3CNXA

Crystal structure of a putative dehydratase from the ntf2-like family (sav_4671) from streptomyces avermitilis at 2.10 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
138
Chain Sequence
TPDTDVEQVGLANTAFYEAMERGDFETLSSLWLTPADLGVPADAGVVSCVHPGWPVLSGRGEVLRSYALIMANTEYIQFFLTDVHVSVTGDTALVTCTENILSGGGPLVGQLVVATNVFRRTPDGWKLWSHHASPVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (NP_825848.1) from Streptomyces avermitilis at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Lyase
molecule keywords Uncharacterized protein
total genus 40
structure length 138
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cnxA00
4HKVB 3CPOA 1HKXA 5KP1A 1EA2A 2CKFB 3GRDA 1OPYA 2I9WA 1O7NB 2XSOB 3ER7A 1JB5A 3BB9A 1OHPA 3B7CA 3GZBA 3K7CA 3NV0B 5AIFA 5IF6A 4HZ9B 4XBXA 3HK4A 2HMLB 5EVHA 2INXA 5AIGA 5AEUB 1E97A 5IG5A 4HM1B 4K1VA 3EJVA 1JKGA 3T8NA 2GEYA 2BMQB 5IEOA 3DMCA 3HX8A 2YFIB 4R9LA 7STDA 2RGQA 4HM6B 2QGUA 4OVMA 4HM0B 1SJWA 3JUNA 4XBYA 5DRVA 2W2CA 3KE7A 3CNMA 3MKIA 5JPPA 3EQQB 3FF2A 6STDA 2GBXB 3GZXB 3EN1B 1ISKA 4L8PA 1W00A 1AR0A 3H3HA 3LZAA 4FCJA 4LEHA 1NDOB 2YFLB 4LMIA 3NUVA 4L8OA 1O7GB 3SEDA 1JKGB 4K1UA 1ZX2A 2HMNB 3A76A 3FGYA 3SOYA 1GYBA 3T8UA 1UUVB 4WYKB 4I4KA 4J8TA 3BLZA 1DMMA 1JB2A 1NU3A 3D9RA 4Q53A 2A15A 1JN5A 1GY6A 2HMMB 3B8LA 3F14A 1OGZA 3FKAA 3HZPA 3M8CA 3S5CA 3STDA 2HMKB 1W01A 3F8XA 1UUWB 3IPTA 4L7KA 3G16A 2R4IA 4IIAA 4XM4A 1U5OA 2XRXB 1E3VA 2B24B 3E99A 4XB5A 4N3VA 2STDA 3FH1A 1TP6A 4H3UA 1Q40A 3UNLA 3KSPA 1OHOA 3EBTA 3NHXA 1GY5A 1W6YA 4HM7B 5G2GA 3RGAA 1O7PB 2IMJA 3VGNA 3UJMA 1TUHA 5IERA 5DREA 4XBTA 4FCMA 1WQLB 3JUOA 3EBYA 8CHOA 3DM8A 1DMNA 5BVBA 5IEPA 3RGRA 1OF5A 1OUNA 2B1XB 2BMRB 3DUKA 3I0YA 3K0ZA 3MSOA 3NXJA 3MHEA 3OX9A 4J9AA 4MJDA 4XDWA 2RFRA 3JUQA 1ULJB 2UX0A 1Q42A 3OWUA 3SOAA 5AEWB 1GS3A 1ZO2A 3MG2A 4HJLB 1Q40B 3WMDA 2QIYA 4R1KA 1CQSA 3CU3A 1GY7A 1NWWA 1OH0A 3G0KA 3NBRA 3JUMA 1OHSA 2GEXA 1OF5B 2K54A 2YFJB 3GZRA 3LYGA 3OXAA 5KP3A 3GZYB 3CNXA 3MYTA 3EN8A 4HM3B 5D82A 3Q90A 1ASKA 3NV0A 5AI1A 4HM4B 2CHCA 2F86B 3B4PA 5STDA 4STDA 1O7HB 2BNGA 5D83A 1A2KA 3JUPA 3MG3A 3VSYA 5JPUA 3F7SA 3GWRA 4HZBB 4RZMA 5CF2A 4GB5A 3F8HA 1QMAA 2Z77A 3MG1A 1W02A 1Z1SA 4WP5A 5CK6A 1OGXA 1O7WB 1ULIB 3FZWA 4R9KA 5CLKA 1IDPA 5BXQA 5TGNA 2BMOB 4HVNA 1QJGA 2XR8B 4HM5B 5IG0A 5AIHA 2OWPA 4HM2B 2HMOB 3B4OA 3OWYA 2GBWB 3G8ZA 3EC9A 4KVHA 4X2HA 5FW5A 4LGQA 1VZZA 5CXOA 1EG9B 4ORLA 4WWUC 3ROBA 5IG4A 1C7HA 3EX9A 3KZTA 3DXOA 4U13A 2XSHB 5IG3A 1OCVA 2JQ5A 2Z7AA 3OV4A 2F98A 5CF1A 1E3RA 4OUQA 3EHCA 1STDA 2F99A 3KKGA 3NM2A 3DZLA 4HM8B 3EF8A 5HGRA 5KP4A 4WYKA 3FSDA 4PEJA 4X2OA 1JB4A 1DMQA 3FLJA 2GXFA 3ECFA 4CDLA 1S5AA 5IENA 1O7MB 3F40A 3F9SA 2HMJB 3H51A 3OWSA 2RCDA 1BUQA 3F7XA 2Z76A 4XDVA 5D81A 2PZVA 5AIIA 3FF0A 1K41A 1JN5B
chains in the Genus database with same CATH superfamily
3N8BA 2P0MA 1BUJA 1RGCA 2CFDA 1BAOA 1O7NB 2XSOB 1MWRA 1JB5A 1BRSA 1GD4A 1OHPA 1JNQA 2P0XA 1WMNA 3K7CA 3SLUA 3WODG 1UUGB 1VQL3 2E2TA 4KT3B 1YNVX 1A67A 5EVHA 5AIGA 1GMQA 3MWZA 1PU4A 1BRKA 2Y74A 3T8NA 1VQ73 1FGRA 2CFLA 4FCZA 5A0OB 1RN4A 1WMPA 5AYSC 2AAEA 4KFEA 5JPPA 4LSOA 3DGLA 4FMAA 1GMPA 3GZXB 1UCJA 1TRPA 1CYUA 2C10A 1BANA 1NDOB 4LZIA 4L8OA 3BNBA 1DVCA 1JKGB 1VQN3 2HMNB 4HAAA 3T8UA 2PNCA 4J8TA 3BLZA 1UI7A 2BO9B 3S27A 3HZPA 2HMKB 3IPTA 1BNSA 4CCVA 2R4IA 1N9JA 1U5OA 3EE1A 1E3VA 3ZFZA 3CCS3 1IK3A 4HOHA 1TTOA 1B2UA 4RNYA 3NHXA 1IV9A 4AKYA 1GSPA 3RGAA 4RNTA 1RSNA 3UJMA 1TUHA 5DREA 1IVXA 3AGNA 1UGHI 3X3YA 1K9M4 4JF8A 3JUOA 1JJ22 3RGRA 3DUKA 2BMRB 2B1XB 3MSOA 3K0ZA 5DRVA 3I553 1B27A 4XDWA 5FGOA 3OWUA 3SVAA 1BGSA 5AEWB 1Q42A 5JBSA 2OTL3 3MG2A 3PS8A 4HJLB 1RGGA 2ML5A 3PYJA 2W9QA 3DGMA 3JUMA 3GZRA 3LYGA 2WO0A 2GSPA 2YFJB 3NX0A 1T5YA 3OXAA 1W2B2 1MGRA 2XFSA 3MYTA 1CYVA 1JZOA 3NV0A 2H0GA 2RSXA 2ZDJA 5M1AA 1O7HB 1I0XA 1A2KA 3MG3A 4EYCA 2E2VA 1RN7A 1ROAA 5JPUA 3GWRA 2OQEC 3F8HA 1QMAA 5STDA 3CCJ3 5CK6A 1Z1SA 4MMZB 4DKIA 4CPKA 4H61A 1IDPA 2OOVA 2BMOB 4HVNA 5IG0A 1IV7A 1BNFA 5AIHA 2KF3A 4HM2B 3G4S3 1FZUA 1KD14 3G8ZA 1VQ53 1VZZA 5CXOA 1X1UA 4ORLA 4QWTA 2WOFA 1C7HA 4ILFA 1B2SA 4FMCA 1QVF2 3DXOA 5IG3A 3LTCA 1OCVA 3IJEB 2JQ5A 1YI23 1FGMA 1PFPA 2F98A 1GOYA 2F99A 3GSPA 3BNDA 3FCSB 1SQWA 3JVCA 2MC8A 1YGWA 4WYKA 3CCR3 3FSDA 2P05A 3I563 1PY3A 1DMQA 1JV2B 2K0MA 4BU4A 1S5AA 2HMJB 3H51A 1VQ43 1BRHA 1RGFA 6RNTA 2Q07A 3F7XA 1K28A 3LT9A 3SYUA 2SARA 3NBJA 1VQ63 1BUQA 3KN4A 5LC6A 1G02A 1L5GB 1IYYA 2E2UA 1EA2A 3FG4A 1YVBI 1SIIA 2OCTA 1RGAA 3AHWA 1FUTA 2KAAA 3BB9A 1I3IA 1IT7A 2W9PA 4XBXA 1B2MA 2HMLB 2UUGC 2UGIA 1E97A 1CEWI 1T2HA 1BNEA 4K1VA 1BSEA 1JKGA 4RNZA 3L0RA 1MNLA 1QALA 4R9LA 1DYUA 7STDA 2CK3H 2RGQA 3AHSA 1AY7A 1QAKA 3MKIA 3EQQB 6STDA 2GBXB 3CC73 2W04A 1ISKA 3CCE3 3LXUX 4LMIA 1U8CB 1AVLA 3V98A 3CMA3 4OK0A 3SOYA 1ZX2A 3A76A 1GYBA 4EV5A 1UUVB 1YIJ3 3UL6A 1B21A 5HOHA 1OACA 3NQYA 1JB2A 2OOVC 3D9RA 3X3ZA 2OTJ3 4CJNA 2ZHXB 3AGOA 3FKAA 3STDA 4BL2A 4EV2A 3A5EA 3MPHA 2IUJA 3V99A 1W01A 3WHOA 1G96A 1M1K4 1SARA 2R41A 4BTXA 4IIAA 1LVNA 4XB5A 4N3VA 2F5MA 3D5IA 1X1YA 1LQMB 2STDA 1TP6A 3FH1A 4K61A 3WDGB 3UNLA 1M9GA 2Y73A 1IQYA 1HU9A 1GY5A 1W6YA 3LMLA 1JZDA 5G2GA 1Q7Y4 1G0TA 1O7PB 2IMJA 3WOFB 1ZGXA 3DGOA 1VQK3 1GOVA 2KF5A 4XBTA 3ZG0A 2AADA 2ZA4A 1YJN3 3EBYA 3PCRA 8CHOA 5BVBA 3ALAA 1IVWA 2WOHA 3O8YA 1IU7A 1OUNA 3I0YA 3OX9A 4MJDA 3RNTA 1W4NA 2RFRA 3K63A 1ULJB 2UX0A 5EQLA 1ZO2A 1KWIA 3WMDA 1T3BA 2QIYA 1CQSA 1UDII 4R1KA 4N6LA 3CU3A 3G0KA 4FMBA 3QRDA 3EN8A 2QA43 1RDSA 1ASKA 3LH4A 4G1MB 4HM4B 2CHCA 2F86B 3B4PA 4STDA 3VSYA 1BNGA 2IA7A 1FA3A 4RZMA 2Z77A 1W02A 1V58A 1ULIB 1M904 2IYJA 1D6ZA 1QJGA 1RJOA 2OWPA 3PZWA 1QAFA 2HMOB 3AMOA 3B4OA 2GBWB 1LNIA 3EC9A 4KVHA 1I2FA 4X2HA 5IG4A 4MEIA 4R80A 4WWUC 2BIRA 1VQ83 1W6GA 1MWSA 2LQVA 5G1LA 3LTDA 1YJ93 2Z7AA 1JBTA 5CF1A 1Q814 4OUQA 4BTYA 1MWTA 2MF7A 4K90B 1LQGC 3CCQ3 4PEJA 3PCSA 1GOUA 4IT7A 3WR2A 1JB4A 1BRIA 1RRHA 3FLJA 4NPBA 5ELUA 1LRAA 4AEQA 1BRNL 1FGQA 1TIJA 1WMOA 3F9SA 3KIIA 1B2XA 1IQXA 2RCDA 2Z76A 1UCLA 3CCU3 1RGKA 2PZVA 5AIIA 4XBYA 1K41A 2ML6A 3Q1CA 2XFTA 1DVDA 4HKVB 5BIRA 1VQQA 3CPOA 3S29A 4N6OB 1HKXA 5KP1A 1D6YA 4O2HA 1FW7A 1RCKA 2CWTA 4KFFA 2V1LA 1OPYA 2I9WA 1Q824 3SXXA 3KSED 5AIFA 3B7CA 2FXTA 3S28A 1I0VA 1RLSA 2M7OA 4HZ9B 2INXA 2JDIH 2IY2A 5AYRB 4GL6A 4HM1B 3U1WA 3D4AA 5AEUB 8RNTA 5IG5A 3EJVA 1K734 1EUIC 2GEYA 1RTUA 2BMQB 3DMCA 3HX8A 1FGTA 3X40A 2YFIB 3FG3A 4EC6A 1NNVA 2CW9A 2CWVA 2W56A 4O8SA 3S67A 4HM0B 3HIIA 2D1WA 2W2CA 3KE7A 3NBBA 3FF2A 1UW1A 1VQO3 1Y4KA 1Q864 3EN1B 1W00A 1AR0A 3LZAA 4LEHA 4O3VA 2YFLB 3N9HA 3X3XA 1KC84 1O7GB 1I3FA 2OQEA 3SEDA 3X41A 1US1A 2BHMA 1W5ZA 3LOYA 4K1UA 4RBNA 1VQM3 1TJDA 4N6UA 4WYKB 2Z6BA 4Q53A 1DMMA 1Q7HA 1RNTA 1TFKA 1JN5A 2HMMB 3B8LA 2SBLA 3FG1A 1EEJA 5GSPA 1UUWB 1V57A 4FMDA 2KCDA 1GMRA 2CG0A 3G16A 1C54A 4XM4A 3D3LA 4N6V0 4N6MA 1PYLA 4H3UA 3D79A 3KSPA 1OHOA 3EBTA 2GU1A 4AKZA 3WA2X 4HM7B 1N5PA 3CC23 3D5GA 1SPUA 3DGNA 1STFI 3TDGA 2W03A 3GAXA 3PGBA 1AQZA 1I2EA 2D42A 3DM8A 1DMNA 2QEX3 1OF5A 3QK9A 1EKMA 1R4YA 3NXJA 3MHEA 4ZM8A 1R4CA 2XF3A 4WFOA 2YX9A 1W6CA 1GS3A 3UL5A 1N8QA 1M1XB 1Q40B 1YGEA 4NREA 2ZL8A 1NWWA 2XH9A 1FGOA 5TGNA 1IVVA 1OF5B 2GEXA 5KP3A 1BU4A 3GZYB 3CNXA 5D82A 3K5TA 3N54B 5AI1A 1B2ZA 3IMAB 1SIHA 3CD63 1MWUA 5D83A 7RNTA 5I97A 3ZG5A 3HOHA 1CH0A 1I8VA 3WOEB 1BVIA 1W7CA 2O9UX 3BNCA 3F7SA 5CF2A 1NO3A 1YIT3 1A90A 5CLKA 1RN1A 2P38A 2L4VA 1HZ1A 1O7WB 1MGWA 3FZWA 1N5HA 2J8XB 1ROVA 3Q3FA 1JRQA 3X42A 5RNTA 5M18A 5IF6A 1HYFA 2CWUA 3OWYA 1LOWA 3J7Yd 1EG9B 1UI8A 3ROBA 2F5WA 1W2ZA 2F4YA 5BU4A 2CIUA 2FGTA 1EQKA 1RGHA 1Q9EA 1DE3A 1NB3I 1VQP3 2WGOA 3EHCA 2W0QA 3KKGA 3NM2A 3DZLA 4HM8B 3V92A 4BTWA 3LTBA 3DY5A 2CC3A 1WNHA 4MMYB 2GXFA 1BOXA 5G1KA 1N8R4 1O7MB 3F40A 3OWSA 1NJI4 4I5QA 1BRGA 1B20A 1V74A 4WHAA 5D81A 3FF0A 1MOLA 1YVSA 3CCV3 7GSPA 1BSDA 1BIRA 4EXRA 2H0IA 4EBGA 5ELJA 3UB1A 2CKFB 3GRDA 4LGQA 4HZBB 2RNTA 3ER7A 3GZBA 3NV0B 4BL3A 6GSPA 1YHQ3 2CX0A 1YJW3 1S723 1BNJA 3K9MC 3HK4A 3URPA 3NQZA 3PXMA 3T0UA 4O02B 3CXC2 1D6UA 5IEOA 1N9EA 2W6JH 1TRQA 4HM6B 1RHLA 2QGUA 2H0HA 4OVMA 1SJWA 3JUNA 3CNMA 3DH2A 2XEPA 4LYLB 2BT3A 4TX4A 5IW9A 3G713 2WGQA 4JRFA 2BU4A 3CPW2 1UCIA 1I2GA 4L8PA 1VQ93 3H3HA 1BNRA 4FCJA 3Q2PA 2C4BA 1BNIA 2CFKA 2XGNA 3NUVA 4J5GA 4EW5A 1KSIA 3FGYA 1BSCA 1BRJA 3WA3A 4MMXB 2O3OA 2XGLA 4KZ1A 4N6NB 9RNTA 3CC43 4I4KA 4GSPA 1K8A4 1NU3A 1RCLA 2A15A 1GY6A 3M8CA 3BU4A 3F14A 2KRTA 1OGZA 3S5CA 3SX1A 4FR9A 5M19A 1LXEA 3F8XA 5LC7A 4L7KA 1T2IA 2IUKA 1RNBA 2XRXB 3DGYA 2B24B 3E99A 4GHOA 3HI7A 1JBRA 1Q40A 1J2BA 3AMOB 1JBSA 2L1SA 3VGNA 5IERA 1UCKA 2CG1A 1WTHA 4FCMA 1WQLB 4NHFA 3RDEA 4J5KA 1RKYA 1QVG2 1X1WA 3LT8A 1BSBA 4J9AA 3KCHA 3JUQA 2W56B 5IEPA 3SOAA 2FNQA 1IVUA 1LOXA 2F56A 2CX1A 4IPBA 1FYSA 1RGLA 1TU5A 1GY7A 1I70A 1OH0A 4R4KA 1ZS7A 3NBRA 1OHSA 2HOHA 2K54A 3EB8A 4HM3B 1LNHA 2CH9A 3Q90A 4KFDA 1AV4A 1FUWA 1TFOA 2LYXA 3KFQC 1A2PA 1JN5B 2BNGA 3JUPA 4N6TA 3NM7A 3CCL3 1KQS2 4GB5A 3MG1A 4WP5A 1BSAA 1OGXA 2RBIA 4HBRA 4R9KA 4BIRA 5BXQA 1F8NA 4HM5B 2XR8B 2C11A 1FUSA 1B3SA 5FW5A 3CME3 5EEOA 3OW22 1LOVA 1AVKA 2GU3A 2KF6A 3HIGA 3EX9A 3KZTA 3BNEA 3LTAA 2XSHB 2KXGA 2CFGA 4U13A 1DETA 1NB5I 3OV4A 1E3RA 1RRLA 1RMSA 1STDA 5HGRA 3VF1A 1X1XA 3EF8A 5KP4A 3G6E3 3CCM3 2KF4A 1RGEA 3BIRA 4X2OA 1IT8A 2K3DA 3ECFA 1A2VA 3U97A 4CDLA 5IENA 2P09A 1LOYA 1GD3A 2CFWA 4HYZA 4XDVA 1UGIA 1IQ8A
chains in the Genus database with same CATH topology
3N8BA 2P0MA 2CFDA 1O7NB 2XSOB 3K7CA 1JB5A 2P0XA 1GD4A 1OHPA 1JNQA 3SLUA 1WMNA 3WODG 1VQL3 2E2TA 1A67A 5EVHA 5AIGA 3MWZA 1PU4A 2Y74A 3T8NA 1VQ73 1FGRA 2CFLA 4FCZA 5A0OB 1WMPA 5AYSC 4KFEA 5JPPA 4LSOA 3DGLA 4FMAA 3GZXB 1CYUA 2C10A 1NDOB 4LZIA 4L8OA 3BNBA 1DVCA 1JKGB 1VQN3 2HMNB 3T8UA 2PNCA 4J8TA 3BLZA 1UI7A 2BO9B 3S27A 3HZPA 2HMKB 3IPTA 4CCVA 2R4IA 1N9JA 1U5OA 3EE1A 1E3VA 3CCS3 1IK3A 4RNYA 3NHXA 1IV9A 4AKYA 3RGAA 3UJMA 1TUHA 5DREA 1IVXA 3X3YA 1K9M4 4JF8A 3JUOA 1JJ22 3RGRA 3DUKA 2BMRB 2B1XB 3MSOA 3K0ZA 5DRVA 3I553 4XDWA 5FGOA 3OWUA 3SVAA 5AEWB 5JBSA 1Q42A 2OTL3 3MG2A 3PS8A 4HJLB 2ML5A 3PYJA 2W9QA 3DGMA 3JUMA 3GZRA 3LYGA 2WO0A 2YFJB 3NX0A 3OXAA 1T5YA 4BTXA 1W2B2 3MYTA 2XFSA 1CYVA 3NV0A 2RSXA 2ZDJA 1O7HB 1A2KA 3MG3A 4EYCA 2E2VA 1RN7A 1ROAA 5JPUA 3GWRA 2OQEC 3F8HA 1QMAA 5STDA 3CCJ3 5CK6A 1Z1SA 4MMZB 4H61A 1IDPA 2OOVA 2BMOB 4HVNA 5IG0A 1IV7A 5AIHA 4HM2B 3G4S3 1KD14 3G8ZA 1VQ53 1VZZA 5CXOA 4ORLA 4QWTA 2WOFA 1C7HA 4FMCA 1QVF2 3DXOA 5IG3A 3LTCA 1OCVA 3IJEB 2JQ5A 1YI23 1FGMA 1PFPA 2F98A 2F99A 3BNDA 3FCSB 1SQWA 3JVCA 2MC8A 4WYKA 3CCR3 3FSDA 2P05A 1DMQA 1JV2B 2K0MA 1S5AA 2HMJB 3H51A 1VQ43 2Q07A 3F7XA 1K28A 3LT9A 3NBJA 1VQ63 1BUQA 3KN4A 5LC6A 1L5GB 2E2UA 1EA2A 3FG4A 1YVBI 1SIIA 2OCTA 3BB9A 1IT7A 2W9PA 4XBXA 2HMLB 1E97A 1CEWI 4K1VA 1JKGA 4RNZA 3L0RA 1MNLA 1QALA 4R9LA 1DYUA 7STDA 2CK3H 2RGQA 1QAKA 3MKIA 3EQQB 6STDA 2GBXB 3CC73 2W04A 1ISKA 3CCE3 3LXUX 4LMIA 1U8CB 1AVLA 3V98A 3CMA3 4OK0A 3SOYA 1ZX2A 3A76A 1GYBA 4EV5A 1UUVB 1YIJ3 3UL6A 1OACA 3NQYA 3D9RA 1JB2A 2OOVC 3X3ZA 2OTJ3 3FKAA 3STDA 4EV2A 3MPHA 2IUJA 3V99A 1W01A 1G96A 1M1K4 4IIAA 1LVNA 4XB5A 4N3VA 2STDA 3FH1A 4K61A 1TP6A 3WDGB 3UNLA 1M9GA 2Y73A 1IQYA 1HU9A 1GY5A 1W6YA 3LMLA 5G2GA 1Q7Y4 1O7PB 2IMJA 3WOFB 1VQK3 3DGOA 4XBTA 1YJN3 3EBYA 3PCRA 8CHOA 5BVBA 3ALAA 1IVWA 2WOHA 3O8YA 1IU7A 1OUNA 3I0YA 3OX9A 4MJDA 1W4NA 2RFRA 3K63A 1ULJB 2UX0A 5EQLA 1ZO2A 1KWIA 3WMDA 2QIYA 4R1KA 1CQSA 4N6LA 3CU3A 3G0KA 4FMBA 3QRDA 3EN8A 2QA43 1ASKA 3LH4A 4G1MB 4HM4B 2CHCA 2F86B 3B4PA 4STDA 3VSYA 2IA7A 1FA3A 4RZMA 2Z77A 1W02A 1ULIB 1M904 1D6ZA 1QJGA 1RJOA 2OWPA 3PZWA 1QAFA 2HMOB 3AMOA 3B4OA 2GBWB 4KVHA 3EC9A 4X2HA 5IG4A 3I563 4MEIA 4R80A 4WWUC 1VQ83 1W6GA 2LQVA 3LTDA 1YJ93 2Z7AA 5CF1A 1Q814 4OUQA 4BTYA 2MF7A 4K90B 3CCQ3 4PEJA 3PCSA 4IT7A 1JB4A 1RRHA 3FLJA 5ELUA 4AEQA 1FGQA 1TIJA 1WMOA 3F9SA 3KIIA 1IQXA 2RCDA 2Z76A 3CCU3 2PZVA 5AIIA 4XBYA 1K41A 2ML6A 3Q1CA 2XFTA 1DVDA 4HKVB 3CPOA 3S29A 4N6OB 1HKXA 5KP1A 1D6YA 4O2HA 2CWTA 4KFFA 2V1LA 1OPYA 2I9WA 1Q824 3SXXA 3KSED 5AIFA 3B7CA 2FXTA 3S28A 2M7OA 4HZ9B 2INXA 2JDIH 5AYRB 3U1WA 4GL6A 4HM1B 5AEUB 5IG5A 1K734 3EJVA 2GEYA 2BMQB 3DMCA 3HX8A 1FGTA 3X40A 2YFIB 3FG3A 4EC6A 2CW9A 2CWVA 2W56A 4O8SA 3S67A 4HM0B 3HIIA 2D1WA 2W2CA 3KE7A 3NBBA 3FF2A 1UW1A 1VQO3 1Y4KA 1Q864 3EN1B 1W00A 1AR0A 3LZAA 4LEHA 4O3VA 2YFLB 3N9HA 3X3XA 1KC84 1O7GB 3SEDA 2OQEA 3X41A 1US1A 2BHMA 1W5ZA 3LOYA 4K1UA 4RBNA 1VQM3 4WYKB 4N6UA 2Z6BA 4Q53A 1DMMA 1TFKA 1JN5A 2HMMB 3B8LA 2SBLA 3FG1A 1UUWB 4FMDA 2KCDA 2CG0A 3G16A 4XM4A 3D3LA 4N6V0 4N6MA 4H3UA 3KSPA 3EBTA 1OHOA 2GU1A 4AKZA 3WA2X 4HM7B 1N5PA 3CC23 1SPUA 3DGNA 1STFI 3TDGA 2W03A 3GAXA 3PGBA 2D42A 3DM8A 1DMNA 2QEX3 1OF5A 3QK9A 1EKMA 3NXJA 3MHEA 4ZM8A 1R4CA 2XF3A 4WFOA 2YX9A 1W6CA 1GS3A 3UL5A 1N8QA 1M1XB 1Q40B 1YGEA 4NREA 2ZL8A 1NWWA 2XH9A 1FGOA 5TGNA 1IVVA 1OF5B 2GEXA 5KP3A 3GZYB 3CNXA 5D82A 3K5TA 3N54B 5AI1A 3IMAB 1SIHA 3CD63 5D83A 5I97A 3WOEB 1W7CA 2O9UX 3BNCA 3F7SA 5CF2A 1YIT3 1NO3A 1A90A 5CLKA 2P38A 2L4VA 1O7WB 3FZWA 1N5HA 1ROVA 1JRQA 3X42A 5IF6A 2CWUA 3OWYA 3J7Yd 1EG9B 1UI8A 3ROBA 1W2ZA 2CIUA 2FGTA 1EQKA 1NB3I 1VQP3 2WGOA 3EHCA 2W0QA 3KKGA 3NM2A 3DZLA 4HM8B 3V92A 4BTWA 3LTBA 3DY5A 2CC3A 1WNHA 4MMYB 2GXFA 1N8R4 1O7MB 3F40A 3OWSA 1NJI4 1V74A 4WHAA 5D81A 3FF0A 1MOLA 3CCV3 4EXRA 4EBGA 5ELJA 3UB1A 2CKFB 3GRDA 4LGQA 4HZBB 3GZBA 3ER7A 1YHQ3 3NV0B 1YJW3 1S723 3K9MC 3HK4A 3NQZA 3PXMA 3T0UA 4O02B 3CXC2 1D6UA 5IEOA 1N9EA 2W6JH 4HM6B 2QGUA 4OVMA 1SJWA 3JUNA 3CNMA 5IW9A 2XEPA 3G713 2BT3A 4TX4A 3CPW2 2WGQA 4JRFA 4L8PA 1VQ93 3H3HA 4FCJA 3Q2PA 2CFKA 3NUVA 2XGNA 1KSIA 3FGYA 3WA3A 4MMXB 2O3OA 2XGLA 4KZ1A 4N6NB 3CC43 4I4KA 1K8A4 1NU3A 2A15A 1GY6A 3M8CA 3S5CA 3F14A 2KRTA 1OGZA 3SX1A 4FR9A 1LXEA 3F8XA 5LC7A 4L7KA 2IUKA 2XRXB 3E99A 2B24B 3HI7A 1Q40A 1J2BA 3AMOB 3VGNA 5IERA 2CG1A 1WTHA 4FCMA 1WQLB 4NHFA 3RDEA 1RKYA 1QVG2 3LT8A 4J9AA 3JUQA 2W56B 5IEPA 3SOAA 2FNQA 1IVUA 1LOXA 4IPBA 1TU5A 1GY7A 1OH0A 4R4KA 3NBRA 1OHSA 2K54A 3EB8A 4HM3B 1LNHA 2CH9A 3Q90A 4KFDA 1AV4A 1FUWA 1TFOA 2LYXA 3KFQC 1JN5B 2BNGA 3JUPA 4N6TA 3NM7A 3CCL3 1KQS2 4GB5A 3MG1A 4WP5A 1OGXA 4HBRA 4R9KA 5BXQA 1F8NA 4HM5B 2XR8B 2C11A 5FW5A 3CME3 5EEOA 3OW22 1AVKA 2GU3A 3HIGA 3EX9A 3KZTA 3BNEA 3LTAA 2XSHB 2KXGA 2CFGA 4U13A 1NB5I 3OV4A 1E3RA 1RRLA 3VF1A 1STDA 5HGRA 3EF8A 5KP4A 3G6E3 3CCM3 4X2OA 1IT8A 3ECFA 1A2VA 3U97A 4CDLA 5IENA 2P09A 1GD3A 2CFWA 4HYZA 4XDVA 1IQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKV B;  3CPO A;  1HKX A;  5KP1 A;  1EA2 A;  2CKF B;  3GRD A;  1OPY A;  2I9W A;  1O7N B;  2XSO B;  3ER7 A;  1JB5 A;  3BB9 A;  1OHP A;  3B7C A;  3GZB A;  3K7C A;  3NV0 B;  5AIF A;  5IF6 A;  4HZ9 B;  4XBX A;  3HK4 A;  2HML B;  5EVH A;  2INX A;  5AIG A;  5AEU B;  1E97 A;  5IG5 A;  4HM1 B;  4K1V A;  3EJV A;  1JKG A;  3T8N A;  2GEY A;  2BMQ B;  5IEO A;  3DMC A;  3HX8 A;  2YFI B;  4R9L A;  7STD A;  2RGQ A;  4HM6 B;  2QGU A;  4OVM A;  4HM0 B;  1SJW A;  3JUN A;  4XBY A;  5DRV A;  2W2C A;  3KE7 A;  3CNM A;  3MKI A;  5JPP A;  3EQQ B;  3FF2 A;  6STD A;  2GBX B;  3GZX B;  3EN1 B;  1ISK A;  4L8P A;  1W00 A;  1AR0 A;  3H3H A;  3LZA A;  4FCJ A;  4LEH A;  1NDO B;  2YFL B;  4LMI A;  3NUV A;  4L8O A;  1O7G B;  3SED A;  1JKG B;  4K1U A;  1ZX2 A;  2HMN B;  3A76 A;  3FGY A;  3SOY A;  1GYB A;  3T8U A;  1UUV B;  4WYK B;  4I4K A;  4J8T A;  3BLZ A;  1DMM A;  1JB2 A;  1NU3 A;  3D9R A;  4Q53 A;  2A15 A;  1JN5 A;  1GY6 A;  2HMM B;  3B8L A;  3F14 A;  1OGZ A;  3FKA A;  3HZP A;  3M8C A;  3S5C A;  3STD A;  2HMK B;  1W01 A;  3F8X A;  1UUW B;  3IPT A;  4L7K A;  3G16 A;  2R4I A;  4IIA A;  4XM4 A;  1U5O A;  2XRX B;  1E3V A;  2B24 B;  3E99 A;  4XB5 A;  4N3V A;  2STD A;  3FH1 A;  1TP6 A;  4H3U A;  1Q40 A;  3UNL A;  3KSP A;  1OHO A;  3EBT A;  3NHX A;  1GY5 A;  1W6Y A;  4HM7 B;  5G2G A;  3RGA A;  1O7P B;  2IMJ A;  3VGN A;  3UJM A;  1TUH A;  5IER A;  5DRE A;  4XBT A;  4FCM A;  1WQL B;  3JUO A;  3EBY A;  8CHO A;  3DM8 A;  1DMN A;  5BVB A;  5IEP A;  3RGR A;  1OF5 A;  1OUN A;  2B1X B;  2BMR B;  3DUK A;  3I0Y A;  3K0Z A;  3MSO A;  3NXJ A;  3MHE A;  3OX9 A;  4J9A A;  4MJD A;  4XDW A;  2RFR A;  3JUQ A;  1ULJ B;  2UX0 A;  1Q42 A;  3OWU A;  3SOA A;  5AEW B;  1GS3 A;  1ZO2 A;  3MG2 A;  4HJL B;  1Q40 B;  3WMD A;  2QIY A;  4R1K A;  1CQS A;  3CU3 A;  1GY7 A;  1NWW A;  1OH0 A;  3G0K A;  3NBR A;  3JUM A;  1OHS A;  2GEX A;  1OF5 B;  2K54 A;  2YFJ B;  3GZR A;  3LYG A;  3OXA A;  5KP3 A;  3GZY B;  3CNX A;  3MYT A;  3EN8 A;  4HM3 B;  5D82 A;  3Q90 A;  1ASK A;  3NV0 A;  5AI1 A;  4HM4 B;  2CHC A;  2F86 B;  3B4P A;  5STD A;  4STD A;  1O7H B;  2BNG A;  5D83 A;  1A2K A;  3JUP A;  3MG3 A;  3VSY A;  5JPU A;  3F7S A;  3GWR A;  4HZB B;  4RZM A;  5CF2 A;  4GB5 A;  3F8H A;  1QMA A;  2Z77 A;  3MG1 A;  1W02 A;  1Z1S A;  4WP5 A;  5CK6 A;  1OGX A;  1O7W B;  1ULI B;  3FZW A;  4R9K A;  5CLK A;  1IDP A;  5BXQ A;  5TGN A;  2BMO B;  4HVN A;  1QJG A;  2XR8 B;  4HM5 B;  5IG0 A;  5AIH A;  2OWP A;  4HM2 B;  2HMO B;  3B4O A;  3OWY A;  2GBW B;  3G8Z A;  3EC9 A;  4KVH A;  4X2H A;  5FW5 A;  4LGQ A;  1VZZ A;  5CXO A;  1EG9 B;  4ORL A;  4WWU C;  3ROB A;  5IG4 A;  1C7H A;  3EX9 A;  3KZT A;  3DXO A;  4U13 A;  2XSH B;  5IG3 A;  1OCV A;  2JQ5 A;  2Z7A A;  3OV4 A;  2F98 A;  5CF1 A;  1E3R A;  4OUQ A;  3EHC A;  1STD A;  2F99 A;  3KKG A;  3NM2 A;  3DZL A;  4HM8 B;  3EF8 A;  5HGR A;  5KP4 A;  4WYK A;  3FSD A;  4PEJ A;  4X2O A;  1JB4 A;  1DMQ A;  3FLJ A;  2GXF A;  3ECF A;  4CDL A;  1S5A A;  5IEN A;  1O7M B;  3F40 A;  3F9S A;  2HMJ B;  3H51 A;  3OWS A;  2RCD A;  1BUQ A;  3F7X A;  2Z76 A;  4XDV A;  5D81 A;  2PZV A;  5AII A;  3FF0 A;  1K41 A;  1JN5 B; 
#chains in the Genus database with same CATH topology
 3N8B A;  2P0M A;  1BUJ A;  1RGC A;  2CFD A;  1BAO A;  1O7N B;  2XSO B;  1MWR A;  1JB5 A;  1BRS A;  1GD4 A;  1OHP A;  1JNQ A;  2P0X A;  1WMN A;  3K7C A;  3SLU A;  3WOD G;  1UUG B;  1VQL 3;  2E2T A;  4KT3 B;  1YNV X;  1A67 A;  5EVH A;  5AIG A;  1GMQ A;  3MWZ A;  1PU4 A;  1BRK A;  2Y74 A;  3T8N A;  1VQ7 3;  1FGR A;  2CFL A;  4FCZ A;  5A0O B;  1RN4 A;  1WMP A;  5AYS C;  2AAE A;  4KFE A;  5JPP A;  4LSO A;  3DGL A;  4FMA A;  1GMP A;  3GZX B;  1UCJ A;  1TRP A;  1CYU A;  2C10 A;  1BAN A;  1NDO B;  4LZI A;  4L8O A;  3BNB A;  1DVC A;  1JKG B;  1VQN 3;  2HMN B;  4HAA A;  3T8U A;  2PNC A;  4J8T A;  3BLZ A;  1UI7 A;  2BO9 B;  3S27 A;  3HZP A;  2HMK B;  3IPT A;  1BNS A;  4CCV A;  2R4I A;  1N9J A;  1U5O A;  3EE1 A;  1E3V A;  3ZFZ A;  3CCS 3;  1IK3 A;  4HOH A;  1TTO A;  1B2U A;  4RNY A;  3NHX A;  1IV9 A;  4AKY A;  1GSP A;  3RGA A;  4RNT A;  1RSN A;  3UJM A;  1TUH A;  5DRE A;  1IVX A;  3AGN A;  1UGH I;  3X3Y A;  1K9M 4;  4JF8 A;  3JUO A;  1JJ2 2;  3RGR A;  3DUK A;  2BMR B;  2B1X B;  3MSO A;  3K0Z A;  5DRV A;  3I55 3;  1B27 A;  4XDW A;  5FGO A;  3OWU A;  3SVA A;  1BGS A;  5AEW B;  1Q42 A;  5JBS A;  2OTL 3;  3MG2 A;  3PS8 A;  4HJL B;  1RGG A;  2ML5 A;  3PYJ A;  2W9Q A;  3DGM A;  3JUM A;  3GZR A;  3LYG A;  2WO0 A;  2GSP A;  2YFJ B;  3NX0 A;  1T5Y A;  3OXA A;  1W2B 2;  1MGR A;  2XFS A;  3MYT A;  1CYV A;  1JZO A;  3NV0 A;  2H0G A;  2RSX A;  2ZDJ A;  5M1A A;  1O7H B;  1I0X A;  1A2K A;  3MG3 A;  4EYC A;  2E2V A;  1RN7 A;  1ROA A;  5JPU A;  3GWR A;  2OQE C;  3F8H A;  1QMA A;  5STD A;  3CCJ 3;  5CK6 A;  1Z1S A;  4MMZ B;  4DKI A;  4CPK A;  4H61 A;  1IDP A;  2OOV A;  2BMO B;  4HVN A;  5IG0 A;  1IV7 A;  1BNF A;  5AIH A;  2KF3 A;  4HM2 B;  3G4S 3;  1FZU A;  1KD1 4;  3G8Z A;  1VQ5 3;  1VZZ A;  5CXO A;  1X1U A;  4ORL A;  4QWT A;  2WOF A;  1C7H A;  4ILF A;  1B2S A;  4FMC A;  1QVF 2;  3DXO A;  5IG3 A;  3LTC A;  1OCV A;  3IJE B;  2JQ5 A;  1YI2 3;  1FGM A;  1PFP A;  2F98 A;  1GOY A;  2F99 A;  3GSP A;  3BND A;  3FCS B;  1SQW A;  3JVC A;  2MC8 A;  1YGW A;  4WYK A;  3CCR 3;  3FSD A;  2P05 A;  3I56 3;  1PY3 A;  1DMQ A;  1JV2 B;  2K0M A;  4BU4 A;  1S5A A;  2HMJ B;  3H51 A;  1VQ4 3;  1BRH A;  1RGF A;  6RNT A;  2Q07 A;  3F7X A;  1K28 A;  3LT9 A;  3SYU A;  2SAR A;  3NBJ A;  1VQ6 3;  1BUQ A;  3KN4 A;  5LC6 A;  1G02 A;  1L5G B;  1IYY A;  2E2U A;  1EA2 A;  3FG4 A;  1YVB I;  1SII A;  2OCT A;  1RGA A;  3AHW A;  1FUT A;  2KAA A;  3BB9 A;  1I3I A;  1IT7 A;  2W9P A;  4XBX A;  1B2M A;  2HML B;  2UUG C;  2UGI A;  1E97 A;  1CEW I;  1T2H A;  1BNE A;  4K1V A;  1BSE A;  1JKG A;  4RNZ A;  3L0R A;  1MNL A;  1QAL A;  4R9L A;  1DYU A;  7STD A;  2CK3 H;  2RGQ A;  3AHS A;  1AY7 A;  1QAK A;  3MKI A;  3EQQ B;  6STD A;  2GBX B;  3CC7 3;  2W04 A;  1ISK A;  3CCE 3;  3LXU X;  4LMI A;  1U8C B;  1AVL A;  3V98 A;  3CMA 3;  4OK0 A;  3SOY A;  1ZX2 A;  3A76 A;  1GYB A;  4EV5 A;  1UUV B;  1YIJ 3;  3UL6 A;  1B21 A;  5HOH A;  1OAC A;  3NQY A;  1JB2 A;  2OOV C;  3D9R A;  3X3Z A;  2OTJ 3;  4CJN A;  2ZHX B;  3AGO A;  3FKA A;  3STD A;  4BL2 A;  4EV2 A;  3A5E A;  3MPH A;  2IUJ A;  3V99 A;  1W01 A;  3WHO A;  1G96 A;  1M1K 4;  1SAR A;  2R41 A;  4BTX A;  4IIA A;  1LVN A;  4XB5 A;  4N3V A;  2F5M A;  3D5I A;  1X1Y A;  1LQM B;  2STD A;  1TP6 A;  3FH1 A;  4K61 A;  3WDG B;  3UNL A;  1M9G A;  2Y73 A;  1IQY A;  1HU9 A;  1GY5 A;  1W6Y A;  3LML A;  1JZD A;  5G2G A;  1Q7Y 4;  1G0T A;  1O7P B;  2IMJ A;  3WOF B;  1ZGX A;  3DGO A;  1VQK 3;  1GOV A;  2KF5 A;  4XBT A;  3ZG0 A;  2AAD A;  2ZA4 A;  1YJN 3;  3EBY A;  3PCR A;  8CHO A;  5BVB A;  3ALA A;  1IVW A;  2WOH A;  3O8Y A;  1IU7 A;  1OUN A;  3I0Y A;  3OX9 A;  4MJD A;  3RNT A;  1W4N A;  2RFR A;  3K63 A;  1ULJ B;  2UX0 A;  5EQL A;  1ZO2 A;  1KWI A;  3WMD A;  1T3B A;  2QIY A;  1CQS A;  1UDI I;  4R1K A;  4N6L A;  3CU3 A;  3G0K A;  4FMB A;  3QRD A;  3EN8 A;  2QA4 3;  1RDS A;  1ASK A;  3LH4 A;  4G1M B;  4HM4 B;  2CHC A;  2F86 B;  3B4P A;  4STD A;  3VSY A;  1BNG A;  2IA7 A;  1FA3 A;  4RZM A;  2Z77 A;  1W02 A;  1V58 A;  1ULI B;  1M90 4;  2IYJ A;  1D6Z A;  1QJG A;  1RJO A;  2OWP A;  3PZW A;  1QAF A;  2HMO B;  3AMO A;  3B4O A;  2GBW B;  1LNI A;  3EC9 A;  4KVH A;  1I2F A;  4X2H A;  5IG4 A;  4MEI A;  4R80 A;  4WWU C;  2BIR A;  1VQ8 3;  1W6G A;  1MWS A;  2LQV A;  5G1L A;  3LTD A;  1YJ9 3;  2Z7A A;  1JBT A;  5CF1 A;  1Q81 4;  4OUQ A;  4BTY A;  1MWT A;  2MF7 A;  4K90 B;  1LQG C;  3CCQ 3;  4PEJ A;  3PCS A;  1GOU A;  4IT7 A;  3WR2 A;  1JB4 A;  1BRI A;  1RRH A;  3FLJ A;  4NPB A;  5ELU A;  1LRA A;  4AEQ A;  1BRN L;  1FGQ A;  1TIJ A;  1WMO A;  3F9S A;  3KII A;  1B2X A;  1IQX A;  2RCD A;  2Z76 A;  1UCL A;  3CCU 3;  1RGK A;  2PZV A;  5AII A;  4XBY A;  1K41 A;  2ML6 A;  3Q1C A;  2XFT A;  1DVD A;  4HKV B;  5BIR A;  1VQQ A;  3CPO A;  3S29 A;  4N6O B;  1HKX A;  5KP1 A;  1D6Y A;  4O2H A;  1FW7 A;  1RCK A;  2CWT A;  4KFF A;  2V1L A;  1OPY A;  2I9W A;  1Q82 4;  3SXX A;  3KSE D;  5AIF A;  3B7C A;  2FXT A;  3S28 A;  1I0V A;  1RLS A;  2M7O A;  4HZ9 B;  2INX A;  2JDI H;  2IY2 A;  5AYR B;  4GL6 A;  4HM1 B;  3U1W A;  3D4A A;  5AEU B;  8RNT A;  5IG5 A;  3EJV A;  1K73 4;  1EUI C;  2GEY A;  1RTU A;  2BMQ B;  3DMC A;  3HX8 A;  1FGT A;  3X40 A;  2YFI B;  3FG3 A;  4EC6 A;  1NNV A;  2CW9 A;  2CWV A;  2W56 A;  4O8S A;  3S67 A;  4HM0 B;  3HII A;  2D1W A;  2W2C A;  3KE7 A;  3NBB A;  3FF2 A;  1UW1 A;  1VQO 3;  1Y4K A;  1Q86 4;  3EN1 B;  1W00 A;  1AR0 A;  3LZA A;  4LEH A;  4O3V A;  2YFL B;  3N9H A;  3X3X A;  1KC8 4;  1O7G B;  1I3F A;  2OQE A;  3SED A;  3X41 A;  1US1 A;  2BHM A;  1W5Z A;  3LOY A;  4K1U A;  4RBN A;  1VQM 3;  1TJD A;  4N6U A;  4WYK B;  2Z6B A;  4Q53 A;  1DMM A;  1Q7H A;  1RNT A;  1TFK A;  1JN5 A;  2HMM B;  3B8L A;  2SBL A;  3FG1 A;  1EEJ A;  5GSP A;  1UUW B;  1V57 A;  4FMD A;  2KCD A;  1GMR A;  2CG0 A;  3G16 A;  1C54 A;  4XM4 A;  3D3L A;  4N6V 0;  4N6M A;  1PYL A;  4H3U A;  3D79 A;  3KSP A;  1OHO A;  3EBT A;  2GU1 A;  4AKZ A;  3WA2 X;  4HM7 B;  1N5P A;  3CC2 3;  3D5G A;  1SPU A;  3DGN A;  1STF I;  3TDG A;  2W03 A;  3GAX A;  3PGB A;  1AQZ A;  1I2E A;  2D42 A;  3DM8 A;  1DMN A;  2QEX 3;  1OF5 A;  3QK9 A;  1EKM A;  1R4Y A;  3NXJ A;  3MHE A;  4ZM8 A;  1R4C A;  2XF3 A;  4WFO A;  2YX9 A;  1W6C A;  1GS3 A;  3UL5 A;  1N8Q A;  1M1X B;  1Q40 B;  1YGE A;  4NRE A;  2ZL8 A;  1NWW A;  2XH9 A;  1FGO A;  5TGN A;  1IVV A;  1OF5 B;  2GEX A;  5KP3 A;  1BU4 A;  3GZY B;  3CNX A;  5D82 A;  3K5T A;  3N54 B;  5AI1 A;  1B2Z A;  3IMA B;  1SIH A;  3CD6 3;  1MWU A;  5D83 A;  7RNT A;  5I97 A;  3ZG5 A;  3HOH A;  1CH0 A;  1I8V A;  3WOE B;  1BVI A;  1W7C A;  2O9U X;  3BNC A;  3F7S A;  5CF2 A;  1NO3 A;  1YIT 3;  1A90 A;  5CLK A;  1RN1 A;  2P38 A;  2L4V A;  1HZ1 A;  1O7W B;  1MGW A;  3FZW A;  1N5H A;  2J8X B;  1ROV A;  3Q3F A;  1JRQ A;  3X42 A;  5RNT A;  5M18 A;  5IF6 A;  1HYF A;  2CWU A;  3OWY A;  1LOW A;  3J7Y d;  1EG9 B;  1UI8 A;  3ROB A;  2F5W A;  1W2Z A;  2F4Y A;  5BU4 A;  2CIU A;  2FGT A;  1EQK A;  1RGH A;  1Q9E A;  1DE3 A;  1NB3 I;  1VQP 3;  2WGO A;  3EHC A;  2W0Q A;  3KKG A;  3NM2 A;  3DZL A;  4HM8 B;  3V92 A;  4BTW A;  3LTB A;  3DY5 A;  2CC3 A;  1WNH A;  4MMY B;  2GXF A;  1BOX A;  5G1K A;  1N8R 4;  1O7M B;  3F40 A;  3OWS A;  1NJI 4;  4I5Q A;  1BRG A;  1B20 A;  1V74 A;  4WHA A;  5D81 A;  3FF0 A;  1MOL A;  1YVS A;  3CCV 3;  7GSP A;  1BSD A;  1BIR A;  4EXR A;  2H0I A;  4EBG A;  5ELJ A;  3UB1 A;  2CKF B;  3GRD A;  4LGQ A;  4HZB B;  2RNT A;  3ER7 A;  3GZB A;  3NV0 B;  4BL3 A;  6GSP A;  1YHQ 3;  2CX0 A;  1YJW 3;  1S72 3;  1BNJ A;  3K9M C;  3HK4 A;  3URP A;  3NQZ A;  3PXM A;  3T0U A;  4O02 B;  3CXC 2;  1D6U A;  5IEO A;  1N9E A;  2W6J H;  1TRQ A;  4HM6 B;  1RHL A;  2QGU A;  2H0H A;  4OVM A;  1SJW A;  3JUN A;  3CNM A;  3DH2 A;  2XEP A;  4LYL B;  2BT3 A;  4TX4 A;  5IW9 A;  3G71 3;  2WGQ A;  4JRF A;  2BU4 A;  3CPW 2;  1UCI A;  1I2G A;  4L8P A;  1VQ9 3;  3H3H A;  1BNR A;  4FCJ A;  3Q2P A;  2C4B A;  1BNI A;  2CFK A;  2XGN A;  3NUV A;  4J5G A;  4EW5 A;  1KSI A;  3FGY A;  1BSC A;  1BRJ A;  3WA3 A;  4MMX B;  2O3O A;  2XGL A;  4KZ1 A;  4N6N B;  9RNT A;  3CC4 3;  4I4K A;  4GSP A;  1K8A 4;  1NU3 A;  1RCL A;  2A15 A;  1GY6 A;  3M8C A;  3BU4 A;  3F14 A;  2KRT A;  1OGZ A;  3S5C A;  3SX1 A;  4FR9 A;  5M19 A;  1LXE A;  3F8X A;  5LC7 A;  4L7K A;  1T2I A;  2IUK A;  1RNB A;  2XRX B;  3DGY A;  2B24 B;  3E99 A;  4GHO A;  3HI7 A;  1JBR A;  1Q40 A;  1J2B A;  3AMO B;  1JBS A;  2L1S A;  3VGN A;  5IER A;  1UCK A;  2CG1 A;  1WTH A;  4FCM A;  1WQL B;  4NHF A;  3RDE A;  4J5K A;  1RKY A;  1QVG 2;  1X1W A;  3LT8 A;  1BSB A;  4J9A A;  3KCH A;  3JUQ A;  2W56 B;  5IEP A;  3SOA A;  2FNQ A;  1IVU A;  1LOX A;  2F56 A;  2CX1 A;  4IPB A;  1FYS A;  1RGL A;  1TU5 A;  1GY7 A;  1I70 A;  1OH0 A;  4R4K A;  1ZS7 A;  3NBR A;  1OHS A;  2HOH A;  2K54 A;  3EB8 A;  4HM3 B;  1LNH A;  2CH9 A;  3Q90 A;  4KFD A;  1AV4 A;  1FUW A;  1TFO A;  2LYX A;  3KFQ C;  1A2P A;  1JN5 B;  2BNG A;  3JUP A;  4N6T A;  3NM7 A;  3CCL 3;  1KQS 2;  4GB5 A;  3MG1 A;  4WP5 A;  1BSA A;  1OGX A;  2RBI A;  4HBR A;  4R9K A;  4BIR A;  5BXQ A;  1F8N A;  4HM5 B;  2XR8 B;  2C11 A;  1FUS A;  1B3S A;  5FW5 A;  3CME 3;  5EEO A;  3OW2 2;  1LOV A;  1AVK A;  2GU3 A;  2KF6 A;  3HIG A;  3EX9 A;  3KZT A;  3BNE A;  3LTA A;  2XSH B;  2KXG A;  2CFG A;  4U13 A;  1DET A;  1NB5 I;  3OV4 A;  1E3R A;  1RRL A;  1RMS A;  1STD A;  5HGR A;  3VF1 A;  1X1X A;  3EF8 A;  5KP4 A;  3G6E 3;  3CCM 3;  2KF4 A;  1RGE A;  3BIR A;  4X2O A;  1IT8 A;  2K3D A;  3ECF A;  1A2V A;  3U97 A;  4CDL A;  5IEN A;  2P09 A;  1LOY A;  1GD3 A;  2CFW A;  4HYZ A;  4XDV A;  1UGI A;  1IQ8 A; 
#chains in the Genus database with same CATH homology
 3N8B A;  2P0M A;  2CFD A;  1O7N B;  2XSO B;  3K7C A;  1JB5 A;  2P0X A;  1GD4 A;  1OHP A;  1JNQ A;  3SLU A;  1WMN A;  3WOD G;  1VQL 3;  2E2T A;  1A67 A;  5EVH A;  5AIG A;  3MWZ A;  1PU4 A;  2Y74 A;  3T8N A;  1VQ7 3;  1FGR A;  2CFL A;  4FCZ A;  5A0O B;  1WMP A;  5AYS C;  4KFE A;  5JPP A;  4LSO A;  3DGL A;  4FMA A;  3GZX B;  1CYU A;  2C10 A;  1NDO B;  4LZI A;  4L8O A;  3BNB A;  1DVC A;  1JKG B;  1VQN 3;  2HMN B;  3T8U A;  2PNC A;  4J8T A;  3BLZ A;  1UI7 A;  2BO9 B;  3S27 A;  3HZP A;  2HMK B;  3IPT A;  4CCV A;  2R4I A;  1N9J A;  1U5O A;  3EE1 A;  1E3V A;  3CCS 3;  1IK3 A;  4RNY A;  3NHX A;  1IV9 A;  4AKY A;  3RGA A;  3UJM A;  1TUH A;  5DRE A;  1IVX A;  3X3Y A;  1K9M 4;  4JF8 A;  3JUO A;  1JJ2 2;  3RGR A;  3DUK A;  2BMR B;  2B1X B;  3MSO A;  3K0Z A;  5DRV A;  3I55 3;  4XDW A;  5FGO A;  3OWU A;  3SVA A;  5AEW B;  5JBS A;  1Q42 A;  2OTL 3;  3MG2 A;  3PS8 A;  4HJL B;  2ML5 A;  3PYJ A;  2W9Q A;  3DGM A;  3JUM A;  3GZR A;  3LYG A;  2WO0 A;  2YFJ B;  3NX0 A;  3OXA A;  1T5Y A;  4BTX A;  1W2B 2;  3MYT A;  2XFS A;  1CYV A;  3NV0 A;  2RSX A;  2ZDJ A;  1O7H B;  1A2K A;  3MG3 A;  4EYC A;  2E2V A;  1RN7 A;  1ROA A;  5JPU A;  3GWR A;  2OQE C;  3F8H A;  1QMA A;  5STD A;  3CCJ 3;  5CK6 A;  1Z1S A;  4MMZ B;  4H61 A;  1IDP A;  2OOV A;  2BMO B;  4HVN A;  5IG0 A;  1IV7 A;  5AIH A;  4HM2 B;  3G4S 3;  1KD1 4;  3G8Z A;  1VQ5 3;  1VZZ A;  5CXO A;  4ORL A;  4QWT A;  2WOF A;  1C7H A;  4FMC A;  1QVF 2;  3DXO A;  5IG3 A;  3LTC A;  1OCV A;  3IJE B;  2JQ5 A;  1YI2 3;  1FGM A;  1PFP A;  2F98 A;  2F99 A;  3BND A;  3FCS B;  1SQW A;  3JVC A;  2MC8 A;  4WYK A;  3CCR 3;  3FSD A;  2P05 A;  1DMQ A;  1JV2 B;  2K0M A;  1S5A A;  2HMJ B;  3H51 A;  1VQ4 3;  2Q07 A;  3F7X A;  1K28 A;  3LT9 A;  3NBJ A;  1VQ6 3;  1BUQ A;  3KN4 A;  5LC6 A;  1L5G B;  2E2U A;  1EA2 A;  3FG4 A;  1YVB I;  1SII A;  2OCT A;  3BB9 A;  1IT7 A;  2W9P A;  4XBX A;  2HML B;  1E97 A;  1CEW I;  4K1V A;  1JKG A;  4RNZ A;  3L0R A;  1MNL A;  1QAL A;  4R9L A;  1DYU A;  7STD A;  2CK3 H;  2RGQ A;  1QAK A;  3MKI A;  3EQQ B;  6STD A;  2GBX B;  3CC7 3;  2W04 A;  1ISK A;  3CCE 3;  3LXU X;  4LMI A;  1U8C B;  1AVL A;  3V98 A;  3CMA 3;  4OK0 A;  3SOY A;  1ZX2 A;  3A76 A;  1GYB A;  4EV5 A;  1UUV B;  1YIJ 3;  3UL6 A;  1OAC A;  3NQY A;  3D9R A;  1JB2 A;  2OOV C;  3X3Z A;  2OTJ 3;  3FKA A;  3STD A;  4EV2 A;  3MPH A;  2IUJ A;  3V99 A;  1W01 A;  1G96 A;  1M1K 4;  4IIA A;  1LVN A;  4XB5 A;  4N3V A;  2STD A;  3FH1 A;  4K61 A;  1TP6 A;  3WDG B;  3UNL A;  1M9G A;  2Y73 A;  1IQY A;  1HU9 A;  1GY5 A;  1W6Y A;  3LML A;  5G2G A;  1Q7Y 4;  1O7P B;  2IMJ A;  3WOF B;  1VQK 3;  3DGO A;  4XBT A;  1YJN 3;  3EBY A;  3PCR A;  8CHO A;  5BVB A;  3ALA A;  1IVW A;  2WOH A;  3O8Y A;  1IU7 A;  1OUN A;  3I0Y A;  3OX9 A;  4MJD A;  1W4N A;  2RFR A;  3K63 A;  1ULJ B;  2UX0 A;  5EQL A;  1ZO2 A;  1KWI A;  3WMD A;  2QIY A;  4R1K A;  1CQS A;  4N6L A;  3CU3 A;  3G0K A;  4FMB A;  3QRD A;  3EN8 A;  2QA4 3;  1ASK A;  3LH4 A;  4G1M B;  4HM4 B;  2CHC A;  2F86 B;  3B4P A;  4STD A;  3VSY A;  2IA7 A;  1FA3 A;  4RZM A;  2Z77 A;  1W02 A;  1ULI B;  1M90 4;  1D6Z A;  1QJG A;  1RJO A;  2OWP A;  3PZW A;  1QAF A;  2HMO B;  3AMO A;  3B4O A;  2GBW B;  4KVH A;  3EC9 A;  4X2H A;  5IG4 A;  3I56 3;  4MEI A;  4R80 A;  4WWU C;  1VQ8 3;  1W6G A;  2LQV A;  3LTD A;  1YJ9 3;  2Z7A A;  5CF1 A;  1Q81 4;  4OUQ A;  4BTY A;  2MF7 A;  4K90 B;  3CCQ 3;  4PEJ A;  3PCS A;  4IT7 A;  1JB4 A;  1RRH A;  3FLJ A;  5ELU A;  4AEQ A;  1FGQ A;  1TIJ A;  1WMO A;  3F9S A;  3KII A;  1IQX A;  2RCD A;  2Z76 A;  3CCU 3;  2PZV A;  5AII A;  4XBY A;  1K41 A;  2ML6 A;  3Q1C A;  2XFT A;  1DVD A;  4HKV B;  3CPO A;  3S29 A;  4N6O B;  1HKX A;  5KP1 A;  1D6Y A;  4O2H A;  2CWT A;  4KFF A;  2V1L A;  1OPY A;  2I9W A;  1Q82 4;  3SXX A;  3KSE D;  5AIF A;  3B7C A;  2FXT A;  3S28 A;  2M7O A;  4HZ9 B;  2INX A;  2JDI H;  5AYR B;  3U1W A;  4GL6 A;  4HM1 B;  5AEU B;  5IG5 A;  1K73 4;  3EJV A;  2GEY A;  2BMQ B;  3DMC A;  3HX8 A;  1FGT A;  3X40 A;  2YFI B;  3FG3 A;  4EC6 A;  2CW9 A;  2CWV A;  2W56 A;  4O8S A;  3S67 A;  4HM0 B;  3HII A;  2D1W A;  2W2C A;  3KE7 A;  3NBB A;  3FF2 A;  1UW1 A;  1VQO 3;  1Y4K A;  1Q86 4;  3EN1 B;  1W00 A;  1AR0 A;  3LZA A;  4LEH A;  4O3V A;  2YFL B;  3N9H A;  3X3X A;  1KC8 4;  1O7G B;  3SED A;  2OQE A;  3X41 A;  1US1 A;  2BHM A;  1W5Z A;  3LOY A;  4K1U A;  4RBN A;  1VQM 3;  4WYK B;  4N6U A;  2Z6B A;  4Q53 A;  1DMM A;  1TFK A;  1JN5 A;  2HMM B;  3B8L A;  2SBL A;  3FG1 A;  1UUW B;  4FMD A;  2KCD A;  2CG0 A;  3G16 A;  4XM4 A;  3D3L A;  4N6V 0;  4N6M A;  4H3U A;  3KSP A;  3EBT A;  1OHO A;  2GU1 A;  4AKZ A;  3WA2 X;  4HM7 B;  1N5P A;  3CC2 3;  1SPU A;  3DGN A;  1STF I;  3TDG A;  2W03 A;  3GAX A;  3PGB A;  2D42 A;  3DM8 A;  1DMN A;  2QEX 3;  1OF5 A;  3QK9 A;  1EKM A;  3NXJ A;  3MHE A;  4ZM8 A;  1R4C A;  2XF3 A;  4WFO A;  2YX9 A;  1W6C A;  1GS3 A;  3UL5 A;  1N8Q A;  1M1X B;  1Q40 B;  1YGE A;  4NRE A;  2ZL8 A;  1NWW A;  2XH9 A;  1FGO A;  5TGN A;  1IVV A;  1OF5 B;  2GEX A;  5KP3 A;  3GZY B;  3CNX A;  5D82 A;  3K5T A;  3N54 B;  5AI1 A;  3IMA B;  1SIH A;  3CD6 3;  5D83 A;  5I97 A;  3WOE B;  1W7C A;  2O9U X;  3BNC A;  3F7S A;  5CF2 A;  1YIT 3;  1NO3 A;  1A90 A;  5CLK A;  2P38 A;  2L4V A;  1O7W B;  3FZW A;  1N5H A;  1ROV A;  1JRQ A;  3X42 A;  5IF6 A;  2CWU A;  3OWY A;  3J7Y d;  1EG9 B;  1UI8 A;  3ROB A;  1W2Z A;  2CIU A;  2FGT A;  1EQK A;  1NB3 I;  1VQP 3;  2WGO A;  3EHC A;  2W0Q A;  3KKG A;  3NM2 A;  3DZL A;  4HM8 B;  3V92 A;  4BTW A;  3LTB A;  3DY5 A;  2CC3 A;  1WNH A;  4MMY B;  2GXF A;  1N8R 4;  1O7M B;  3F40 A;  3OWS A;  1NJI 4;  1V74 A;  4WHA A;  5D81 A;  3FF0 A;  1MOL A;  3CCV 3;  4EXR A;  4EBG A;  5ELJ A;  3UB1 A;  2CKF B;  3GRD A;  4LGQ A;  4HZB B;  3GZB A;  3ER7 A;  1YHQ 3;  3NV0 B;  1YJW 3;  1S72 3;  3K9M C;  3HK4 A;  3NQZ A;  3PXM A;  3T0U A;  4O02 B;  3CXC 2;  1D6U A;  5IEO A;  1N9E A;  2W6J H;  4HM6 B;  2QGU A;  4OVM A;  1SJW A;  3JUN A;  3CNM A;  5IW9 A;  2XEP A;  3G71 3;  2BT3 A;  4TX4 A;  3CPW 2;  2WGQ A;  4JRF A;  4L8P A;  1VQ9 3;  3H3H A;  4FCJ A;  3Q2P A;  2CFK A;  3NUV A;  2XGN A;  1KSI A;  3FGY A;  3WA3 A;  4MMX B;  2O3O A;  2XGL A;  4KZ1 A;  4N6N B;  3CC4 3;  4I4K A;  1K8A 4;  1NU3 A;  2A15 A;  1GY6 A;  3M8C A;  3S5C A;  3F14 A;  2KRT A;  1OGZ A;  3SX1 A;  4FR9 A;  1LXE A;  3F8X A;  5LC7 A;  4L7K A;  2IUK A;  2XRX B;  3E99 A;  2B24 B;  3HI7 A;  1Q40 A;  1J2B A;  3AMO B;  3VGN A;  5IER A;  2CG1 A;  1WTH A;  4FCM A;  1WQL B;  4NHF A;  3RDE A;  1RKY A;  1QVG 2;  3LT8 A;  4J9A A;  3JUQ A;  2W56 B;  5IEP A;  3SOA A;  2FNQ A;  1IVU A;  1LOX A;  4IPB A;  1TU5 A;  1GY7 A;  1OH0 A;  4R4K A;  3NBR A;  1OHS A;  2K54 A;  3EB8 A;  4HM3 B;  1LNH A;  2CH9 A;  3Q90 A;  4KFD A;  1AV4 A;  1FUW A;  1TFO A;  2LYX A;  3KFQ C;  1JN5 B;  2BNG A;  3JUP A;  4N6T A;  3NM7 A;  3CCL 3;  1KQS 2;  4GB5 A;  3MG1 A;  4WP5 A;  1OGX A;  4HBR A;  4R9K A;  5BXQ A;  1F8N A;  4HM5 B;  2XR8 B;  2C11 A;  5FW5 A;  3CME 3;  5EEO A;  3OW2 2;  1AVK A;  2GU3 A;  3HIG A;  3EX9 A;  3KZT A;  3BNE A;  3LTA A;  2XSH B;  2KXG A;  2CFG A;  4U13 A;  1NB5 I;  3OV4 A;  1E3R A;  1RRL A;  3VF1 A;  1STD A;  5HGR A;  3EF8 A;  5KP4 A;  3G6E 3;  3CCM 3;  4X2O A;  1IT8 A;  3ECF A;  1A2V A;  3U97 A;  4CDL A;  5IEN A;  2P09 A;  1GD3 A;  2CFW A;  4HYZ A;  4XDV A;  1IQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...