2HMKB

Crystal structure of naphthalene 1,2-dioxygenase bound to phenanthrene
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 53
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmkB00
3EBTA 3OX9A 3FLJA 3OV4A 4OVMA 3KE7A 1O7HB 5AEWB 2I9WA 3KSPA 3MG2A 2Z7AA 2CKFB 4HM5B 1QJGA 3NM2A 3GZBA 4X2OA 4L8PA 5DREA 1OPYA 4J9AA 1ULIB 3B4PA 3F40A 4XDVA 3ECFA 3MSOA 3MYTA 4HM3B 3STDA 1C7HA 3SEDA 3G16A 5EVHA 3F7XA 4R9LA 4STDA 2XR8B 5CF2A 2XSHB 4PEJA 4N3VA 5IF6A 3NUVA 1HKXA 2UX0A 4HVNA 3FSDA 3KKGA 3FF0A 3E99A 5DRVA 3A76A 1STDA 3NXJA 3JUPA 4R9KA 2YFJB 4H3UA 1JB4A 1E3RA 4L8OA 4XBXA 4XBTA 3EHCA 4HM1B 2F99A 3GZXB 3HZPA 1O7NB 2PZVA 1GY7A 4LGQA 2GBWB 1JB2A 4R1KA 3B7CA 3EN8A 2RCDA 5IEPA 4FCMA 1TUHA 3MG3A 4HJLB 1O7PB 3GWRA 5BVBA 1SJWA 5IERA 2IMJA 3SOYA 1VZZA 3F8HA 4HM8B 5IEOA 3K7CA 1BUQA 3HX8A 3OWYA 3MKIA 3JUNA 3EQQB 4LMIA 3DUKA 3CNMA 1DMNA 4HM2B 5D83A 1UUVB 5CLKA 1W00A 2STDA 3K0ZA 3ER7A 3RGRA 1EG9B 4OUQA 7STDA 5KP1A 4K1UA 3WMDA 2A15A 2GBXB 3LYGA 1E3VA 2JQ5A 4IIAA 4HZ9B 3OXAA 1DMQA 3T8NA 3VGNA 3NV0A 1OHSA 4ORLA 5FW5A 4K1VA 4J8TA 1JKGA 1O7GB 3FH1A 2R4IA 5D81A 1NDOB 3CPOA 3EBYA 5AIFA 2HMKB 3UJMA 1W6YA 4XB5A 3B4OA 1OHOA 3FZWA 4LEHA 3JUOA 3IPTA 3OWSA 2GXFA 3S5CA 3T8UA 4RZMA 1OHPA 4I4KA 5AIHA 4WWUC 3ROBA 3JUMA 3DMCA 3CU3A 5KP3A 3DXOA 4X2HA 4FCJA 1GY6A 1ISKA 1QMAA 5HGRA 2HMLB 5G2GA 4Q53A 1GS3A 1OF5A 1OCVA 4GB5A 2QGUA 1IDPA 3DM8A 1OGZA 3LZAA 3NV0B 1JB5A 2HMJB 1GYBA 1Q40A 1ZO2A 4WYKA 2F98A 3DZLA 1WQLB 1DMMA 1Z1SA 1E97A 4HM4B 1JN5A 5TGNA 3EC9A 3MG1A 1W02A 2GEYA 2YFLB 4KVHA 5IG5A 1W01A 6STDA 1Q42A 3I0YA 3GZRA 3VSYA 3CNXA 2RGQA 5CK6A 1A2KA 5AIGA 1GY5A 5JPUA 5KP4A 5BXQA 3FGYA 1OUNA 2HMNB 3G0KA 2B24B 4HKVB 2RFRA 1UUWB 1NU3A 3F14A 1OH0A 2K54A 1O7WB 4WP5A 1ASKA 1ZX2A 3EF8A 3B8LA 8CHOA 2GEXA 3SOAA 4HM6B 3UNLA 3JUQA 2W2CA 1OF5B 3FKAA 2B1XB 5JPPA 2BMRB 2Z77A 1EA2A 4CDLA 3G8ZA 2F86B 1CQSA 3H51A 5AEUB 2CHCA 1Q40B 3KZTA 4XDWA 4WYKB 3BLZA 5IG3A 3GZYB 1S5AA 5IENA 1JN5B 2BMQB 3H3HA 3EN1B 3F9SA 3BB9A 2XRXB 5IG4A 4XM4A 3NHXA 3NBRA 5CF1A 2OWPA 3Q90A 4L7KA 2XSOB 3F7SA 3F8XA 2QIYA 4HM7B 3EX9A 1O7MB 5IG0A 5D82A 4MJDA 1NWWA 2INXA 1OGXA 4HZBB 2BMOB 2HMOB 3EJVA 3GRDA 3M8CA 5CXOA 2Z76A 1JKGB 5STDA 2BNGA 3HK4A 4XBYA 2YFIB 4U13A 3RGAA 5AIIA 4HM0B 3OWUA 1TP6A 1U5OA 1ULJB 2HMMB 3D9RA 1AR0A 5AI1A 3MHEA 1K41A 3FF2A
chains in the Genus database with same CATH superfamily
3EBTA 3WA3A 2RBIA 5HOHA 2RSXA 3OX9A 2FNQA 1EEJA 1YIJ3 1B27A 1RCLA 1LOYA 1HYFA 1W4NA 3FLJA 2E2TA 3OV4A 4OVMA 1GSPA 3KE7A 1O7HB 3DGNA 3LT9A 5AEWB 2I9WA 1A2PA 2ML5A 3CD63 1B2SA 2J8XB 2OTJ3 1YHQ3 3KSPA 2K0MA 3BNCA 3MG2A 3QK9A 2O9UX 2W9QA 2Z7AA 2CWUA 1L5GB 1TJDA 2W0QA 2CKFB 1RLSA 4HM5B 1QJGA 2SARA 2V1LA 2C10A 1U8CB 1BAOA 1IT8A 1VQM3 2Y74A 1Q9EA 3NM2A 3GZBA 4G1MB 1GMPA 2KF5A 1FGOA 1UI8A 3HIGA 3ZFZA 4X2OA 3N8BA 1RMSA 5LC7A 3S67A 1BANA 4L8PA 1RDSA 5BU4A 1YI23 4OK0A 5DREA 8RNTA 1OPYA 4J9AA 2P09A 1GD3A 1UI7A 3JVCA 1ULIB 2E2UA 3B4PA 1VQO3 3DGLA 2H0IA 1RN4A 3F40A 4XDVA 1LNHA 1D6ZA 2XH9A 1BSDA 2BO9B 3ECFA 2Z6BA 3MSOA 3MYTA 3NQYA 2CG0A 2UUGC 1RTUA 4HM3B 3STDA 1C7HA 3SEDA 3G16A 3SVAA 1IQ8A 3D4AA 3K63A 2O3OA 1RCKA 2CFKA 4WFOA 3ALAA 4CJNA 5EVHA 3F7XA 1JZOA 4LYLB 2K3DA 1CYUA 4R9LA 1IYYA 4STDA 1ZGXA 1SARA 4FMCA 1B20A 4EC6A 2XR8B 5CF2A 2LQVA 3FG1A 2XSHB 4HAAA 4PEJA 4N3VA 1FYSA 1HZ1A 5IF6A 2CX0A 3NUVA 3WOEB 1HKXA 1KC84 1WMPA 1FUTA 2UX0A 3KN4A 2XF3A 4HVNA 2AADA 3FSDA 1MWRA 1UCIA 3NM7A 3KKGA 1N5HA 1JZDA 1IV7A 3FF0A 1K734 3AMOB 1RGCA 1V58A 1NB3I 1X1UA 4N6UA 3E99A 5DRVA 3CC43 3A76A 3AGNA 1STDA 4EV5A 2MC8A 3RDEA 1IV9A 1SPUA 1PU4A 2P0MA 3DGYA 3FG4A 3LTAA 2Q07A 3K9MC 3NXJA 3Q3FA 1RJOA 3JUPA 4R9KA 3LTBA 1VQ63 5M19A 2FXTA 1VQ83 2YFJB 4H3UA 1JB4A 1E3RA 1TFKA 1B2ZA 4L8OA 4XBXA 3J7Yd 2OTL3 3BNEA 3NBBA 4XBTA 3MPHA 1FW7A 1I2GA 3EHCA 4HM1B 1US1A 1V74A 3DGMA 2KAAA 1JBSA 2F99A 3GZXB 1I0VA 3HZPA 1O7NB 1BIRA 1IVVA 3A5EA 2PZVA 1GY7A 4O8SA 1AVLA 4LGQA 2GBWB 1NB5I 4MEIA 1JB2A 4R1KA 3B7CA 3EN8A 2RCDA 5IEPA 4FCMA 1TUHA 3MG3A 1MGWA 4ZM8A 2P38A 2LYXA 4HJLB 1O7PB 1IK3A 3CCU3 4FR9A 3GWRA 5BVBA 2ZDJA 4RBNA 1SJWA 2IUKA 1JBTA 3K5TA 5IERA 4QWTA 1TRPA 2CC3A 2IMJA 1F8NA 2FGTA 3SOYA 1RGFA 1VZZA 3DGOA 3F8HA 4HM8B 1K9M4 1YNVX 3SX1A 1JBRA 1ROVA 4BL3A 2HOHA 1X1WA 1T2HA 3LTCA 5IEOA 3K7CA 3ZG0A 1BUQA 4KFDA 1C54A 2BT3A 3HX8A 3OWYA 3CCS3 3MKIA 1NO3A 1Q864 1YGEA 3JUNA 3EQQB 1BNFA 1I2FA 2XFSA 1VQ43 1BRJA 2CWVA 5RNTA 1KD14 5LC6A 4LMIA 1VQK3 3FG3A 3D5IA 3TDGA 3IJEB 3UL5A 1EKMA 2ZHXB 3PYJA 3DUKA 2OQEC 3RNTA 3CNMA 1DMNA 1DVDA 4HM2B 5D83A 1BVIA 1UUVB 3DY5A 5CLKA 1W00A 2STDA 4TX4A 4DKIA 3K0ZA 4NHFA 3ER7A 3RGRA 1WMNA 1EG9B 1BOXA 2C11A 4FMDA 1TRQA 1V57A 3GSPA 4OUQA 3UB1A 5GSPA 2CFDA 4IT7A 4KFFA 2CK3H 2F56A 2W03A 3WOFB 1MWTA 2C4BA 1VQQA 2IYJA 2KF4A 3X42A 1KSIA 7STDA 2IUJA 5KP1A 4K1UA 2R41A 3WMDA 1W5ZA 2A15A 1DYUA 2GBXB 1FGMA 3X41A 3LYGA 1K28A 1E3VA 1B2XA 2JQ5A 4NREA 1YGWA 4IIAA 1W2ZA 3S29A 5ELUA 4EXRA 4O02B 4HZ9B 1LOWA 2CH9A 1HU9A 3OXAA 3KFQC 1RGKA 1OACA 1RGLA 5EEOA 1DMQA 4JF8A 2WGOA 4RNTA 2KCDA 2BHMA 2W56A 1AV4A 4GSPA 1TIJA 4AKZA 4R4KA 1BRKA 4CPKA 3T8NA 3VGNA 3NV0A 1UCJA 2L4VA 1OHSA 1LRAA 3L0RA 5ELJA 4ORLA 1MWSA 4IPBA 2GSPA 2L1SA 4K1VA 5FW5A 4J8TA 1JKGA 1O7GB 4O3VA 3CME3 1G0TA 3BU4A 1D6UA 1YIT3 1BNIA 3FH1A 5IW9A 1RGHA 2ML6A 1FGTA 1TTOA 2R4IA 2BIRA 1S723 1SIHA 1CEWI 1UDII 2M7OA 5D81A 1NDOB 4EV2A 1N9EA 3CPOA 9RNTA 3G713 3CPW2 1LOVA 1A67A 3EBYA 1RGEA 1JJ22 1RNBA 1PFPA 5EQLA 3CCJ3 4KFEA 5AIFA 1M1K4 2HMKB 3MWZA 3UJMA 2H0GA 1DETA 1W6YA 3B4OA 1FZUA 1OHOA 4XB5A 1VQ73 2WO0A 3CCE3 3CCQ3 3X3XA 1FGRA 5AYRB 1TU5A 3PXMA 2CIUA 3FZWA 4LEHA 3OW22 1W6GA 2AAEA 1BRGA 3V99A 2CFLA 3JUOA 3NQZA 3IPTA 1QAKA 3OWSA 2GXFA 2Y73A 3HOHA 3AGOA 4H61A 2P05A 4N6V0 1EUIC 3S5CA 3T8UA 3PZWA 3UL6A 4RZMA 3SXXA 1BRNL 2CX1A 1RRHA 1RN7A 1OHPA 4BU4A 3CCV3 4I4KA 1BU4A 5AIHA 3ZG5A 4WWUC 1M9GA 2WOFA 1IQXA 1BRIA 3JUMA 3DMCA 3ROBA 1GD4A 4KT3B 4N6NB 1VQP3 3CU3A 1AY7A 1AQZA 4RNYA 1Q814 3Q1CA 5KP3A 3DXOA 4X2HA 1RKYA 4FCJA 1GY6A 1ISKA 3NX0A 1Q7Y4 1UCLA 2QEX3 1YJN3 3X3ZA 1QMAA 5HGRA 1BNJA 1RRLA 1X1XA 5BIRA 1X1YA 2HMLB 4FCZA 5G2GA 1BNEA 4Q53A 3URPA 1GS3A 2H0HA 2W56B 5AYSC 1G96A 1OF5A 3N54B 1GMRA 4KZ1A 2D1WA 1OCVA 4GB5A 4WHAA 2KRTA 2QGUA 3LH4A 1QVG2 1M904 2OOVA 2ZL8A 4ILFA 4GL6A 3T0UA 1IDPA 1BSAA 2ZA4A 3DM8A 1OGZA 1IQYA 3HI7A 1BRSA 3KIIA 3LZAA 3NV0B 1JB5A 4J5KA 3WODG 2QA43 1B2UA 1B3SA 1AVKA 1GOVA 3PS8A 4R80A 1KWIA 2HMJB 2CFWA 1N8R4 1Q824 1GOYA 1BNSA 1WTHA 3AMOA 6GSPA 1GYBA 1Q40A 1WMOA 1YJ93 1ZO2A 4JRFA 4J5GA 1RGGA 4BIRA 4WYKA 1FUWA 1IVXA 2F98A 3DZLA 2CW9A 1I3IA 1WQLB 2YX9A 1DMMA 1ZS7A 1Z1SA 1E97A 4HM4B 1JN5A 4LSOA 3CCR3 4K61A 3GAXA 2KF3A 3EC9A 3MG1A 3DH2A 5TGNA 1K8A4 4N6LA 1W02A 2GEYA 2YFLB 4KVHA 5IG5A 1W01A 1LQMB 2KF6A 5FGOA 6STDA 1N8QA 3X40A 1Q42A 3WHOA 3V92A 3I0YA 3GZRA 3QRDA 3VSYA 1J2BA 1LXEA 3VF1A 3CNXA 1GMQA 1UGHI 1CYVA 2RGQA 5I97A 5CK6A 1MGRA 3CXC2 1A2KA 1Q7HA 4MMYB 5AIGA 5A0OB 5JBSA 3IMAB 1GY5A 1BNGA 2PNCA 3LOYA 3CCL3 5JPUA 1IT7A 1JNQA 3PCSA 4BTWA 2F5WA 3D3LA 2IY2A 3HIIA 1STFI 5KP4A 5BXQA 3CCM3 3KSED 2JDIH 3LXUX 3FGYA 1OUNA 1SQWA 2HMNB 2P0XA 3G0KA 4N6MA 2WOHA 1DE3A 1QALA 4MMXB 1I0XA 1BRHA 1I3FA 1M1XB 1MOLA 2BU4A 3SYUA 4EBGA 3I563 1B2MA 5M18A 2B24B 4N6TA 4HKVB 2OQEA 2RFRA 1UUWB 1NU3A 1UGIA 3F14A 1OH0A 2K54A 4O2HA 2CG1A 1UCKA 1O7WB 4WP5A 1ASKA 1MNLA 1ZX2A 4EW5A 3EF8A 3B8LA 2XGNA 1BSCA 8CHOA 2GEXA 3SOAA 4HM6B 3UNLA 3Q2PA 2UGIA 2IA7A 3JUQA 3N9HA 4K90B 1T5YA 1VQ93 3CMA3 1IU7A 2W2CA 1LQGC 3U97A 1OF5B 3FKAA 1RHLA 2SBLA 2B1XB 1R4YA 1DVCA 1SIIA 3EB8A 3EE1A 4EYCA 5JPPA 2BMRB 2Z77A 3S27A 1EA2A 7GSPA 1BUJA 1N5PA 3LT8A 1YVSA 3G8ZA 4NPBA 4CDLA 3WA2X 2F86B 2XFTA 1CQSA 4FMAA 1IVUA 1JRQA 1UW1A 3H51A 3O8YA 5G1LA 3U1WA 5AEUB 1A90A 2CHCA 3SLUA 1LNIA 1Q40B 3KZTA 4XDWA 1CH0A 1QAFA 1VQN3 4WYKB 5M1AA 2D42A 3BNBA 1VQL3 3BLZA 5IG3A 3G6E3 3AHSA 1BGSA 3GZYB 1I8VA 1S5AA 1W6CA 5IENA 4GHOA 4AKYA 1W7CA 1JN5B 2BMQB 3H3HA 3EN1B 3F9SA 2W04A 1TFOA 2F5MA 3BB9A 1UUGB 2XRXB 4MMZB 5IG4A 3LMLA 3I553 1FA3A 2W9PA 2XGLA 2OOVC 1A2VA 4BTYA 1T2IA 3D79A 2CWTA 1YJW3 4XM4A 3NHXA 4N6OB 4I5QA 4HBRA 3V98A 3G4S3 1JV2B 2W6JH 3NBRA 5CF1A 2OWPA 4AEQA 3Q90A 1T3BA 3PCRA 1I2EA 4L7KA 2XSOB 3F7SA 3F8XA 2MF7A 2QIYA 4HM7B 2XEPA 2E2VA 1RNTA 1PY3A 2KXGA 3EX9A 1FUSA 3S28A 4HOHA 1O7MB 5IG0A 5D82A 1EQKA 4MJDA 1MWUA 1W2B2 1NWWA 2INXA 1GOUA 3NBJA 1BSEA 1I70A 1OGXA 2RNTA 1YVBI 1RN1A 1NJI4 4HZBB 1FGQA 1KQS2 2BMOB 3X3YA 1LOXA 2HMOB 3EJVA 3GRDA 3M8CA 5CXOA 1PYLA 3BIRA 3WR2A 1ROAA 4BL2A 1B21A 3WDGB 2Z76A 1JKGB 1Y4KA 3BNDA 3FCSB 3KCHA 3LTDA 5STDA 2BNGA 3AHWA 4HYZA 6RNTA 3HK4A 4XBYA 2YFIB 1LVNA 2GU3A 1G02A 2CFGA 4U13A 3CC23 5G1KA 2OCTA 3RGAA 4BTXA 1VQ53 1WNHA 5AIIA 1RSNA 4HM0B 7RNTA 1NNVA 2WGQA 1N9JA 1QVF2 3OWUA 1R4CA 2F4YA 3CC73 1TP6A 1D6YA 3D5GA 1U5OA 1ULJB 2HMMB 1RGAA 3D9RA 4FMBA 1BSBA 1AR0A 2GU1A 4LZIA 5AI1A 3MHEA 4RNZA 1BNRA 3PGBA 4CCVA 1K41A 3FF2A 1IVWA
chains in the Genus database with same CATH topology
3EBTA 3WA3A 2RSXA 3OX9A 2FNQA 1YIJ3 1W4NA 3FLJA 2E2TA 3OV4A 4OVMA 3KE7A 1O7HB 3DGNA 3LT9A 5AEWB 2I9WA 2ML5A 3CD63 2OTJ3 1YHQ3 3KSPA 2K0MA 3BNCA 3MG2A 3QK9A 2O9UX 2W9QA 2Z7AA 2CWUA 2W0QA 2CKFB 4HM5B 1QJGA 2V1LA 2C10A 1U8CB 1IT8A 1VQM3 2Y74A 3NM2A 3GZBA 4G1MB 1FGOA 1UI8A 3HIGA 4X2OA 3N8BA 5LC7A 3S67A 4L8PA 1YI23 4OK0A 5DREA 1OPYA 4J9AA 2P09A 1GD3A 1UI7A 3JVCA 1ULIB 2E2UA 3B4PA 1VQO3 3DGLA 3F40A 4XDVA 1LNHA 1D6ZA 2XH9A 2BO9B 3ECFA 1L5GB 2Z6BA 3MSOA 3MYTA 3NQYA 2CG0A 4HM3B 3STDA 5I97A 1C7HA 3SEDA 3G16A 3SVAA 1IQ8A 3K63A 2O3OA 2CFKA 4WFOA 3ALAA 5EVHA 3F7XA 1CYUA 4R9LA 4STDA 4FMCA 4EC6A 2XR8B 5CF2A 2LQVA 3FG1A 2XSHB 4PEJA 4N3VA 5IF6A 1KC84 3NUVA 3WOEB 1HKXA 1WMPA 2UX0A 3KN4A 2XF3A 4HVNA 3FSDA 3NM7A 3KKGA 1N5HA 1K734 1IV7A 3FF0A 3AMOB 1NB3I 4N6UA 3E99A 5DRVA 3CC43 3A76A 1STDA 4EV5A 2MC8A 3RDEA 1IV9A 1SPUA 1PU4A 2P0MA 3FG4A 3LTAA 2Q07A 3K9MC 3NXJA 1RJOA 3JUPA 4R9KA 3LTBA 1VQ63 2FXTA 1VQ83 2YFJB 4H3UA 1JB4A 1E3RA 1TFKA 4L8OA 4XBXA 2OTL3 3J7Yd 3BNEA 3NBBA 4XBTA 3MPHA 3EHCA 4HM1B 1US1A 1V74A 3DGMA 2F99A 3GZXB 3HZPA 1O7NB 1IVVA 2PZVA 1GY7A 4O8SA 1AVLA 4LGQA 2GBWB 1NB5I 4MEIA 1JB2A 4R1KA 3B7CA 3EN8A 2RCDA 5IEPA 4FCMA 1TUHA 3MG3A 4ZM8A 2P38A 2LYXA 4HJLB 1O7PB 1IK3A 3CCU3 4FR9A 3GWRA 5BVBA 2ZDJA 4RBNA 2IUKA 1SJWA 3K5TA 5IERA 4QWTA 2CC3A 2IMJA 1F8NA 2FGTA 3SOYA 1VZZA 3F8HA 3DGOA 4HM8B 1K9M4 3SX1A 1ROVA 3LTCA 5IEOA 3K7CA 1BUQA 4KFDA 2BT3A 3HX8A 3OWYA 3CCS3 3MKIA 1NO3A 1Q864 1YGEA 3JUNA 3EQQB 2XFSA 1VQ43 2CWVA 1KD14 5LC6A 4LMIA 1VQK3 3FG3A 3TDGA 3IJEB 3UL5A 1EKMA 3PYJA 3DUKA 2OQEC 3CNMA 1DMNA 1DVDA 4HM2B 5D83A 1UUVB 3DY5A 5CLKA 1W00A 2STDA 4TX4A 3K0ZA 4NHFA 3ER7A 3RGRA 1WMNA 1EG9B 2C11A 4FMDA 4OUQA 3UB1A 2CFDA 4IT7A 4KFFA 2CK3H 3WOFB 2W03A 3X42A 1KSIA 7STDA 2IUJA 5KP1A 4K1UA 3WMDA 1W5ZA 2A15A 1DYUA 2GBXB 1FGMA 3X41A 3LYGA 1K28A 1E3VA 4NREA 2JQ5A 3S29A 4IIAA 1W2ZA 4EXRA 5ELUA 4O02B 4HZ9B 2CH9A 1HU9A 3OXAA 3KFQC 1OACA 5EEOA 1DMQA 4JF8A 2WGOA 2KCDA 2BHMA 2W56A 1AV4A 1TIJA 4AKZA 4R4KA 3T8NA 3VGNA 3NV0A 2L4VA 1OHSA 3L0RA 5ELJA 4ORLA 4IPBA 5FW5A 4K1VA 4J8TA 1JKGA 1O7GB 4O3VA 3CME3 1D6UA 1YIT3 3FH1A 5IW9A 2ML6A 1FGTA 2R4IA 1S723 1SIHA 1CEWI 2M7OA 5D81A 1NDOB 4EV2A 1N9EA 3CPOA 3G713 3CPW2 1A67A 3EBYA 1JJ22 1PFPA 5EQLA 3CCJ3 4KFEA 5AIFA 1M1K4 2HMKB 3MWZA 3UJMA 1W6YA 3B4OA 4XB5A 1OHOA 1VQ73 2WO0A 3CCE3 3X3XA 1FGRA 5AYRB 1TU5A 3PXMA 2CIUA 3FZWA 4LEHA 3OW22 1W6GA 3V99A 2CFLA 3JUOA 3NQZA 3IPTA 1QAKA 3OWSA 2GXFA 2Y73A 4H61A 2P05A 4N6V0 3S5CA 3T8UA 3PZWA 3UL6A 4RZMA 3SXXA 1RRHA 1RN7A 1OHPA 3CCV3 4I4KA 5AIHA 4WWUC 1M9GA 2WOFA 1IQXA 3JUMA 3ROBA 3DMCA 1VQP3 1GD4A 4N6NB 3CU3A 4RNYA 1Q814 3Q1CA 5KP3A 3DXOA 4X2HA 1RKYA 4FCJA 1GY6A 1ISKA 3NX0A 1Q7Y4 2QEX3 1YJN3 3X3ZA 1QMAA 5HGRA 1RRLA 2HMLB 4FCZA 5G2GA 4Q53A 1GS3A 2W56B 5AYSC 1G96A 1OF5A 3N54B 4KZ1A 2D1WA 1OCVA 4GB5A 4WHAA 2KRTA 2QGUA 3LH4A 1QVG2 1M904 2OOVA 2ZL8A 4GL6A 3T0UA 1IDPA 3DM8A 1OGZA 1IQYA 3HI7A 3KIIA 3LZAA 3NV0B 3WODG 1JB5A 2QA43 3PS8A 1AVKA 4R80A 1KWIA 2HMJB 2CFWA 1N8R4 1Q824 1WTHA 3AMOA 1GYBA 1Q40A 1WMOA 1YJ93 1ZO2A 4JRFA 4WYKA 1FUWA 1IVXA 2F98A 3DZLA 2CW9A 1WQLB 2YX9A 1DMMA 1Z1SA 1E97A 4HM4B 1JN5A 4LSOA 3CCR3 4K61A 3GAXA 5TGNA 3EC9A 3MG1A 1K8A4 4N6LA 1W02A 2GEYA 2YFLB 4KVHA 5IG5A 1W01A 5FGOA 6STDA 3CCQ3 1N8QA 3X40A 1Q42A 3V92A 3I0YA 3GZRA 3QRDA 3VSYA 1J2BA 1LXEA 3VF1A 3CNXA 1CYVA 2RGQA 5CK6A 3CXC2 1A2KA 4MMYB 5AIGA 5A0OB 5JBSA 3IMAB 1GY5A 2PNCA 3LOYA 3CCL3 5JPUA 1IT7A 1JNQA 3PCSA 4BTWA 3D3LA 3HIIA 1STFI 5KP4A 5BXQA 3CCM3 3KSED 2JDIH 3LXUX 3FGYA 1OUNA 1SQWA 2HMNB 2P0XA 3G0KA 4N6MA 2WOHA 1QALA 4MMXB 1M1XB 1MOLA 4EBGA 3I563 2B24B 4N6TA 4HKVB 2OQEA 2RFRA 1UUWB 1NU3A 3F14A 1OH0A 2K54A 4O2HA 2CG1A 1O7WB 4WP5A 1ASKA 1MNLA 1ZX2A 3EF8A 3B8LA 2XGNA 8CHOA 2GEXA 3SOAA 4HM6B 3UNLA 3Q2PA 2IA7A 3JUQA 3N9HA 4K90B 1T5YA 1VQ93 3CMA3 1IU7A 2W2CA 3U97A 1OF5B 3FKAA 2SBLA 2B1XB 1DVCA 1SIIA 3EB8A 3EE1A 4EYCA 5JPPA 2BMRB 2Z77A 3S27A 1EA2A 1N5PA 3LT8A 4CDLA 3G8ZA 3WA2X 2F86B 2XFTA 1CQSA 4FMAA 1IVUA 1JRQA 1UW1A 3H51A 3O8YA 3U1WA 5AEUB 1A90A 2CHCA 3SLUA 1Q40B 3KZTA 4XDWA 1QAFA 1VQN3 4WYKB 1VQL3 2D42A 3BNBA 3BLZA 5IG3A 3G6E3 3GZYB 1S5AA 1W6CA 5IENA 4AKYA 1W7CA 1JN5B 2BMQB 3H3HA 3EN1B 3F9SA 2W04A 1TFOA 3BB9A 4MMZB 3I553 2XRXB 5IG4A 3LMLA 1FA3A 2W9PA 2XGLA 2OOVC 1A2VA 4BTYA 2CWTA 1YJW3 4XM4A 3NHXA 4N6OB 4HBRA 3V98A 3G4S3 1JV2B 2W6JH 3NBRA 5CF1A 2OWPA 4AEQA 3Q90A 3PCRA 4L7KA 2XSOB 3F7SA 3F8XA 2MF7A 2QIYA 4HM7B 2XEPA 2E2VA 3EX9A 2KXGA 3S28A 1O7MB 5IG0A 5D82A 1EQKA 4MJDA 1W2B2 1NWWA 2INXA 3NBJA 1OGXA 1YVBI 1NJI4 4HZBB 1FGQA 1KQS2 2BMOB 3X3YA 1LOXA 2HMOB 3EJVA 3GRDA 3M8CA 5CXOA 1ROAA 3WDGB 2Z76A 1JKGB 1Y4KA 3BNDA 3FCSB 3LTDA 5STDA 2BNGA 4HYZA 3HK4A 4XBYA 2YFIB 1LVNA 2GU3A 2CFGA 4U13A 3CC23 4BTXA 2OCTA 3RGAA 1VQ53 1WNHA 5AIIA 4HM0B 2WGQA 1N9JA 1QVF2 3OWUA 1R4CA 3CC73 1TP6A 1D6YA 1U5OA 1ULJB 2HMMB 3D9RA 4FMBA 2GU1A 1AR0A 4LZIA 5AI1A 3MHEA 4RNZA 3PGBA 4CCVA 1K41A 3FF2A 1IVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBT A;  3OX9 A;  3FLJ A;  3OV4 A;  4OVM A;  3KE7 A;  1O7H B;  5AEW B;  2I9W A;  3KSP A;  3MG2 A;  2Z7A A;  2CKF B;  4HM5 B;  1QJG A;  3NM2 A;  3GZB A;  4X2O A;  4L8P A;  5DRE A;  1OPY A;  4J9A A;  1ULI B;  3B4P A;  3F40 A;  4XDV A;  3ECF A;  3MSO A;  3MYT A;  4HM3 B;  3STD A;  1C7H A;  3SED A;  3G16 A;  5EVH A;  3F7X A;  4R9L A;  4STD A;  2XR8 B;  5CF2 A;  2XSH B;  4PEJ A;  4N3V A;  5IF6 A;  3NUV A;  1HKX A;  2UX0 A;  4HVN A;  3FSD A;  3KKG A;  3FF0 A;  3E99 A;  5DRV A;  3A76 A;  1STD A;  3NXJ A;  3JUP A;  4R9K A;  2YFJ B;  4H3U A;  1JB4 A;  1E3R A;  4L8O A;  4XBX A;  4XBT A;  3EHC A;  4HM1 B;  2F99 A;  3GZX B;  3HZP A;  1O7N B;  2PZV A;  1GY7 A;  4LGQ A;  2GBW B;  1JB2 A;  4R1K A;  3B7C A;  3EN8 A;  2RCD A;  5IEP A;  4FCM A;  1TUH A;  3MG3 A;  4HJL B;  1O7P B;  3GWR A;  5BVB A;  1SJW A;  5IER A;  2IMJ A;  3SOY A;  1VZZ A;  3F8H A;  4HM8 B;  5IEO A;  3K7C A;  1BUQ A;  3HX8 A;  3OWY A;  3MKI A;  3JUN A;  3EQQ B;  4LMI A;  3DUK A;  3CNM A;  1DMN A;  4HM2 B;  5D83 A;  1UUV B;  5CLK A;  1W00 A;  2STD A;  3K0Z A;  3ER7 A;  3RGR A;  1EG9 B;  4OUQ A;  7STD A;  5KP1 A;  4K1U A;  3WMD A;  2A15 A;  2GBX B;  3LYG A;  1E3V A;  2JQ5 A;  4IIA A;  4HZ9 B;  3OXA A;  1DMQ A;  3T8N A;  3VGN A;  3NV0 A;  1OHS A;  4ORL A;  5FW5 A;  4K1V A;  4J8T A;  1JKG A;  1O7G B;  3FH1 A;  2R4I A;  5D81 A;  1NDO B;  3CPO A;  3EBY A;  5AIF A;  2HMK B;  3UJM A;  1W6Y A;  4XB5 A;  3B4O A;  1OHO A;  3FZW A;  4LEH A;  3JUO A;  3IPT A;  3OWS A;  2GXF A;  3S5C A;  3T8U A;  4RZM A;  1OHP A;  4I4K A;  5AIH A;  4WWU C;  3ROB A;  3JUM A;  3DMC A;  3CU3 A;  5KP3 A;  3DXO A;  4X2H A;  4FCJ A;  1GY6 A;  1ISK A;  1QMA A;  5HGR A;  2HML B;  5G2G A;  4Q53 A;  1GS3 A;  1OF5 A;  1OCV A;  4GB5 A;  2QGU A;  1IDP A;  3DM8 A;  1OGZ A;  3LZA A;  3NV0 B;  1JB5 A;  2HMJ B;  1GYB A;  1Q40 A;  1ZO2 A;  4WYK A;  2F98 A;  3DZL A;  1WQL B;  1DMM A;  1Z1S A;  1E97 A;  4HM4 B;  1JN5 A;  5TGN A;  3EC9 A;  3MG1 A;  1W02 A;  2GEY A;  2YFL B;  4KVH A;  5IG5 A;  1W01 A;  6STD A;  1Q42 A;  3I0Y A;  3GZR A;  3VSY A;  3CNX A;  2RGQ A;  5CK6 A;  1A2K A;  5AIG A;  1GY5 A;  5JPU A;  5KP4 A;  5BXQ A;  3FGY A;  1OUN A;  2HMN B;  3G0K A;  2B24 B;  4HKV B;  2RFR A;  1UUW B;  1NU3 A;  3F14 A;  1OH0 A;  2K54 A;  1O7W B;  4WP5 A;  1ASK A;  1ZX2 A;  3EF8 A;  3B8L A;  8CHO A;  2GEX A;  3SOA A;  4HM6 B;  3UNL A;  3JUQ A;  2W2C A;  1OF5 B;  3FKA A;  2B1X B;  5JPP A;  2BMR B;  2Z77 A;  1EA2 A;  4CDL A;  3G8Z A;  2F86 B;  1CQS A;  3H51 A;  5AEU B;  2CHC A;  1Q40 B;  3KZT A;  4XDW A;  4WYK B;  3BLZ A;  5IG3 A;  3GZY B;  1S5A A;  5IEN A;  1JN5 B;  2BMQ B;  3H3H A;  3EN1 B;  3F9S A;  3BB9 A;  2XRX B;  5IG4 A;  4XM4 A;  3NHX A;  3NBR A;  5CF1 A;  2OWP A;  3Q90 A;  4L7K A;  2XSO B;  3F7S A;  3F8X A;  2QIY A;  4HM7 B;  3EX9 A;  1O7M B;  5IG0 A;  5D82 A;  4MJD A;  1NWW A;  2INX A;  1OGX A;  4HZB B;  2BMO B;  2HMO B;  3EJV A;  3GRD A;  3M8C A;  5CXO A;  2Z76 A;  1JKG B;  5STD A;  2BNG A;  3HK4 A;  4XBY A;  2YFI B;  4U13 A;  3RGA A;  5AII A;  4HM0 B;  3OWU A;  1TP6 A;  1U5O A;  1ULJ B;  2HMM B;  3D9R A;  1AR0 A;  5AI1 A;  3MHE A;  1K41 A;  3FF2 A; 
#chains in the Genus database with same CATH topology
 3EBT A;  3WA3 A;  2RBI A;  5HOH A;  2RSX A;  3OX9 A;  2FNQ A;  1EEJ A;  1YIJ 3;  1B27 A;  1RCL A;  1LOY A;  1HYF A;  1W4N A;  3FLJ A;  2E2T A;  3OV4 A;  4OVM A;  1GSP A;  3KE7 A;  1O7H B;  3DGN A;  3LT9 A;  5AEW B;  2I9W A;  1A2P A;  2ML5 A;  3CD6 3;  1B2S A;  2J8X B;  2OTJ 3;  1YHQ 3;  3KSP A;  2K0M A;  3BNC A;  3MG2 A;  3QK9 A;  2O9U X;  2W9Q A;  2Z7A A;  2CWU A;  1L5G B;  1TJD A;  2W0Q A;  2CKF B;  1RLS A;  4HM5 B;  1QJG A;  2SAR A;  2V1L A;  2C10 A;  1U8C B;  1BAO A;  1IT8 A;  1VQM 3;  2Y74 A;  1Q9E A;  3NM2 A;  3GZB A;  4G1M B;  1GMP A;  2KF5 A;  1FGO A;  1UI8 A;  3HIG A;  3ZFZ A;  4X2O A;  3N8B A;  1RMS A;  5LC7 A;  3S67 A;  1BAN A;  4L8P A;  1RDS A;  5BU4 A;  1YI2 3;  4OK0 A;  5DRE A;  8RNT A;  1OPY A;  4J9A A;  2P09 A;  1GD3 A;  1UI7 A;  3JVC A;  1ULI B;  2E2U A;  3B4P A;  1VQO 3;  3DGL A;  2H0I A;  1RN4 A;  3F40 A;  4XDV A;  1LNH A;  1D6Z A;  2XH9 A;  1BSD A;  2BO9 B;  3ECF A;  2Z6B A;  3MSO A;  3MYT A;  3NQY A;  2CG0 A;  2UUG C;  1RTU A;  4HM3 B;  3STD A;  1C7H A;  3SED A;  3G16 A;  3SVA A;  1IQ8 A;  3D4A A;  3K63 A;  2O3O A;  1RCK A;  2CFK A;  4WFO A;  3ALA A;  4CJN A;  5EVH A;  3F7X A;  1JZO A;  4LYL B;  2K3D A;  1CYU A;  4R9L A;  1IYY A;  4STD A;  1ZGX A;  1SAR A;  4FMC A;  1B20 A;  4EC6 A;  2XR8 B;  5CF2 A;  2LQV A;  3FG1 A;  2XSH B;  4HAA A;  4PEJ A;  4N3V A;  1FYS A;  1HZ1 A;  5IF6 A;  2CX0 A;  3NUV A;  3WOE B;  1HKX A;  1KC8 4;  1WMP A;  1FUT A;  2UX0 A;  3KN4 A;  2XF3 A;  4HVN A;  2AAD A;  3FSD A;  1MWR A;  1UCI A;  3NM7 A;  3KKG A;  1N5H A;  1JZD A;  1IV7 A;  3FF0 A;  1K73 4;  3AMO B;  1RGC A;  1V58 A;  1NB3 I;  1X1U A;  4N6U A;  3E99 A;  5DRV A;  3CC4 3;  3A76 A;  3AGN A;  1STD A;  4EV5 A;  2MC8 A;  3RDE A;  1IV9 A;  1SPU A;  1PU4 A;  2P0M A;  3DGY A;  3FG4 A;  3LTA A;  2Q07 A;  3K9M C;  3NXJ A;  3Q3F A;  1RJO A;  3JUP A;  4R9K A;  3LTB A;  1VQ6 3;  5M19 A;  2FXT A;  1VQ8 3;  2YFJ B;  4H3U A;  1JB4 A;  1E3R A;  1TFK A;  1B2Z A;  4L8O A;  4XBX A;  3J7Y d;  2OTL 3;  3BNE A;  3NBB A;  4XBT A;  3MPH A;  1FW7 A;  1I2G A;  3EHC A;  4HM1 B;  1US1 A;  1V74 A;  3DGM A;  2KAA A;  1JBS A;  2F99 A;  3GZX B;  1I0V A;  3HZP A;  1O7N B;  1BIR A;  1IVV A;  3A5E A;  2PZV A;  1GY7 A;  4O8S A;  1AVL A;  4LGQ A;  2GBW B;  1NB5 I;  4MEI A;  1JB2 A;  4R1K A;  3B7C A;  3EN8 A;  2RCD A;  5IEP A;  4FCM A;  1TUH A;  3MG3 A;  1MGW A;  4ZM8 A;  2P38 A;  2LYX A;  4HJL B;  1O7P B;  1IK3 A;  3CCU 3;  4FR9 A;  3GWR A;  5BVB A;  2ZDJ A;  4RBN A;  1SJW A;  2IUK A;  1JBT A;  3K5T A;  5IER A;  4QWT A;  1TRP A;  2CC3 A;  2IMJ A;  1F8N A;  2FGT A;  3SOY A;  1RGF A;  1VZZ A;  3DGO A;  3F8H A;  4HM8 B;  1K9M 4;  1YNV X;  3SX1 A;  1JBR A;  1ROV A;  4BL3 A;  2HOH A;  1X1W A;  1T2H A;  3LTC A;  5IEO A;  3K7C A;  3ZG0 A;  1BUQ A;  4KFD A;  1C54 A;  2BT3 A;  3HX8 A;  3OWY A;  3CCS 3;  3MKI A;  1NO3 A;  1Q86 4;  1YGE A;  3JUN A;  3EQQ B;  1BNF A;  1I2F A;  2XFS A;  1VQ4 3;  1BRJ A;  2CWV A;  5RNT A;  1KD1 4;  5LC6 A;  4LMI A;  1VQK 3;  3FG3 A;  3D5I A;  3TDG A;  3IJE B;  3UL5 A;  1EKM A;  2ZHX B;  3PYJ A;  3DUK A;  2OQE C;  3RNT A;  3CNM A;  1DMN A;  1DVD A;  4HM2 B;  5D83 A;  1BVI A;  1UUV B;  3DY5 A;  5CLK A;  1W00 A;  2STD A;  4TX4 A;  4DKI A;  3K0Z A;  4NHF A;  3ER7 A;  3RGR A;  1WMN A;  1EG9 B;  1BOX A;  2C11 A;  4FMD A;  1TRQ A;  1V57 A;  3GSP A;  4OUQ A;  3UB1 A;  5GSP A;  2CFD A;  4IT7 A;  4KFF A;  2CK3 H;  2F56 A;  2W03 A;  3WOF B;  1MWT A;  2C4B A;  1VQQ A;  2IYJ A;  2KF4 A;  3X42 A;  1KSI A;  7STD A;  2IUJ A;  5KP1 A;  4K1U A;  2R41 A;  3WMD A;  1W5Z A;  2A15 A;  1DYU A;  2GBX B;  1FGM A;  3X41 A;  3LYG A;  1K28 A;  1E3V A;  1B2X A;  2JQ5 A;  4NRE A;  1YGW A;  4IIA A;  1W2Z A;  3S29 A;  5ELU A;  4EXR A;  4O02 B;  4HZ9 B;  1LOW A;  2CH9 A;  1HU9 A;  3OXA A;  3KFQ C;  1RGK A;  1OAC A;  1RGL A;  5EEO A;  1DMQ A;  4JF8 A;  2WGO A;  4RNT A;  2KCD A;  2BHM A;  2W56 A;  1AV4 A;  4GSP A;  1TIJ A;  4AKZ A;  4R4K A;  1BRK A;  4CPK A;  3T8N A;  3VGN A;  3NV0 A;  1UCJ A;  2L4V A;  1OHS A;  1LRA A;  3L0R A;  5ELJ A;  4ORL A;  1MWS A;  4IPB A;  2GSP A;  2L1S A;  4K1V A;  5FW5 A;  4J8T A;  1JKG A;  1O7G B;  4O3V A;  3CME 3;  1G0T A;  3BU4 A;  1D6U A;  1YIT 3;  1BNI A;  3FH1 A;  5IW9 A;  1RGH A;  2ML6 A;  1FGT A;  1TTO A;  2R4I A;  2BIR A;  1S72 3;  1SIH A;  1CEW I;  1UDI I;  2M7O A;  5D81 A;  1NDO B;  4EV2 A;  1N9E A;  3CPO A;  9RNT A;  3G71 3;  3CPW 2;  1LOV A;  1A67 A;  3EBY A;  1RGE A;  1JJ2 2;  1RNB A;  1PFP A;  5EQL A;  3CCJ 3;  4KFE A;  5AIF A;  1M1K 4;  2HMK B;  3MWZ A;  3UJM A;  2H0G A;  1DET A;  1W6Y A;  3B4O A;  1FZU A;  1OHO A;  4XB5 A;  1VQ7 3;  2WO0 A;  3CCE 3;  3CCQ 3;  3X3X A;  1FGR A;  5AYR B;  1TU5 A;  3PXM A;  2CIU A;  3FZW A;  4LEH A;  3OW2 2;  1W6G A;  2AAE A;  1BRG A;  3V99 A;  2CFL A;  3JUO A;  3NQZ A;  3IPT A;  1QAK A;  3OWS A;  2GXF A;  2Y73 A;  3HOH A;  3AGO A;  4H61 A;  2P05 A;  4N6V 0;  1EUI C;  3S5C A;  3T8U A;  3PZW A;  3UL6 A;  4RZM A;  3SXX A;  1BRN L;  2CX1 A;  1RRH A;  1RN7 A;  1OHP A;  4BU4 A;  3CCV 3;  4I4K A;  1BU4 A;  5AIH A;  3ZG5 A;  4WWU C;  1M9G A;  2WOF A;  1IQX A;  1BRI A;  3JUM A;  3DMC A;  3ROB A;  1GD4 A;  4KT3 B;  4N6N B;  1VQP 3;  3CU3 A;  1AY7 A;  1AQZ A;  4RNY A;  1Q81 4;  3Q1C A;  5KP3 A;  3DXO A;  4X2H A;  1RKY A;  4FCJ A;  1GY6 A;  1ISK A;  3NX0 A;  1Q7Y 4;  1UCL A;  2QEX 3;  1YJN 3;  3X3Z A;  1QMA A;  5HGR A;  1BNJ A;  1RRL A;  1X1X A;  5BIR A;  1X1Y A;  2HML B;  4FCZ A;  5G2G A;  1BNE A;  4Q53 A;  3URP A;  1GS3 A;  2H0H A;  2W56 B;  5AYS C;  1G96 A;  1OF5 A;  3N54 B;  1GMR A;  4KZ1 A;  2D1W A;  1OCV A;  4GB5 A;  4WHA A;  2KRT A;  2QGU A;  3LH4 A;  1QVG 2;  1M90 4;  2OOV A;  2ZL8 A;  4ILF A;  4GL6 A;  3T0U A;  1IDP A;  1BSA A;  2ZA4 A;  3DM8 A;  1OGZ A;  1IQY A;  3HI7 A;  1BRS A;  3KII A;  3LZA A;  3NV0 B;  1JB5 A;  4J5K A;  3WOD G;  2QA4 3;  1B2U A;  1B3S A;  1AVK A;  1GOV A;  3PS8 A;  4R80 A;  1KWI A;  2HMJ B;  2CFW A;  1N8R 4;  1Q82 4;  1GOY A;  1BNS A;  1WTH A;  3AMO A;  6GSP A;  1GYB A;  1Q40 A;  1WMO A;  1YJ9 3;  1ZO2 A;  4JRF A;  4J5G A;  1RGG A;  4BIR A;  4WYK A;  1FUW A;  1IVX A;  2F98 A;  3DZL A;  2CW9 A;  1I3I A;  1WQL B;  2YX9 A;  1DMM A;  1ZS7 A;  1Z1S A;  1E97 A;  4HM4 B;  1JN5 A;  4LSO A;  3CCR 3;  4K61 A;  3GAX A;  2KF3 A;  3EC9 A;  3MG1 A;  3DH2 A;  5TGN A;  1K8A 4;  4N6L A;  1W02 A;  2GEY A;  2YFL B;  4KVH A;  5IG5 A;  1W01 A;  1LQM B;  2KF6 A;  5FGO A;  6STD A;  1N8Q A;  3X40 A;  1Q42 A;  3WHO A;  3V92 A;  3I0Y A;  3GZR A;  3QRD A;  3VSY A;  1J2B A;  1LXE A;  3VF1 A;  3CNX A;  1GMQ A;  1UGH I;  1CYV A;  2RGQ A;  5I97 A;  5CK6 A;  1MGR A;  3CXC 2;  1A2K A;  1Q7H A;  4MMY B;  5AIG A;  5A0O B;  5JBS A;  3IMA B;  1GY5 A;  1BNG A;  2PNC A;  3LOY A;  3CCL 3;  5JPU A;  1IT7 A;  1JNQ A;  3PCS A;  4BTW A;  2F5W A;  3D3L A;  2IY2 A;  3HII A;  1STF I;  5KP4 A;  5BXQ A;  3CCM 3;  3KSE D;  2JDI H;  3LXU X;  3FGY A;  1OUN A;  1SQW A;  2HMN B;  2P0X A;  3G0K A;  4N6M A;  2WOH A;  1DE3 A;  1QAL A;  4MMX B;  1I0X A;  1BRH A;  1I3F A;  1M1X B;  1MOL A;  2BU4 A;  3SYU A;  4EBG A;  3I56 3;  1B2M A;  5M18 A;  2B24 B;  4N6T A;  4HKV B;  2OQE A;  2RFR A;  1UUW B;  1NU3 A;  1UGI A;  3F14 A;  1OH0 A;  2K54 A;  4O2H A;  2CG1 A;  1UCK A;  1O7W B;  4WP5 A;  1ASK A;  1MNL A;  1ZX2 A;  4EW5 A;  3EF8 A;  3B8L A;  2XGN A;  1BSC A;  8CHO A;  2GEX A;  3SOA A;  4HM6 B;  3UNL A;  3Q2P A;  2UGI A;  2IA7 A;  3JUQ A;  3N9H A;  4K90 B;  1T5Y A;  1VQ9 3;  3CMA 3;  1IU7 A;  2W2C A;  1LQG C;  3U97 A;  1OF5 B;  3FKA A;  1RHL A;  2SBL A;  2B1X B;  1R4Y A;  1DVC A;  1SII A;  3EB8 A;  3EE1 A;  4EYC A;  5JPP A;  2BMR B;  2Z77 A;  3S27 A;  1EA2 A;  7GSP A;  1BUJ A;  1N5P A;  3LT8 A;  1YVS A;  3G8Z A;  4NPB A;  4CDL A;  3WA2 X;  2F86 B;  2XFT A;  1CQS A;  4FMA A;  1IVU A;  1JRQ A;  1UW1 A;  3H51 A;  3O8Y A;  5G1L A;  3U1W A;  5AEU B;  1A90 A;  2CHC A;  3SLU A;  1LNI A;  1Q40 B;  3KZT A;  4XDW A;  1CH0 A;  1QAF A;  1VQN 3;  4WYK B;  5M1A A;  2D42 A;  3BNB A;  1VQL 3;  3BLZ A;  5IG3 A;  3G6E 3;  3AHS A;  1BGS A;  3GZY B;  1I8V A;  1S5A A;  1W6C A;  5IEN A;  4GHO A;  4AKY A;  1W7C A;  1JN5 B;  2BMQ B;  3H3H A;  3EN1 B;  3F9S A;  2W04 A;  1TFO A;  2F5M A;  3BB9 A;  1UUG B;  2XRX B;  4MMZ B;  5IG4 A;  3LML A;  3I55 3;  1FA3 A;  2W9P A;  2XGL A;  2OOV C;  1A2V A;  4BTY A;  1T2I A;  3D79 A;  2CWT A;  1YJW 3;  4XM4 A;  3NHX A;  4N6O B;  4I5Q A;  4HBR A;  3V98 A;  3G4S 3;  1JV2 B;  2W6J H;  3NBR A;  5CF1 A;  2OWP A;  4AEQ A;  3Q90 A;  1T3B A;  3PCR A;  1I2E A;  4L7K A;  2XSO B;  3F7S A;  3F8X A;  2MF7 A;  2QIY A;  4HM7 B;  2XEP A;  2E2V A;  1RNT A;  1PY3 A;  2KXG A;  3EX9 A;  1FUS A;  3S28 A;  4HOH A;  1O7M B;  5IG0 A;  5D82 A;  1EQK A;  4MJD A;  1MWU A;  1W2B 2;  1NWW A;  2INX A;  1GOU A;  3NBJ A;  1BSE A;  1I70 A;  1OGX A;  2RNT A;  1YVB I;  1RN1 A;  1NJI 4;  4HZB B;  1FGQ A;  1KQS 2;  2BMO B;  3X3Y A;  1LOX A;  2HMO B;  3EJV A;  3GRD A;  3M8C A;  5CXO A;  1PYL A;  3BIR A;  3WR2 A;  1ROA A;  4BL2 A;  1B21 A;  3WDG B;  2Z76 A;  1JKG B;  1Y4K A;  3BND A;  3FCS B;  3KCH A;  3LTD A;  5STD A;  2BNG A;  3AHW A;  4HYZ A;  6RNT A;  3HK4 A;  4XBY A;  2YFI B;  1LVN A;  2GU3 A;  1G02 A;  2CFG A;  4U13 A;  3CC2 3;  5G1K A;  2OCT A;  3RGA A;  4BTX A;  1VQ5 3;  1WNH A;  5AII A;  1RSN A;  4HM0 B;  7RNT A;  1NNV A;  2WGQ A;  1N9J A;  1QVF 2;  3OWU A;  1R4C A;  2F4Y A;  3CC7 3;  1TP6 A;  1D6Y A;  3D5G A;  1U5O A;  1ULJ B;  2HMM B;  1RGA A;  3D9R A;  4FMB A;  1BSB A;  1AR0 A;  2GU1 A;  4LZI A;  5AI1 A;  3MHE A;  4RNZ A;  1BNR A;  3PGB A;  4CCV A;  1K41 A;  3FF2 A;  1IVW A; 
#chains in the Genus database with same CATH homology
 3EBT A;  3WA3 A;  2RSX A;  3OX9 A;  2FNQ A;  1YIJ 3;  1W4N A;  3FLJ A;  2E2T A;  3OV4 A;  4OVM A;  3KE7 A;  1O7H B;  3DGN A;  3LT9 A;  5AEW B;  2I9W A;  2ML5 A;  3CD6 3;  2OTJ 3;  1YHQ 3;  3KSP A;  2K0M A;  3BNC A;  3MG2 A;  3QK9 A;  2O9U X;  2W9Q A;  2Z7A A;  2CWU A;  2W0Q A;  2CKF B;  4HM5 B;  1QJG A;  2V1L A;  2C10 A;  1U8C B;  1IT8 A;  1VQM 3;  2Y74 A;  3NM2 A;  3GZB A;  4G1M B;  1FGO A;  1UI8 A;  3HIG A;  4X2O A;  3N8B A;  5LC7 A;  3S67 A;  4L8P A;  1YI2 3;  4OK0 A;  5DRE A;  1OPY A;  4J9A A;  2P09 A;  1GD3 A;  1UI7 A;  3JVC A;  1ULI B;  2E2U A;  3B4P A;  1VQO 3;  3DGL A;  3F40 A;  4XDV A;  1LNH A;  1D6Z A;  2XH9 A;  2BO9 B;  3ECF A;  1L5G B;  2Z6B A;  3MSO A;  3MYT A;  3NQY A;  2CG0 A;  4HM3 B;  3STD A;  5I97 A;  1C7H A;  3SED A;  3G16 A;  3SVA A;  1IQ8 A;  3K63 A;  2O3O A;  2CFK A;  4WFO A;  3ALA A;  5EVH A;  3F7X A;  1CYU A;  4R9L A;  4STD A;  4FMC A;  4EC6 A;  2XR8 B;  5CF2 A;  2LQV A;  3FG1 A;  2XSH B;  4PEJ A;  4N3V A;  5IF6 A;  1KC8 4;  3NUV A;  3WOE B;  1HKX A;  1WMP A;  2UX0 A;  3KN4 A;  2XF3 A;  4HVN A;  3FSD A;  3NM7 A;  3KKG A;  1N5H A;  1K73 4;  1IV7 A;  3FF0 A;  3AMO B;  1NB3 I;  4N6U A;  3E99 A;  5DRV A;  3CC4 3;  3A76 A;  1STD A;  4EV5 A;  2MC8 A;  3RDE A;  1IV9 A;  1SPU A;  1PU4 A;  2P0M A;  3FG4 A;  3LTA A;  2Q07 A;  3K9M C;  3NXJ A;  1RJO A;  3JUP A;  4R9K A;  3LTB A;  1VQ6 3;  2FXT A;  1VQ8 3;  2YFJ B;  4H3U A;  1JB4 A;  1E3R A;  1TFK A;  4L8O A;  4XBX A;  2OTL 3;  3J7Y d;  3BNE A;  3NBB A;  4XBT A;  3MPH A;  3EHC A;  4HM1 B;  1US1 A;  1V74 A;  3DGM A;  2F99 A;  3GZX B;  3HZP A;  1O7N B;  1IVV A;  2PZV A;  1GY7 A;  4O8S A;  1AVL A;  4LGQ A;  2GBW B;  1NB5 I;  4MEI A;  1JB2 A;  4R1K A;  3B7C A;  3EN8 A;  2RCD A;  5IEP A;  4FCM A;  1TUH A;  3MG3 A;  4ZM8 A;  2P38 A;  2LYX A;  4HJL B;  1O7P B;  1IK3 A;  3CCU 3;  4FR9 A;  3GWR A;  5BVB A;  2ZDJ A;  4RBN A;  2IUK A;  1SJW A;  3K5T A;  5IER A;  4QWT A;  2CC3 A;  2IMJ A;  1F8N A;  2FGT A;  3SOY A;  1VZZ A;  3F8H A;  3DGO A;  4HM8 B;  1K9M 4;  3SX1 A;  1ROV A;  3LTC A;  5IEO A;  3K7C A;  1BUQ A;  4KFD A;  2BT3 A;  3HX8 A;  3OWY A;  3CCS 3;  3MKI A;  1NO3 A;  1Q86 4;  1YGE A;  3JUN A;  3EQQ B;  2XFS A;  1VQ4 3;  2CWV A;  1KD1 4;  5LC6 A;  4LMI A;  1VQK 3;  3FG3 A;  3TDG A;  3IJE B;  3UL5 A;  1EKM A;  3PYJ A;  3DUK A;  2OQE C;  3CNM A;  1DMN A;  1DVD A;  4HM2 B;  5D83 A;  1UUV B;  3DY5 A;  5CLK A;  1W00 A;  2STD A;  4TX4 A;  3K0Z A;  4NHF A;  3ER7 A;  3RGR A;  1WMN A;  1EG9 B;  2C11 A;  4FMD A;  4OUQ A;  3UB1 A;  2CFD A;  4IT7 A;  4KFF A;  2CK3 H;  3WOF B;  2W03 A;  3X42 A;  1KSI A;  7STD A;  2IUJ A;  5KP1 A;  4K1U A;  3WMD A;  1W5Z A;  2A15 A;  1DYU A;  2GBX B;  1FGM A;  3X41 A;  3LYG A;  1K28 A;  1E3V A;  4NRE A;  2JQ5 A;  3S29 A;  4IIA A;  1W2Z A;  4EXR A;  5ELU A;  4O02 B;  4HZ9 B;  2CH9 A;  1HU9 A;  3OXA A;  3KFQ C;  1OAC A;  5EEO A;  1DMQ A;  4JF8 A;  2WGO A;  2KCD A;  2BHM A;  2W56 A;  1AV4 A;  1TIJ A;  4AKZ A;  4R4K A;  3T8N A;  3VGN A;  3NV0 A;  2L4V A;  1OHS A;  3L0R A;  5ELJ A;  4ORL A;  4IPB A;  5FW5 A;  4K1V A;  4J8T A;  1JKG A;  1O7G B;  4O3V A;  3CME 3;  1D6U A;  1YIT 3;  3FH1 A;  5IW9 A;  2ML6 A;  1FGT A;  2R4I A;  1S72 3;  1SIH A;  1CEW I;  2M7O A;  5D81 A;  1NDO B;  4EV2 A;  1N9E A;  3CPO A;  3G71 3;  3CPW 2;  1A67 A;  3EBY A;  1JJ2 2;  1PFP A;  5EQL A;  3CCJ 3;  4KFE A;  5AIF A;  1M1K 4;  2HMK B;  3MWZ A;  3UJM A;  1W6Y A;  3B4O A;  4XB5 A;  1OHO A;  1VQ7 3;  2WO0 A;  3CCE 3;  3X3X A;  1FGR A;  5AYR B;  1TU5 A;  3PXM A;  2CIU A;  3FZW A;  4LEH A;  3OW2 2;  1W6G A;  3V99 A;  2CFL A;  3JUO A;  3NQZ A;  3IPT A;  1QAK A;  3OWS A;  2GXF A;  2Y73 A;  4H61 A;  2P05 A;  4N6V 0;  3S5C A;  3T8U A;  3PZW A;  3UL6 A;  4RZM A;  3SXX A;  1RRH A;  1RN7 A;  1OHP A;  3CCV 3;  4I4K A;  5AIH A;  4WWU C;  1M9G A;  2WOF A;  1IQX A;  3JUM A;  3ROB A;  3DMC A;  1VQP 3;  1GD4 A;  4N6N B;  3CU3 A;  4RNY A;  1Q81 4;  3Q1C A;  5KP3 A;  3DXO A;  4X2H A;  1RKY A;  4FCJ A;  1GY6 A;  1ISK A;  3NX0 A;  1Q7Y 4;  2QEX 3;  1YJN 3;  3X3Z A;  1QMA A;  5HGR A;  1RRL A;  2HML B;  4FCZ A;  5G2G A;  4Q53 A;  1GS3 A;  2W56 B;  5AYS C;  1G96 A;  1OF5 A;  3N54 B;  4KZ1 A;  2D1W A;  1OCV A;  4GB5 A;  4WHA A;  2KRT A;  2QGU A;  3LH4 A;  1QVG 2;  1M90 4;  2OOV A;  2ZL8 A;  4GL6 A;  3T0U A;  1IDP A;  3DM8 A;  1OGZ A;  1IQY A;  3HI7 A;  3KII A;  3LZA A;  3NV0 B;  3WOD G;  1JB5 A;  2QA4 3;  3PS8 A;  1AVK A;  4R80 A;  1KWI A;  2HMJ B;  2CFW A;  1N8R 4;  1Q82 4;  1WTH A;  3AMO A;  1GYB A;  1Q40 A;  1WMO A;  1YJ9 3;  1ZO2 A;  4JRF A;  4WYK A;  1FUW A;  1IVX A;  2F98 A;  3DZL A;  2CW9 A;  1WQL B;  2YX9 A;  1DMM A;  1Z1S A;  1E97 A;  4HM4 B;  1JN5 A;  4LSO A;  3CCR 3;  4K61 A;  3GAX A;  5TGN A;  3EC9 A;  3MG1 A;  1K8A 4;  4N6L A;  1W02 A;  2GEY A;  2YFL B;  4KVH A;  5IG5 A;  1W01 A;  5FGO A;  6STD A;  3CCQ 3;  1N8Q A;  3X40 A;  1Q42 A;  3V92 A;  3I0Y A;  3GZR A;  3QRD A;  3VSY A;  1J2B A;  1LXE A;  3VF1 A;  3CNX A;  1CYV A;  2RGQ A;  5CK6 A;  3CXC 2;  1A2K A;  4MMY B;  5AIG A;  5A0O B;  5JBS A;  3IMA B;  1GY5 A;  2PNC A;  3LOY A;  3CCL 3;  5JPU A;  1IT7 A;  1JNQ A;  3PCS A;  4BTW A;  3D3L A;  3HII A;  1STF I;  5KP4 A;  5BXQ A;  3CCM 3;  3KSE D;  2JDI H;  3LXU X;  3FGY A;  1OUN A;  1SQW A;  2HMN B;  2P0X A;  3G0K A;  4N6M A;  2WOH A;  1QAL A;  4MMX B;  1M1X B;  1MOL A;  4EBG A;  3I56 3;  2B24 B;  4N6T A;  4HKV B;  2OQE A;  2RFR A;  1UUW B;  1NU3 A;  3F14 A;  1OH0 A;  2K54 A;  4O2H A;  2CG1 A;  1O7W B;  4WP5 A;  1ASK A;  1MNL A;  1ZX2 A;  3EF8 A;  3B8L A;  2XGN A;  8CHO A;  2GEX A;  3SOA A;  4HM6 B;  3UNL A;  3Q2P A;  2IA7 A;  3JUQ A;  3N9H A;  4K90 B;  1T5Y A;  1VQ9 3;  3CMA 3;  1IU7 A;  2W2C A;  3U97 A;  1OF5 B;  3FKA A;  2SBL A;  2B1X B;  1DVC A;  1SII A;  3EB8 A;  3EE1 A;  4EYC A;  5JPP A;  2BMR B;  2Z77 A;  3S27 A;  1EA2 A;  1N5P A;  3LT8 A;  4CDL A;  3G8Z A;  3WA2 X;  2F86 B;  2XFT A;  1CQS A;  4FMA A;  1IVU A;  1JRQ A;  1UW1 A;  3H51 A;  3O8Y A;  3U1W A;  5AEU B;  1A90 A;  2CHC A;  3SLU A;  1Q40 B;  3KZT A;  4XDW A;  1QAF A;  1VQN 3;  4WYK B;  1VQL 3;  2D42 A;  3BNB A;  3BLZ A;  5IG3 A;  3G6E 3;  3GZY B;  1S5A A;  1W6C A;  5IEN A;  4AKY A;  1W7C A;  1JN5 B;  2BMQ B;  3H3H A;  3EN1 B;  3F9S A;  2W04 A;  1TFO A;  3BB9 A;  4MMZ B;  3I55 3;  2XRX B;  5IG4 A;  3LML A;  1FA3 A;  2W9P A;  2XGL A;  2OOV C;  1A2V A;  4BTY A;  2CWT A;  1YJW 3;  4XM4 A;  3NHX A;  4N6O B;  4HBR A;  3V98 A;  3G4S 3;  1JV2 B;  2W6J H;  3NBR A;  5CF1 A;  2OWP A;  4AEQ A;  3Q90 A;  3PCR A;  4L7K A;  2XSO B;  3F7S A;  3F8X A;  2MF7 A;  2QIY A;  4HM7 B;  2XEP A;  2E2V A;  3EX9 A;  2KXG A;  3S28 A;  1O7M B;  5IG0 A;  5D82 A;  1EQK A;  4MJD A;  1W2B 2;  1NWW A;  2INX A;  3NBJ A;  1OGX A;  1YVB I;  1NJI 4;  4HZB B;  1FGQ A;  1KQS 2;  2BMO B;  3X3Y A;  1LOX A;  2HMO B;  3EJV A;  3GRD A;  3M8C A;  5CXO A;  1ROA A;  3WDG B;  2Z76 A;  1JKG B;  1Y4K A;  3BND A;  3FCS B;  3LTD A;  5STD A;  2BNG A;  4HYZ A;  3HK4 A;  4XBY A;  2YFI B;  1LVN A;  2GU3 A;  2CFG A;  4U13 A;  3CC2 3;  4BTX A;  2OCT A;  3RGA A;  1VQ5 3;  1WNH A;  5AII A;  4HM0 B;  2WGQ A;  1N9J A;  1QVF 2;  3OWU A;  1R4C A;  3CC7 3;  1TP6 A;  1D6Y A;  1U5O A;  1ULJ B;  2HMM B;  3D9R A;  4FMB A;  2GU1 A;  1AR0 A;  4LZI A;  5AI1 A;  3MHE A;  4RNZ A;  3PGB A;  4CCV A;  1K41 A;  3FF2 A;  1IVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...