;  5AII A;  1O7N B;  4N6M A;  2KRT A;  3Q1C A;  3EJV A;  3G16 A;  3F9S A;  1YHQ 3;  1WMO A;  3MSO A;  3K63 A;  1OGX A;  3MG1 A;  3SED A;  1A90 A;  3DY5 A;  3Q2P A;  4LMI A;  1J2B A;  1OPY A;  2CK3 H;  2KCD A;  1W6Y A;  1N5P A;  3NQY A;  1R4C A;  1ROV A;  3NQZ A;  2XSO B;  3B7C A;  3UL5 A;  2RSX A;  1U8C B;  3NXJ A;  2A15 A;  3Q90 A;  1TP6 A;  4HM2 B;  1L5G B;  1Q42 A;  3LTA A;  3FGY A;  3DXO A;  4AKY A;  3PS8 A;  4EXR A;  3CCM 3;  1BUQ A;  1Q86 4;  3VF1 A;  2GBX B;  2YFI B;  2IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...