3CNXA

Crystal structure of a putative dehydratase from the ntf2-like family (sav_4671) from streptomyces avermitilis at 2.10 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
138
Chain Sequence
TPDTDVEQVGLANTAFYEAMERGDFETLSSLWLTPADLGVPADAGVVSCVHPGWPVLSGRGEVLRSYALIMANTEYIQFFLTDVHVSVTGDTALVTCTENILSGGGPLVGQLVVATNVFRRTPDGWKLWSHHASPVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF2-like protein of unknown function (NP_825848.1) from Streptomyces avermitilis at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis
total genus 40
structure length 138
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cnxA00
3JUOA 1JB4A 3OWYA 1W6YA 3NV0B 5EVHA 3ER7A 3EBYA 8CHOA 1UUVB 3DXOA 4STDA 4I4KA 3DM8A 2STDA 5IG5A 5CK6A 4LEHA 5IEOA 5CXOA 1O7HB 2RGQA 4XBTA 4RZMA 1OF5A 4FCJA 1VZZA 1SJWA 3FF2A 3OWSA 3BB9A 4Q53A 1HKXA 3HZPA 2B24B 1K41A 2GXFA 4XBYA 3VSYA 3B7CA 1NWWA 3F8XA 3MYTA 4HVNA 3HK4A 1GY5A 4J8TA 2Z7AA 1E3VA 1A2KA 2YFJB 1OHSA 2BMQB 3F7SA 3KKGA 3S5CA 5TGNA 2GBWB 3F40A 3CNXA 3MKIA 4WYKA 2BMOB 4HZ9B 3OXAA 1GYBA 2I9WA 1JN5A 3MG2A 4L7KA 3K7CA 4K1VA 4IIAA 2UX0A 2HMMB 3M8CA 1AR0A 3EN1B 5CF2A 3K0ZA 6STDA 5D83A 3DZLA 3ECFA 2XRXB 3EHCA 3KZTA 3GWRA 3GZRA 3EQQB 4R1KA 5IG3A 3STDA 1Q40B 2INXA 2RCDA 3NV0A 5FW5A 5KP3A 3NXJA 2IMJA 4HZBB 1JKGB 4HM8B 5STDA 4XB5A 2HMLB 4HM2B 4OUQA 1NDOB 3H3HA 4FCMA 4L8OA 1ULJB 3EN8A 4X2OA 3F9SA 3SOYA 3G8ZA 3EX9A 1IDPA 1OUNA 2QIYA 3OWUA 4HM3B 3NM2A 1EG9B 2XSOB 1Q42A 3A76A 5AIHA 2BMRB 3FKAA 4WWUC 3FH1A 1GY7A 2K54A 3F7XA 2A15A 4XDWA 3MG1A 1OPYA 3E99A 4HM1B 2HMNB 3OX9A 1ZX2A 2GEYA 5IG0A 3GZYB 3JUPA 5CF1A 3BLZA 1UUWB 1S5AA 5D82A 3JUQA 3EBTA 4GB5A 1OF5B 5IERA 3GRDA 2W2CA 3GZBA 2JQ5A 4HM0B 3T8NA 5DRVA 1Z1SA 4HKVB 4HM5B 1BUQA 3OV4A 3B8LA 2XR8B 2OWPA 4MJDA 3RGAA 4LGQA 3FGYA 4CDLA 3UNLA 1TUHA 3DUKA 4LMIA 3RGRA 4L8PA 3SEDA 4XM4A 2F99A 1EA2A 1C7HA 3MG3A 4HM7B 5G2GA 4R9KA 5AEUB 1OHPA 4OVMA 2Z76A 5IG4A 4WYKB 3F14A 1JKGA 1JN5B 3EJVA 1DMMA 1TP6A 2CKFB 3MSOA 3LZAA 4HM6B 3NBRA 2YFLB 2RFRA 2QGUA 3UJMA 5IEPA 3GZXB 3G16A 5AIIA 2F98A 3HX8A 3FSDA 4N3VA 3H51A 3FZWA 1QJGA 4XBXA 2GBXB 1O7PB 3EF8A 3IPTA 4WP5A 4X2HA 3D9RA 1OGXA 5KP4A 3G0KA 3JUNA 1ZO2A 2XSHB 4PEJA 2PZVA 3Q90A 1JB5A 3B4PA 3VGNA 1W02A 3FF0A 2BNGA 5CLKA 5KP1A 1JB2A 3EC9A 4HJLB 2HMKB 5BVBA 5DREA 2F86B 3DMCA 1QMAA 2HMJB 3T8UA 7STDA 1ISKA 1U5OA 4KVHA 2R4IA 3F8HA 2Z77A 1ULIB 3B4OA 3ROBA 1W00A 4R9LA 3NHXA 1NU3A 1ASKA 1O7WB 1O7NB 3LYGA 3NUVA 5JPPA 5D81A 1GS3A 1OH0A 5IF6A 5BXQA 1WQLB 1W01A 3I0YA 1E3RA 5HGRA 1DMQA 1OHOA 2HMOB 4ORLA 3CNMA 3WMDA 1STDA 4U13A 3CPOA 1OGZA 5AIFA 2B1XB 4HM4B 3SOAA 1O7GB 2GEXA 1Q40A 3CU3A 3JUMA 2YFIB 1GY6A 1DMNA 5AI1A 1OCVA 4H3UA 3KSPA 3FLJA 2CHCA 5JPUA 5AEWB 4J9AA 3KE7A 3MHEA 5IENA 4K1UA 4XDVA 1E97A 1O7MB 1CQSA 5AIGA
chains in the Genus database with same CATH superfamily
3JUOA 3LTAA 1B2SA 4NREA 1JB4A 3PCRA 2E2VA 3OWYA 5IW9A 1IQYA 1RCLA 1W6YA 1IVVA 5EQLA 2L4VA 1A90A 4EV2A 3NV0B 1T2IA 2D42A 4BIRA 5EVHA 1RGGA 1MWUA 3ER7A 3CCS3 4HYZA 4EXRA 3EBYA 4N6NB 3V92A 1BRHA 5LC6A 1JBTA 3CCM3 1RJOA 1GMRA 3DGMA 5LC7A 1HZ1A 3WODG 4O3VA 1BGSA 8CHOA 1IV7A 1RSNA 3LTCA 1UUVB 3DXOA 4STDA 3TDGA 1HYFA 1AY7A 1EQKA 1IQ8A 4I4KA 1BSAA 1CH0A 2STDA 3DM8A 1K734 1UCJA 3QRDA 1VQM3 1V74A 1FUTA 5IG5A 4FMCA 3DGNA 4LEHA 5CK6A 1T3BA 3T0UA 1IT8A 1W2ZA 2W9PA 1D6UA 2UGIA 1JZOA 1R4CA 4QWTA 4BTWA 1RN7A 1GOVA 2UUGC 2WGQA 5CXOA 5IEOA 1O7HB 2RGQA 3CCU3 1I2EA 1W4NA 4XBTA 4TX4A 3G713 1G96A 3WOEB 4RZMA 3CCQ3 1OF5A 2LQVA 1S723 3LOYA 3I563 4FCJA 4FR9A 3LTDA 2H0HA 1VZZA 1FYSA 1SJWA 3FF2A 1NJI4 3OWSA 1FGOA 3BB9A 4Q53A 1DVCA 1HKXA 1LQGC 3DH2A 3HZPA 4I5QA 1I3FA 1UW1A 5ELJA 1B2UA 2B24B 1NO3A 4MMYB 2Z6BA 1K41A 2GXFA 1YJ93 4XBYA 1B21A 1BRJA 1NNVA 2CFKA 4BL2A 2XGLA 3X3XA 2CK3H 3VSYA 3B7CA 2ZL8A 4EW5A 4N6TA 1NWWA 2CIUA 2OQEC 3F8XA 3MYTA 3PXMA 1M1XB 1VQN3 1I0XA 1IYYA 3IJEB 4HVNA 4HBRA 1T5YA 1W5ZA 2BHMA 2RSXA 3HK4A 3V98A 2GU1A 1GY5A 2H0GA 4R4KA 4EBGA 1A2VA 1B20A 1RMSA 4J8TA 3CCV3 1UCIA 2Z7AA 1E3VA 3EE1A 4MMZB 4BL3A 1A2KA 2YFJB 1OHSA 3NX0A 1C54A 8RNTA 4N6MA 2BMQB 2XGNA 4KFFA 4N6OB 3F7SA 2PNCA 3KKGA 3S5CA 3UL5A 1TRQA 5TGNA 1VQ53 2GBWB 1Q824 2FNQA 3F40A 2IUKA 5G1LA 1MGWA 3CNXA 3MKIA 3PCSA 4WYKA 4AEQA 3RNTA 2BMOB 3AHWA 1BUJA 1WNHA 4HZ9B 3OXAA 1GYBA 2I9WA 3BNEA 2XH9A 1JN5A 1FGQA 3MG2A 4L7KA 3K7CA 4K1VA 3FCSB 3S29A 4IIAA 2F5MA 2UX0A 3DGOA 3IMAB 1LOVA 1QALA 2HMMB 3M8CA 7GSPA 1AR0A 2QA43 4MMXB 3EN1B 4RNZA 5ELUA 5CF2A 3ALAA 1X1YA 3K0ZA 1BNEA 1ROVA 1BSBA 6STDA 4CJNA 5M18A 5D83A 3HOHA 1Q7HA 1IU7A 1SARA 2CX1A 2XFTA 4J5KA 1YVBI 3U97A 3UL6A 3EB8A 3DZLA 1L5GB 3GSPA 3CC73 2CC3A 2FXTA 1FA3A 3ECFA 3N9HA 1UGIA 1TFOA 4H61A 3FG4A 5JBSA 3D79A 2C10A 2IA7A 1UI7A 3SVAA 2OTJ3 1IVWA 3AMOA 3EHCA 3KZTA 4EYCA 1WMNA 2W56A 3FG3A 2AADA 3GWRA 1MGRA 1RGEA 3GZRA 4O8SA 3EQQB 1SPUA 4R1KA 5IG3A 1LNHA 2FGTA 2MC8A 1RDSA 1MWTA 1KD14 3A5EA 2HOHA 3STDA 4HOHA 1Q40B 2OOVA 2INXA 1VQK3 3D3LA 5FGOA 1I3IA 1TRPA 2RCDA 1ROAA 3NBBA 1W6CA 3NV0A 4G1MB 5FW5A 5KP3A 3WR2A 3NXJA 2Y74A 2IMJA 3X3YA 4DKIA 3URPA 1MWRA 2C4BA 1UUGB 1JKGB 4HM8B 4HZBB 3SXXA 2WOHA 5STDA 4KFEA 1GOYA 1FGRA 2P0XA 1T2HA 4XB5A 1BRKA 1KWIA 2HMLB 3HIGA 4HM2B 1IT7A 4LSOA 1VQ93 1N8QA 4R80A 1GD4A 2K0MA 2WGOA 4OUQA 1NDOB 3H3HA 3ZG0A 4IT7A 1YVSA 1AV4A 3WA3A 4FCMA 1FUWA 1A2PA 4AKYA 4L8OA 1KC84 1ULJB 3EN8A 3BNDA 3F9SA 2KXGA 3LXUX 3G8ZA 4X2OA 3SOYA 3EX9A 1IDPA 1OUNA 2QIYA 3OWUA 4K90B 4HM3B 3NM2A 1VQ63 1M1K4 3OW22 1EG9B 1YHQ3 2XSOB 1BRIA 1Q42A 1TTOA 3A76A 2CWVA 1VQ43 1ZS7A 1I2FA 1LOXA 1LVNA 1BSCA 2BMRB 3FKAA 5AIHA 4CCVA 1YIJ3 4WWUC 1STFI 1GOUA 2MF7A 1AVKA 2ZA4A 3FH1A 1GY7A 1VQQA 2K54A 1LQMB 3F7XA 2IYJA 1PYLA 3MPHA 1VQO3 3V99A 4GHOA 2A15A 3LT8A 4XDWA 3MG1A 1G0TA 3AHSA 3KSED 4N6LA 3CCL3 1PU4A 3Q3FA 4K61A 4OK0A 1GD3A 1OPYA 2XFSA 3E99A 2IUJA 3MWZA 4HM1B 3SYUA 1BRGA 3RDEA 2HMNB 1IQXA 2KF3A 3HIIA 3OX9A 3WHOA 1Q9EA 1ZX2A 2GU3A 2KF6A 2GEYA 1SIHA 3K9MC 4KFDA 4FCZA 5IG0A 3GZYB 3X42A 3JUPA 1BNRA 2LYXA 1I2GA 5CF1A 2CG0A 1UGHI 3DGYA 3CXC2 4LYLB 1KSIA 1JNQA 1QVF2 3BLZA 3CCE3 1UUWB 2AAEA 1S5AA 1PFPA 5D82A 1JBRA 3JUQA 3EBTA 3QK9A 4NPBA 5AIGA 6GSPA 2RBIA 3BIRA 1D6YA 4GB5A 1RTUA 1OF5B 1BNIA 5AYSC 5IERA 1VQ83 3I553 3GRDA 3D5IA 2W2CA 2BIRA 2KF5A 7RNTA 3GZBA 3CC43 2JQ5A 1MWSA 3NM7A 4HM0B 3T8NA 5DRVA 1Z1SA 3K63A 4HKVB 4HM5B 4NHFA 1BUQA 3OV4A 2CFLA 4KZ1A 4RBNA 3ZFZA 1BIRA 2Y73A 3J7Yd 1IVUA 2YX9A 2XR8B 2OWPA 3B8LA 4MJDA 1YJN3 3RGAA 1RRLA 2JDIH 4LGQA 3FGYA 4CDLA 2E2UA 1TJDA 4MEIA 3UNLA 9RNTA 1SIIA 1TUHA 3S27A 3DUKA 4FMAA 1BU4A 1GMQA 2BT3A 4LMIA 1YI23 1RNBA 3RGRA 6RNTA 2CWTA 1WMOA 4LZIA 4L8PA 4O2HA 2SARA 3KN4A 3SEDA 3G6E3 1B2MA 4XM4A 1V57A 2F99A 4WFOA 5A0OB 1EA2A 1K9M4 2CW9A 1C7HA 1WTHA 1I0VA 3MG3A 4HM7B 3SX1A 1NB5I 4WHAA 5G2GA 3U1WA 3CME3 4R9KA 3X41A 1BAOA 2O3OA 5AEUB 3AGNA 1OHPA 1BNSA 2CFGA 4OVMA 2W03A 1VQP3 4N6V0 3PYJA 2Z76A 1WMPA 3G4S3 2GSPA 1IV9A 2C11A 5IG4A 1UCLA 4WYKB 3F14A 3KFQC 4J5GA 1OACA 1X1UA 1JKGA 1LOWA 1K8A4 2F4YA 1JN5B 3EJVA 1DMMA 2OQEA 1TP6A 4RNTA 2V1LA 2CKFB 1EUIC 2OCTA 3MSOA 3NBJA 1N9JA 1JRQA 3LZAA 4HM6B 3CPW2 5HOHA 1PY3A 1SQWA 4AKZA 3NBRA 2YFLB 3WDGB 1NB3I 3BNBA 4FMBA 4O02B 3SLUA 2RFRA 2CFWA 2QGUA 1DVDA 3UJMA 5IEPA 1BNJA 3GZXB 3VF1A 1RNTA 1BNFA 1HU9A 1QAKA 3CC23 1Y4KA 2CWUA 1U8CB 1QAFA 3G16A 1MOLA 5AIIA 5G1KA 1YGWA 3AMOB 3LT9A 1TIJA 5M1AA 1TU5A 1Q7Y4 3WA2X 1B2XA 1AVLA 2F98A 3HX8A 1N5PA 2K3DA 1BNGA 3UB1A 3FSDA 3X40A 4N3VA 3H51A 3CMA3 1KQS2 2H0IA 1ZGXA 3GAXA 3D5GA 1RN4A 3FZWA 4BU4A 1I8VA 1QJGA 4XBXA 1US1A 2GBXB 1O7PB 3EF8A 3IPTA 4WP5A 3BU4A 4X2HA 3N54B 3PS8A 1M9GA 3KIIA 1R4YA 3D9RA 1OGXA 5KP4A 3G0KA 3JUNA 2CG1A 3DY5A 4IPBA 5I97A 1ZO2A 2XSHB 4PEJA 2PZVA 1LXEA 1JB5A 2ZDJA 3B4PA 3Q90A 3S67A 2ML5A 1F8NA 3LTBA 3VGNA 1W2B2 1RGFA 1W02A 2O9UX 3FF0A 1W7CA 2BNGA 5CLKA 5KP1A 1B3SA 1JB2A 1UCKA 4BTYA 2KRTA 3EC9A 4HJLB 3PGBA 1RKYA 2HMKB 2E2TA 3CCJ3 5BVBA 2R41A 2QEX3 5DREA 4CPKA 2F86B 4RNYA 2P05A 1RGKA 1Q864 1RGHA 3DMCA 1QMAA 2KF4A 1N5HA 2CH9A 1FZUA 3Q2PA 2HMJB 3X3ZA 3T8UA 7STDA 3N8BA 1GMPA 1ISKA 1U5OA 1X1XA 4KVHA 3AGOA 1YJW3 2W0QA 2R4IA 5M19A 1QVG2 1BSDA 1I70A 1D6ZA 2M7OA 3FG1A 1RLSA 3L0RA 3F8HA 1FGMA 3Q1CA 4EC6A 1VQ73 3CCR3 1VQL3 2P09A 2CX0A 2Z77A 3WOFB 4EV5A 1RRHA 2L1SA 1EKMA 1ULIB 3B4OA 1W00A 4R9LA 1K28A 3ROBA 1FUSA 1BOXA 1DYUA 1EEJA 1RN1A 3NHXA 1NU3A 1RGAA 4N6UA 5RNTA 1RHLA 1JBSA 1ASKA 1O7WB 1O7NB 3LMLA 3LYGA 3NUVA 5JPPA 1M904 2OTL3 2KAAA 5D81A 1JJ22 2P0MA 1N8R4 1DE3A 2D1WA 2OOVC 1LRAA 2SBLA 4ILFA 1GS3A 1OH0A 3O8YA 3PZWA 1AQZA 5IF6A 1JZDA 1CYVA 3BNCA 1B27A 5GSPA 3DGLA 5BXQA 1UI8A 1WQLB 1BANA 1CEWI 1FGTA 1W01A 3I0YA 1E3RA 1DETA 4ORLA 1DMQA 1OHOA 2HMOB 5HGRA 2W04A 3CNMA 1IK3A 3WMDA 1MNLA 1STDA 1YIT3 1BRNL 4U13A 3CPOA 1OGZA 3D4AA 5AIFA 4KT3B 2WO0A 3CD63 1B2ZA 1JV2B 1YNVX 2RNTA 1J2BA 5BU4A 4JF8A 2B1XB 4HM4B 2W9QA 3NQZA 4HAAA 3SOAA 1CYUA 5EEOA 2J8XB 1RCKA 1O7GB 2GEXA 1Q40A 2CFDA 1G02A 3CU3A 2WOFA 3JVCA 2XEPA 3JUMA 1RGLA 2YFIB 3ZG5A 1RGCA 1GY6A 2XF3A 4BTXA 1DMNA 1LNIA 5AI1A 2F56A 1OCVA 1LOYA 1X1WA 2KCDA 1A67A 1BRSA 4H3UA 3KSPA 1TFKA 3S28A 1YGEA 1UDII 2BU4A 1FW7A 2W6JH 3FLJA 2P38A 2CHCA 3K5TA 5BIRA 3LH4A 5JPUA 1BVIA 4JRFA 4ZM8A 4GSPA 4J9AA 5AEWB 1V58A 5AYRB 1N9EA 3KE7A 3KCHA 3MHEA 3HI7A 2Q07A 4FMDA 2IY2A 1GSPA 2F5WA 3NQYA 5IENA 2ML6A 1BSEA 4K1UA 1W6GA 1E97A 4XDVA 2BO9B 1Q814 1IVXA 2W56B 1O7MB 1CQSA 4GL6A 2XRXB 2ZHXB
chains in the Genus database with same CATH topology
3JUOA 3LTAA 4NREA 1JB4A 3PCRA 2E2VA 3OWYA 5IW9A 1IQYA 1W6YA 1IVVA 5EQLA 2L4VA 1A90A 4EV2A 3NV0B 2D42A 5EVHA 3ER7A 3CCS3 4HYZA 4EXRA 3EBYA 4N6NB 3V92A 5LC6A 3CCM3 1RJOA 3DGMA 5LC7A 3WODG 4O3VA 8CHOA 1IV7A 3LTCA 1UUVB 3DXOA 4STDA 3TDGA 1EQKA 1IQ8A 4I4KA 3DM8A 2STDA 1K734 3QRDA 1VQM3 1V74A 5IG5A 4FMCA 3DGNA 4LEHA 5CK6A 3T0UA 1IT8A 1W2ZA 2W9PA 1D6UA 4QWTA 1R4CA 4BTWA 1RN7A 2WGQA 5CXOA 5IEOA 1O7HB 2RGQA 3CCU3 4XBTA 1W4NA 3G713 4TX4A 3CCQ3 1G96A 3WOEB 4RZMA 1S723 1OF5A 2LQVA 3LOYA 3I563 4FCJA 4FR9A 3LTDA 1VZZA 1SJWA 3FF2A 1NJI4 3OWSA 1FGOA 3BB9A 4Q53A 1DVCA 1HKXA 3HZPA 1UW1A 5ELJA 2B24B 1NO3A 4MMYB 2Z6BA 1K41A 2GXFA 1YJ93 4XBYA 2CFKA 2XGLA 2CK3H 3VSYA 3B7CA 2ZL8A 4N6TA 1NWWA 2CIUA 2OQEC 3F8XA 3MYTA 3PXMA 1M1XB 1VQN3 3IJEB 4HVNA 4HBRA 1T5YA 1W5ZA 2BHMA 2RSXA 3HK4A 3V98A 2GU1A 1GY5A 4R4KA 4EBGA 1A2VA 4J8TA 3CCV3 2Z7AA 1E3VA 3EE1A 4MMZB 1A2KA 2YFJB 1OHSA 3NX0A 4N6MA 2BMQB 2XGNA 4KFFA 4N6OB 3F7SA 2PNCA 3KKGA 3S5CA 3UL5A 5TGNA 1VQ53 2GBWB 1Q824 2FNQA 3F40A 2IUKA 4AEQA 3CNXA 3MKIA 3PCSA 4WYKA 2BMOB 1WNHA 4HZ9B 3OXAA 1GYBA 2I9WA 3BNEA 2XH9A 1JN5A 1FGQA 3MG2A 4L7KA 3K7CA 4K1VA 3FCSB 3S29A 4IIAA 3DGOA 2UX0A 3IMAB 1QALA 2HMMB 3M8CA 1AR0A 2QA43 4MMXB 3EN1B 4RNZA 5ELUA 5CF2A 3ALAA 3K0ZA 1ROVA 6STDA 5D83A 2XFTA 1IU7A 3U97A 3UL6A 1YVBI 3EB8A 3DZLA 1L5GB 1FA3A 3CC73 2CC3A 2FXTA 3ECFA 3N9HA 1TFOA 4H61A 3FG4A 5JBSA 2C10A 2IA7A 1UI7A 3SVAA 2OTJ3 1IVWA 3AMOA 3EHCA 3KZTA 4EYCA 1WMNA 2W56A 3FG3A 3GWRA 4O8SA 3GZRA 3EQQB 1SPUA 4R1KA 5IG3A 1LNHA 2FGTA 2MC8A 1KD14 3STDA 1Q40B 2OOVA 2INXA 1VQK3 3D3LA 5FGOA 2RCDA 3NV0A 3X3XA 1ROAA 3NBBA 1W6CA 4G1MB 5FW5A 5KP3A 3X3YA 3NXJA 2Y74A 2IMJA 4HZBB 1JKGB 4HM8B 3SXXA 2WOHA 5STDA 4KFEA 1FGRA 2P0XA 4XB5A 1KWIA 2HMLB 3HIGA 4HM2B 1IT7A 4LSOA 1VQ93 1N8QA 4R80A 1GD4A 2K0MA 2WGOA 4OUQA 1NDOB 3H3HA 4IT7A 1AV4A 3WA3A 4FCMA 1FUWA 4AKYA 4L8OA 1KC84 1ULJB 3EN8A 3BNDA 3F9SA 2KXGA 3LXUX 3G8ZA 4X2OA 3SOYA 3EX9A 1IDPA 1OUNA 2QIYA 3OWUA 4K90B 4HM3B 3NM2A 1VQ63 1M1K4 3OW22 1EG9B 1YHQ3 2XSOB 1Q42A 3A76A 2CWVA 1VQ43 1LOXA 1LVNA 5AIHA 2BMRB 3FKAA 4CCVA 1YIJ3 4WWUC 1STFI 2MF7A 1AVKA 3FH1A 1GY7A 2K54A 3F7XA 3MPHA 1VQO3 3V99A 2A15A 3LT8A 4XDWA 3MG1A 3KSED 4N6LA 3CCL3 1PU4A 4K61A 4OK0A 1GD3A 1OPYA 2XFSA 3E99A 2IUJA 3MWZA 4HM1B 3RDEA 2HMNB 1IQXA 3HIIA 3OX9A 1ZX2A 2GU3A 2GEYA 1SIHA 3K9MC 4KFDA 4FCZA 5IG0A 3GZYB 3X42A 3JUPA 2LYXA 5CF1A 2CG0A 3CXC2 1KSIA 1JNQA 1QVF2 3BLZA 3CCE3 1UUWB 1S5AA 1PFPA 5D82A 3JUQA 3EBTA 3QK9A 5AIGA 4GB5A 1D6YA 5AYSC 1OF5B 5IERA 1VQ83 3I553 3GRDA 2W2CA 3GZBA 3CC43 2JQ5A 3NM7A 4HM0B 3T8NA 5DRVA 1Z1SA 3K63A 4HKVB 4HM5B 4NHFA 1BUQA 3OV4A 2CFLA 4KZ1A 4RBNA 3J7Yd 2Y73A 1IVUA 2YX9A 2XR8B 2OWPA 3B8LA 4MJDA 1YJN3 3RGAA 1RRLA 2JDIH 4LGQA 3FGYA 4CDLA 2E2UA 4MEIA 3UNLA 1SIIA 1TUHA 3S27A 3DUKA 4FMAA 4LMIA 2BT3A 1YI23 3RGRA 2CWTA 1WMOA 4LZIA 4L8PA 4O2HA 3G6E3 3KN4A 3SEDA 4XM4A 2F99A 4WFOA 5A0OB 1EA2A 1K9M4 2CW9A 1C7HA 1WTHA 3MG3A 4HM7B 3SX1A 1NB5I 4WHAA 5G2GA 3U1WA 3CME3 4R9KA 3X41A 5AEUB 2O3OA 1OHPA 4OVMA 2CFGA 2W03A 1VQP3 4N6V0 3PYJA 2Z76A 1WMPA 3G4S3 1IV9A 2C11A 5IG4A 4WYKB 3F14A 3KFQC 1OACA 1JKGA 1K8A4 1JN5B 3EJVA 1DMMA 2OQEA 1TP6A 2V1LA 2CKFB 2OCTA 3MSOA 3NBJA 1N9JA 1JRQA 3LZAA 4HM6B 3CPW2 1SQWA 4AKZA 3NBRA 2YFLB 3WDGB 1NB3I 3BNBA 4FMBA 4O02B 3SLUA 2RFRA 2CFWA 2QGUA 1DVDA 3UJMA 5IEPA 3GZXB 3VF1A 1HU9A 1QAKA 3CC23 1Y4KA 2CWUA 1U8CB 1QAFA 3G16A 1MOLA 5AIIA 3AMOB 3LT9A 1TIJA 1TU5A 1Q7Y4 3WA2X 1AVLA 2F98A 3HX8A 1N5PA 3UB1A 3FSDA 3X40A 4N3VA 3H51A 3CMA3 1KQS2 3GAXA 3FZWA 1QJGA 4XBXA 1US1A 2GBXB 1O7PB 3EF8A 3IPTA 4WP5A 4X2HA 3N54B 3PS8A 1M9GA 3KIIA 3D9RA 1OGXA 5KP4A 3G0KA 3JUNA 2CG1A 3DY5A 4IPBA 5I97A 1ZO2A 2XSHB 4PEJA 2PZVA 1LXEA 1JB5A 2ZDJA 3B4PA 3Q90A 3S67A 2ML5A 1F8NA 3LTBA 3VGNA 1W2B2 1W02A 2O9UX 3FF0A 1W7CA 2BNGA 5CLKA 5KP1A 1JB2A 4BTYA 2KRTA 3EC9A 4HJLB 3PGBA 1RKYA 2HMKB 2E2TA 3CCJ3 5BVBA 2QEX3 5DREA 2F86B 4RNYA 2P05A 1Q864 3DMCA 3Q2PA 1QMAA 1N5HA 2CH9A 3X3ZA 2HMJB 3T8UA 7STDA 3N8BA 1ISKA 1U5OA 4KVHA 1YJW3 2W0QA 2R4IA 1QVG2 1D6ZA 2M7OA 3FG1A 3L0RA 3Q1CA 3F8HA 1FGMA 1VQ73 4EC6A 1VQL3 3CCR3 2P09A 2Z77A 3WOFB 4EV5A 1RRHA 1EKMA 1ULIB 3B4OA 1W00A 4R9LA 1K28A 3ROBA 1DYUA 3NHXA 1NU3A 4N6UA 1ASKA 1O7WB 1O7NB 3LMLA 3LYGA 3NUVA 5JPPA 1M904 2OTL3 5D81A 1JJ22 2P0MA 1N8R4 2D1WA 2OOVC 2SBLA 1GS3A 1OH0A 3O8YA 3PZWA 5IF6A 1CYVA 3BNCA 3DGLA 5BXQA 1UI8A 1CEWI 1WQLB 1FGTA 1W01A 3I0YA 1E3RA 4ORLA 1DMQA 1OHOA 2HMOB 5HGRA 2W04A 3CNMA 1IK3A 3WMDA 1MNLA 1STDA 1YIT3 4U13A 3CPOA 1OGZA 5AIFA 2WO0A 3CD63 1JV2B 1J2BA 4JF8A 2B1XB 4HM4B 2W9QA 3NQZA 3SOAA 1CYUA 5EEOA 1O7GB 2GEXA 1Q40A 2CFDA 3CU3A 2WOFA 3JVCA 2XEPA 3JUMA 2YFIB 2XF3A 1GY6A 4BTXA 1DMNA 5AI1A 1A67A 1OCVA 2KCDA 4H3UA 3KSPA 1TFKA 3S28A 1YGEA 2W6JH 3FLJA 2P38A 2CHCA 3K5TA 3LH4A 5JPUA 4JRFA 5AEWB 4ZM8A 4J9AA 5AYRB 1N9EA 3KE7A 3MHEA 3HI7A 2Q07A 4FMDA 3NQYA 5IENA 2ML6A 4K1UA 1W6GA 1E97A 4XDVA 2BO9B 1Q814 1IVXA 2W56B 1O7MB 1CQSA 4GL6A 2XRXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUO A;  1JB4 A;  3OWY A;  1W6Y A;  3NV0 B;  5EVH A;  3ER7 A;  3EBY A;  8CHO A;  1UUV B;  3DXO A;  4STD A;  4I4K A;  3DM8 A;  2STD A;  5IG5 A;  5CK6 A;  4LEH A;  5IEO A;  5CXO A;  1O7H B;  2RGQ A;  4XBT A;  4RZM A;  1OF5 A;  4FCJ A;  1VZZ A;  1SJW A;  3FF2 A;  3OWS A;  3BB9 A;  4Q53 A;  1HKX A;  3HZP A;  2B24 B;  1K41 A;  2GXF A;  4XBY A;  3VSY A;  3B7C A;  1NWW A;  3F8X A;  3MYT A;  4HVN A;  3HK4 A;  1GY5 A;  4J8T A;  2Z7A A;  1E3V A;  1A2K A;  2YFJ B;  1OHS A;  2BMQ B;  3F7S A;  3KKG A;  3S5C A;  5TGN A;  2GBW B;  3F40 A;  3CNX A;  3MKI A;  4WYK A;  2BMO B;  4HZ9 B;  3OXA A;  1GYB A;  2I9W A;  1JN5 A;  3MG2 A;  4L7K A;  3K7C A;  4K1V A;  4IIA A;  2UX0 A;  2HMM B;  3M8C A;  1AR0 A;  3EN1 B;  5CF2 A;  3K0Z A;  6STD A;  5D83 A;  3DZL A;  3ECF A;  2XRX B;  3EHC A;  3KZT A;  3GWR A;  3GZR A;  3EQQ B;  4R1K A;  5IG3 A;  3STD A;  1Q40 B;  2INX A;  2RCD A;  3NV0 A;  5FW5 A;  5KP3 A;  3NXJ A;  2IMJ A;  4HZB B;  1JKG B;  4HM8 B;  5STD A;  4XB5 A;  2HML B;  4HM2 B;  4OUQ A;  1NDO B;  3H3H A;  4FCM A;  4L8O A;  1ULJ B;  3EN8 A;  4X2O A;  3F9S A;  3SOY A;  3G8Z A;  3EX9 A;  1IDP A;  1OUN A;  2QIY A;  3OWU A;  4HM3 B;  3NM2 A;  1EG9 B;  2XSO B;  1Q42 A;  3A76 A;  5AIH A;  2BMR B;  3FKA A;  4WWU C;  3FH1 A;  1GY7 A;  2K54 A;  3F7X A;  2A15 A;  4XDW A;  3MG1 A;  1OPY A;  3E99 A;  4HM1 B;  2HMN B;  3OX9 A;  1ZX2 A;  2GEY A;  5IG0 A;  3GZY B;  3JUP A;  5CF1 A;  3BLZ A;  1UUW B;  1S5A A;  5D82 A;  3JUQ A;  3EBT A;  4GB5 A;  1OF5 B;  5IER A;  3GRD A;  2W2C A;  3GZB A;  2JQ5 A;  4HM0 B;  3T8N A;  5DRV A;  1Z1S A;  4HKV B;  4HM5 B;  1BUQ A;  3OV4 A;  3B8L A;  2XR8 B;  2OWP A;  4MJD A;  3RGA A;  4LGQ A;  3FGY A;  4CDL A;  3UNL A;  1TUH A;  3DUK A;  4LMI A;  3RGR A;  4L8P A;  3SED A;  4XM4 A;  2F99 A;  1EA2 A;  1C7H A;  3MG3 A;  4HM7 B;  5G2G A;  4R9K A;  5AEU B;  1OHP A;  4OVM A;  2Z76 A;  5IG4 A;  4WYK B;  3F14 A;  1JKG A;  1JN5 B;  3EJV A;  1DMM A;  1TP6 A;  2CKF B;  3MSO A;  3LZA A;  4HM6 B;  3NBR A;  2YFL B;  2RFR A;  2QGU A;  3UJM A;  5IEP A;  3GZX B;  3G16 A;  5AII A;  2F98 A;  3HX8 A;  3FSD A;  4N3V A;  3H51 A;  3FZW A;  1QJG A;  4XBX A;  2GBX B;  1O7P B;  3EF8 A;  3IPT A;  4WP5 A;  4X2H A;  3D9R A;  1OGX A;  5KP4 A;  3G0K A;  3JUN A;  1ZO2 A;  2XSH B;  4PEJ A;  2PZV A;  3Q90 A;  1JB5 A;  3B4P A;  3VGN A;  1W02 A;  3FF0 A;  2BNG A;  5CLK A;  5KP1 A;  1JB2 A;  3EC9 A;  4HJL B;  2HMK B;  5BVB A;  5DRE A;  2F86 B;  3DMC A;  1QMA A;  2HMJ B;  3T8U A;  7STD A;  1ISK A;  1U5O A;  4KVH A;  2R4I A;  3F8H A;  2Z77 A;  1ULI B;  3B4O A;  3ROB A;  1W00 A;  4R9L A;  3NHX A;  1NU3 A;  1ASK A;  1O7W B;  1O7N B;  3LYG A;  3NUV A;  5JPP A;  5D81 A;  1GS3 A;  1OH0 A;  5IF6 A;  5BXQ A;  1WQL B;  1W01 A;  3I0Y A;  1E3R A;  5HGR A;  1DMQ A;  1OHO A;  2HMO B;  4ORL A;  3CNM A;  3WMD A;  1STD A;  4U13 A;  3CPO A;  1OGZ A;  5AIF A;  2B1X B;  4HM4 B;  3SOA A;  1O7G B;  2GEX A;  1Q40 A;  3CU3 A;  3JUM A;  2YFI B;  1GY6 A;  1DMN A;  5AI1 A;  1OCV A;  4H3U A;  3KSP A;  3FLJ A;  2CHC A;  5JPU A;  5AEW B;  4J9A A;  3KE7 A;  3MHE A;  5IEN A;  4K1U A;  4XDV A;  1E97 A;  1O7M B;  1CQS A;  5AIG A; 
#chains in the Genus database with same CATH topology
 3JUO A;  3LTA A;  1B2S A;  4NRE A;  1JB4 A;  3PCR A;  2E2V A;  3OWY A;  5IW9 A;  1IQY A;  1RCL A;  1W6Y A;  1IVV A;  5EQL A;  2L4V A;  1A90 A;  4EV2 A;  3NV0 B;  1T2I A;  2D42 A;  4BIR A;  5EVH A;  1RGG A;  1MWU A;  3ER7 A;  3CCS 3;  4HYZ A;  4EXR A;  3EBY A;  4N6N B;  3V92 A;  1BRH A;  5LC6 A;  1JBT A;  3CCM 3;  1RJO A;  1GMR A;  3DGM A;  5LC7 A;  1HZ1 A;  3WOD G;  4O3V A;  1BGS A;  8CHO A;  1IV7 A;  1RSN A;  3LTC A;  1UUV B;  3DXO A;  4STD A;  3TDG A;  1HYF A;  1AY7 A;  1EQK A;  1IQ8 A;  4I4K A;  1BSA A;  1CH0 A;  2STD A;  3DM8 A;  1K73 4;  1UCJ A;  3QRD A;  1VQM 3;  1V74 A;  1FUT A;  5IG5 A;  4FMC A;  3DGN A;  4LEH A;  5CK6 A;  1T3B A;  3T0U A;  1IT8 A;  1W2Z A;  2W9P A;  1D6U A;  2UGI A;  1JZO A;  1R4C A;  4QWT A;  4BTW A;  1RN7 A;  1GOV A;  2UUG C;  2WGQ A;  5CXO A;  5IEO A;  1O7H B;  2RGQ A;  3CCU 3;  1I2E A;  1W4N A;  4XBT A;  4TX4 A;  3G71 3;  1G96 A;  3WOE B;  4RZM A;  3CCQ 3;  1OF5 A;  2LQV A;  1S72 3;  3LOY A;  3I56 3;  4FCJ A;  4FR9 A;  3LTD A;  2H0H A;  1VZZ A;  1FYS A;  1SJW A;  3FF2 A;  1NJI 4;  3OWS A;  1FGO A;  3BB9 A;  4Q53 A;  1DVC A;  1HKX A;  1LQG C;  3DH2 A;  3HZP A;  4I5Q A;  1I3F A;  1UW1 A;  5ELJ A;  1B2U A;  2B24 B;  1NO3 A;  4MMY B;  2Z6B A;  1K41 A;  2GXF A;  1YJ9 3;  4XBY A;  1B21 A;  1BRJ A;  1NNV A;  2CFK A;  4BL2 A;  2XGL A;  3X3X A;  2CK3 H;  3VSY A;  3B7C A;  2ZL8 A;  4EW5 A;  4N6T A;  1NWW A;  2CIU A;  2OQE C;  3F8X A;  3MYT A;  3PXM A;  1M1X B;  1VQN 3;  1I0X A;  1IYY A;  3IJE B;  4HVN A;  4HBR A;  1T5Y A;  1W5Z A;  2BHM A;  2RSX A;  3HK4 A;  3V98 A;  2GU1 A;  1GY5 A;  2H0G A;  4R4K A;  4EBG A;  1A2V A;  1B20 A;  1RMS A;  4J8T A;  3CCV 3;  1UCI A;  2Z7A A;  1E3V A;  3EE1 A;  4MMZ B;  4BL3 A;  1A2K A;  2YFJ B;  1OHS A;  3NX0 A;  1C54 A;  8RNT A;  4N6M A;  2BMQ B;  2XGN A;  4KFF A;  4N6O B;  3F7S A;  2PNC A;  3KKG A;  3S5C A;  3UL5 A;  1TRQ A;  5TGN A;  1VQ5 3;  2GBW B;  1Q82 4;  2FNQ A;  3F40 A;  2IUK A;  5G1L A;  1MGW A;  3CNX A;  3MKI A;  3PCS A;  4WYK A;  4AEQ A;  3RNT A;  2BMO B;  3AHW A;  1BUJ A;  1WNH A;  4HZ9 B;  3OXA A;  1GYB A;  2I9W A;  3BNE A;  2XH9 A;  1JN5 A;  1FGQ A;  3MG2 A;  4L7K A;  3K7C A;  4K1V A;  3FCS B;  3S29 A;  4IIA A;  2F5M A;  2UX0 A;  3DGO A;  3IMA B;  1LOV A;  1QAL A;  2HMM B;  3M8C A;  7GSP A;  1AR0 A;  2QA4 3;  4MMX B;  3EN1 B;  4RNZ A;  5ELU A;  5CF2 A;  3ALA A;  1X1Y A;  3K0Z A;  1BNE A;  1ROV A;  1BSB A;  6STD A;  4CJN A;  5M18 A;  5D83 A;  3HOH A;  1Q7H A;  1IU7 A;  1SAR A;  2CX1 A;  2XFT A;  4J5K A;  1YVB I;  3U97 A;  3UL6 A;  3EB8 A;  3DZL A;  1L5G B;  3GSP A;  3CC7 3;  2CC3 A;  2FXT A;  1FA3 A;  3ECF A;  3N9H A;  1UGI A;  1TFO A;  4H61 A;  3FG4 A;  5JBS A;  3D79 A;  2C10 A;  2IA7 A;  1UI7 A;  3SVA A;  2OTJ 3;  1IVW A;  3AMO A;  3EHC A;  3KZT A;  4EYC A;  1WMN A;  2W56 A;  3FG3 A;  2AAD A;  3GWR A;  1MGR A;  1RGE A;  3GZR A;  4O8S A;  3EQQ B;  1SPU A;  4R1K A;  5IG3 A;  1LNH A;  2FGT A;  2MC8 A;  1RDS A;  1MWT A;  1KD1 4;  3A5E A;  2HOH A;  3STD A;  4HOH A;  1Q40 B;  2OOV A;  2INX A;  1VQK 3;  3D3L A;  5FGO A;  1I3I A;  1TRP A;  2RCD A;  1ROA A;  3NBB A;  1W6C A;  3NV0 A;  4G1M B;  5FW5 A;  5KP3 A;  3WR2 A;  3NXJ A;  2Y74 A;  2IMJ A;  3X3Y A;  4DKI A;  3URP A;  1MWR A;  2C4B A;  1UUG B;  1JKG B;  4HM8 B;  4HZB B;  3SXX A;  2WOH A;  5STD A;  4KFE A;  1GOY A;  1FGR A;  2P0X A;  1T2H A;  4XB5 A;  1BRK A;  1KWI A;  2HML B;  3HIG A;  4HM2 B;  1IT7 A;  4LSO A;  1VQ9 3;  1N8Q A;  4R80 A;  1GD4 A;  2K0M A;  2WGO A;  4OUQ A;  1NDO B;  3H3H A;  3ZG0 A;  4IT7 A;  1YVS A;  1AV4 A;  3WA3 A;  4FCM A;  1FUW A;  1A2P A;  4AKY A;  4L8O A;  1KC8 4;  1ULJ B;  3EN8 A;  3BND A;  3F9S A;  2KXG A;  3LXU X;  3G8Z A;  4X2O A;  3SOY A;  3EX9 A;  1IDP A;  1OUN A;  2QIY A;  3OWU A;  4K90 B;  4HM3 B;  3NM2 A;  1VQ6 3;  1M1K 4;  3OW2 2;  1EG9 B;  1YHQ 3;  2XSO B;  1BRI A;  1Q42 A;  1TTO A;  3A76 A;  2CWV A;  1VQ4 3;  1ZS7 A;  1I2F A;  1LOX A;  1LVN A;  1BSC A;  2BMR B;  3FKA A;  5AIH A;  4CCV A;  1YIJ 3;  4WWU C;  1STF I;  1GOU A;  2MF7 A;  1AVK A;  2ZA4 A;  3FH1 A;  1GY7 A;  1VQQ A;  2K54 A;  1LQM B;  3F7X A;  2IYJ A;  1PYL A;  3MPH A;  1VQO 3;  3V99 A;  4GHO A;  2A15 A;  3LT8 A;  4XDW A;  3MG1 A;  1G0T A;  3AHS A;  3KSE D;  4N6L A;  3CCL 3;  1PU4 A;  3Q3F A;  4K61 A;  4OK0 A;  1GD3 A;  1OPY A;  2XFS A;  3E99 A;  2IUJ A;  3MWZ A;  4HM1 B;  3SYU A;  1BRG A;  3RDE A;  2HMN B;  1IQX A;  2KF3 A;  3HII A;  3OX9 A;  3WHO A;  1Q9E A;  1ZX2 A;  2GU3 A;  2KF6 A;  2GEY A;  1SIH A;  3K9M C;  4KFD A;  4FCZ A;  5IG0 A;  3GZY B;  3X42 A;  3JUP A;  1BNR A;  2LYX A;  1I2G A;  5CF1 A;  2CG0 A;  1UGH I;  3DGY A;  3CXC 2;  4LYL B;  1KSI A;  1JNQ A;  1QVF 2;  3BLZ A;  3CCE 3;  1UUW B;  2AAE A;  1S5A A;  1PFP A;  5D82 A;  1JBR A;  3JUQ A;  3EBT A;  3QK9 A;  4NPB A;  5AIG A;  6GSP A;  2RBI A;  3BIR A;  1D6Y A;  4GB5 A;  1RTU A;  1OF5 B;  1BNI A;  5AYS C;  5IER A;  1VQ8 3;  3I55 3;  3GRD A;  3D5I A;  2W2C A;  2BIR A;  2KF5 A;  7RNT A;  3GZB A;  3CC4 3;  2JQ5 A;  1MWS A;  3NM7 A;  4HM0 B;  3T8N A;  5DRV A;  1Z1S A;  3K63 A;  4HKV B;  4HM5 B;  4NHF A;  1BUQ A;  3OV4 A;  2CFL A;  4KZ1 A;  4RBN A;  3ZFZ A;  1BIR A;  2Y73 A;  3J7Y d;  1IVU A;  2YX9 A;  2XR8 B;  2OWP A;  3B8L A;  4MJD A;  1YJN 3;  3RGA A;  1RRL A;  2JDI H;  4LGQ A;  3FGY A;  4CDL A;  2E2U A;  1TJD A;  4MEI A;  3UNL A;  9RNT A;  1SII A;  1TUH A;  3S27 A;  3DUK A;  4FMA A;  1BU4 A;  1GMQ A;  2BT3 A;  4LMI A;  1YI2 3;  1RNB A;  3RGR A;  6RNT A;  2CWT A;  1WMO A;  4LZI A;  4L8P A;  4O2H A;  2SAR A;  3KN4 A;  3SED A;  3G6E 3;  1B2M A;  4XM4 A;  1V57 A;  2F99 A;  4WFO A;  5A0O B;  1EA2 A;  1K9M 4;  2CW9 A;  1C7H A;  1WTH A;  1I0V A;  3MG3 A;  4HM7 B;  3SX1 A;  1NB5 I;  4WHA A;  5G2G A;  3U1W A;  3CME 3;  4R9K A;  3X41 A;  1BAO A;  2O3O A;  5AEU B;  3AGN A;  1OHP A;  1BNS A;  2CFG A;  4OVM A;  2W03 A;  1VQP 3;  4N6V 0;  3PYJ A;  2Z76 A;  1WMP A;  3G4S 3;  2GSP A;  1IV9 A;  2C11 A;  5IG4 A;  1UCL A;  4WYK B;  3F14 A;  3KFQ C;  4J5G A;  1OAC A;  1X1U A;  1JKG A;  1LOW A;  1K8A 4;  2F4Y A;  1JN5 B;  3EJV A;  1DMM A;  2OQE A;  1TP6 A;  4RNT A;  2V1L A;  2CKF B;  1EUI C;  2OCT A;  3MSO A;  3NBJ A;  1N9J A;  1JRQ A;  3LZA A;  4HM6 B;  3CPW 2;  5HOH A;  1PY3 A;  1SQW A;  4AKZ A;  3NBR A;  2YFL B;  3WDG B;  1NB3 I;  3BNB A;  4FMB A;  4O02 B;  3SLU A;  2RFR A;  2CFW A;  2QGU A;  1DVD A;  3UJM A;  5IEP A;  1BNJ A;  3GZX B;  3VF1 A;  1RNT A;  1BNF A;  1HU9 A;  1QAK A;  3CC2 3;  1Y4K A;  2CWU A;  1U8C B;  1QAF A;  3G16 A;  1MOL A;  5AII A;  5G1K A;  1YGW A;  3AMO B;  3LT9 A;  1TIJ A;  5M1A A;  1TU5 A;  1Q7Y 4;  3WA2 X;  1B2X A;  1AVL A;  2F98 A;  3HX8 A;  1N5P A;  2K3D A;  1BNG A;  3UB1 A;  3FSD A;  3X40 A;  4N3V A;  3H51 A;  3CMA 3;  1KQS 2;  2H0I A;  1ZGX A;  3GAX A;  3D5G A;  1RN4 A;  3FZW A;  4BU4 A;  1I8V A;  1QJG A;  4XBX A;  1US1 A;  2GBX B;  1O7P B;  3EF8 A;  3IPT A;  4WP5 A;  3BU4 A;  4X2H A;  3N54 B;  3PS8 A;  1M9G A;  3KII A;  1R4Y A;  3D9R A;  1OGX A;  5KP4 A;  3G0K A;  3JUN A;  2CG1 A;  3DY5 A;  4IPB A;  5I97 A;  1ZO2 A;  2XSH B;  4PEJ A;  2PZV A;  1LXE A;  1JB5 A;  2ZDJ A;  3B4P A;  3Q90 A;  3S67 A;  2ML5 A;  1F8N A;  3LTB A;  3VGN A;  1W2B 2;  1RGF A;  1W02 A;  2O9U X;  3FF0 A;  1W7C A;  2BNG A;  5CLK A;  5KP1 A;  1B3S A;  1JB2 A;  1UCK A;  4BTY A;  2KRT A;  3EC9 A;  4HJL B;  3PGB A;  1RKY A;  2HMK B;  2E2T A;  3CCJ 3;  5BVB A;  2R41 A;  2QEX 3;  5DRE A;  4CPK A;  2F86 B;  4RNY A;  2P05 A;  1RGK A;  1Q86 4;  1RGH A;  3DMC A;  1QMA A;  2KF4 A;  1N5H A;  2CH9 A;  1FZU A;  3Q2P A;  2HMJ B;  3X3Z A;  3T8U A;  7STD A;  3N8B A;  1GMP A;  1ISK A;  1U5O A;  1X1X A;  4KVH A;  3AGO A;  1YJW 3;  2W0Q A;  2R4I A;  5M19 A;  1QVG 2;  1BSD A;  1I70 A;  1D6Z A;  2M7O A;  3FG1 A;  1RLS A;  3L0R A;  3F8H A;  1FGM A;  3Q1C A;  4EC6 A;  1VQ7 3;  3CCR 3;  1VQL 3;  2P09 A;  2CX0 A;  2Z77 A;  3WOF B;  4EV5 A;  1RRH A;  2L1S A;  1EKM A;  1ULI B;  3B4O A;  1W00 A;  4R9L A;  1K28 A;  3ROB A;  1FUS A;  1BOX A;  1DYU A;  1EEJ A;  1RN1 A;  3NHX A;  1NU3 A;  1RGA A;  4N6U A;  5RNT A;  1RHL A;  1JBS A;  1ASK A;  1O7W B;  1O7N B;  3LML A;  3LYG A;  3NUV A;  5JPP A;  1M90 4;  2OTL 3;  2KAA A;  5D81 A;  1JJ2 2;  2P0M A;  1N8R 4;  1DE3 A;  2D1W A;  2OOV C;  1LRA A;  2SBL A;  4ILF A;  1GS3 A;  1OH0 A;  3O8Y A;  3PZW A;  1AQZ A;  5IF6 A;  1JZD A;  1CYV A;  3BNC A;  1B27 A;  5GSP A;  3DGL A;  5BXQ A;  1UI8 A;  1WQL B;  1BAN A;  1CEW I;  1FGT A;  1W01 A;  3I0Y A;  1E3R A;  1DET A;  4ORL A;  1DMQ A;  1OHO A;  2HMO B;  5HGR A;  2W04 A;  3CNM A;  1IK3 A;  3WMD A;  1MNL A;  1STD A;  1YIT 3;  1BRN L;  4U13 A;  3CPO A;  1OGZ A;  3D4A A;  5AIF A;  4KT3 B;  2WO0 A;  3CD6 3;  1B2Z A;  1JV2 B;  1YNV X;  2RNT A;  1J2B A;  5BU4 A;  4JF8 A;  2B1X B;  4HM4 B;  2W9Q A;  3NQZ A;  4HAA A;  3SOA A;  1CYU A;  5EEO A;  2J8X B;  1RCK A;  1O7G B;  2GEX A;  1Q40 A;  2CFD A;  1G02 A;  3CU3 A;  2WOF A;  3JVC A;  2XEP A;  3JUM A;  1RGL A;  2YFI B;  3ZG5 A;  1RGC A;  1GY6 A;  2XF3 A;  4BTX A;  1DMN A;  1LNI A;  5AI1 A;  2F56 A;  1OCV A;  1LOY A;  1X1W A;  2KCD A;  1A67 A;  1BRS A;  4H3U A;  3KSP A;  1TFK A;  3S28 A;  1YGE A;  1UDI I;  2BU4 A;  1FW7 A;  2W6J H;  3FLJ A;  2P38 A;  2CHC A;  3K5T A;  5BIR A;  3LH4 A;  5JPU A;  1BVI A;  4JRF A;  4ZM8 A;  4GSP A;  4J9A A;  5AEW B;  1V58 A;  5AYR B;  1N9E A;  3KE7 A;  3KCH A;  3MHE A;  3HI7 A;  2Q07 A;  4FMD A;  2IY2 A;  1GSP A;  2F5W A;  3NQY A;  5IEN A;  2ML6 A;  1BSE A;  4K1U A;  1W6G A;  1E97 A;  4XDV A;  2BO9 B;  1Q81 4;  1IVX A;  2W56 B;  1O7M B;  1CQS A;  4GL6 A;  2XRX B;  2ZHX B; 
#chains in the Genus database with same CATH homology
 3JUO A;  3LTA A;  4NRE A;  1JB4 A;  3PCR A;  2E2V A;  3OWY A;  5IW9 A;  1IQY A;  1W6Y A;  1IVV A;  5EQL A;  2L4V A;  1A90 A;  4EV2 A;  3NV0 B;  2D42 A;  5EVH A;  3ER7 A;  3CCS 3;  4HYZ A;  4EXR A;  3EBY A;  4N6N B;  3V92 A;  5LC6 A;  3CCM 3;  1RJO A;  3DGM A;  5LC7 A;  3WOD G;  4O3V A;  8CHO A;  1IV7 A;  3LTC A;  1UUV B;  3DXO A;  4STD A;  3TDG A;  1EQK A;  1IQ8 A;  4I4K A;  3DM8 A;  2STD A;  1K73 4;  3QRD A;  1VQM 3;  1V74 A;  5IG5 A;  4FMC A;  3DGN A;  4LEH A;  5CK6 A;  3T0U A;  1IT8 A;  1W2Z A;  2W9P A;  1D6U A;  4QWT A;  1R4C A;  4BTW A;  1RN7 A;  2WGQ A;  5CXO A;  5IEO A;  1O7H B;  2RGQ A;  3CCU 3;  4XBT A;  1W4N A;  3G71 3;  4TX4 A;  3CCQ 3;  1G96 A;  3WOE B;  4RZM A;  1S72 3;  1OF5 A;  2LQV A;  3LOY A;  3I56 3;  4FCJ A;  4FR9 A;  3LTD A;  1VZZ A;  1SJW A;  3FF2 A;  1NJI 4;  3OWS A;  1FGO A;  3BB9 A;  4Q53 A;  1DVC A;  1HKX A;  3HZP A;  1UW1 A;  5ELJ A;  2B24 B;  1NO3 A;  4MMY B;  2Z6B A;  1K41 A;  2GXF A;  1YJ9 3;  4XBY A;  2CFK A;  2XGL A;  2CK3 H;  3VSY A;  3B7C A;  2ZL8 A;  4N6T A;  1NWW A;  2CIU A;  2OQE C;  3F8X A;  3MYT A;  3PXM A;  1M1X B;  1VQN 3;  3IJE B;  4HVN A;  4HBR A;  1T5Y A;  1W5Z A;  2BHM A;  2RSX A;  3HK4 A;  3V98 A;  2GU1 A;  1GY5 A;  4R4K A;  4EBG A;  1A2V A;  4J8T A;  3CCV 3;  2Z7A A;  1E3V A;  3EE1 A;  4MMZ B;  1A2K A;  2YFJ B;  1OHS A;  3NX0 A;  4N6M A;  2BMQ B;  2XGN A;  4KFF A;  4N6O B;  3F7S A;  2PNC A;  3KKG A;  3S5C A;  3UL5 A;  5TGN A;  1VQ5 3;  2GBW B;  1Q82 4;  2FNQ A;  3F40 A;  2IUK A;  4AEQ A;  3CNX A;  3MKI A;  3PCS A;  4WYK A;  2BMO B;  1WNH A;  4HZ9 B;  3OXA A;  1GYB A;  2I9W A;  3BNE A;  2XH9 A;  1JN5 A;  1FGQ A;  3MG2 A;  4L7K A;  3K7C A;  4K1V A;  3FCS B;  3S29 A;  4IIA A;  3DGO A;  2UX0 A;  3IMA B;  1QAL A;  2HMM B;  3M8C A;  1AR0 A;  2QA4 3;  4MMX B;  3EN1 B;  4RNZ A;  5ELU A;  5CF2 A;  3ALA A;  3K0Z A;  1ROV A;  6STD A;  5D83 A;  2XFT A;  1IU7 A;  3U97 A;  3UL6 A;  1YVB I;  3EB8 A;  3DZL A;  1L5G B;  1FA3 A;  3CC7 3;  2CC3 A;  2FXT A;  3ECF A;  3N9H A;  1TFO A;  4H61 A;  3FG4 A;  5JBS A;  2C10 A;  2IA7 A;  1UI7 A;  3SVA A;  2OTJ 3;  1IVW A;  3AMO A;  3EHC A;  3KZT A;  4EYC A;  1WMN A;  2W56 A;  3FG3 A;  3GWR A;  4O8S A;  3GZR A;  3EQQ B;  1SPU A;  4R1K A;  5IG3 A;  1LNH A;  2FGT A;  2MC8 A;  1KD1 4;  3STD A;  1Q40 B;  2OOV A;  2INX A;  1VQK 3;  3D3L A;  5FGO A;  2RCD A;  3NV0 A;  3X3X A;  1ROA A;  3NBB A;  1W6C A;  4G1M B;  5FW5 A;  5KP3 A;  3X3Y A;  3NXJ A;  2Y74 A;  2IMJ A;  4HZB B;  1JKG B;  4HM8 B;  3SXX A;  2WOH A;  5STD A;  4KFE A;  1FGR A;  2P0X A;  4XB5 A;  1KWI A;  2HML B;  3HIG A;  4HM2 B;  1IT7 A;  4LSO A;  1VQ9 3;  1N8Q A;  4R80 A;  1GD4 A;  2K0M A;  2WGO A;  4OUQ A;  1NDO B;  3H3H A;  4IT7 A;  1AV4 A;  3WA3 A;  4FCM A;  1FUW A;  4AKY A;  4L8O A;  1KC8 4;  1ULJ B;  3EN8 A;  3BND A;  3F9S A;  2KXG A;  3LXU X;  3G8Z A;  4X2O A;  3SOY A;  3EX9 A;  1IDP A;  1OUN A;  2QIY A;  3OWU A;  4K90 B;  4HM3 B;  3NM2 A;  1VQ6 3;  1M1K 4;  3OW2 2;  1EG9 B;  1YHQ 3;  2XSO B;  1Q42 A;  3A76 A;  2CWV A;  1VQ4 3;  1LOX A;  1LVN A;  5AIH A;  2BMR B;  3FKA A;  4CCV A;  1YIJ 3;  4WWU C;  1STF I;  2MF7 A;  1AVK A;  3FH1 A;  1GY7 A;  2K54 A;  3F7X A;  3MPH A;  1VQO 3;  3V99 A;  2A15 A;  3LT8 A;  4XDW A;  3MG1 A;  3KSE D;  4N6L A;  3CCL 3;  1PU4 A;  4K61 A;  4OK0 A;  1GD3 A;  1OPY A;  2XFS A;  3E99 A;  2IUJ A;  3MWZ A;  4HM1 B;  3RDE A;  2HMN B;  1IQX A;  3HII A;  3OX9 A;  1ZX2 A;  2GU3 A;  2GEY A;  1SIH A;  3K9M C;  4KFD A;  4FCZ A;  5IG0 A;  3GZY B;  3X42 A;  3JUP A;  2LYX A;  5CF1 A;  2CG0 A;  3CXC 2;  1KSI A;  1JNQ A;  1QVF 2;  3BLZ A;  3CCE 3;  1UUW B;  1S5A A;  1PFP A;  5D82 A;  3JUQ A;  3EBT A;  3QK9 A;  5AIG A;  4GB5 A;  1D6Y A;  5AYS C;  1OF5 B;  5IER A;  1VQ8 3;  3I55 3;  3GRD A;  2W2C A;  3GZB A;  3CC4 3;  2JQ5 A;  3NM7 A;  4HM0 B;  3T8N A;  5DRV A;  1Z1S A;  3K63 A;  4HKV B;  4HM5 B;  4NHF A;  1BUQ A;  3OV4 A;  2CFL A;  4KZ1 A;  4RBN A;  3J7Y d;  2Y73 A;  1IVU A;  2YX9 A;  2XR8 B;  2OWP A;  3B8L A;  4MJD A;  1YJN 3;  3RGA A;  1RRL A;  2JDI H;  4LGQ A;  3FGY A;  4CDL A;  2E2U A;  4MEI A;  3UNL A;  1SII A;  1TUH A;  3S27 A;  3DUK A;  4FMA A;  4LMI A;  2BT3 A;  1YI2 3;  3RGR A;  2CWT A;  1WMO A;  4LZI A;  4L8P A;  4O2H A;  3G6E 3;  3KN4 A;  3SED A;  4XM4 A;  2F99 A;  4WFO A;  5A0O B;  1EA2 A;  1K9M 4;  2CW9 A;  1C7H A;  1WTH A;  3MG3 A;  4HM7 B;  3SX1 A;  1NB5 I;  4WHA A;  5G2G A;  3U1W A;  3CME 3;  4R9K A;  3X41 A;  5AEU B;  2O3O A;  1OHP A;  4OVM A;  2CFG A;  2W03 A;  1VQP 3;  4N6V 0;  3PYJ A;  2Z76 A;  1WMP A;  3G4S 3;  1IV9 A;  2C11 A;  5IG4 A;  4WYK B;  3F14 A;  3KFQ C;  1OAC A;  1JKG A;  1K8A 4;  1JN5 B;  3EJV A;  1DMM A;  2OQE A;  1TP6 A;  2V1L A;  2CKF B;  2OCT A;  3MSO A;  3NBJ A;  1N9J A;  1JRQ A;  3LZA A;  4HM6 B;  3CPW 2;  1SQW A;  4AKZ A;  3NBR A;  2YFL B;  3WDG B;  1NB3 I;  3BNB A;  4FMB A;  4O02 B;  3SLU A;  2RFR A;  2CFW A;  2QGU A;  1DVD A;  3UJM A;  5IEP A;  3GZX B;  3VF1 A;  1HU9 A;  1QAK A;  3CC2 3;  1Y4K A;  2CWU A;  1U8C B;  1QAF A;  3G16 A;  1MOL A;  5AII A;  3AMO B;  3LT9 A;  1TIJ A;  1TU5 A;  1Q7Y 4;  3WA2 X;  1AVL A;  2F98 A;  3HX8 A;  1N5P A;  3UB1 A;  3FSD A;  3X40 A;  4N3V A;  3H51 A;  3CMA 3;  1KQS 2;  3GAX A;  3FZW A;  1QJG A;  4XBX A;  1US1 A;  2GBX B;  1O7P B;  3EF8 A;  3IPT A;  4WP5 A;  4X2H A;  3N54 B;  3PS8 A;  1M9G A;  3KII A;  3D9R A;  1OGX A;  5KP4 A;  3G0K A;  3JUN A;  2CG1 A;  3DY5 A;  4IPB A;  5I97 A;  1ZO2 A;  2XSH B;  4PEJ A;  2PZV A;  1LXE A;  1JB5 A;  2ZDJ A;  3B4P A;  3Q90 A;  3S67 A;  2ML5 A;  1F8N A;  3LTB A;  3VGN A;  1W2B 2;  1W02 A;  2O9U X;  3FF0 A;  1W7C A;  2BNG A;  5CLK A;  5KP1 A;  1JB2 A;  4BTY A;  2KRT A;  3EC9 A;  4HJL B;  3PGB A;  1RKY A;  2HMK B;  2E2T A;  3CCJ 3;  5BVB A;  2QEX 3;  5DRE A;  2F86 B;  4RNY A;  2P05 A;  1Q86 4;  3DMC A;  3Q2P A;  1QMA A;  1N5H A;  2CH9 A;  3X3Z A;  2HMJ B;  3T8U A;  7STD A;  3N8B A;  1ISK A;  1U5O A;  4KVH A;  1YJW 3;  2W0Q A;  2R4I A;  1QVG 2;  1D6Z A;  2M7O A;  3FG1 A;  3L0R A;  3Q1C A;  3F8H A;  1FGM A;  1VQ7 3;  4EC6 A;  1VQL 3;  3CCR 3;  2P09 A;  2Z77 A;  3WOF B;  4EV5 A;  1RRH A;  1EKM A;  1ULI B;  3B4O A;  1W00 A;  4R9L A;  1K28 A;  3ROB A;  1DYU A;  3NHX A;  1NU3 A;  4N6U A;  1ASK A;  1O7W B;  1O7N B;  3LML A;  3LYG A;  3NUV A;  5JPP A;  1M90 4;  2OTL 3;  5D81 A;  1JJ2 2;  2P0M A;  1N8R 4;  2D1W A;  2OOV C;  2SBL A;  1GS3 A;  1OH0 A;  3O8Y A;  3PZW A;  5IF6 A;  1CYV A;  3BNC A;  3DGL A;  5BXQ A;  1UI8 A;  1CEW I;  1WQL B;  1FGT A;  1W01 A;  3I0Y A;  1E3R A;  4ORL A;  1DMQ A;  1OHO A;  2HMO B;  5HGR A;  2W04 A;  3CNM A;  1IK3 A;  3WMD A;  1MNL A;  1STD A;  1YIT 3;  4U13 A;  3CPO A;  1OGZ A;  5AIF A;  2WO0 A;  3CD6 3;  1JV2 B;  1J2B A;  4JF8 A;  2B1X B;  4HM4 B;  2W9Q A;  3NQZ A;  3SOA A;  1CYU A;  5EEO A;  1O7G B;  2GEX A;  1Q40 A;  2CFD A;  3CU3 A;  2WOF A;  3JVC A;  2XEP A;  3JUM A;  2YFI B;  2XF3 A;  1GY6 A;  4BTX A;  1DMN A;  5AI1 A;  1A67 A;  1OCV A;  2KCD A;  4H3U A;  3KSP A;  1TFK A;  3S28 A;  1YGE A;  2W6J H;  3FLJ A;  2P38 A;  2CHC A;  3K5T A;  3LH4 A;  5JPU A;  4JRF A;  5AEW B;  4ZM8 A;  4J9A A;  5AYR B;  1N9E A;  3KE7 A;  3MHE A;  3HI7 A;  2Q07 A;  4FMD A;  3NQY A;  5IEN A;  2ML6 A;  4K1U A;  1W6G A;  1E97 A;  4XDV A;  2BO9 B;  1Q81 4;  1IVX A;  2W56 B;  1O7M B;  1CQS A;  4GL6 A;  2XRX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...