3CNXA

Crystal structure of a putative dehydratase from the ntf2-like family (sav_4671) from streptomyces avermitilis at 2.10 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
138
Chain Sequence
TPDTDVEQVGLANTAFYEAMERGDFETLSSLWLTPADLGVPADAGVVSCVHPGWPVLSGRGEVLRSYALIMANTEYIQFFLTDVHVSVTGDTALVTCTENILSGGGPLVGQLVVATNVFRRTPDGWKLWSHHASPVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF2-like protein of unknown function (NP_825848.1) from Streptomyces avermitilis at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Lyase
total genus 40
structure length 138
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cnxA00
3RGRA 2W2CA 1W6YA 1STDA 3OXAA 3EC9A 3H51A 2HMNB 2HMLB 4N3VA 3MKIA 1Q40B 3EN1B 3F9SA 4I4KA 4WYKB 1IDPA 3HK4A 3DMCA 2CKFB 3T8UA 4LGQA 3B4PA 4Q53A 4HZBB 2STDA 1W02A 4FCMA 1ULJB 4XM4A 1OPYA 1EG9B 1E3RA 3NV0A 2F86B 4PEJA 5TGNA 1HKXA 5CF2A 3KE7A 1O7GB 4L7KA 4XDWA 3UJMA 4GB5A 1U5OA 1OUNA 3B7CA 2GBWB 1OF5B 3EBTA 1SJWA 2F98A 2YFLB 5IEOA 5AIGA 1UUWB 5D82A 2K54A 1OH0A 5HGRA 3H3HA 1AR0A 3CU3A 3SOYA 1ZO2A 3KSPA 5IG3A 1W01A 4LEHA 1NDOB 3CNMA 2HMOB 4X2HA 4STDA 4LMIA 3IPTA 4HVNA 1OCVA 3FGYA 4XBXA 1O7PB 5DREA 4KVHA 3GZYB 5EVHA 3MSOA 3G0KA 3I0YA 3MYTA 3K0ZA 3ER7A 4HM2B 6STDA 3FZWA 3LYGA 3MG1A 5FW5A 1ULIB 3NM2A 3EN8A 3F14A 3FF2A 5AIFA 2CHCA 5BXQA 4HM7B 3SEDA 1GY6A 4RZMA 3EBYA 3CNXA 1Q40A 2GBXB 4WYKA 4HM4B 4HZ9B 2Z76A 5IENA 2XSOB 5AIHA 1JB2A 3JUPA 1S5AA 3GWRA 1GYBA 1Q42A 2R4IA 3D9RA 3F7XA 3S5CA 3FF0A 4HM6B 3DZLA 2QGUA 5KP3A 3GZXB 2HMMB 3G16A 1OF5A 3FKAA 3GZBA 1O7WB 2YFIB 4X2OA 5BVBA 4OVMA 3G8ZA 3VSYA 3FSDA 1E3VA 3JUQA 4HM1B 2XRXB 4H3UA 1O7HB 3FLJA 5CK6A 1CQSA 3DXOA 2IMJA 2F99A 1GY5A 1GY7A 3NHXA 2Z77A 1DMMA 2RCDA 3HZPA 5AEWB 1ISKA 4HM0B 1ZX2A 2XSHB 1JKGB 4R1KA 5CF1A 3M8CA 2RGQA 1K41A 4OUQA 1JN5B 4XB5A 1BUQA 5KP1A 4XBTA 3B8LA 3T8NA 3B4OA 1QJGA 2OWPA 4XDVA 3JUMA 1DMNA 5CXOA 5IF6A 3K7CA 5AI1A 3MG2A 3SOAA 2QIYA 2I9WA 1ASKA 1GS3A 4K1UA 3VGNA 5JPUA 3EJVA 1VZZA 3F8HA 4WWUC 2JQ5A 3WMDA 3RGAA 5AEUB 2XR8B 4R9KA 3MG3A 3Q90A 1DMQA 3F8XA 4HJLB 5IG5A 3JUOA 1OHOA 3EF8A 2B24B 1EA2A 1NU3A 2A15A 2GEXA 3F7SA 4L8PA 5IG0A 1NWWA 3HX8A 3JUNA 5DRVA 3OX9A 4L8OA 4CDLA 2UX0A 4FCJA 5KP4A 4HM3B 2GXFA 3LZAA 3BB9A 4ORLA 2BNGA 2Z7AA 1E97A 5AIIA 5IG4A 4J8TA 5CLKA 5D81A 4HM5B 3OWYA 3GRDA 1QMAA 3OV4A 3CPOA 4MJDA 3NXJA 4U13A 3UNLA 2INXA 2RFRA 3DUKA 1TP6A 1JKGA 2YFJB 3STDA 1WQLB 3NV0B 1A2KA 1JN5A 1OHSA 3ROBA 4WP5A 1OHPA 4IIAA 7STDA 8CHOA 1OGZA 1Z1SA 3EX9A 5IEPA 1UUVB 2BMOB 1JB5A 2PZVA 3DM8A 4R9LA 3EQQB 3OWSA 5STDA 3OWUA 3KKGA 3KZTA 3NUVA 1O7MB 3GZRA 5G2GA 3EHCA 4XBYA 2HMJB 1O7NB 1JB4A 2BMRB 3FH1A 1OGXA 1W00A 2B1XB 3NBRA 5D83A 3ECFA 2BMQB 2GEYA 4K1VA 3A76A 3BLZA 4J9AA 3F40A 2HMKB 3E99A 1C7HA 4HM8B 5JPPA 1TUHA 5IERA 4HKVB 3MHEA
chains in the Genus database with same CATH superfamily
1ZGXA 3RGRA 3DGOA 2ZA4A 2W2CA 1W6YA 1STDA 3OXAA 3EC9A 3H51A 2HMNB 1LQMB 2HMLB 4N3VA 2ZL8A 1Q864 1X1UA 6RNTA 3MKIA 1Q40B 3EN1B 3F9SA 4I4KA 4WYKB 2CG0A 1IDPA 2FNQA 1V74A 3HK4A 1YI23 1SQWA 3BNBA 3DMCA 1G96A 2QEX3 2CKFB 1UI8A 4LGQA 1GOYA 3T8UA 2UUGC 7RNTA 1RN7A 2F56A 3B4PA 1YJ93 4Q53A 4HZBB 3SX1A 4MEIA 2STDA 1W02A 3KFQC 4O3VA 3CCS3 4FCMA 3KSED 1ULJB 4XM4A 1OPYA 1W5ZA 1EG9B 1X1WA 5HOHA 1E3RA 1RCLA 3KCHA 3N54B 3NV0A 2F86B 1B20A 1GD4A 2BU4A 1I70A 1RLSA 4J5GA 4PEJA 5TGNA 8RNTA 1HKXA 1RN4A 2O3OA 3KE7A 5CF2A 1O7GB 2W56A 4FR9A 1HZ1A 1UI7A 4L7KA 1BSBA 3QK9A 2ZDJA 4XDWA 1RGFA 3UJMA 1WTHA 4AKYA 2W9QA 4GB5A 1T2HA 1UDII 1U5OA 1IVUA 1SARA 3LXUX 1OUNA 1RNTA 5LC6A 3B7CA 2WOFA 4N6MA 2GBWB 1A2VA 1OF5B 3EBTA 1SJWA 2F98A 4GL6A 2YFLB 2CWTA 2OCTA 4HOHA 5IEOA 5AIGA 4EW5A 1A67A 4J5KA 2H0HA 4WFOA 1SIHA 1RGCA 3D5IA 3SLUA 1PFPA 1I3FA 1UUWB 2P38A 5D82A 3K9MC 2K54A 1BRIA 2XFTA 4TX4A 1I3IA 1OH0A 5HGRA 2WO0A 1I2GA 3BU4A 3CCE3 3H3HA 1AR0A 3CU3A 2C10A 3SOYA 3X3ZA 3IMAB 1CYVA 3LH4A 1TFKA 2F5MA 5IW9A 1ZO2A 1RGGA 3KSPA 1FGQA 1LOYA 1W01A 3QRDA 4JF8A 2M7OA 4LEHA 5GSPA 4AKZA 1BNJA 1CH0A 1NDOB 4K61A 5AYRB 3V98A 3X41A 3CCJ3 1UCJA 1W2ZA 2PNCA 2IA7A 1SIIA 3CNMA 3WOFB 2W9PA 3RDEA 1T3BA 1IT8A 2HMOB 3MHEA 4NREA 1I8VA 5RNTA 3CCR3 3AGNA 3JVCA 1FA3A 3EB8A 1BGSA 1ROVA 4STDA 1WMOA 4LMIA 4X2HA 1YIJ3 3IPTA 3LT9A 1RNBA 1DVDA 4HVNA 1BNEA 1OCVA 2F5WA 4EXRA 3FGYA 4XBXA 1O7PB 1LNHA 3AMOB 1JNQA 5DREA 3ZFZA 3HIIA 4KVHA 1ZS7A 1RDSA 2Y73A 1VQ93 1RJOA 3GZYB 3WODG 3BNDA 1IVVA 1RGLA 1STFI 5EVHA 3MSOA 2AADA 4KZ1A 3I563 3G4S3 1LXEA 1IYYA 4R4KA 3G0KA 5G1KA 1KD14 2OQEC 3I0YA 2OTL3 3MYTA 3WOEB 1BIRA 3K0ZA 2CIUA 3ER7A 1M1XB 1KC84 4HM2B 1FUWA 4FMBA 2CWUA 6STDA 3FZWA 5A0OB 3LYGA 3AHWA 3MG1A 4EBGA 4EV2A 5FW5A 2H0GA 4GHOA 1Q7HA 2CX1A 1W2B2 3NBBA 1ULIB 1BAOA 3NM2A 3EN8A 3BNCA 3F14A 3FF2A 3S28A 1VQ43 1RRHA 1AY7A 1GSPA 4RNTA 1AVKA 5AIFA 1F8NA 2CHCA 5BXQA 2WOHA 4KT3B 3J7Yd 4R80A 1YJN3 3D79A 4HM7B 4LYLB 1BVIA 5AYSC 3SEDA 1RMSA 1GY6A 3CCV3 2Q07A 3DGMA 4RZMA 3TDGA 2FXTA 1MNLA 3EBYA 2W0QA 1UGHI 3CNXA 1Q40A 2GBXB 4WYKA 4HM4B 3K5TA 4H61A 4HZ9B 2Z76A 1TRPA 2CFLA 2CG1A 4AEQA 1MGRA 3OW22 1GMPA 3DY5A 1LOVA 1MWTA 4G1MB 1C54A 2IUKA 5IENA 1I0XA 2XSOB 2KAAA 1JB2A 4FMAA 5AIHA 3JUPA 4DKIA 2OTJ3 1N5PA 3V99A 1S5AA 1B3SA 3GWRA 1G02A 2E2UA 3LTDA 1RRLA 1W7CA 2CFDA 2KF6A 3I553 1N9EA 1LOXA 2Y74A 2E2VA 3UL6A 1GYBA 2UGIA 4JRFA 3ZG0A 1Q42A 2R4IA 2LQVA 3D9RA 1FGTA 2BHMA 3F7XA 4BTYA 4CPKA 2K3DA 1GOUA 1BSCA 3S5CA 1J2BA 1WMNA 3FF0A 2K0MA 4HM6B 2IUJA 1BSEA 3L0RA 3DZLA 1BUJA 2QGUA 5KP3A 1NNVA 1N8QA 1LQGC 1NB3I 3FG3A 2CFKA 2HMMB 3G16A 3GZXB 1VQP3 1WMPA 1OF5A 2OOVA 3FKAA 2CWVA 3GZBA 1V58A 1I2EA 1TTOA 1O7WB 4LSOA 1FUTA 1VQL3 2YFIB 2ML5A 1A90A 1K9M4 1RN1A 4X2OA 5BVBA 3NQZA 1VQK3 2L4VA 4OVMA 3MPHA 1LNIA 3G8ZA 1BRGA 1KSIA 3VSYA 1UUGB 3FSDA 1E3VA 3JUQA 1BSAA 3K63A 9RNTA 2WGOA 1YIT3 2CC3A 2LYXA 2W6JH 4HM1B 2XRXB 4HAAA 4H3UA 1YNVX 3CCU3 2Z6BA 1O7HB 2FGTA 2P05A 3FLJA 3CME3 1IV7A 3SVAA 1WNHA 2CH9A 5CK6A 1CQSA 2R41A 3DXOA 2IMJA 4BU4A 2F99A 2KF5A 1GY5A 2CW9A 2SARA 4K90B 1I2FA 3V92A 1GY7A 3MWZA 4N6UA 1B2MA 1IQXA 3NHXA 1BRKA 1K8A4 4HBRA 1QVG2 2Z77A 2C11A 1BRNL 1JBRA 5M18A 1DMMA 2JDIH 2RCDA 3HZPA 4NPBA 3N9HA 1CEWI 5AEWB 3FG1A 5EEOA 1ISKA 4HM0B 1KWIA 1ZX2A 1IT7A 1JKGB 2XSHB 3AMOA 4GSPA 4R1KA 5CF1A 1FGMA 1LVNA 3M8CA 1RGKA 2RGQA 1K41A 1N8R4 1DVCA 4OUQA 1JN5B 4XB5A 4N6TA 2L1SA 3CCQ3 3G713 1BUQA 1UW1A 1UGIA 3X3XA 6GSPA 1NB5I 5KP1A 1US1A 1YGEA 3KIIA 4N6V0 4XBTA 3LTAA 3UL5A 3B8LA 3X3YA 2XF3A 3T8NA 3CC73 3B4OA 1D6UA 1JJ22 1VQQA 1QJGA 3SXXA 1MWSA 2OWPA 3NX0A 4XDVA 4CJNA 3JUMA 1EQKA 1DMNA 3PXMA 3PS8A 1FGOA 2QA43 5CXOA 3DGLA 1DYUA 1QVF2 1M1K4 5IF6A 3K7CA 5AI1A 1W6CA 2D1WA 3MG2A 1W4NA 5ELUA 4O8SA 3CCM3 2KCDA 2CX0A 3SOAA 2QIYA 3CPW2 1I0VA 2I9WA 4ILFA 1RTUA 3AHSA 4HYZA 4BIRA 1MOLA 3S67A 1Q814 1DETA 1ASKA 2D42A 3CD63 1MGWA 4ZM8A 1GOVA 1AQZA 4EC6A 3N8BA 1GS3A 4K1UA 1R4CA 3VGNA 4FCZA 2HOHA 3EJVA 5BU4A 2GSPA 3EE1A 5JPUA 1PU4A 4IPBA 4RNZA 3X42A 1VZZA 1VQ63 1BNSA 2W04A 1V57A 3F8HA 4N6LA 4WWUC 2JQ5A 3PZWA 3WMDA 2RBIA 3D4AA 1TU5A 1PYLA 3RGAA 1LOWA 1RGAA 5AEUB 1TRQA 2XR8B 4R9KA 3MG3A 3Q90A 3WDGB 1RSNA 5ELJA 1EKMA 1DMQA 3F8XA 3DGNA 2ZHXB 2XH9A 1BOXA 4HJLB 5IG5A 3JUOA 1OHOA 3CC43 1FUSA 1GMRA 3S27A 3EF8A 1FGRA 1VQM3 1VQ83 1YVSA 2B24B 3WHOA 1EA2A 2RNTA 1HYFA 5LC7A 4O02B 1NU3A 2A15A 3PCSA 3Q1CA 1NO3A 1UCKA 2BO9B 1BNFA 2GEXA 3F7SA 4KFEA 4BL3A 4L8PA 5IG0A 4EV5A 1JZDA 1NWWA 3HX8A 1HU9A 1X1YA 3JUNA 5DRVA 4OK0A 1B27A 3BIRA 5G1LA 3NBJA 3OX9A 3SYUA 4I5QA 1S723 1IK3A 4L8OA 4CDLA 2UX0A 4FCJA 5KP4A 4HM3B 2GXFA 4BL2A 1ROAA 1N9JA 1VQ53 3LZAA 1QAKA 4LZIA 3BB9A 1VQN3 4ORLA 3GAXA 1EUIC 2BNGA 1JV2B 1E97A 2Z7AA 5AIIA 4BTXA 4J8TA 1B21A 5CLKA 1N5HA 3URPA 5IG4A 1JBTA 3WR2A 5D81A 3CCL3 3CC23 3LT8A 4HM5B 3OWYA 3NQYA 3U1WA 3GRDA 1QMAA 3OV4A 1DE3A 1BRSA 2CFWA 3FCSB 1BSDA 2IY2A 1B2SA 2O9UX 1X1XA 4NHFA 3CPOA 1T5YA 4MJDA 3KN4A 4MMXB 3G6E3 1Y4KA 2AAEA 1JZOA 2GU1A 3PCRA 5IG3A 3NXJA 2KF3A 4U13A 3UNLA 1QAFA 1RKYA 2INXA 2RFRA 2OOVC 2KRTA 3DUKA 3HOHA 4KFDA 4RBNA 1BNRA 2XEPA 2YX9A 1TP6A 1JKGA 1BANA 2V1LA 2YFJB 1KQS2 3T0UA 1M904 3STDA 1CYUA 1TIJA 5M19A 5EQLA 1WQLB 2CFGA 3NV0B 1A2KA 1JN5A 1RGHA 3FG4A 3HI7A 5FGOA 1OHSA 1RGEA 3A5EA 2IYJA 4O2HA 3ROBA 1JBSA 1M9GA 3CMA3 4MMZB 3GSPA 5M1AA 3HIGA 3RNTA 2W56B 3ZG5A 4WP5A 4KFFA 1YHQ3 1IV9A 1BNIA 3BNEA 1OHPA 4IIAA 7STDA 1FYSA 1IVXA 1YVBI 1GD3A 8CHOA 1OGZA 1Z1SA 3CXC2 3EX9A 2ML6A 1UCIA 4MMYB 5IEPA 1UUVB 1IU7A 2BMOB 2P0XA 2BT3A 2XGNA 1JB5A 2E2TA 2W03A 3IJEB 1NJI4 1L5GB 1IQYA 3LTCA 1Q7Y4 1TFOA 5BIRA 2SBLA 3NM7A 2PZVA 4EYCA 3UB1A 2KF4A 1VQ73 5I97A 1Q9EA 1OACA 4IT7A 2KXGA 2H0IA 3Q3FA 1D6ZA 1R4YA 1MWRA 1YGWA 4FMCA 2OQEA 3AGOA 3WA2X 3DM8A 3S29A 1D6YA 7GSPA 1AV4A 1VQO3 4R9LA 1LRAA 4N6NB 3EQQB 1YJW3 1W6GA 1FZUA 3OWSA 4FMDA 1PY3A 5STDA 1TJDA 1K28A 3OWUA 2P09A 4RNYA 3KKGA 1MWUA 1IQ8A 3KZTA 1GMQA 3NUVA 1U8CB 1O7MB 1Q824 1FW7A 1JRQA 2GU3A 3DGYA 1EEJA 1T2IA 4WHAA 3GZRA 3ALAA 1RCKA 2XFSA 5G2GA 3EHCA 1SPUA 2MC8A 4XBYA 3O8YA 1BU4A 2HMJB 2P0MA 1O7NB 1JB4A 2BMRB 4QWTA 1G0TA 3FH1A 1OGXA 2C4BA 3PGBA 3Q2PA 3LTBA 1W00A 1B2ZA 3PYJA 1BNGA 4CCVA 2B1XB 3NBRA 3D3LA 5D83A 2J8XB 1B2UA 3D5GA 1B2XA 2F4YA 1A2PA 2WGQA 1BRHA 4N6OB 3ECFA 1UCLA 3LOYA 3X40A 3VF1A 2BMQB 5JBSA 2GEYA 4K1VA 1BRJA 4BTWA 3A76A 3BLZA 2XGLA 4J9AA 1QALA 3F40A 2CK3H 3WA3A 3U97A 1K734 2HMKB 1AVLA 2MF7A 3E99A 1RHLA 1IVWA 1C7HA 4HM8B 3LMLA 5JPPA 1TUHA 5IERA 3DH2A 2RSXA 4HKVB 2BIRA
chains in the Genus database with same CATH topology
3RGRA 3DGOA 2W2CA 1W6YA 1STDA 3OXAA 3EC9A 3H51A 2HMNB 2HMLB 4N3VA 1Q864 2ZL8A 3MKIA 1Q40B 3EN1B 3F9SA 4I4KA 4WYKB 2CG0A 1IDPA 2FNQA 1V74A 3HK4A 1YI23 1SQWA 3BNBA 3DMCA 1G96A 2QEX3 2CKFB 1UI8A 4LGQA 3T8UA 1RN7A 3B4PA 1YJ93 4Q53A 4HZBB 3SX1A 4MEIA 2STDA 1W02A 3KFQC 4O3VA 3CCS3 4FCMA 3KSED 1ULJB 4XM4A 1OPYA 1W5ZA 1EG9B 1E3RA 3N54B 3NV0A 2F86B 1GD4A 4PEJA 5TGNA 1HKXA 5CF2A 2O3OA 3KE7A 1O7GB 2W56A 4FR9A 1UI7A 4L7KA 3QK9A 2ZDJA 4XDWA 3UJMA 1WTHA 4AKYA 2W9QA 4GB5A 1U5OA 1IVUA 3LXUX 1OUNA 5LC6A 3B7CA 2WOFA 4N6MA 2GBWB 1A2VA 1OF5B 3EBTA 1SJWA 2F98A 4GL6A 2YFLB 2CWTA 2OCTA 5IEOA 5AIGA 1A67A 4WFOA 1SIHA 3SLUA 1PFPA 1UUWB 2P38A 5D82A 3K9MC 2K54A 2XFTA 4TX4A 1OH0A 5HGRA 2WO0A 3CCE3 3H3HA 1AR0A 3CU3A 2C10A 3SOYA 3X3ZA 3IMAB 1CYVA 3LH4A 1TFKA 5IW9A 1ZO2A 3KSPA 3QRDA 1FGQA 4JF8A 1W01A 4LEHA 4AKZA 2M7OA 5IG3A 4K61A 1NDOB 5AYRB 3V98A 3X41A 3CCJ3 1W2ZA 2PNCA 2IA7A 1SIIA 3CNMA 3WOFB 2W9PA 3RDEA 1IT8A 2HMOB 4NREA 3CCR3 3JVCA 1FA3A 3EB8A 1ROVA 4STDA 1WMOA 4LMIA 4X2HA 1YIJ3 3IPTA 3LT9A 1DVDA 4HVNA 4EXRA 1OCVA 3FGYA 4XBXA 1O7PB 1LNHA 3AMOB 1JNQA 5DREA 3HIIA 4KVHA 2Y73A 1VQ93 1RJOA 3GZYB 3WODG 3BNDA 1IVVA 1STFI 5EVHA 3MSOA 4KZ1A 3I563 3G4S3 1LXEA 4R4KA 3G0KA 1KD14 2OQEC 3I0YA 2OTL3 3MYTA 3WOEB 3K0ZA 2CIUA 3ER7A 1M1XB 1KC84 4HM2B 1FUWA 4FMBA 2CWUA 6STDA 3FZWA 5A0OB 3LYGA 3MG1A 4EBGA 4EV2A 5FW5A 1W2B2 3NBBA 1ULIB 3NM2A 3EN8A 3BNCA 3F14A 3FF2A 3S28A 1VQ43 1RRHA 5AIFA 1AVKA 1F8NA 2CHCA 5BXQA 2WOHA 3J7Yd 4R80A 1YJN3 4HM7B 5AYSC 3SEDA 1GY6A 3CCV3 2Q07A 3DGMA 4RZMA 3TDGA 2FXTA 1MNLA 3EBYA 2W0QA 3CNXA 1Q40A 2GBXB 4WYKA 4HM4B 3K5TA 4H61A 4HZ9B 2Z76A 2CFLA 2CG1A 4AEQA 3OW22 3DY5A 4G1MB 2IUKA 5IENA 2XSOB 4FMAA 1JB2A 5AIHA 2OTJ3 3JUPA 1N5PA 3V99A 1S5AA 3LTDA 3GWRA 2E2UA 1RRLA 1W7CA 2CFDA 3I553 1N9EA 1LOXA 2Y74A 2E2VA 3UL6A 1GYBA 4JRFA 1Q42A 2R4IA 2LQVA 3D9RA 1FGTA 2BHMA 3F7XA 4BTYA 3S5CA 1J2BA 1WMNA 3FF0A 2K0MA 4HM6B 2IUJA 3L0RA 3DZLA 2QGUA 5KP3A 1N8QA 1NB3I 3FG3A 2CFKA 2HMMB 3G16A 3GZXB 1VQP3 1WMPA 1OF5A 2OOVA 3FKAA 2CWVA 3GZBA 1O7WB 4LSOA 1VQL3 2YFIB 2ML5A 1A90A 1K9M4 4X2OA 5BVBA 3NQZA 1VQK3 2L4VA 4OVMA 3MPHA 3G8ZA 1KSIA 3VSYA 3K63A 3FSDA 1E3VA 3JUQA 1YIT3 2WGOA 2CC3A 2LYXA 2W6JH 4HM1B 2XRXB 4H3UA 3CCU3 2Z6BA 1O7HB 2FGTA 2P05A 3FLJA 3CME3 1IV7A 3SVAA 1WNHA 2CH9A 5CK6A 1CQSA 3DXOA 2IMJA 2F99A 1GY5A 2CW9A 4K90B 3V92A 1GY7A 3MWZA 4N6UA 1IQXA 3NHXA 1K8A4 4HBRA 1QVG2 2Z77A 2C11A 1DMMA 2JDIH 2RCDA 3HZPA 3N9HA 1CEWI 5AEWB 3FG1A 5EEOA 1ISKA 4HM0B 1KWIA 1ZX2A 1IT7A 1JKGB 2XSHB 3AMOA 4R1KA 5CF1A 1FGMA 1LVNA 3M8CA 2RGQA 1K41A 1N8R4 1DVCA 4OUQA 1JN5B 4XB5A 4N6TA 3CCQ3 3G713 1BUQA 1UW1A 3X3XA 1NB5I 5KP1A 1US1A 1YGEA 3KIIA 4N6V0 4XBTA 3LTAA 3UL5A 3B8LA 3X3YA 2XF3A 3T8NA 3CC73 3B4OA 1D6UA 1JJ22 1QJGA 3SXXA 2OWPA 3NX0A 4XDVA 3JUMA 1EQKA 1DMNA 3PXMA 3PS8A 1FGOA 2QA43 5CXOA 3DGLA 1DYUA 1QVF2 1M1K4 5IF6A 3K7CA 5AI1A 1W6CA 2D1WA 3MG2A 1W4NA 5ELUA 4O8SA 3CCM3 2KCDA 3SOAA 2QIYA 3CPW2 2I9WA 4HYZA 1MOLA 3S67A 1Q814 1ASKA 2D42A 3CD63 4ZM8A 4EC6A 3N8BA 1GS3A 4K1UA 1R4CA 3VGNA 4FCZA 3EJVA 5JPUA 1PU4A 3EE1A 4IPBA 4RNZA 3X42A 1VZZA 1VQ63 2W04A 3F8HA 4N6LA 4WWUC 2JQ5A 3PZWA 3WMDA 1TU5A 3RGAA 5AEUB 2XR8B 4R9KA 3MG3A 3Q90A 3WDGB 5ELJA 1EKMA 1DMQA 3F8XA 3DGNA 2XH9A 4HJLB 5IG5A 3JUOA 1OHOA 3CC43 3S27A 3EF8A 1FGRA 1VQM3 1VQ83 2B24B 1EA2A 5LC7A 4O02B 1NU3A 2A15A 3PCSA 3Q1CA 1NO3A 2BO9B 2GEXA 3F7SA 4KFEA 4L8PA 5IG0A 4EV5A 1NWWA 3HX8A 1HU9A 3JUNA 5DRVA 4OK0A 3NBJA 3OX9A 1S723 1IK3A 4L8OA 4CDLA 2UX0A 4FCJA 5KP4A 4HM3B 2GXFA 1ROAA 1N9JA 1VQ53 3LZAA 1QAKA 4LZIA 3BB9A 1VQN3 4ORLA 3GAXA 2BNGA 1JV2B 1E97A 2Z7AA 5AIIA 4BTXA 4J8TA 5CLKA 5IG4A 1N5HA 5D81A 3CCL3 3CC23 3LT8A 4HM5B 3OWYA 3NQYA 3U1WA 3GRDA 1QMAA 3OV4A 2CFWA 3FCSB 2O9UX 4NHFA 3CPOA 1T5YA 4MJDA 3KN4A 4MMXB 3G6E3 1Y4KA 3PCRA 2GU1A 3NXJA 4U13A 3UNLA 1QAFA 1RKYA 2INXA 2RFRA 2OOVC 2KRTA 3DUKA 4RBNA 4KFDA 2XEPA 2YX9A 1TP6A 1JKGA 2V1LA 2YFJB 1KQS2 3T0UA 1M904 3STDA 1CYUA 1TIJA 5EQLA 1WQLB 2CFGA 3NV0B 1A2KA 1JN5A 3FG4A 3HI7A 5FGOA 1OHSA 4O2HA 3ROBA 3CMA3 1M9GA 4MMZB 3HIGA 2W56B 4WP5A 4KFFA 1YHQ3 1IV9A 3BNEA 1OHPA 4IIAA 7STDA 1YVBI 1IVXA 8CHOA 1GD3A 3CXC2 1OGZA 1Z1SA 3EX9A 2ML6A 4MMYB 5IEPA 1UUVB 1IU7A 2BMOB 2P0XA 2BT3A 2XGNA 1JB5A 2E2TA 2W03A 3IJEB 1NJI4 1L5GB 1IQYA 3LTCA 1Q7Y4 1TFOA 2SBLA 3NM7A 2PZVA 4EYCA 3UB1A 1VQ73 5I97A 1OACA 4IT7A 2KXGA 1D6ZA 4FMCA 2OQEA 3WA2X 3DM8A 3S29A 1D6YA 1AV4A 1VQO3 4R9LA 4N6NB 3EQQB 1YJW3 1W6GA 3OWSA 4FMDA 5STDA 1K28A 3OWUA 2P09A 4RNYA 3KKGA 1IQ8A 3KZTA 3NUVA 1U8CB 1O7MB 1Q824 1JRQA 2GU3A 4WHAA 3GZRA 3ALAA 2XFSA 5G2GA 3EHCA 1SPUA 2MC8A 4XBYA 3O8YA 2HMJB 2P0MA 1O7NB 1JB4A 2BMRB 4QWTA 3FH1A 1OGXA 3PGBA 3Q2PA 3LTBA 1W00A 3PYJA 4CCVA 2B1XB 3NBRA 3D3LA 5D83A 2WGQA 4N6OB 3ECFA 3LOYA 3X40A 3VF1A 2BMQB 5JBSA 2GEYA 4K1VA 4BTWA 3A76A 3BLZA 2XGLA 4J9AA 1QALA 3F40A 2CK3H 3WA3A 3U97A 1K734 2HMKB 1AVLA 2MF7A 3E99A 1IVWA 1C7HA 4HM8B 3LMLA 5JPPA 1TUHA 5IERA 2RSXA 4HKVB 3MHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGR A;  2W2C A;  1W6Y A;  1STD A;  3OXA A;  3EC9 A;  3H51 A;  2HMN B;  2HML B;  4N3V A;  3MKI A;  1Q40 B;  3EN1 B;  3F9S A;  4I4K A;  4WYK B;  1IDP A;  3HK4 A;  3DMC A;  2CKF B;  3T8U A;  4LGQ A;  3B4P A;  4Q53 A;  4HZB B;  2STD A;  1W02 A;  4FCM A;  1ULJ B;  4XM4 A;  1OPY A;  1EG9 B;  1E3R A;  3NV0 A;  2F86 B;  4PEJ A;  5TGN A;  1HKX A;  5CF2 A;  3KE7 A;  1O7G B;  4L7K A;  4XDW A;  3UJM A;  4GB5 A;  1U5O A;  1OUN A;  3B7C A;  2GBW B;  1OF5 B;  3EBT A;  1SJW A;  2F98 A;  2YFL B;  5IEO A;  5AIG A;  1UUW B;  5D82 A;  2K54 A;  1OH0 A;  5HGR A;  3H3H A;  1AR0 A;  3CU3 A;  3SOY A;  1ZO2 A;  3KSP A;  5IG3 A;  1W01 A;  4LEH A;  1NDO B;  3CNM A;  2HMO B;  4X2H A;  4STD A;  4LMI A;  3IPT A;  4HVN A;  1OCV A;  3FGY A;  4XBX A;  1O7P B;  5DRE A;  4KVH A;  3GZY B;  5EVH A;  3MSO A;  3G0K A;  3I0Y A;  3MYT A;  3K0Z A;  3ER7 A;  4HM2 B;  6STD A;  3FZW A;  3LYG A;  3MG1 A;  5FW5 A;  1ULI B;  3NM2 A;  3EN8 A;  3F14 A;  3FF2 A;  5AIF A;  2CHC A;  5BXQ A;  4HM7 B;  3SED A;  1GY6 A;  4RZM A;  3EBY A;  3CNX A;  1Q40 A;  2GBX B;  4WYK A;  4HM4 B;  4HZ9 B;  2Z76 A;  5IEN A;  2XSO B;  5AIH A;  1JB2 A;  3JUP A;  1S5A A;  3GWR A;  1GYB A;  1Q42 A;  2R4I A;  3D9R A;  3F7X A;  3S5C A;  3FF0 A;  4HM6 B;  3DZL A;  2QGU A;  5KP3 A;  3GZX B;  2HMM B;  3G16 A;  1OF5 A;  3FKA A;  3GZB A;  1O7W B;  2YFI B;  4X2O A;  5BVB A;  4OVM A;  3G8Z A;  3VSY A;  3FSD A;  1E3V A;  3JUQ A;  4HM1 B;  2XRX B;  4H3U A;  1O7H B;  3FLJ A;  5CK6 A;  1CQS A;  3DXO A;  2IMJ A;  2F99 A;  1GY5 A;  1GY7 A;  3NHX A;  2Z77 A;  1DMM A;  2RCD A;  3HZP A;  5AEW B;  1ISK A;  4HM0 B;  1ZX2 A;  2XSH B;  1JKG B;  4R1K A;  5CF1 A;  3M8C A;  2RGQ A;  1K41 A;  4OUQ A;  1JN5 B;  4XB5 A;  1BUQ A;  5KP1 A;  4XBT A;  3B8L A;  3T8N A;  3B4O A;  1QJG A;  2OWP A;  4XDV A;  3JUM A;  1DMN A;  5CXO A;  5IF6 A;  3K7C A;  5AI1 A;  3MG2 A;  3SOA A;  2QIY A;  2I9W A;  1ASK A;  1GS3 A;  4K1U A;  3VGN A;  5JPU A;  3EJV A;  1VZZ A;  3F8H A;  4WWU C;  2JQ5 A;  3WMD A;  3RGA A;  5AEU B;  2XR8 B;  4R9K A;  3MG3 A;  3Q90 A;  1DMQ A;  3F8X A;  4HJL B;  5IG5 A;  3JUO A;  1OHO A;  3EF8 A;  2B24 B;  1EA2 A;  1NU3 A;  2A15 A;  2GEX A;  3F7S A;  4L8P A;  5IG0 A;  1NWW A;  3HX8 A;  3JUN A;  5DRV A;  3OX9 A;  4L8O A;  4CDL A;  2UX0 A;  4FCJ A;  5KP4 A;  4HM3 B;  2GXF A;  3LZA A;  3BB9 A;  4ORL A;  2BNG A;  2Z7A A;  1E97 A;  5AII A;  5IG4 A;  4J8T A;  5CLK A;  5D81 A;  4HM5 B;  3OWY A;  3GRD A;  1QMA A;  3OV4 A;  3CPO A;  4MJD A;  3NXJ A;  4U13 A;  3UNL A;  2INX A;  2RFR A;  3DUK A;  1TP6 A;  1JKG A;  2YFJ B;  3STD A;  1WQL B;  3NV0 B;  1A2K A;  1JN5 A;  1OHS A;  3ROB A;  4WP5 A;  1OHP A;  4IIA A;  7STD A;  8CHO A;  1OGZ A;  1Z1S A;  3EX9 A;  5IEP A;  1UUV B;  2BMO B;  1JB5 A;  2PZV A;  3DM8 A;  4R9L A;  3EQQ B;  3OWS A;  5STD A;  3OWU A;  3KKG A;  3KZT A;  3NUV A;  1O7M B;  3GZR A;  5G2G A;  3EHC A;  4XBY A;  2HMJ B;  1O7N B;  1JB4 A;  2BMR B;  3FH1 A;  1OGX A;  1W00 A;  2B1X B;  3NBR A;  5D83 A;  3ECF A;  2BMQ B;  2GEY A;  4K1V A;  3A76 A;  3BLZ A;  4J9A A;  3F40 A;  2HMK B;  3E99 A;  1C7H A;  4HM8 B;  5JPP A;  1TUH A;  5IER A;  4HKV B;  3MHE A; 
#chains in the Genus database with same CATH topology
 1ZGX A;  3RGR A;  3DGO A;  2ZA4 A;  2W2C A;  1W6Y A;  1STD A;  3OXA A;  3EC9 A;  3H51 A;  2HMN B;  1LQM B;  2HML B;  4N3V A;  2ZL8 A;  1Q86 4;  1X1U A;  6RNT A;  3MKI A;  1Q40 B;  3EN1 B;  3F9S A;  4I4K A;  4WYK B;  2CG0 A;  1IDP A;  2FNQ A;  1V74 A;  3HK4 A;  1YI2 3;  1SQW A;  3BNB A;  3DMC A;  1G96 A;  2QEX 3;  2CKF B;  1UI8 A;  4LGQ A;  1GOY A;  3T8U A;  2UUG C;  7RNT A;  1RN7 A;  2F56 A;  3B4P A;  1YJ9 3;  4Q53 A;  4HZB B;  3SX1 A;  4MEI A;  2STD A;  1W02 A;  3KFQ C;  4O3V A;  3CCS 3;  4FCM A;  3KSE D;  1ULJ B;  4XM4 A;  1OPY A;  1W5Z A;  1EG9 B;  1X1W A;  5HOH A;  1E3R A;  1RCL A;  3KCH A;  3N54 B;  3NV0 A;  2F86 B;  1B20 A;  1GD4 A;  2BU4 A;  1I70 A;  1RLS A;  4J5G A;  4PEJ A;  5TGN A;  8RNT A;  1HKX A;  1RN4 A;  2O3O A;  3KE7 A;  5CF2 A;  1O7G B;  2W56 A;  4FR9 A;  1HZ1 A;  1UI7 A;  4L7K A;  1BSB A;  3QK9 A;  2ZDJ A;  4XDW A;  1RGF A;  3UJM A;  1WTH A;  4AKY A;  2W9Q A;  4GB5 A;  1T2H A;  1UDI I;  1U5O A;  1IVU A;  1SAR A;  3LXU X;  1OUN A;  1RNT A;  5LC6 A;  3B7C A;  2WOF A;  4N6M A;  2GBW B;  1A2V A;  1OF5 B;  3EBT A;  1SJW A;  2F98 A;  4GL6 A;  2YFL B;  2CWT A;  2OCT A;  4HOH A;  5IEO A;  5AIG A;  4EW5 A;  1A67 A;  4J5K A;  2H0H A;  4WFO A;  1SIH A;  1RGC A;  3D5I A;  3SLU A;  1PFP A;  1I3F A;  1UUW B;  2P38 A;  5D82 A;  3K9M C;  2K54 A;  1BRI A;  2XFT A;  4TX4 A;  1I3I A;  1OH0 A;  5HGR A;  2WO0 A;  1I2G A;  3BU4 A;  3CCE 3;  3H3H A;  1AR0 A;  3CU3 A;  2C10 A;  3SOY A;  3X3Z A;  3IMA B;  1CYV A;  3LH4 A;  1TFK A;  2F5M A;  5IW9 A;  1ZO2 A;  1RGG A;  3KSP A;  1FGQ A;  1LOY A;  1W01 A;  3QRD A;  4JF8 A;  2M7O A;  4LEH A;  5GSP A;  4AKZ A;  1BNJ A;  1CH0 A;  1NDO B;  4K61 A;  5AYR B;  3V98 A;  3X41 A;  3CCJ 3;  1UCJ A;  1W2Z A;  2PNC A;  2IA7 A;  1SII A;  3CNM A;  3WOF B;  2W9P A;  3RDE A;  1T3B A;  1IT8 A;  2HMO B;  3MHE A;  4NRE A;  1I8V A;  5RNT A;  3CCR 3;  3AGN A;  3JVC A;  1FA3 A;  3EB8 A;  1BGS A;  1ROV A;  4STD A;  1WMO A;  4LMI A;  4X2H A;  1YIJ 3;  3IPT A;  3LT9 A;  1RNB A;  1DVD A;  4HVN A;  1BNE A;  1OCV A;  2F5W A;  4EXR A;  3FGY A;  4XBX A;  1O7P B;  1LNH A;  3AMO B;  1JNQ A;  5DRE A;  3ZFZ A;  3HII A;  4KVH A;  1ZS7 A;  1RDS A;  2Y73 A;  1VQ9 3;  1RJO A;  3GZY B;  3WOD G;  3BND A;  1IVV A;  1RGL A;  1STF I;  5EVH A;  3MSO A;  2AAD A;  4KZ1 A;  3I56 3;  3G4S 3;  1LXE A;  1IYY A;  4R4K A;  3G0K A;  5G1K A;  1KD1 4;  2OQE C;  3I0Y A;  2OTL 3;  3MYT A;  3WOE B;  1BIR A;  3K0Z A;  2CIU A;  3ER7 A;  1M1X B;  1KC8 4;  4HM2 B;  1FUW A;  4FMB A;  2CWU A;  6STD A;  3FZW A;  5A0O B;  3LYG A;  3AHW A;  3MG1 A;  4EBG A;  4EV2 A;  5FW5 A;  2H0G A;  4GHO A;  1Q7H A;  2CX1 A;  1W2B 2;  3NBB A;  1ULI B;  1BAO A;  3NM2 A;  3EN8 A;  3BNC A;  3F14 A;  3FF2 A;  3S28 A;  1VQ4 3;  1RRH A;  1AY7 A;  1GSP A;  4RNT A;  1AVK A;  5AIF A;  1F8N A;  2CHC A;  5BXQ A;  2WOH A;  4KT3 B;  3J7Y d;  4R80 A;  1YJN 3;  3D79 A;  4HM7 B;  4LYL B;  1BVI A;  5AYS C;  3SED A;  1RMS A;  1GY6 A;  3CCV 3;  2Q07 A;  3DGM A;  4RZM A;  3TDG A;  2FXT A;  1MNL A;  3EBY A;  2W0Q A;  1UGH I;  3CNX A;  1Q40 A;  2GBX B;  4WYK A;  4HM4 B;  3K5T A;  4H61 A;  4HZ9 B;  2Z76 A;  1TRP A;  2CFL A;  2CG1 A;  4AEQ A;  1MGR A;  3OW2 2;  1GMP A;  3DY5 A;  1LOV A;  1MWT A;  4G1M B;  1C54 A;  2IUK A;  5IEN A;  1I0X A;  2XSO B;  2KAA A;  1JB2 A;  4FMA A;  5AIH A;  3JUP A;  4DKI A;  2OTJ 3;  1N5P A;  3V99 A;  1S5A A;  1B3S A;  3GWR A;  1G02 A;  2E2U A;  3LTD A;  1RRL A;  1W7C A;  2CFD A;  2KF6 A;  3I55 3;  1N9E A;  1LOX A;  2Y74 A;  2E2V A;  3UL6 A;  1GYB A;  2UGI A;  4JRF A;  3ZG0 A;  1Q42 A;  2R4I A;  2LQV A;  3D9R A;  1FGT A;  2BHM A;  3F7X A;  4BTY A;  4CPK A;  2K3D A;  1GOU A;  1BSC A;  3S5C A;  1J2B A;  1WMN A;  3FF0 A;  2K0M A;  4HM6 B;  2IUJ A;  1BSE A;  3L0R A;  3DZL A;  1BUJ A;  2QGU A;  5KP3 A;  1NNV A;  1N8Q A;  1LQG C;  1NB3 I;  3FG3 A;  2CFK A;  2HMM B;  3G16 A;  3GZX B;  1VQP 3;  1WMP A;  1OF5 A;  2OOV A;  3FKA A;  2CWV A;  3GZB A;  1V58 A;  1I2E A;  1TTO A;  1O7W B;  4LSO A;  1FUT A;  1VQL 3;  2YFI B;  2ML5 A;  1A90 A;  1K9M 4;  1RN1 A;  4X2O A;  5BVB A;  3NQZ A;  1VQK 3;  2L4V A;  4OVM A;  3MPH A;  1LNI A;  3G8Z A;  1BRG A;  1KSI A;  3VSY A;  1UUG B;  3FSD A;  1E3V A;  3JUQ A;  1BSA A;  3K63 A;  9RNT A;  2WGO A;  1YIT 3;  2CC3 A;  2LYX A;  2W6J H;  4HM1 B;  2XRX B;  4HAA A;  4H3U A;  1YNV X;  3CCU 3;  2Z6B A;  1O7H B;  2FGT A;  2P05 A;  3FLJ A;  3CME 3;  1IV7 A;  3SVA A;  1WNH A;  2CH9 A;  5CK6 A;  1CQS A;  2R41 A;  3DXO A;  2IMJ A;  4BU4 A;  2F99 A;  2KF5 A;  1GY5 A;  2CW9 A;  2SAR A;  4K90 B;  1I2F A;  3V92 A;  1GY7 A;  3MWZ A;  4N6U A;  1B2M A;  1IQX A;  3NHX A;  1BRK A;  1K8A 4;  4HBR A;  1QVG 2;  2Z77 A;  2C11 A;  1BRN L;  1JBR A;  5M18 A;  1DMM A;  2JDI H;  2RCD A;  3HZP A;  4NPB A;  3N9H A;  1CEW I;  5AEW B;  3FG1 A;  5EEO A;  1ISK A;  4HM0 B;  1KWI A;  1ZX2 A;  1IT7 A;  1JKG B;  2XSH B;  3AMO A;  4GSP A;  4R1K A;  5CF1 A;  1FGM A;  1LVN A;  3M8C A;  1RGK A;  2RGQ A;  1K41 A;  1N8R 4;  1DVC A;  4OUQ A;  1JN5 B;  4XB5 A;  4N6T A;  2L1S A;  3CCQ 3;  3G71 3;  1BUQ A;  1UW1 A;  1UGI A;  3X3X A;  6GSP A;  1NB5 I;  5KP1 A;  1US1 A;  1YGE A;  3KII A;  4N6V 0;  4XBT A;  3LTA A;  3UL5 A;  3B8L A;  3X3Y A;  2XF3 A;  3T8N A;  3CC7 3;  3B4O A;  1D6U A;  1JJ2 2;  1VQQ A;  1QJG A;  3SXX A;  1MWS A;  2OWP A;  3NX0 A;  4XDV A;  4CJN A;  3JUM A;  1EQK A;  1DMN A;  3PXM A;  3PS8 A;  1FGO A;  2QA4 3;  5CXO A;  3DGL A;  1DYU A;  1QVF 2;  1M1K 4;  5IF6 A;  3K7C A;  5AI1 A;  1W6C A;  2D1W A;  3MG2 A;  1W4N A;  5ELU A;  4O8S A;  3CCM 3;  2KCD A;  2CX0 A;  3SOA A;  2QIY A;  3CPW 2;  1I0V A;  2I9W A;  4ILF A;  1RTU A;  3AHS A;  4HYZ A;  4BIR A;  1MOL A;  3S67 A;  1Q81 4;  1DET A;  1ASK A;  2D42 A;  3CD6 3;  1MGW A;  4ZM8 A;  1GOV A;  1AQZ A;  4EC6 A;  3N8B A;  1GS3 A;  4K1U A;  1R4C A;  3VGN A;  4FCZ A;  2HOH A;  3EJV A;  5BU4 A;  2GSP A;  3EE1 A;  5JPU A;  1PU4 A;  4IPB A;  4RNZ A;  3X42 A;  1VZZ A;  1VQ6 3;  1BNS A;  2W04 A;  1V57 A;  3F8H A;  4N6L A;  4WWU C;  2JQ5 A;  3PZW A;  3WMD A;  2RBI A;  3D4A A;  1TU5 A;  1PYL A;  3RGA A;  1LOW A;  1RGA A;  5AEU B;  1TRQ A;  2XR8 B;  4R9K A;  3MG3 A;  3Q90 A;  3WDG B;  1RSN A;  5ELJ A;  1EKM A;  1DMQ A;  3F8X A;  3DGN A;  2ZHX B;  2XH9 A;  1BOX A;  4HJL B;  5IG5 A;  3JUO A;  1OHO A;  3CC4 3;  1FUS A;  1GMR A;  3S27 A;  3EF8 A;  1FGR A;  1VQM 3;  1VQ8 3;  1YVS A;  2B24 B;  3WHO A;  1EA2 A;  2RNT A;  1HYF A;  5LC7 A;  4O02 B;  1NU3 A;  2A15 A;  3PCS A;  3Q1C A;  1NO3 A;  1UCK A;  2BO9 B;  1BNF A;  2GEX A;  3F7S A;  4KFE A;  4BL3 A;  4L8P A;  5IG0 A;  4EV5 A;  1JZD A;  1NWW A;  3HX8 A;  1HU9 A;  1X1Y A;  3JUN A;  5DRV A;  4OK0 A;  1B27 A;  3BIR A;  5G1L A;  3NBJ A;  3OX9 A;  3SYU A;  4I5Q A;  1S72 3;  1IK3 A;  4L8O A;  4CDL A;  2UX0 A;  4FCJ A;  5KP4 A;  4HM3 B;  2GXF A;  4BL2 A;  1ROA A;  1N9J A;  1VQ5 3;  3LZA A;  1QAK A;  4LZI A;  3BB9 A;  1VQN 3;  4ORL A;  3GAX A;  1EUI C;  2BNG A;  1JV2 B;  1E97 A;  2Z7A A;  5AII A;  4BTX A;  4J8T A;  1B21 A;  5CLK A;  1N5H A;  3URP A;  5IG4 A;  1JBT A;  3WR2 A;  5D81 A;  3CCL 3;  3CC2 3;  3LT8 A;  4HM5 B;  3OWY A;  3NQY A;  3U1W A;  3GRD A;  1QMA A;  3OV4 A;  1DE3 A;  1BRS A;  2CFW A;  3FCS B;  1BSD A;  2IY2 A;  1B2S A;  2O9U X;  1X1X A;  4NHF A;  3CPO A;  1T5Y A;  4MJD A;  3KN4 A;  4MMX B;  3G6E 3;  1Y4K A;  2AAE A;  1JZO A;  2GU1 A;  3PCR A;  5IG3 A;  3NXJ A;  2KF3 A;  4U13 A;  3UNL A;  1QAF A;  1RKY A;  2INX A;  2RFR A;  2OOV C;  2KRT A;  3DUK A;  3HOH A;  4KFD A;  4RBN A;  1BNR A;  2XEP A;  2YX9 A;  1TP6 A;  1JKG A;  1BAN A;  2V1L A;  2YFJ B;  1KQS 2;  3T0U A;  1M90 4;  3STD A;  1CYU A;  1TIJ A;  5M19 A;  5EQL A;  1WQL B;  2CFG A;  3NV0 B;  1A2K A;  1JN5 A;  1RGH A;  3FG4 A;  3HI7 A;  5FGO A;  1OHS A;  1RGE A;  3A5E A;  2IYJ A;  4O2H A;  3ROB A;  1JBS A;  1M9G A;  3CMA 3;  4MMZ B;  3GSP A;  5M1A A;  3HIG A;  3RNT A;  2W56 B;  3ZG5 A;  4WP5 A;  4KFF A;  1YHQ 3;  1IV9 A;  1BNI A;  3BNE A;  1OHP A;  4IIA A;  7STD A;  1FYS A;  1IVX A;  1YVB I;  1GD3 A;  8CHO A;  1OGZ A;  1Z1S A;  3CXC 2;  3EX9 A;  2ML6 A;  1UCI A;  4MMY B;  5IEP A;  1UUV B;  1IU7 A;  2BMO B;  2P0X A;  2BT3 A;  2XGN A;  1JB5 A;  2E2T A;  2W03 A;  3IJE B;  1NJI 4;  1L5G B;  1IQY A;  3LTC A;  1Q7Y 4;  1TFO A;  5BIR A;  2SBL A;  3NM7 A;  2PZV A;  4EYC A;  3UB1 A;  2KF4 A;  1VQ7 3;  5I97 A;  1Q9E A;  1OAC A;  4IT7 A;  2KXG A;  2H0I A;  3Q3F A;  1D6Z A;  1R4Y A;  1MWR A;  1YGW A;  4FMC A;  2OQE A;  3AGO A;  3WA2 X;  3DM8 A;  3S29 A;  1D6Y A;  7GSP A;  1AV4 A;  1VQO 3;  4R9L A;  1LRA A;  4N6N B;  3EQQ B;  1YJW 3;  1W6G A;  1FZU A;  3OWS A;  4FMD A;  1PY3 A;  5STD A;  1TJD A;  1K28 A;  3OWU A;  2P09 A;  4RNY A;  3KKG A;  1MWU A;  1IQ8 A;  3KZT A;  1GMQ A;  3NUV A;  1U8C B;  1O7M B;  1Q82 4;  1FW7 A;  1JRQ A;  2GU3 A;  3DGY A;  1EEJ A;  1T2I A;  4WHA A;  3GZR A;  3ALA A;  1RCK A;  2XFS A;  5G2G A;  3EHC A;  1SPU A;  2MC8 A;  4XBY A;  3O8Y A;  1BU4 A;  2HMJ B;  2P0M A;  1O7N B;  1JB4 A;  2BMR B;  4QWT A;  1G0T A;  3FH1 A;  1OGX A;  2C4B A;  3PGB A;  3Q2P A;  3LTB A;  1W00 A;  1B2Z A;  3PYJ A;  1BNG A;  4CCV A;  2B1X B;  3NBR A;  3D3L A;  5D83 A;  2J8X B;  1B2U A;  3D5G A;  1B2X A;  2F4Y A;  1A2P A;  2WGQ A;  1BRH A;  4N6O B;  3ECF A;  1UCL A;  3LOY A;  3X40 A;  3VF1 A;  2BMQ B;  5JBS A;  2GEY A;  4K1V A;  1BRJ A;  4BTW A;  3A76 A;  3BLZ A;  2XGL A;  4J9A A;  1QAL A;  3F40 A;  2CK3 H;  3WA3 A;  3U97 A;  1K73 4;  2HMK B;  1AVL A;  2MF7 A;  3E99 A;  1RHL A;  1IVW A;  1C7H A;  4HM8 B;  3LML A;  5JPP A;  1TUH A;  5IER A;  3DH2 A;  2RSX A;  4HKV B;  2BIR A; 
#chains in the Genus database with same CATH homology
 3RGR A;  3DGO A;  2W2C A;  1W6Y A;  1STD A;  3OXA A;  3EC9 A;  3H51 A;  2HMN B;  2HML B;  4N3V A;  1Q86 4;  2ZL8 A;  3MKI A;  1Q40 B;  3EN1 B;  3F9S A;  4I4K A;  4WYK B;  2CG0 A;  1IDP A;  2FNQ A;  1V74 A;  3HK4 A;  1YI2 3;  1SQW A;  3BNB A;  3DMC A;  1G96 A;  2QEX 3;  2CKF B;  1UI8 A;  4LGQ A;  3T8U A;  1RN7 A;  3B4P A;  1YJ9 3;  4Q53 A;  4HZB B;  3SX1 A;  4MEI A;  2STD A;  1W02 A;  3KFQ C;  4O3V A;  3CCS 3;  4FCM A;  3KSE D;  1ULJ B;  4XM4 A;  1OPY A;  1W5Z A;  1EG9 B;  1E3R A;  3N54 B;  3NV0 A;  2F86 B;  1GD4 A;  4PEJ A;  5TGN A;  1HKX A;  5CF2 A;  2O3O A;  3KE7 A;  1O7G B;  2W56 A;  4FR9 A;  1UI7 A;  4L7K A;  3QK9 A;  2ZDJ A;  4XDW A;  3UJM A;  1WTH A;  4AKY A;  2W9Q A;  4GB5 A;  1U5O A;  1IVU A;  3LXU X;  1OUN A;  5LC6 A;  3B7C A;  2WOF A;  4N6M A;  2GBW B;  1A2V A;  1OF5 B;  3EBT A;  1SJW A;  2F98 A;  4GL6 A;  2YFL B;  2CWT A;  2OCT A;  5IEO A;  5AIG A;  1A67 A;  4WFO A;  1SIH A;  3SLU A;  1PFP A;  1UUW B;  2P38 A;  5D82 A;  3K9M C;  2K54 A;  2XFT A;  4TX4 A;  1OH0 A;  5HGR A;  2WO0 A;  3CCE 3;  3H3H A;  1AR0 A;  3CU3 A;  2C10 A;  3SOY A;  3X3Z A;  3IMA B;  1CYV A;  3LH4 A;  1TFK A;  5IW9 A;  1ZO2 A;  3KSP A;  3QRD A;  1FGQ A;  4JF8 A;  1W01 A;  4LEH A;  4AKZ A;  2M7O A;  5IG3 A;  4K61 A;  1NDO B;  5AYR B;  3V98 A;  3X41 A;  3CCJ 3;  1W2Z A;  2PNC A;  2IA7 A;  1SII A;  3CNM A;  3WOF B;  2W9P A;  3RDE A;  1IT8 A;  2HMO B;  4NRE A;  3CCR 3;  3JVC A;  1FA3 A;  3EB8 A;  1ROV A;  4STD A;  1WMO A;  4LMI A;  4X2H A;  1YIJ 3;  3IPT A;  3LT9 A;  1DVD A;  4HVN A;  4EXR A;  1OCV A;  3FGY A;  4XBX A;  1O7P B;  1LNH A;  3AMO B;  1JNQ A;  5DRE A;  3HII A;  4KVH A;  2Y73 A;  1VQ9 3;  1RJO A;  3GZY B;  3WOD G;  3BND A;  1IVV A;  1STF I;  5EVH A;  3MSO A;  4KZ1 A;  3I56 3;  3G4S 3;  1LXE A;  4R4K A;  3G0K A;  1KD1 4;  2OQE C;  3I0Y A;  2OTL 3;  3MYT A;  3WOE B;  3K0Z A;  2CIU A;  3ER7 A;  1M1X B;  1KC8 4;  4HM2 B;  1FUW A;  4FMB A;  2CWU A;  6STD A;  3FZW A;  5A0O B;  3LYG A;  3MG1 A;  4EBG A;  4EV2 A;  5FW5 A;  1W2B 2;  3NBB A;  1ULI B;  3NM2 A;  3EN8 A;  3BNC A;  3F14 A;  3FF2 A;  3S28 A;  1VQ4 3;  1RRH A;  5AIF A;  1AVK A;  1F8N A;  2CHC A;  5BXQ A;  2WOH A;  3J7Y d;  4R80 A;  1YJN 3;  4HM7 B;  5AYS C;  3SED A;  1GY6 A;  3CCV 3;  2Q07 A;  3DGM A;  4RZM A;  3TDG A;  2FXT A;  1MNL A;  3EBY A;  2W0Q A;  3CNX A;  1Q40 A;  2GBX B;  4WYK A;  4HM4 B;  3K5T A;  4H61 A;  4HZ9 B;  2Z76 A;  2CFL A;  2CG1 A;  4AEQ A;  3OW2 2;  3DY5 A;  4G1M B;  2IUK A;  5IEN A;  2XSO B;  4FMA A;  1JB2 A;  5AIH A;  2OTJ 3;  3JUP A;  1N5P A;  3V99 A;  1S5A A;  3LTD A;  3GWR A;  2E2U A;  1RRL A;  1W7C A;  2CFD A;  3I55 3;  1N9E A;  1LOX A;  2Y74 A;  2E2V A;  3UL6 A;  1GYB A;  4JRF A;  1Q42 A;  2R4I A;  2LQV A;  3D9R A;  1FGT A;  2BHM A;  3F7X A;  4BTY A;  3S5C A;  1J2B A;  1WMN A;  3FF0 A;  2K0M A;  4HM6 B;  2IUJ A;  3L0R A;  3DZL A;  2QGU A;  5KP3 A;  1N8Q A;  1NB3 I;  3FG3 A;  2CFK A;  2HMM B;  3G16 A;  3GZX B;  1VQP 3;  1WMP A;  1OF5 A;  2OOV A;  3FKA A;  2CWV A;  3GZB A;  1O7W B;  4LSO A;  1VQL 3;  2YFI B;  2ML5 A;  1A90 A;  1K9M 4;  4X2O A;  5BVB A;  3NQZ A;  1VQK 3;  2L4V A;  4OVM A;  3MPH A;  3G8Z A;  1KSI A;  3VSY A;  3K63 A;  3FSD A;  1E3V A;  3JUQ A;  1YIT 3;  2WGO A;  2CC3 A;  2LYX A;  2W6J H;  4HM1 B;  2XRX B;  4H3U A;  3CCU 3;  2Z6B A;  1O7H B;  2FGT A;  2P05 A;  3FLJ A;  3CME 3;  1IV7 A;  3SVA A;  1WNH A;  2CH9 A;  5CK6 A;  1CQS A;  3DXO A;  2IMJ A;  2F99 A;  1GY5 A;  2CW9 A;  4K90 B;  3V92 A;  1GY7 A;  3MWZ A;  4N6U A;  1IQX A;  3NHX A;  1K8A 4;  4HBR A;  1QVG 2;  2Z77 A;  2C11 A;  1DMM A;  2JDI H;  2RCD A;  3HZP A;  3N9H A;  1CEW I;  5AEW B;  3FG1 A;  5EEO A;  1ISK A;  4HM0 B;  1KWI A;  1ZX2 A;  1IT7 A;  1JKG B;  2XSH B;  3AMO A;  4R1K A;  5CF1 A;  1FGM A;  1LVN A;  3M8C A;  2RGQ A;  1K41 A;  1N8R 4;  1DVC A;  4OUQ A;  1JN5 B;  4XB5 A;  4N6T A;  3CCQ 3;  3G71 3;  1BUQ A;  1UW1 A;  3X3X A;  1NB5 I;  5KP1 A;  1US1 A;  1YGE A;  3KII A;  4N6V 0;  4XBT A;  3LTA A;  3UL5 A;  3B8L A;  3X3Y A;  2XF3 A;  3T8N A;  3CC7 3;  3B4O A;  1D6U A;  1JJ2 2;  1QJG A;  3SXX A;  2OWP A;  3NX0 A;  4XDV A;  3JUM A;  1EQK A;  1DMN A;  3PXM A;  3PS8 A;  1FGO A;  2QA4 3;  5CXO A;  3DGL A;  1DYU A;  1QVF 2;  1M1K 4;  5IF6 A;  3K7C A;  5AI1 A;  1W6C A;  2D1W A;  3MG2 A;  1W4N A;  5ELU A;  4O8S A;  3CCM 3;  2KCD A;  3SOA A;  2QIY A;  3CPW 2;  2I9W A;  4HYZ A;  1MOL A;  3S67 A;  1Q81 4;  1ASK A;  2D42 A;  3CD6 3;  4ZM8 A;  4EC6 A;  3N8B A;  1GS3 A;  4K1U A;  1R4C A;  3VGN A;  4FCZ A;  3EJV A;  5JPU A;  1PU4 A;  3EE1 A;  4IPB A;  4RNZ A;  3X42 A;  1VZZ A;  1VQ6 3;  2W04 A;  3F8H A;  4N6L A;  4WWU C;  2JQ5 A;  3PZW A;  3WMD A;  1TU5 A;  3RGA A;  5AEU B;  2XR8 B;  4R9K A;  3MG3 A;  3Q90 A;  3WDG B;  5ELJ A;  1EKM A;  1DMQ A;  3F8X A;  3DGN A;  2XH9 A;  4HJL B;  5IG5 A;  3JUO A;  1OHO A;  3CC4 3;  3S27 A;  3EF8 A;  1FGR A;  1VQM 3;  1VQ8 3;  2B24 B;  1EA2 A;  5LC7 A;  4O02 B;  1NU3 A;  2A15 A;  3PCS A;  3Q1C A;  1NO3 A;  2BO9 B;  2GEX A;  3F7S A;  4KFE A;  4L8P A;  5IG0 A;  4EV5 A;  1NWW A;  3HX8 A;  1HU9 A;  3JUN A;  5DRV A;  4OK0 A;  3NBJ A;  3OX9 A;  1S72 3;  1IK3 A;  4L8O A;  4CDL A;  2UX0 A;  4FCJ A;  5KP4 A;  4HM3 B;  2GXF A;  1ROA A;  1N9J A;  1VQ5 3;  3LZA A;  1QAK A;  4LZI A;  3BB9 A;  1VQN 3;  4ORL A;  3GAX A;  2BNG A;  1JV2 B;  1E97 A;  2Z7A A;  5AII A;  4BTX A;  4J8T A;  5CLK A;  5IG4 A;  1N5H A;  5D81 A;  3CCL 3;  3CC2 3;  3LT8 A;  4HM5 B;  3OWY A;  3NQY A;  3U1W A;  3GRD A;  1QMA A;  3OV4 A;  2CFW A;  3FCS B;  2O9U X;  4NHF A;  3CPO A;  1T5Y A;  4MJD A;  3KN4 A;  4MMX B;  3G6E 3;  1Y4K A;  3PCR A;  2GU1 A;  3NXJ A;  4U13 A;  3UNL A;  1QAF A;  1RKY A;  2INX A;  2RFR A;  2OOV C;  2KRT A;  3DUK A;  4RBN A;  4KFD A;  2XEP A;  2YX9 A;  1TP6 A;  1JKG A;  2V1L A;  2YFJ B;  1KQS 2;  3T0U A;  1M90 4;  3STD A;  1CYU A;  1TIJ A;  5EQL A;  1WQL B;  2CFG A;  3NV0 B;  1A2K A;  1JN5 A;  3FG4 A;  3HI7 A;  5FGO A;  1OHS A;  4O2H A;  3ROB A;  3CMA 3;  1M9G A;  4MMZ B;  3HIG A;  2W56 B;  4WP5 A;  4KFF A;  1YHQ 3;  1IV9 A;  3BNE A;  1OHP A;  4IIA A;  7STD A;  1YVB I;  1IVX A;  8CHO A;  1GD3 A;  3CXC 2;  1OGZ A;  1Z1S A;  3EX9 A;  2ML6 A;  4MMY B;  5IEP A;  1UUV B;  1IU7 A;  2BMO B;  2P0X A;  2BT3 A;  2XGN A;  1JB5 A;  2E2T A;  2W03 A;  3IJE B;  1NJI 4;  1L5G B;  1IQY A;  3LTC A;  1Q7Y 4;  1TFO A;  2SBL A;  3NM7 A;  2PZV A;  4EYC A;  3UB1 A;  1VQ7 3;  5I97 A;  1OAC A;  4IT7 A;  2KXG A;  1D6Z A;  4FMC A;  2OQE A;  3WA2 X;  3DM8 A;  3S29 A;  1D6Y A;  1AV4 A;  1VQO 3;  4R9L A;  4N6N B;  3EQQ B;  1YJW 3;  1W6G A;  3OWS A;  4FMD A;  5STD A;  1K28 A;  3OWU A;  2P09 A;  4RNY A;  3KKG A;  1IQ8 A;  3KZT A;  3NUV A;  1U8C B;  1O7M B;  1Q82 4;  1JRQ A;  2GU3 A;  4WHA A;  3GZR A;  3ALA A;  2XFS A;  5G2G A;  3EHC A;  1SPU A;  2MC8 A;  4XBY A;  3O8Y A;  2HMJ B;  2P0M A;  1O7N B;  1JB4 A;  2BMR B;  4QWT A;  3FH1 A;  1OGX A;  3PGB A;  3Q2P A;  3LTB A;  1W00 A;  3PYJ A;  4CCV A;  2B1X B;  3NBR A;  3D3L A;  5D83 A;  2WGQ A;  4N6O B;  3ECF A;  3LOY A;  3X40 A;  3VF1 A;  2BMQ B;  5JBS A;  2GEY A;  4K1V A;  4BTW A;  3A76 A;  3BLZ A;  2XGL A;  4J9A A;  1QAL A;  3F40 A;  2CK3 H;  3WA3 A;  3U97 A;  1K73 4;  2HMK B;  1AVL A;  2MF7 A;  3E99 A;  1IVW A;  1C7H A;  4HM8 B;  3LML A;  5JPP A;  1TUH A;  5IER A;  2RSX A;  4HKV B;  3MHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...