1O7GB

Naphthalene 1,2-dioxygenase with naphthalene bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
b'MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7gB00
5FW5A 1O7GB 1ULJB 4HJLB 5IEOA 3G8ZA 7STDA 3NM2A 2GEXA 1JB2A 4HZBB 1Q40B 2XSOB 3EQQB 3BB9A 3RGAA 4HM6B 3EHCA 3T8UA 1W00A 4J9AA 1JKGB 5G2GA 4R9LA 4HM3B 3UNLA 3NUVA 2RCDA 5CXOA 1OH0A 1GY6A 2B24B 3H3HA 1SJWA 1EA2A 1JB4A 3GWRA 3FF2A 4KVHA 3HK4A 4HM7B 3B7CA 6STDA 5AIIA 1DMQA 3UJMA 5JPPA 4LMIA 2XRXB 1VZZA 3ER7A 5AIHA 3GZYB 3Q90A 1O7WB 3CPOA 4XDWA 4J8TA 3MKIA 1OHOA 2BMQB 2Z7AA 5IG4A 3FF0A 4U13A 2OWPA 5CLKA 2F98A 5IERA 4K1UA 1IDPA 2CHCA 1HKXA 3EN1B 1ZO2A 1E3RA 3JUQA 1O7MB 3NBRA 4Q53A 1TP6A 3OXAA 4STDA 5IEPA 1OF5A 4N3VA 1OGXA 3T8NA 3ROBA 4LGQA 5KP3A 3OWYA 2QIYA 3OWUA 3MG1A 1TUHA 4OUQA 5STDA 1ISKA 5AIFA 2BMOB 3GZXB 1O7PB 2GBWB 5CK6A 3FSDA 3CU3A 1OGZA 4WYKB 5AEUB 3FKAA 4PEJA 3BLZA 3JUMA 3SOAA 2BNGA 4WP5A 5D82A 3OX9A 1GYBA 1UUWB 3FLJA 1ASKA 3CNXA 4L7KA 1STDA 3NV0B 4HVNA 4WYKA 1ZX2A 3F7XA 4HM2B 8CHOA 3B4OA 3MHEA 1Q40A 3DUKA 5IG3A 1NU3A 1GS3A 5JPUA 5KP1A 2HMMB 2RGQA 1W01A 4XBTA 4I4KA 3NV0A 2HMLB 3DM8A 1JKGA 3MYTA 2INXA 5AI1A 1JN5B 1OCVA 3JUPA 3B8LA 1DMNA 3K0ZA 4HM5B 2UX0A 4HM8B 2JQ5A 1W6YA 3SEDA 3FGYA 5KP4A 3GRDA 4X2HA 5CF1A 3MG2A 2XSHB 4XBXA 4OVMA 3MG3A 5AIGA 5CF2A 4R9KA 2Z76A 1OHPA 3DXOA 3HX8A 4R1KA 1BUQA 2QGUA 2GEYA 2YFJB 1O7NB 4IIAA 1OUNA 1C7HA 3I0YA 1NWWA 4GB5A 5TGNA 3F7SA 1Z1SA 3H51A 2HMKB 1S5AA 2I9WA 1O7HB 3JUNA 4HM0B 3STDA 3EBYA 3ECFA 3A76A 4XBYA 3GZRA 3JUOA 1CQSA 4XB5A 4FCJA 4FCMA 4HM4B 3CNMA 3K7CA 5IG0A 5EVHA 1E97A 3EC9A 3F14A 2PZVA 3FH1A 1GY5A 3OV4A 1JB5A 1U5OA 3B4PA 3M8CA 3SOYA 2XR8B 3F8XA 4HZ9B 2W2CA 1K41A 4L8OA 2BMRB 1AR0A 2HMJB 1NDOB 1QJGA 3F9SA 5IENA 1OHSA 3DZLA 2F86B 1QMAA 1W02A 4LEHA 1OPYA 5DRVA 2R4IA 4HKVB 2Z77A 2HMOB 3F40A 4HM1B 3LZAA 3VGNA 4RZMA 3KE7A 2YFIB 2K54A 2GBXB 3EN8A 3IPTA 2CKFB 2IMJA 4WWUC 3MSOA 5AEWB 2HMNB 3EF8A 5D83A 3EX9A 1GY7A 3RGRA 3WMDA 3D9RA 3E99A 4ORLA 3S5CA 3G0KA 3G16A 2YFLB 1JN5A 5DREA 5BXQA 5BVBA 5HGRA 3EJVA 3OWSA 3DMCA 3KSPA 1OF5B 2STDA 2A15A 3GZBA 4H3UA 1ULIB 4MJDA 4X2OA 2F99A 3KKGA 4K1VA 3NHXA 3LYGA 1A2KA 1UUVB 2GXFA 3VSYA 4CDLA 3F8HA 4XM4A 1Q42A 1WQLB 1DMMA 4L8PA 5IG5A 2RFRA 4XDVA 1E3VA 3FZWA 2B1XB 5D81A 1EG9B 5IF6A 3KZTA 3NXJA 3EBTA 3HZPA
chains in the Genus database with same CATH superfamily
5FGOA 1TU5A 1BRGA 5FW5A 2CW9A 1GOUA 1O7GB 4KFEA 4N6MA 5AYRB 1SIIA 2Y74A 1ULJB 4HJLB 1VQK3 1NO3A 1W6GA 1NB3I 2OCTA 1I2GA 2W56A 3G8ZA 2C10A 5IEOA 3WHOA 4EV2A 3V99A 7STDA 3NM2A 2GEXA 3WA2X 1MOLA 1JB2A 3Q1CA 5G1KA 3BNBA 4CJNA 1YHQ3 2F56A 4RBNA 4HZBB 1Q40B 1TFKA 2XSOB 1EQKA 4CCVA 3D3LA 3CCR3 1BRKA 2CFLA 1WMPA 3EQQB 4KZ1A 2OTJ3 3BB9A 3RGAA 3FG3A 1SARA 4AKZA 4HM6B 1IQYA 1X1XA 2GU1A 3EHCA 1QALA 1U8CB 3LTDA 1PU4A 2XGNA 3T8UA 4FR9A 4FMCA 1W00A 1D6YA 1VQP3 1T3BA 1W7CA 4J9AA 4BU4A 2W04A 1YI23 1JKGB 4MMZB 5G2GA 5A0OB 1ZGXA 4R9LA 1RGLA 1W2B2 4HM3B 3UNLA 3NUVA 2RCDA 4CPKA 1LNIA 3D4AA 3D79A 4FMAA 1OH0A 5CXOA 1GY6A 2MC8A 2B24B 2O9UX 3H3HA 1T2HA 1SJWA 1FGQA 2CX0A 1EA2A 1US1A 4J5GA 3AGOA 2CX1A 2UGIA 1JB4A 3O8YA 2F5WA 1FUSA 1AVLA 1YIT3 3GWRA 3FF2A 2W9PA 4KVHA 3HK4A 2LYXA 4O3VA 4HM7B 2KF5A 2ZA4A 1UDII 1GD4A 4BTXA 2Y73A 1N9JA 3B7CA 5AIIA 6STDA 2UUGC 1KQS2 1DMQA 2P09A 3UJMA 3MWZA 5JPPA 1UCJA 1UCLA 4LMIA 2XRXB 2H0HA 2W9QA 1JBSA 1VZZA 1I3IA 3ER7A 1B2SA 5AIHA 3KSED 1RSNA 3ZFZA 1KD14 1J2BA 1DYUA 1SQWA 1I2FA 2E2TA 3GZYB 1IU7A 1O7WB 3Q90A 3HI7A 4QWTA 3SYUA 1IT8A 1VQN3 1WMOA 1N9EA 4NREA 4AKYA 3CPOA 3GAXA 4KFFA 4J8TA 1BU4A 4XDWA 2XEPA 4FCZA 5BIRA 3CCL3 3MKIA 1DE3A 4EYCA 1OHOA 1BGSA 2BMQB 2W0QA 2Z7AA 3BNEA 3FF0A 5IG4A 4U13A 2OWPA 5CLKA 5LC7A 3LTCA 9RNTA 2F98A 1G96A 1RGKA 1X1YA 5IERA 1M1K4 3WOFB 2CFDA 1UI8A 4BL2A 1PY3A 1UCKA 2D1WA 4K1UA 4BTYA 1NB5I 1IDPA 1CH0A 3CCQ3 3DGLA 1QVG2 1HYFA 3RDEA 3BIRA 2CHCA 4WFOA 3KIIA 2CIUA 3DGNA 3X3ZA 1HKXA 3EN1B 1N5HA 1KC84 4I5QA 1ZO2A 3FG4A 1V58A 2RSXA 1E3RA 2LQVA 3JUQA 2L4VA 2CG1A 4HYZA 2WO0A 1O7MB 2CG0A 1V74A 2BT3A 3NBRA 4GSPA 1YNVX 1K28A 4Q53A 4NPBA 3NM7A 5EEOA 2JDIH 1RTUA 3WOEB 1TP6A 3OXAA 4STDA 1A90A 5IEPA 1OF5A 2QA43 2KCDA 1Q864 3BNDA 4N3VA 3FCSB 1OGXA 2C11A 4RNYA 2CC3A 2H0GA 4J5KA 1DVDA 3T8NA 2OTL3 3LT8A 3ROBA 4LGQA 5KP3A 2R41A 3L0RA 1DETA 1Y4KA 3OWYA 4JRFA 1RCLA 1FZUA 1PFPA 3SX1A 2QIYA 3OWUA 3MG1A 1CEWI 1TUHA 4OUQA 5STDA 3UL5A 6GSPA 1ISKA 4KFDA 1W2ZA 5AIFA 2CFKA 3X3XA 2BMOB 2H0IA 3GZXB 1BRSA 1TRQA 4WHAA 1O7PB 2GBWB 1YJW3 5CK6A 3FSDA 3Q3FA 1GOYA 1BSDA 3CU3A 1G02A 4AEQA 3CCE3 1OGZA 1UGHI 4WYKB 5AEUB 3JVCA 1GMPA 3FKAA 1TRPA 4PEJA 1EUIC 3BLZA 3JUMA 3SOAA 3X3YA 2BNGA 3SLUA 1N8R4 4WP5A 5D82A 4GL6A 3V92A 3DH2A 1A67A 3OX9A 2YX9A 1CYVA 1GYBA 1UUWB 1T2IA 3IJEB 3FLJA 1ASKA 1HU9A 3CNXA 4L7KA 4KT3B 1AQZA 3WODG 4LSOA 3D5GA 1LQGC 1LNHA 1LQMB 2Z6BA 1STDA 3TDGA 3N8BA 3S29A 3WA3A 1MGRA 1GMRA 3QRDA 3NV0B 2HOHA 4N6OB 4N6LA 1BAOA 4MMYB 3V98A 1VQ63 1CYUA 3NBBA 3WR2A 4HVNA 3CCU3 1OACA 3LXUX 5RNTA 4WYKA 4BIRA 3A5EA 4MMXB 1ZX2A 3F7XA 4HM2B 4EC6A 3N54B 2KF3A 3B4OA 3PXMA 8CHOA 2WOFA 3MHEA 2OQEA 1Q40A 3DUKA 5IG3A 3SVAA 2FXTA 5I97A 1JNQA 1MWSA 1NU3A 2D42A 4K90B 1GS3A 1MNLA 1KWIA 1QAKA 1BNEA 2XH9A 4HOHA 3X41A 5JPUA 5KP1A 3I563 2HMMB 1LOYA 1BRIA 3DY5A 3MPHA 2RGQA 1RLSA 4EBGA 1RN1A 2RBIA 1W01A 4XBTA 4I4KA 2FGTA 3NV0A 2HMLB 3DM8A 1VQ73 2CFGA 3CCS3 4H61A 1JKGA 3G6E3 1JJ22 1IV9A 2QEX3 2OQEC 1EEJA 3BU4A 1VQO3 2XF3A 3MYTA 2IA7A 1VQM3 3AHWA 1LOXA 1YVBI 1BIRA 2INXA 4NHFA 5AI1A 1JN5B 4K61A 1K9M4 1D6ZA 3CPW2 1DVCA 1OCVA 3URPA 3JUPA 3B8LA 1DMNA 1NJI4 2OOVA 1STFI 3K0ZA 4N6V0 1UW1A 1A2VA 1I0VA 4HM5B 1BRNL 1B3SA 4ZM8A 3AGNA 2SARA 3PYJA 2UX0A 4HM8B 2JQ5A 4EV5A 1BNJA 4LYLB 2CH9A 1RRLA 1W6YA 3SEDA 2IUJA 3EE1A 3AMOB 3FGYA 3DGOA 3BNCA 5KP4A 1AY7A 3GRDA 3K9MC 4X2HA 5CF1A 1YIJ3 4N6UA 3MG2A 2XSHB 1RDSA 4XBXA 4N6NB 1YJN3 4OVMA 1RRHA 3MG3A 2P05A 2BO9B 1B2ZA 3HIGA 3CXC2 1IVXA 5AIGA 5CF2A 2XFSA 4EW5A 4LZIA 3QK9A 3LTAA 1IQXA 1I70A 1N5PA 2Z76A 1FGOA 1UUGB 4R9KA 1W6CA 1OHPA 4G1MB 5HOHA 2RNTA 3DXOA 3HX8A 1YJ93 3LH4A 4R1KA 4BL3A 5M1AA 4O8SA 1BUQA 1YVSA 2QGUA 1BOXA 1KSIA 1MWRA 2GEYA 2YFJB 5GSPA 2MF7A 1BVIA 4R4KA 3T0UA 1O7NB 4IIAA 1VQ93 1LOWA 4GHOA 3N9HA 2IYJA 1IQ8A 1OUNA 1C7HA 3UB1A 3I0YA 4FMBA 1AVKA 1NWWA 4GB5A 1C54A 5TGNA 3F7SA 6RNTA 1Z1SA 3H51A 2HMKB 3CMA3 1EKMA 1S5AA 2ML6A 1LVNA 1RGHA 2I9WA 1O7HB 2W6JH 1MWTA 3FG1A 1IV7A 1L5GB 3CME3 2M7OA 1HZ1A 1LOVA 3JUNA 1FGRA 1RKYA 1GD3A 4HM0B 5LC6A 3STDA 3EBYA 3ECFA 1RGCA 1RN4A 3A76A 3LMLA 2E2UA 4XBYA 1BSEA 2P0XA 3GZRA 3JUOA 3PCRA 1CQSA 4N6TA 1NNVA 2XFTA 2XGLA 2KAAA 1IVWA 1RGGA 4XB5A 3S28A 2CWTA 1BSAA 4FCJA 1Q7HA 2GU3A 4FCMA 3LOYA 1RHLA 4HM4B 8RNTA 3CNMA 3OW22 1FW7A 2Q07A 1X1WA 4OK0A 3K7CA 1RGEA 1JBRA 1PYLA 1QAFA 2GSPA 1Q9EA 3KFQC 5IG0A 5EVHA 1E97A 3EC9A 3F14A 4O2HA 4RNZA 2PZVA 1BRHA 3FH1A 1VQ83 1GY5A 3OV4A 5AYSC 3CC43 1JB5A 1TJDA 1U5OA 1R4CA 1BSBA 1I2EA 3B4PA 3M8CA 2CWVA 3PCSA 3SOYA 3NX0A 3NQZA 2P0MA 2XR8B 3F8XA 1GOVA 4HBRA 4HZ9B 1S723 1JBTA 1UCIA 3X42A 2BHMA 2W2CA 1WTHA 1K41A 4L8OA 1RNBA 5G1LA 3VF1A 2W03A 5IW9A 2P38A 1BNFA 3KCHA 3NQYA 1B27A 3EB8A 1D6UA 2BMRB 1BNRA 2ZHXB 1AR0A 1BSCA 2HMJB 2C4BA 1NDOB 1B2MA 2L1SA 1RJOA 2CWUA 4ILFA 3DGYA 3SXXA 1QJGA 3PGBA 3F9SA 1AV4A 5IENA 1OHSA 3DZLA 1ROAA 1BUJA 1BNGA 2F86B 1QMAA 1W02A 4LEHA 1OPYA 2F4YA 5DRVA 5JBSA 1QVF2 2R4IA 3GSPA 4HKVB 1WNHA 2Z77A 3X40A 1W5ZA 2AADA 2HMOB 3F40A 1FA3A 4HM1B 3LZAA 3VGNA 1G0TA 1R4YA 1IVVA 1V57A 3IMAB 4RZMA 4DKIA 1IYYA 1GMQA 1MWUA 3KE7A 1K734 1JV2B 1SIHA 1I8VA 2YFIB 2K54A 2GBXB 3EN8A 3WDGB 1Q824 1LRAA 1IVUA 3IPTA 2CKFB 2IMJA 4WWUC 2AAEA 1RGFA 3MSOA 2HMNB 5EQLA 5AEWB 5M18A 3LTBA 3EF8A 4JF8A 1M904 5D83A 4R80A 1B2UA 1W4NA 3EX9A 1BRJA 4HAAA 5ELUA 5M19A 1N8QA 1VQ43 3RNTA 1FGMA 1FYSA 1WMNA 4O02B 1RMSA 1GY7A 4IT7A 3RGRA 1FUWA 1YGEA 1M9GA 4MEIA 3WMDA 3D9RA 3PZWA 7RNTA 1BANA 4TX4A 1MGWA 1BNSA 3D5IA 4RNTA 1TTOA 3E99A 4ORLA 3S5CA 3G0KA 1B21A 2BU4A 3ZG5A 2PNCA 3CD63 1RCKA 2WOHA 2CK3H 3G16A 2YFLB 7GSPA 1SPUA 1TIJA 1JN5A 1RGAA 2KXGA 2WGQA 4FMDA 5DREA 2OOVC 5BXQA 5BVBA 1B2XA 5HGRA 1Q7Y4 1ROVA 3EJVA 3OWSA 3CC23 2BIRA 1JZOA 3DMCA 3I553 1F8NA 1VQQA 3KSPA 1ZS7A 3Q2PA 3CC73 1FUTA 1OF5B 1TFOA 2STDA 3LT9A 2A15A 3GZBA 2ZDJA 4IPBA 3UL6A 2IUKA 1VQL3 1YGWA 2K0MA 2WGOA 3AMOA 3G4S3 1VQ53 4H3UA 3U1WA 3CCM3 1Q814 2FNQA 1ULIB 2KF6A 3NBJA 4MJDA 3CCJ3 3PS8A 3CCV3 1K8A4 1GSPA 1I3FA 4X2OA 1IK3A 1UI7A 2F5MA 2F99A 1BNIA 3ALAA 5ELJA 1JZDA 2O3OA 2V1LA 3KKGA 4K1VA 3NHXA 3KN4A 1A2KA 3LYGA 1M1XB 1UUVB 2IY2A 3AHSA 2GXFA 3VSYA 3ZG0A 4CDLA 2ML5A 3F8HA 4XM4A 3U97A 3G713 1RNTA 1Q42A 1WQLB 4EXRA 1A2PA 1I0XA 1JRQA 1DMMA 2W56B 1FGTA 2KRTA 1UGIA 3K5TA 3HOHA 1RN7A 4L8PA 5IG5A 1T5YA 1B20A 2J8XB 2RFRA 3DGMA 2E2VA 2KF4A 4XDVA 3S27A 1E3VA 2SBLA 2ZL8A 3FZWA 5BU4A 2B1XB 5D81A 1EG9B 3S67A 1LXEA 1IT7A 3K63A 5IF6A 3KZTA 3NXJA 3J7Yd 3HIIA 3EBTA 2K3DA 4BTWA 2CFWA 1X1UA 3HZPA
chains in the Genus database with same CATH topology
5FGOA 1TU5A 5FW5A 2CW9A 1O7GB 4KFEA 4N6MA 5AYRB 1SIIA 2Y74A 1ULJB 4HJLB 1VQK3 1NO3A 1W6GA 1NB3I 2OCTA 2W56A 5IEOA 3G8ZA 2C10A 4EV2A 3V99A 7STDA 3NM2A 2GEXA 3WA2X 1MOLA 1JB2A 3Q1CA 3BNBA 1YHQ3 4RBNA 4HZBB 1Q40B 1TFKA 2XSOB 1EQKA 4CCVA 3D3LA 3CCR3 2CFLA 1WMPA 3EQQB 4KZ1A 2OTJ3 3BB9A 3RGAA 3FG3A 4AKZA 4HM6B 1IQYA 2GU1A 3EHCA 1QALA 1U8CB 3LTDA 1PU4A 2XGNA 3T8UA 4FR9A 4FMCA 1W00A 1D6YA 1VQP3 1W7CA 4J9AA 2W04A 1YI23 1JKGB 4MMZB 5G2GA 5A0OB 4R9LA 1W2B2 4HM3B 3UNLA 3NUVA 2RCDA 5CXOA 4FMAA 1OH0A 1GY6A 2MC8A 2B24B 2O9UX 3H3HA 1SJWA 1FGQA 1EA2A 1US1A 1JB4A 3O8YA 1AVLA 1YIT3 3GWRA 3FF2A 2W9PA 4KVHA 3HK4A 2LYXA 4O3VA 4HM7B 4BTXA 1GD4A 2Y73A 1N9JA 3B7CA 5AIIA 6STDA 1KQS2 1DMQA 2P09A 3UJMA 3MWZA 5JPPA 4LMIA 2XRXB 2W9QA 1VZZA 3ER7A 1J2BA 5AIHA 3KSED 1KD14 1DYUA 1SQWA 2E2TA 3GZYB 1IU7A 1O7WB 3Q90A 3HI7A 4QWTA 1IT8A 1VQN3 1WMOA 1N9EA 4NREA 4AKYA 3CPOA 3GAXA 4KFFA 4J8TA 4XDWA 3CCL3 2XEPA 4FCZA 3MKIA 4EYCA 1OHOA 2BMQB 2Z7AA 2W0QA 3BNEA 3FF0A 5IG4A 4U13A 2OWPA 5CLKA 5LC7A 3LTCA 2F98A 1G96A 5IERA 1M1K4 3WOFB 2CFDA 1UI8A 2D1WA 4K1UA 4BTYA 1NB5I 1IDPA 3CCQ3 3DGLA 1QVG2 3RDEA 2CHCA 4WFOA 3KIIA 2CIUA 3DGNA 3X3ZA 1HKXA 3EN1B 1N5HA 1KC84 1ZO2A 3FG4A 2RSXA 1E3RA 2LQVA 3JUQA 2L4VA 2CG1A 4HYZA 2WO0A 1O7MB 2CG0A 1V74A 2BT3A 3NBRA 1K28A 4Q53A 3WOEB 3NM7A 5EEOA 2JDIH 1TP6A 3OXAA 4STDA 1A90A 5IEPA 1OF5A 2QA43 2KCDA 1Q864 3BNDA 4N3VA 3FCSB 1OGXA 2C11A 4RNYA 2CC3A 1DVDA 3T8NA 2OTL3 3LT8A 3ROBA 4LGQA 5KP3A 3L0RA 1Y4KA 3OWYA 4JRFA 1PFPA 3SX1A 2QIYA 3OWUA 3MG1A 1CEWI 1TUHA 4OUQA 5STDA 3UL5A 1ISKA 4KFDA 1W2ZA 5AIFA 2CFKA 3X3XA 2BMOB 3GZXB 4WHAA 1O7PB 2GBWB 1YJW3 5CK6A 3FSDA 3CU3A 4AEQA 3CCE3 1OGZA 4WYKB 5AEUB 3JVCA 3FKAA 4PEJA 3BLZA 3JUMA 3SOAA 3X3YA 2BNGA 3SLUA 1N8R4 4WP5A 5D82A 4GL6A 3V92A 1A67A 3OX9A 2YX9A 1CYVA 1GYBA 1UUWB 3IJEB 3FLJA 1HU9A 1ASKA 3CNXA 4L7KA 3WODG 4LSOA 1LNHA 2Z6BA 1STDA 3TDGA 3N8BA 3S29A 3WA3A 3QRDA 3NV0B 4N6OB 4N6LA 3V98A 1CYUA 4MMYB 1VQ63 3NBBA 3CCU3 4HVNA 1OACA 3LXUX 4WYKA 4MMXB 1ZX2A 3F7XA 4HM2B 4EC6A 3N54B 8CHOA 3B4OA 3PXMA 2WOFA 3MHEA 2OQEA 1Q40A 3DUKA 5IG3A 3SVAA 2FXTA 5I97A 1JNQA 1NU3A 2D42A 4K90B 1MNLA 1GS3A 1KWIA 1QAKA 2XH9A 5JPUA 3I563 3X41A 5KP1A 2HMMB 3DY5A 3MPHA 2RGQA 4EBGA 1W01A 4XBTA 4I4KA 2FGTA 3NV0A 2HMLB 3DM8A 1VQ73 2CFGA 3CCS3 4H61A 1JKGA 3G6E3 1JJ22 1IV9A 2QEX3 2OQEC 1VQO3 2XF3A 3MYTA 2IA7A 1VQM3 1LOXA 1YVBI 2INXA 4NHFA 5AI1A 1JN5B 4K61A 1K9M4 1D6ZA 3CPW2 1DVCA 1OCVA 3JUPA 3B8LA 1DMNA 1NJI4 2OOVA 1STFI 3K0ZA 4N6V0 1UW1A 1A2VA 4HM5B 4ZM8A 3PYJA 2UX0A 4HM8B 2JQ5A 2CH9A 1RRLA 1W6YA 3SEDA 2IUJA 3EE1A 3AMOB 3FGYA 3DGOA 3BNCA 5KP4A 3GRDA 3K9MC 4X2HA 5CF1A 1YIJ3 4N6UA 3MG2A 2XSHB 4XBXA 4N6NB 1YJN3 4OVMA 1RRHA 3MG3A 2P05A 2BO9B 3HIGA 3CXC2 1IVXA 5AIGA 5CF2A 2XFSA 4LZIA 3QK9A 3LTAA 1IQXA 1N5PA 4R9KA 2Z76A 1FGOA 1W6CA 1OHPA 4G1MB 3DXOA 3HX8A 1YJ93 3LH4A 4R1KA 4O8SA 1BUQA 2QGUA 1KSIA 2GEYA 2YFJB 2MF7A 4R4KA 3T0UA 1O7NB 4IIAA 1VQ93 3N9HA 1IQ8A 1OUNA 1C7HA 3UB1A 3I0YA 4FMBA 1AVKA 1NWWA 4GB5A 5TGNA 3F7SA 1Z1SA 3H51A 2HMKB 3CMA3 1EKMA 1S5AA 2ML6A 1LVNA 2I9WA 1O7HB 2W6JH 3FG1A 1IV7A 1L5GB 3CME3 2M7OA 3JUNA 1FGRA 1RKYA 1GD3A 4HM0B 5LC6A 3STDA 3EBYA 3ECFA 3A76A 3LMLA 2E2UA 4XBYA 3GZRA 2P0XA 3JUOA 3PCRA 1CQSA 4N6TA 2XFTA 2XGLA 1IVWA 3S28A 4XB5A 2CWTA 4FCJA 2GU3A 4FCMA 3LOYA 4HM4B 3CNMA 3OW22 2Q07A 4OK0A 3K7CA 1QAFA 3KFQC 5IG0A 5EVHA 1E97A 3EC9A 3F14A 4O2HA 4RNZA 2PZVA 3FH1A 1VQ83 1GY5A 3OV4A 5AYSC 3CC43 1JB5A 1U5OA 3B4PA 1R4CA 3M8CA 3PCSA 2CWVA 3SOYA 3NX0A 3NQZA 2P0MA 2XR8B 3F8XA 4HZ9B 4HBRA 1S723 3X42A 2BHMA 2W2CA 1WTHA 1K41A 4L8OA 3VF1A 2W03A 5IW9A 2P38A 3NQYA 3EB8A 1D6UA 2BMRB 1AR0A 2HMJB 1NDOB 1RJOA 2CWUA 3SXXA 1QJGA 3PGBA 3F9SA 1AV4A 5IENA 1OHSA 3DZLA 1ROAA 2F86B 1QMAA 1W02A 4LEHA 1OPYA 5DRVA 5JBSA 1QVF2 2R4IA 4HKVB 1WNHA 2Z77A 3X40A 1W5ZA 2HMOB 3F40A 1FA3A 4HM1B 3LZAA 3VGNA 4EV5A 3IMAB 1IVVA 4RZMA 3KE7A 1K734 1JV2B 1SIHA 2YFIB 2K54A 2GBXB 3EN8A 3WDGB 1Q824 3IPTA 1IVUA 2CKFB 2IMJA 4WWUC 3MSOA 5EQLA 5AEWB 2HMNB 3LTBA 3EF8A 4JF8A 1M904 5D83A 4R80A 1W4NA 3EX9A 5ELUA 1N8QA 1VQ43 1FGMA 1WMNA 4O02B 4IT7A 1GY7A 3RGRA 1FUWA 1YGEA 1M9GA 4MEIA 3WMDA 3D9RA 3PZWA 4TX4A 3E99A 4ORLA 3S5CA 3G0KA 3CD63 2PNCA 3G16A 2WOHA 2CK3H 2YFLB 1SPUA 1TIJA 1JN5A 2KXGA 2WGQA 4FMDA 5DREA 2OOVC 5BXQA 5BVBA 5HGRA 1Q7Y4 1ROVA 3EJVA 3OWSA 3CC23 3DMCA 3I553 1F8NA 3KSPA 3Q2PA 3CC73 1TFOA 1OF5B 2STDA 3LT9A 2A15A 3GZBA 2ZDJA 4IPBA 3UL6A 2IUKA 1VQL3 2WGOA 2K0MA 3AMOA 3G4S3 1VQ53 4H3UA 3U1WA 3CCM3 1Q814 2FNQA 1ULIB 3NBJA 4MJDA 3CCJ3 3PS8A 3CCV3 1K8A4 4X2OA 1IK3A 1UI7A 2F99A 3ALAA 5ELJA 2V1LA 2O3OA 3KKGA 4K1VA 3NHXA 3KN4A 1A2KA 3LYGA 1M1XB 1UUVB 2GXFA 3VSYA 4CDLA 2ML5A 3F8HA 4XM4A 3U97A 3G713 1Q42A 1WQLB 4EXRA 1JRQA 2W56B 1DMMA 1FGTA 2KRTA 3K5TA 1RN7A 4L8PA 5IG5A 1T5YA 2RFRA 3DGMA 2E2VA 4XDVA 3S27A 1E3VA 2SBLA 2ZL8A 3FZWA 2B1XB 5D81A 1EG9B 3S67A 1LXEA 1IT7A 3K63A 5IF6A 3KZTA 3NXJA 3J7Yd 3HIIA 3EBTA 4BTWA 2CFWA 3HZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW5 A;  1O7G B;  1ULJ B;  4HJL B;  5IEO A;  3G8Z A;  7STD A;  3NM2 A;  2GEX A;  1JB2 A;  4HZB B;  1Q40 B;  2XSO B;  3EQQ B;  3BB9 A;  3RGA A;  4HM6 B;  3EHC A;  3T8U A;  1W00 A;  4J9A A;  1JKG B;  5G2G A;  4R9L A;  4HM3 B;  3UNL A;  3NUV A;  2RCD A;  5CXO A;  1OH0 A;  1GY6 A;  2B24 B;  3H3H A;  1SJW A;  1EA2 A;  1JB4 A;  3GWR A;  3FF2 A;  4KVH A;  3HK4 A;  4HM7 B;  3B7C A;  6STD A;  5AII A;  1DMQ A;  3UJM A;  5JPP A;  4LMI A;  2XRX B;  1VZZ A;  3ER7 A;  5AIH A;  3GZY B;  3Q90 A;  1O7W B;  3CPO A;  4XDW A;  4J8T A;  3MKI A;  1OHO A;  2BMQ B;  2Z7A A;  5IG4 A;  3FF0 A;  4U13 A;  2OWP A;  5CLK A;  2F98 A;  5IER A;  4K1U A;  1IDP A;  2CHC A;  1HKX A;  3EN1 B;  1ZO2 A;  1E3R A;  3JUQ A;  1O7M B;  3NBR A;  4Q53 A;  1TP6 A;  3OXA A;  4STD A;  5IEP A;  1OF5 A;  4N3V A;  1OGX A;  3T8N A;  3ROB A;  4LGQ A;  5KP3 A;  3OWY A;  2QIY A;  3OWU A;  3MG1 A;  1TUH A;  4OUQ A;  5STD A;  1ISK A;  5AIF A;  2BMO B;  3GZX B;  1O7P B;  2GBW B;  5CK6 A;  3FSD A;  3CU3 A;  1OGZ A;  4WYK B;  5AEU B;  3FKA A;  4PEJ A;  3BLZ A;  3JUM A;  3SOA A;  2BNG A;  4WP5 A;  5D82 A;  3OX9 A;  1GYB A;  1UUW B;  3FLJ A;  1ASK A;  3CNX A;  4L7K A;  1STD A;  3NV0 B;  4HVN A;  4WYK A;  1ZX2 A;  3F7X A;  4HM2 B;  8CHO A;  3B4O A;  3MHE A;  1Q40 A;  3DUK A;  5IG3 A;  1NU3 A;  1GS3 A;  5JPU A;  5KP1 A;  2HMM B;  2RGQ A;  1W01 A;  4XBT A;  4I4K A;  3NV0 A;  2HML B;  3DM8 A;  1JKG A;  3MYT A;  2INX A;  5AI1 A;  1JN5 B;  1OCV A;  3JUP A;  3B8L A;  1DMN A;  3K0Z A;  4HM5 B;  2UX0 A;  4HM8 B;  2JQ5 A;  1W6Y A;  3SED A;  3FGY A;  5KP4 A;  3GRD A;  4X2H A;  5CF1 A;  3MG2 A;  2XSH B;  4XBX A;  4OVM A;  3MG3 A;  5AIG A;  5CF2 A;  4R9K A;  2Z76 A;  1OHP A;  3DXO A;  3HX8 A;  4R1K A;  1BUQ A;  2QGU A;  2GEY A;  2YFJ B;  1O7N B;  4IIA A;  1OUN A;  1C7H A;  3I0Y A;  1NWW A;  4GB5 A;  5TGN A;  3F7S A;  1Z1S A;  3H51 A;  2HMK B;  1S5A A;  2I9W A;  1O7H B;  3JUN A;  4HM0 B;  3STD A;  3EBY A;  3ECF A;  3A76 A;  4XBY A;  3GZR A;  3JUO A;  1CQS A;  4XB5 A;  4FCJ A;  4FCM A;  4HM4 B;  3CNM A;  3K7C A;  5IG0 A;  5EVH A;  1E97 A;  3EC9 A;  3F14 A;  2PZV A;  3FH1 A;  1GY5 A;  3OV4 A;  1JB5 A;  1U5O A;  3B4P A;  3M8C A;  3SOY A;  2XR8 B;  3F8X A;  4HZ9 B;  2W2C A;  1K41 A;  4L8O A;  2BMR B;  1AR0 A;  2HMJ B;  1NDO B;  1QJG A;  3F9S A;  5IEN A;  1OHS A;  3DZL A;  2F86 B;  1QMA A;  1W02 A;  4LEH A;  1OPY A;  5DRV A;  2R4I A;  4HKV B;  2Z77 A;  2HMO B;  3F40 A;  4HM1 B;  3LZA A;  3VGN A;  4RZM A;  3KE7 A;  2YFI B;  2K54 A;  2GBX B;  3EN8 A;  3IPT A;  2CKF B;  2IMJ A;  4WWU C;  3MSO A;  5AEW B;  2HMN B;  3EF8 A;  5D83 A;  3EX9 A;  1GY7 A;  3RGR A;  3WMD A;  3D9R A;  3E99 A;  4ORL A;  3S5C A;  3G0K A;  3G16 A;  2YFL B;  1JN5 A;  5DRE A;  5BXQ A;  5BVB A;  5HGR A;  3EJV A;  3OWS A;  3DMC A;  3KSP A;  1OF5 B;  2STD A;  2A15 A;  3GZB A;  4H3U A;  1ULI B;  4MJD A;  4X2O A;  2F99 A;  3KKG A;  4K1V A;  3NHX A;  3LYG A;  1A2K A;  1UUV B;  2GXF A;  3VSY A;  4CDL A;  3F8H A;  4XM4 A;  1Q42 A;  1WQL B;  1DMM A;  4L8P A;  5IG5 A;  2RFR A;  4XDV A;  1E3V A;  3FZW A;  2B1X B;  5D81 A;  1EG9 B;  5IF6 A;  3KZT A;  3NXJ A;  3EBT A;  3HZP A; 
#chains in the Genus database with same CATH topology
 5FGO A;  1TU5 A;  1BRG A;  5FW5 A;  2CW9 A;  1GOU A;  1O7G B;  4KFE A;  4N6M A;  5AYR B;  1SII A;  2Y74 A;  1ULJ B;  4HJL B;  1VQK 3;  1NO3 A;  1W6G A;  1NB3 I;  2OCT A;  1I2G A;  2W56 A;  3G8Z A;  2C10 A;  5IEO A;  3WHO A;  4EV2 A;  3V99 A;  7STD A;  3NM2 A;  2GEX A;  3WA2 X;  1MOL A;  1JB2 A;  3Q1C A;  5G1K A;  3BNB A;  4CJN A;  1YHQ 3;  2F56 A;  4RBN A;  4HZB B;  1Q40 B;  1TFK A;  2XSO B;  1EQK A;  4CCV A;  3D3L A;  3CCR 3;  1BRK A;  2CFL A;  1WMP A;  3EQQ B;  4KZ1 A;  2OTJ 3;  3BB9 A;  3RGA A;  3FG3 A;  1SAR A;  4AKZ A;  4HM6 B;  1IQY A;  1X1X A;  2GU1 A;  3EHC A;  1QAL A;  1U8C B;  3LTD A;  1PU4 A;  2XGN A;  3T8U A;  4FR9 A;  4FMC A;  1W00 A;  1D6Y A;  1VQP 3;  1T3B A;  1W7C A;  4J9A A;  4BU4 A;  2W04 A;  1YI2 3;  1JKG B;  4MMZ B;  5G2G A;  5A0O B;  1ZGX A;  4R9L A;  1RGL A;  1W2B 2;  4HM3 B;  3UNL A;  3NUV A;  2RCD A;  4CPK A;  1LNI A;  3D4A A;  3D79 A;  4FMA A;  1OH0 A;  5CXO A;  1GY6 A;  2MC8 A;  2B24 B;  2O9U X;  3H3H A;  1T2H A;  1SJW A;  1FGQ A;  2CX0 A;  1EA2 A;  1US1 A;  4J5G A;  3AGO A;  2CX1 A;  2UGI A;  1JB4 A;  3O8Y A;  2F5W A;  1FUS A;  1AVL A;  1YIT 3;  3GWR A;  3FF2 A;  2W9P A;  4KVH A;  3HK4 A;  2LYX A;  4O3V A;  4HM7 B;  2KF5 A;  2ZA4 A;  1UDI I;  1GD4 A;  4BTX A;  2Y73 A;  1N9J A;  3B7C A;  5AII A;  6STD A;  2UUG C;  1KQS 2;  1DMQ A;  2P09 A;  3UJM A;  3MWZ A;  5JPP A;  1UCJ A;  1UCL A;  4LMI A;  2XRX B;  2H0H A;  2W9Q A;  1JBS A;  1VZZ A;  1I3I A;  3ER7 A;  1B2S A;  5AIH A;  3KSE D;  1RSN A;  3ZFZ A;  1KD1 4;  1J2B A;  1DYU A;  1SQW A;  1I2F A;  2E2T A;  3GZY B;  1IU7 A;  1O7W B;  3Q90 A;  3HI7 A;  4QWT A;  3SYU A;  1IT8 A;  1VQN 3;  1WMO A;  1N9E A;  4NRE A;  4AKY A;  3CPO A;  3GAX A;  4KFF A;  4J8T A;  1BU4 A;  4XDW A;  2XEP A;  4FCZ A;  5BIR A;  3CCL 3;  3MKI A;  1DE3 A;  4EYC A;  1OHO A;  1BGS A;  2BMQ B;  2W0Q A;  2Z7A A;  3BNE A;  3FF0 A;  5IG4 A;  4U13 A;  2OWP A;  5CLK A;  5LC7 A;  3LTC A;  9RNT A;  2F98 A;  1G96 A;  1RGK A;  1X1Y A;  5IER A;  1M1K 4;  3WOF B;  2CFD A;  1UI8 A;  4BL2 A;  1PY3 A;  1UCK A;  2D1W A;  4K1U A;  4BTY A;  1NB5 I;  1IDP A;  1CH0 A;  3CCQ 3;  3DGL A;  1QVG 2;  1HYF A;  3RDE A;  3BIR A;  2CHC A;  4WFO A;  3KII A;  2CIU A;  3DGN A;  3X3Z A;  1HKX A;  3EN1 B;  1N5H A;  1KC8 4;  4I5Q A;  1ZO2 A;  3FG4 A;  1V58 A;  2RSX A;  1E3R A;  2LQV A;  3JUQ A;  2L4V A;  2CG1 A;  4HYZ A;  2WO0 A;  1O7M B;  2CG0 A;  1V74 A;  2BT3 A;  3NBR A;  4GSP A;  1YNV X;  1K28 A;  4Q53 A;  4NPB A;  3NM7 A;  5EEO A;  2JDI H;  1RTU A;  3WOE B;  1TP6 A;  3OXA A;  4STD A;  1A90 A;  5IEP A;  1OF5 A;  2QA4 3;  2KCD A;  1Q86 4;  3BND A;  4N3V A;  3FCS B;  1OGX A;  2C11 A;  4RNY A;  2CC3 A;  2H0G A;  4J5K A;  1DVD A;  3T8N A;  2OTL 3;  3LT8 A;  3ROB A;  4LGQ A;  5KP3 A;  2R41 A;  3L0R A;  1DET A;  1Y4K A;  3OWY A;  4JRF A;  1RCL A;  1FZU A;  1PFP A;  3SX1 A;  2QIY A;  3OWU A;  3MG1 A;  1CEW I;  1TUH A;  4OUQ A;  5STD A;  3UL5 A;  6GSP A;  1ISK A;  4KFD A;  1W2Z A;  5AIF A;  2CFK A;  3X3X A;  2BMO B;  2H0I A;  3GZX B;  1BRS A;  1TRQ A;  4WHA A;  1O7P B;  2GBW B;  1YJW 3;  5CK6 A;  3FSD A;  3Q3F A;  1GOY A;  1BSD A;  3CU3 A;  1G02 A;  4AEQ A;  3CCE 3;  1OGZ A;  1UGH I;  4WYK B;  5AEU B;  3JVC A;  1GMP A;  3FKA A;  1TRP A;  4PEJ A;  1EUI C;  3BLZ A;  3JUM A;  3SOA A;  3X3Y A;  2BNG A;  3SLU A;  1N8R 4;  4WP5 A;  5D82 A;  4GL6 A;  3V92 A;  3DH2 A;  1A67 A;  3OX9 A;  2YX9 A;  1CYV A;  1GYB A;  1UUW B;  1T2I A;  3IJE B;  3FLJ A;  1ASK A;  1HU9 A;  3CNX A;  4L7K A;  4KT3 B;  1AQZ A;  3WOD G;  4LSO A;  3D5G A;  1LQG C;  1LNH A;  1LQM B;  2Z6B A;  1STD A;  3TDG A;  3N8B A;  3S29 A;  3WA3 A;  1MGR A;  1GMR A;  3QRD A;  3NV0 B;  2HOH A;  4N6O B;  4N6L A;  1BAO A;  4MMY B;  3V98 A;  1VQ6 3;  1CYU A;  3NBB A;  3WR2 A;  4HVN A;  3CCU 3;  1OAC A;  3LXU X;  5RNT A;  4WYK A;  4BIR A;  3A5E A;  4MMX B;  1ZX2 A;  3F7X A;  4HM2 B;  4EC6 A;  3N54 B;  2KF3 A;  3B4O A;  3PXM A;  8CHO A;  2WOF A;  3MHE A;  2OQE A;  1Q40 A;  3DUK A;  5IG3 A;  3SVA A;  2FXT A;  5I97 A;  1JNQ A;  1MWS A;  1NU3 A;  2D42 A;  4K90 B;  1GS3 A;  1MNL A;  1KWI A;  1QAK A;  1BNE A;  2XH9 A;  4HOH A;  3X41 A;  5JPU A;  5KP1 A;  3I56 3;  2HMM B;  1LOY A;  1BRI A;  3DY5 A;  3MPH A;  2RGQ A;  1RLS A;  4EBG A;  1RN1 A;  2RBI A;  1W01 A;  4XBT A;  4I4K A;  2FGT A;  3NV0 A;  2HML B;  3DM8 A;  1VQ7 3;  2CFG A;  3CCS 3;  4H61 A;  1JKG A;  3G6E 3;  1JJ2 2;  1IV9 A;  2QEX 3;  2OQE C;  1EEJ A;  3BU4 A;  1VQO 3;  2XF3 A;  3MYT A;  2IA7 A;  1VQM 3;  3AHW A;  1LOX A;  1YVB I;  1BIR A;  2INX A;  4NHF A;  5AI1 A;  1JN5 B;  4K61 A;  1K9M 4;  1D6Z A;  3CPW 2;  1DVC A;  1OCV A;  3URP A;  3JUP A;  3B8L A;  1DMN A;  1NJI 4;  2OOV A;  1STF I;  3K0Z A;  4N6V 0;  1UW1 A;  1A2V A;  1I0V A;  4HM5 B;  1BRN L;  1B3S A;  4ZM8 A;  3AGN A;  2SAR A;  3PYJ A;  2UX0 A;  4HM8 B;  2JQ5 A;  4EV5 A;  1BNJ A;  4LYL B;  2CH9 A;  1RRL A;  1W6Y A;  3SED A;  2IUJ A;  3EE1 A;  3AMO B;  3FGY A;  3DGO A;  3BNC A;  5KP4 A;  1AY7 A;  3GRD A;  3K9M C;  4X2H A;  5CF1 A;  1YIJ 3;  4N6U A;  3MG2 A;  2XSH B;  1RDS A;  4XBX A;  4N6N B;  1YJN 3;  4OVM A;  1RRH A;  3MG3 A;  2P05 A;  2BO9 B;  1B2Z A;  3HIG A;  3CXC 2;  1IVX A;  5AIG A;  5CF2 A;  2XFS A;  4EW5 A;  4LZI A;  3QK9 A;  3LTA A;  1IQX A;  1I70 A;  1N5P A;  2Z76 A;  1FGO A;  1UUG B;  4R9K A;  1W6C A;  1OHP A;  4G1M B;  5HOH A;  2RNT A;  3DXO A;  3HX8 A;  1YJ9 3;  3LH4 A;  4R1K A;  4BL3 A;  5M1A A;  4O8S A;  1BUQ A;  1YVS A;  2QGU A;  1BOX A;  1KSI A;  1MWR A;  2GEY A;  2YFJ B;  5GSP A;  2MF7 A;  1BVI A;  4R4K A;  3T0U A;  1O7N B;  4IIA A;  1VQ9 3;  1LOW A;  4GHO A;  3N9H A;  2IYJ A;  1IQ8 A;  1OUN A;  1C7H A;  3UB1 A;  3I0Y A;  4FMB A;  1AVK A;  1NWW A;  4GB5 A;  1C54 A;  5TGN A;  3F7S A;  6RNT A;  1Z1S A;  3H51 A;  2HMK B;  3CMA 3;  1EKM A;  1S5A A;  2ML6 A;  1LVN A;  1RGH A;  2I9W A;  1O7H B;  2W6J H;  1MWT A;  3FG1 A;  1IV7 A;  1L5G B;  3CME 3;  2M7O A;  1HZ1 A;  1LOV A;  3JUN A;  1FGR A;  1RKY A;  1GD3 A;  4HM0 B;  5LC6 A;  3STD A;  3EBY A;  3ECF A;  1RGC A;  1RN4 A;  3A76 A;  3LML A;  2E2U A;  4XBY A;  1BSE A;  2P0X A;  3GZR A;  3JUO A;  3PCR A;  1CQS A;  4N6T A;  1NNV A;  2XFT A;  2XGL A;  2KAA A;  1IVW A;  1RGG A;  4XB5 A;  3S28 A;  2CWT A;  1BSA A;  4FCJ A;  1Q7H A;  2GU3 A;  4FCM A;  3LOY A;  1RHL A;  4HM4 B;  8RNT A;  3CNM A;  3OW2 2;  1FW7 A;  2Q07 A;  1X1W A;  4OK0 A;  3K7C A;  1RGE A;  1JBR A;  1PYL A;  1QAF A;  2GSP A;  1Q9E A;  3KFQ C;  5IG0 A;  5EVH A;  1E97 A;  3EC9 A;  3F14 A;  4O2H A;  4RNZ A;  2PZV A;  1BRH A;  3FH1 A;  1VQ8 3;  1GY5 A;  3OV4 A;  5AYS C;  3CC4 3;  1JB5 A;  1TJD A;  1U5O A;  1R4C A;  1BSB A;  1I2E A;  3B4P A;  3M8C A;  2CWV A;  3PCS A;  3SOY A;  3NX0 A;  3NQZ A;  2P0M A;  2XR8 B;  3F8X A;  1GOV A;  4HBR A;  4HZ9 B;  1S72 3;  1JBT A;  1UCI A;  3X42 A;  2BHM A;  2W2C A;  1WTH A;  1K41 A;  4L8O A;  1RNB A;  5G1L A;  3VF1 A;  2W03 A;  5IW9 A;  2P38 A;  1BNF A;  3KCH A;  3NQY A;  1B27 A;  3EB8 A;  1D6U A;  2BMR B;  1BNR A;  2ZHX B;  1AR0 A;  1BSC A;  2HMJ B;  2C4B A;  1NDO B;  1B2M A;  2L1S A;  1RJO A;  2CWU A;  4ILF A;  3DGY A;  3SXX A;  1QJG A;  3PGB A;  3F9S A;  1AV4 A;  5IEN A;  1OHS A;  3DZL A;  1ROA A;  1BUJ A;  1BNG A;  2F86 B;  1QMA A;  1W02 A;  4LEH A;  1OPY A;  2F4Y A;  5DRV A;  5JBS A;  1QVF 2;  2R4I A;  3GSP A;  4HKV B;  1WNH A;  2Z77 A;  3X40 A;  1W5Z A;  2AAD A;  2HMO B;  3F40 A;  1FA3 A;  4HM1 B;  3LZA A;  3VGN A;  1G0T A;  1R4Y A;  1IVV A;  1V57 A;  3IMA B;  4RZM A;  4DKI A;  1IYY A;  1GMQ A;  1MWU A;  3KE7 A;  1K73 4;  1JV2 B;  1SIH A;  1I8V A;  2YFI B;  2K54 A;  2GBX B;  3EN8 A;  3WDG B;  1Q82 4;  1LRA A;  1IVU A;  3IPT A;  2CKF B;  2IMJ A;  4WWU C;  2AAE A;  1RGF A;  3MSO A;  2HMN B;  5EQL A;  5AEW B;  5M18 A;  3LTB A;  3EF8 A;  4JF8 A;  1M90 4;  5D83 A;  4R80 A;  1B2U A;  1W4N A;  3EX9 A;  1BRJ A;  4HAA A;  5ELU A;  5M19 A;  1N8Q A;  1VQ4 3;  3RNT A;  1FGM A;  1FYS A;  1WMN A;  4O02 B;  1RMS A;  1GY7 A;  4IT7 A;  3RGR A;  1FUW A;  1YGE A;  1M9G A;  4MEI A;  3WMD A;  3D9R A;  3PZW A;  7RNT A;  1BAN A;  4TX4 A;  1MGW A;  1BNS A;  3D5I A;  4RNT A;  1TTO A;  3E99 A;  4ORL A;  3S5C A;  3G0K A;  1B21 A;  2BU4 A;  3ZG5 A;  2PNC A;  3CD6 3;  1RCK A;  2WOH A;  2CK3 H;  3G16 A;  2YFL B;  7GSP A;  1SPU A;  1TIJ A;  1JN5 A;  1RGA A;  2KXG A;  2WGQ A;  4FMD A;  5DRE A;  2OOV C;  5BXQ A;  5BVB A;  1B2X A;  5HGR A;  1Q7Y 4;  1ROV A;  3EJV A;  3OWS A;  3CC2 3;  2BIR A;  1JZO A;  3DMC A;  3I55 3;  1F8N A;  1VQQ A;  3KSP A;  1ZS7 A;  3Q2P A;  3CC7 3;  1FUT A;  1OF5 B;  1TFO A;  2STD A;  3LT9 A;  2A15 A;  3GZB A;  2ZDJ A;  4IPB A;  3UL6 A;  2IUK A;  1VQL 3;  1YGW A;  2K0M A;  2WGO A;  3AMO A;  3G4S 3;  1VQ5 3;  4H3U A;  3U1W A;  3CCM 3;  1Q81 4;  2FNQ A;  1ULI B;  2KF6 A;  3NBJ A;  4MJD A;  3CCJ 3;  3PS8 A;  3CCV 3;  1K8A 4;  1GSP A;  1I3F A;  4X2O A;  1IK3 A;  1UI7 A;  2F5M A;  2F99 A;  1BNI A;  3ALA A;  5ELJ A;  1JZD A;  2O3O A;  2V1L A;  3KKG A;  4K1V A;  3NHX A;  3KN4 A;  1A2K A;  3LYG A;  1M1X B;  1UUV B;  2IY2 A;  3AHS A;  2GXF A;  3VSY A;  3ZG0 A;  4CDL A;  2ML5 A;  3F8H A;  4XM4 A;  3U97 A;  3G71 3;  1RNT A;  1Q42 A;  1WQL B;  4EXR A;  1A2P A;  1I0X A;  1JRQ A;  1DMM A;  2W56 B;  1FGT A;  2KRT A;  1UGI A;  3K5T A;  3HOH A;  1RN7 A;  4L8P A;  5IG5 A;  1T5Y A;  1B20 A;  2J8X B;  2RFR A;  3DGM A;  2E2V A;  2KF4 A;  4XDV A;  3S27 A;  1E3V A;  2SBL A;  2ZL8 A;  3FZW A;  5BU4 A;  2B1X B;  5D81 A;  1EG9 B;  3S67 A;  1LXE A;  1IT7 A;  3K63 A;  5IF6 A;  3KZT A;  3NXJ A;  3J7Y d;  3HII A;  3EBT A;  2K3D A;  4BTW A;  2CFW A;  1X1U A;  3HZP A; 
#chains in the Genus database with same CATH homology
 5FGO A;  1TU5 A;  5FW5 A;  2CW9 A;  1O7G B;  4KFE A;  4N6M A;  5AYR B;  1SII A;  2Y74 A;  1ULJ B;  4HJL B;  1VQK 3;  1NO3 A;  1W6G A;  1NB3 I;  2OCT A;  2W56 A;  5IEO A;  3G8Z A;  2C10 A;  4EV2 A;  3V99 A;  7STD A;  3NM2 A;  2GEX A;  3WA2 X;  1MOL A;  1JB2 A;  3Q1C A;  3BNB A;  1YHQ 3;  4RBN A;  4HZB B;  1Q40 B;  1TFK A;  2XSO B;  1EQK A;  4CCV A;  3D3L A;  3CCR 3;  2CFL A;  1WMP A;  3EQQ B;  4KZ1 A;  2OTJ 3;  3BB9 A;  3RGA A;  3FG3 A;  4AKZ A;  4HM6 B;  1IQY A;  2GU1 A;  3EHC A;  1QAL A;  1U8C B;  3LTD A;  1PU4 A;  2XGN A;  3T8U A;  4FR9 A;  4FMC A;  1W00 A;  1D6Y A;  1VQP 3;  1W7C A;  4J9A A;  2W04 A;  1YI2 3;  1JKG B;  4MMZ B;  5G2G A;  5A0O B;  4R9L A;  1W2B 2;  4HM3 B;  3UNL A;  3NUV A;  2RCD A;  5CXO A;  4FMA A;  1OH0 A;  1GY6 A;  2MC8 A;  2B24 B;  2O9U X;  3H3H A;  1SJW A;  1FGQ A;  1EA2 A;  1US1 A;  1JB4 A;  3O8Y A;  1AVL A;  1YIT 3;  3GWR A;  3FF2 A;  2W9P A;  4KVH A;  3HK4 A;  2LYX A;  4O3V A;  4HM7 B;  4BTX A;  1GD4 A;  2Y73 A;  1N9J A;  3B7C A;  5AII A;  6STD A;  1KQS 2;  1DMQ A;  2P09 A;  3UJM A;  3MWZ A;  5JPP A;  4LMI A;  2XRX B;  2W9Q A;  1VZZ A;  3ER7 A;  1J2B A;  5AIH A;  3KSE D;  1KD1 4;  1DYU A;  1SQW A;  2E2T A;  3GZY B;  1IU7 A;  1O7W B;  3Q90 A;  3HI7 A;  4QWT A;  1IT8 A;  1VQN 3;  1WMO A;  1N9E A;  4NRE A;  4AKY A;  3CPO A;  3GAX A;  4KFF A;  4J8T A;  4XDW A;  3CCL 3;  2XEP A;  4FCZ A;  3MKI A;  4EYC A;  1OHO A;  2BMQ B;  2Z7A A;  2W0Q A;  3BNE A;  3FF0 A;  5IG4 A;  4U13 A;  2OWP A;  5CLK A;  5LC7 A;  3LTC A;  2F98 A;  1G96 A;  5IER A;  1M1K 4;  3WOF B;  2CFD A;  1UI8 A;  2D1W A;  4K1U A;  4BTY A;  1NB5 I;  1IDP A;  3CCQ 3;  3DGL A;  1QVG 2;  3RDE A;  2CHC A;  4WFO A;  3KII A;  2CIU A;  3DGN A;  3X3Z A;  1HKX A;  3EN1 B;  1N5H A;  1KC8 4;  1ZO2 A;  3FG4 A;  2RSX A;  1E3R A;  2LQV A;  3JUQ A;  2L4V A;  2CG1 A;  4HYZ A;  2WO0 A;  1O7M B;  2CG0 A;  1V74 A;  2BT3 A;  3NBR A;  1K28 A;  4Q53 A;  3WOE B;  3NM7 A;  5EEO A;  2JDI H;  1TP6 A;  3OXA A;  4STD A;  1A90 A;  5IEP A;  1OF5 A;  2QA4 3;  2KCD A;  1Q86 4;  3BND A;  4N3V A;  3FCS B;  1OGX A;  2C11 A;  4RNY A;  2CC3 A;  1DVD A;  3T8N A;  2OTL 3;  3LT8 A;  3ROB A;  4LGQ A;  5KP3 A;  3L0R A;  1Y4K A;  3OWY A;  4JRF A;  1PFP A;  3SX1 A;  2QIY A;  3OWU A;  3MG1 A;  1CEW I;  1TUH A;  4OUQ A;  5STD A;  3UL5 A;  1ISK A;  4KFD A;  1W2Z A;  5AIF A;  2CFK A;  3X3X A;  2BMO B;  3GZX B;  4WHA A;  1O7P B;  2GBW B;  1YJW 3;  5CK6 A;  3FSD A;  3CU3 A;  4AEQ A;  3CCE 3;  1OGZ A;  4WYK B;  5AEU B;  3JVC A;  3FKA A;  4PEJ A;  3BLZ A;  3JUM A;  3SOA A;  3X3Y A;  2BNG A;  3SLU A;  1N8R 4;  4WP5 A;  5D82 A;  4GL6 A;  3V92 A;  1A67 A;  3OX9 A;  2YX9 A;  1CYV A;  1GYB A;  1UUW B;  3IJE B;  3FLJ A;  1HU9 A;  1ASK A;  3CNX A;  4L7K A;  3WOD G;  4LSO A;  1LNH A;  2Z6B A;  1STD A;  3TDG A;  3N8B A;  3S29 A;  3WA3 A;  3QRD A;  3NV0 B;  4N6O B;  4N6L A;  3V98 A;  1CYU A;  4MMY B;  1VQ6 3;  3NBB A;  3CCU 3;  4HVN A;  1OAC A;  3LXU X;  4WYK A;  4MMX B;  1ZX2 A;  3F7X A;  4HM2 B;  4EC6 A;  3N54 B;  8CHO A;  3B4O A;  3PXM A;  2WOF A;  3MHE A;  2OQE A;  1Q40 A;  3DUK A;  5IG3 A;  3SVA A;  2FXT A;  5I97 A;  1JNQ A;  1NU3 A;  2D42 A;  4K90 B;  1MNL A;  1GS3 A;  1KWI A;  1QAK A;  2XH9 A;  5JPU A;  3I56 3;  3X41 A;  5KP1 A;  2HMM B;  3DY5 A;  3MPH A;  2RGQ A;  4EBG A;  1W01 A;  4XBT A;  4I4K A;  2FGT A;  3NV0 A;  2HML B;  3DM8 A;  1VQ7 3;  2CFG A;  3CCS 3;  4H61 A;  1JKG A;  3G6E 3;  1JJ2 2;  1IV9 A;  2QEX 3;  2OQE C;  1VQO 3;  2XF3 A;  3MYT A;  2IA7 A;  1VQM 3;  1LOX A;  1YVB I;  2INX A;  4NHF A;  5AI1 A;  1JN5 B;  4K61 A;  1K9M 4;  1D6Z A;  3CPW 2;  1DVC A;  1OCV A;  3JUP A;  3B8L A;  1DMN A;  1NJI 4;  2OOV A;  1STF I;  3K0Z A;  4N6V 0;  1UW1 A;  1A2V A;  4HM5 B;  4ZM8 A;  3PYJ A;  2UX0 A;  4HM8 B;  2JQ5 A;  2CH9 A;  1RRL A;  1W6Y A;  3SED A;  2IUJ A;  3EE1 A;  3AMO B;  3FGY A;  3DGO A;  3BNC A;  5KP4 A;  3GRD A;  3K9M C;  4X2H A;  5CF1 A;  1YIJ 3;  4N6U A;  3MG2 A;  2XSH B;  4XBX A;  4N6N B;  1YJN 3;  4OVM A;  1RRH A;  3MG3 A;  2P05 A;  2BO9 B;  3HIG A;  3CXC 2;  1IVX A;  5AIG A;  5CF2 A;  2XFS A;  4LZI A;  3QK9 A;  3LTA A;  1IQX A;  1N5P A;  4R9K A;  2Z76 A;  1FGO A;  1W6C A;  1OHP A;  4G1M B;  3DXO A;  3HX8 A;  1YJ9 3;  3LH4 A;  4R1K A;  4O8S A;  1BUQ A;  2QGU A;  1KSI A;  2GEY A;  2YFJ B;  2MF7 A;  4R4K A;  3T0U A;  1O7N B;  4IIA A;  1VQ9 3;  3N9H A;  1IQ8 A;  1OUN A;  1C7H A;  3UB1 A;  3I0Y A;  4FMB A;  1AVK A;  1NWW A;  4GB5 A;  5TGN A;  3F7S A;  1Z1S A;  3H51 A;  2HMK B;  3CMA 3;  1EKM A;  1S5A A;  2ML6 A;  1LVN A;  2I9W A;  1O7H B;  2W6J H;  3FG1 A;  1IV7 A;  1L5G B;  3CME 3;  2M7O A;  3JUN A;  1FGR A;  1RKY A;  1GD3 A;  4HM0 B;  5LC6 A;  3STD A;  3EBY A;  3ECF A;  3A76 A;  3LML A;  2E2U A;  4XBY A;  3GZR A;  2P0X A;  3JUO A;  3PCR A;  1CQS A;  4N6T A;  2XFT A;  2XGL A;  1IVW A;  3S28 A;  4XB5 A;  2CWT A;  4FCJ A;  2GU3 A;  4FCM A;  3LOY A;  4HM4 B;  3CNM A;  3OW2 2;  2Q07 A;  4OK0 A;  3K7C A;  1QAF A;  3KFQ C;  5IG0 A;  5EVH A;  1E97 A;  3EC9 A;  3F14 A;  4O2H A;  4RNZ A;  2PZV A;  3FH1 A;  1VQ8 3;  1GY5 A;  3OV4 A;  5AYS C;  3CC4 3;  1JB5 A;  1U5O A;  3B4P A;  1R4C A;  3M8C A;  3PCS A;  2CWV A;  3SOY A;  3NX0 A;  3NQZ A;  2P0M A;  2XR8 B;  3F8X A;  4HZ9 B;  4HBR A;  1S72 3;  3X42 A;  2BHM A;  2W2C A;  1WTH A;  1K41 A;  4L8O A;  3VF1 A;  2W03 A;  5IW9 A;  2P38 A;  3NQY A;  3EB8 A;  1D6U A;  2BMR B;  1AR0 A;  2HMJ B;  1NDO B;  1RJO A;  2CWU A;  3SXX A;  1QJG A;  3PGB A;  3F9S A;  1AV4 A;  5IEN A;  1OHS A;  3DZL A;  1ROA A;  2F86 B;  1QMA A;  1W02 A;  4LEH A;  1OPY A;  5DRV A;  5JBS A;  1QVF 2;  2R4I A;  4HKV B;  1WNH A;  2Z77 A;  3X40 A;  1W5Z A;  2HMO B;  3F40 A;  1FA3 A;  4HM1 B;  3LZA A;  3VGN A;  4EV5 A;  3IMA B;  1IVV A;  4RZM A;  3KE7 A;  1K73 4;  1JV2 B;  1SIH A;  2YFI B;  2K54 A;  2GBX B;  3EN8 A;  3WDG B;  1Q82 4;  3IPT A;  1IVU A;  2CKF B;  2IMJ A;  4WWU C;  3MSO A;  5EQL A;  5AEW B;  2HMN B;  3LTB A;  3EF8 A;  4JF8 A;  1M90 4;  5D83 A;  4R80 A;  1W4N A;  3EX9 A;  5ELU A;  1N8Q A;  1VQ4 3;  1FGM A;  1WMN A;  4O02 B;  4IT7 A;  1GY7 A;  3RGR A;  1FUW A;  1YGE A;  1M9G A;  4MEI A;  3WMD A;  3D9R A;  3PZW A;  4TX4 A;  3E99 A;  4ORL A;  3S5C A;  3G0K A;  3CD6 3;  2PNC A;  3G16 A;  2WOH A;  2CK3 H;  2YFL B;  1SPU A;  1TIJ A;  1JN5 A;  2KXG A;  2WGQ A;  4FMD A;  5DRE A;  2OOV C;  5BXQ A;  5BVB A;  5HGR A;  1Q7Y 4;  1ROV A;  3EJV A;  3OWS A;  3CC2 3;  3DMC A;  3I55 3;  1F8N A;  3KSP A;  3Q2P A;  3CC7 3;  1TFO A;  1OF5 B;  2STD A;  3LT9 A;  2A15 A;  3GZB A;  2ZDJ A;  4IPB A;  3UL6 A;  2IUK A;  1VQL 3;  2WGO A;  2K0M A;  3AMO A;  3G4S 3;  1VQ5 3;  4H3U A;  3U1W A;  3CCM 3;  1Q81 4;  2FNQ A;  1ULI B;  3NBJ A;  4MJD A;  3CCJ 3;  3PS8 A;  3CCV 3;  1K8A 4;  4X2O A;  1IK3 A;  1UI7 A;  2F99 A;  3ALA A;  5ELJ A;  2V1L A;  2O3O A;  3KKG A;  4K1V A;  3NHX A;  3KN4 A;  1A2K A;  3LYG A;  1M1X B;  1UUV B;  2GXF A;  3VSY A;  4CDL A;  2ML5 A;  3F8H A;  4XM4 A;  3U97 A;  3G71 3;  1Q42 A;  1WQL B;  4EXR A;  1JRQ A;  2W56 B;  1DMM A;  1FGT A;  2KRT A;  3K5T A;  1RN7 A;  4L8P A;  5IG5 A;  1T5Y A;  2RFR A;  3DGM A;  2E2V A;  4XDV A;  3S27 A;  1E3V A;  2SBL A;  2ZL8 A;  3FZW A;  2B1X B;  5D81 A;  1EG9 B;  3S67 A;  1LXE A;  1IT7 A;  3K63 A;  5IF6 A;  3KZT A;  3NXJ A;  3J7Y d;  3HII A;  3EBT A;  4BTW A;  2CFW A;  3HZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...