3PXMA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKAIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Monellin chain B/Monellin chain A chimeric protein
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 22
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3pxmA00
3Q2PA 1DVCA 5ELJA 1FUWA 1IV9A 4CCVA 1CYUA 3UL5A 3KSED 3GAXA 1MOLA 1YVBI 1TIJA 2KXGA 1FA3A 1N5PA 4N6OB 1M9GA 1ROAA 4EYCA 1KWIA 1IV7A 1CEWI 5LC6A 2W9QA 3PS8A 5ELUA 2OCTA 1WNHA 1LXEA 3PYJA 1N5HA 1DVDA 1NB3I 3KFQC 1GD4A 1PFPA 4N6LA 3MWZA 3QRDA 4N6V0 1STFI 3PXMA 5EQLA 1A67A 1EQKA 3S67A 4N6TA 3K9MC 1MNLA 1R4CA 1RN7A 4IT7A 3LH4A 1GD3A 4TX4A 1A90A 1G96A 1N9JA 4ZM8A 3IMAB 2O9UX 3SVAA 1CYVA 2BO9B 3L0RA 5A0OB 2CH9A 3UL6A 2W9PA 3NX0A 1NB5I 4LZIA 4N6UA 4N6MA 4N6NB 5LC7A
chains in the Genus database with same CATH superfamily
2RSXA 3WA2X 3BIRA 4EW5A 3D5IA 2FNQA 1YIT3 1CH0A 1FUWA 1JKGA 3WA3A 8RNTA 1JBSA 1OH0A 5EEOA 1EG9B 2F86B 3BLZA 1QVF2 1CYUA 3CNXA 3UL5A 1S723 3CCL3 3D79A 3LTAA 3KSED 1B2UA 1V74A 3BU4A 1UI7A 1DMNA 1ZX2A 2CIUA 1TIJA 4K61A 4HBRA 1C54A 1B2XA 5BU4A 3VGNA 2CG1A 5JBSA 1LQGC 1B2SA 1OGXA 3LTCA 1RGLA 3JUOA 2AAEA 1US1A 1JJ22 1RGCA 2C4BA 3G8ZA 1TRPA 4N6OB 2M7OA 2WGOA 5JPUA 3FCSB 3PZWA 4EYCA 1PU4A 5CXOA 1CEWI 2QA43 1OHOA 3PS8A 1BU4A 3LT9A 3N8BA 2CK3H 2OCTA 3A5EA 3LZAA 4FMDA 3FG1A 5IW9A 4LSOA 5KP3A 1LXEA 1PYLA 3CMA3 1RRLA 2L1SA 1STDA 3FG4A 1TFKA 2CG0A 4EXRA 4GB5A 2Z77A 5M1AA 5M18A 3B8LA 2INXA 2CFWA 4ILFA 4R1KA 4HM0B 1JNQA 3F8HA 4QWTA 4U13A 1VQ53 4N6LA 1Q814 3ALAA 3K63A 2F98A 3MWZA 3NBJA 3G0KA 3S27A 1QVG2 1VQ83 4LEHA 1WMPA 2KF3A 1BANA 2CWUA 1L5GB 1VQ43 3VF1A 1RN4A 2KF6A 2QEX3 1D6YA 1JN5B 1LRAA 1WMNA 2H0GA 2YX9A 1MWUA 5AYSC 3CNMA 3KKGA 3S29A 1VQ93 2GBXB 1RGFA 1GY6A 3K9MC 5D81A 2OTJ3 2F5WA 1DE3A 3F8XA 2HMJB 1GMPA 1VQ73 3UNLA 5IERA 3HK4A 4HOHA 3LYGA 1CQSA 1BNEA 4G1MB 3NBBA 4TX4A 1UCIA 3I553 1DMMA 4O2HA 1ULIB 2GXFA 1N9JA 1RN1A 5AIGA 3ZG5A 2C11A 2R4IA 3Q3FA 1W7CA 4MJDA 3U97A 1K9M4 1UW1A 1SIHA 2KAAA 4JRFA 2WO0A 4XB5A 1BSEA 1T5YA 3H3HA 1G0TA 9RNTA 3DGNA 1IVXA 5IEOA 3OWUA 1LOYA 2W6JH 3EBYA 4K90B 1KQS2 1GY5A 3F14A 2XF3A 3CCS3 2BO9B 4DKIA 3S5CA 1AY7A 3O8YA 3DGYA 2BT3A 1VZZA 3CME3 3EE1A 3RGRA 2XFSA 1Q7HA 1RCLA 1VQL3 3OV4A 1W6CA 7RNTA 3CU3A 4OK0A 2CH9A 2OOVC 2W56A 3UL6A 1QJGA 2P09A 1YJN3 2UX0A 1G02A 3EBTA 5AEWB 2D42A 1JKGB 3SYUA 1OHSA 1X1YA 2GEYA 1A2VA 1RGHA 3X3YA 3CCE3 4MEIA 1DMQA 1LNHA 3LMLA 3T0UA 4H61A 3T8NA 1B21A 3JUNA 1GYBA 4N6NB 3DY5A 1BRGA 3MG3A 5STDA 5TGNA 4KFDA 2W2CA 5HOHA 1K8A4 1OUNA 3BNEA 3EN8A 3WOFB 1W2ZA 3LTDA 3NM7A 2RNTA 1O7MB 3X40A 1IU7A 3MSOA 1NO3A 3OXAA 5CF1A 1WMOA 4X2HA 4EV2A 3G16A 4PEJA 5IG4A 1FGTA 3CC23 1GOVA 3ZG0A 1O7WB 2Y73A 4WYKA 1BAOA 2CFGA 3V99A 3ZFZA 2CHCA 1MOLA 1YVBI 3SLUA 1TU5A 5G2GA 1DYUA 3WMDA 2K54A 2AADA 3DZLA 4KT3B 1IK3A 1N5PA 3DGLA 1IQYA 1BRIA 2XRXB 3EN1B 2K0MA 2CX0A 2CW9A 2XGNA 3K0ZA 2KRTA 1QMAA 1Q7Y4 3I0YA 2GU3A 3I563 2GBWB 1I0XA 1RDSA 4HZ9B 2XGLA 5AIFA 1ROAA 4AEQA 3NV0A 1M1XB 2Y74A 4CJNA 3CXC2 1FZUA 1RGKA 1U5OA 2KF4A 2WOFA 1GY7A 1R4YA 4HAAA 3LT8A 4J9AA 3AGNA 1Q824 1WNHA 3AMOA 4XBYA 1N5HA 1FW7A 3LOYA 3CCM3 1A2PA 4R9KA 4WWUC 3MYTA 7GSPA 2UGIA 4ORLA 3X42A 1RNTA 2Z7AA 3EHCA 1TJDA 1ISKA 3KFQC 4HM4B 5FW5A 3GZBA 4EV5A 1VQN3 1GS3A 4CDLA 4HM3B 1N8QA 1Q864 1IQXA 3SOYA 2K3DA 2OQEC 1YGEA 4N6V0 1V58A 3IPTA 1GOUA 5EQLA 1Z1SA 3X41A 2F56A 3S67A 4LYLB 1Q42A 2CFDA 2JDIH 2BIRA 3JVCA 1JRQA 4FCJA 1N8R4 1E3RA 1FGRA 1R4CA 1RN7A 1BNIA 2BHMA 4J5GA 4NPBA 2PZVA 2IMJA 3FH1A 2QIYA 1RHLA 2E2TA 3OX9A 1E97A 3HOHA 3RDEA 2GEXA 4XM4A 3B4OA 3KE7A 3K5TA 2KCDA 1D6ZA 3EC9A 3G4S3 1BSCA 3WR2A 1IT7A 3NM2A 1I2GA 1AR0A 3U1WA 2W0QA 1HKXA 3B7CA 3K7CA 5AIIA 3HIGA 2RCDA 4IIAA 1ZO2A 1AVKA 2R41A 4BTWA 2W56B 1CYVA 4NREA 2CX1A 1VQM3 1WQLB 1NJI4 1D6UA 3DMCA 1BRNL 2B1XB 4K1VA 4BL2A 4L8PA 1BNFA 4STDA 1YGWA 1V57A 1O7NB 2ZL8A 1RGEA 3BNDA 5A0OB 1OF5A 1RGAA 2YFIB 4R80A 1VQP3 4BTYA 1KD14 3FSDA 1OHPA 1VQK3 2ZA4A 3NX0A 1J2BA 5AIHA 3G713 1YI23 4CPKA 2HMOB 1N9EA 1GOYA 4NHFA 4FMBA 4L8OA 3F9SA 1RLSA 4N6UA 1LOXA 4WYKB 3DH2A 1GMRA 1C7HA 3EF8A 1AV4A 3MPHA 2MC8A 1T3BA 2YFLB 1NDOB 3GZXB 1A2KA 1DVCA 3Q2PA 3CC73 5AEUB 2OTL3 2BMRB 3JUPA 4HKVB 3DM8A 1RJOA 3V92A 1MWTA 3SXXA 4CCVA 2CC3A 3CPOA 5D83A 4KZ1A 3GRDA 4FCMA 3IJEB 3GAXA 1BOXA 3FLJA 1O7HB 1IVWA 2BMOB 5CF2A 1UUGB 2KXGA 1JBTA 1JBRA 2O3OA 2F4YA 2L4VA 3NV0B 3BB9A 3DXOA 1W6YA 3CC43 4HM8B 3T8UA 1MWRA 1UUWB 1FA3A 3Q1CA 1HZ1A 1UI8A 1W02A 1X1XA 2H0IA 1SJWA 2XR8B 3D4AA 4OUQA 3AMOB 2WGQA 3CCV3 5JPPA 2OQEA 4I5QA 2ML6A 1W01A 1NNVA 2LYXA 1BUQA 2JQ5A 2BU4A 3SX1A 1JV2B 1IV7A 4BL3A 1T2HA 1DETA 4FR9A 4GL6A 2HOHA 3NHXA 1LVNA 1M1K4 1YJW3 1B20A 3MHEA 3OW22 3CPW2 2HMMB 3CCQ3 1FUSA 2D1WA 1NB3I 4BU4A 1UCKA 1Q40A 1LOWA 1YJ93 4GHOA 1GD4A 1EEJA 1PFPA 2Z76A 3DGMA 3NQYA 3NQZA 3NXJA 1VQO3 1BRSA 1EKMA 1I2EA 1NWWA 1UDII 3ER7A 3QK9A 5FGOA 3QRDA 3X3XA 1W2B2 3AHWA 3Q90A 2RBIA 1IQ8A 3D3LA 3GWRA 4LMIA 1B3SA 1ULJB 2RGQA 1RRHA 1UGIA 3FKAA 1STFI 1O7PB 3SOAA 1YVSA 2XFTA 1UUVB 4MMZB 5IG5A 1A67A 1B2ZA 4KFEA 5D82A 4WHAA 2ZDJA 4HM7B 2P0MA 4O02B 1T2IA 1FGOA 1TUHA 2XEPA 5RNTA 3TDGA 5BXQA 5IENA 2SARA 3KIIA 4AKZA 1ROVA 4IT7A 2BMQB 1S5AA 6STDA 1RNBA 1BIRA 3NBRA 3LH4A 4I4KA 3KSPA 3UB1A 1I3FA 4IPBA 1I8VA 3NUVA 2KF5A 3F40A 3RGAA 3PCSA 4R9LA 4L7KA 1KC84 1JB2A 1MGRA 2V1LA 1RSNA 3FF0A 3X3ZA 3FG3A 4JF8A 2XH9A 5GSPA 1UCLA 3IMAB 2OWPA 1OPYA 4RNZA 1B27A 2O9UX 2W04A 1OF5B 1BSDA 5EVHA 3LTBA 5M19A 1IVVA 2GSPA 1WTHA 1JB4A 1QAKA 1SPUA 1W00A 4XBTA 1BSAA 1SARA 1OGZA 5KP4A 1Y4KA 2CKFB 2LQVA 4H3UA 4O3VA 2J8XB 4X2OA 1BNJA 1F8NA 1FGMA 1Q9EA 1JB5A 3OWSA 4R4KA 2B24B 3GZYB 3JUMA 4RZMA 3CCJ3 4HYZA 4RNTA 5DRVA 1RTUA 1IVUA 1EUIC 4XBXA 2OOVA 3GZRA 2W9PA 1I70A 3HZPA 1FYSA 2C10A 3AHSA 4OVMA 1YHQ3 3CCU3 1SQWA 1QALA 1MGWA 1BRKA 3N9HA 5AI1A 7STDA 4N6MA 1ZGXA 3MG2A 4BTXA 5LC7A 4RBNA 3STDA 2ML5A 5ELJA 3S28A 5HGRA 2STDA 2I9WA 3CD63 1YIJ3 4WFOA 1IV9A 1RCKA 3ROBA 1W6GA 3A76A 2A15A 2W03A 3WHOA 5IEPA 4HM6B 2GU1A 3HI7A 3EQQB 3HIIA 3OWYA 4LGQA 3WOEB 2PNCA 2IA7A 5IF6A 4AKYA 3F7SA 1AVLA 2CWVA 2CFLA 3JUQA 4J5KA 3DGOA 2P05A 4HM5B 5DREA 3B4PA 1M9GA 2P0XA 2ZHXB 3BNCA 3EX9A 4XDVA 4HM2B 1FUTA 2F99A 3WDGB 3D5GA 1KWIA 1K28A 1RMSA 2E2UA 2QGUA 1Q40B 2W9QA 2RFRA 5LC6A 1K41A 1IDPA 1YNVX 2HMLB 5ELUA 5IG0A 4K1UA 3DUKA 1TTOA 3PYJA 1DVDA 4HM1B 1QAFA 1JZOA 2E2VA 2YFJB 2FGTA 4HZBB 2HMNB 1BRHA 1PY3A 3RNTA 1IYYA 1LNIA 5G1LA 1GMQA 3PGBA 1HU9A 3UJMA 3J7Yd 4HJLB 1BNGA 1X1UA 3KCHA 4KFFA 3ECFA 8CHOA 6GSPA 1KSIA 2P38A 3HX8A 1MWSA 3PXMA 1I0VA 1TRQA 5CK6A 1LQMB 1EQKA 3H51A 4KVHA 4N6TA 5IG3A 1OACA 3D9RA 1MNLA 5G1KA 3G6E3 3F7XA 1VQ63 2FXTA 1SIIA 3LXUX 4FMAA 1NU3A 1EA2A 3EJVA 1K734 1BNRA 1BUJA 1M904 1BSBA 1RGGA 3EB8A 5CLKA 1BRJA 3FGYA 1GD3A 1I3IA 1E3VA 1JN5A 1O7GB 2Q07A 6RNTA 3AGOA 1ZS7A 1A90A 3VSYA 3KZTA 1TFOA 1G96A 4N3VA 2CWTA 1I2FA 1LOVA 3KN4A 4MMYB 4HVNA 4ZM8A 2IUJA 3URPA 2XSHB 2H0HA 1UGHI 4EBGA 5KP1A 4O8SA 4RNYA 3WODG 5BVBA 1FGQA 3SVAA 2MF7A 1BGSA 4Q53A 3M8CA 2SBLA 3V98A 1AQZA 3MG1A 1VQQA 1BNSA 2XSOB 5BIRA 2WOHA 2HMKB 2IYJA 3L0RA 3MKIA 5I97A 3BNBA 3SEDA 1ASKA 1HYFA 3PCRA 4GSPA 4EC6A 1JZDA 4FCZA 4J8TA 2F5MA 3CCR3 3FF2A 1IT8A 2IUKA 1RKYA 3E99A 1OCVA 1TP6A 1BVIA 3N54B 4XDWA 1U8CB 4MMXB 1NB5I 2BNGA 2UUGC 1W5ZA 4FMCA 1B2MA 1X1WA 2CFKA 4BIRA 2IY2A 2Z6BA 4LZIA 4WP5A 3GSPA 5AYRB 1GSPA 3FZWA 1W4NA 1UCJA
chains in the Genus database with same CATH topology
2RSXA 3WA2X 1YIT3 2FNQA 1FUWA 1JKGA 3WA3A 1OH0A 5EEOA 1EG9B 2F86B 3BLZA 1QVF2 1CYUA 3CNXA 3UL5A 1S723 3CCL3 3LTAA 3KSED 1V74A 1UI7A 1DMNA 1ZX2A 2CIUA 1TIJA 4K61A 4HBRA 3VGNA 2CG1A 5JBSA 1OGXA 3LTCA 3JUOA 1US1A 1JJ22 3G8ZA 4N6OB 2M7OA 2WGOA 5JPUA 3FCSB 3PZWA 4EYCA 1PU4A 5CXOA 1CEWI 2QA43 1OHOA 3PS8A 3LT9A 3N8BA 2CK3H 2OCTA 3LZAA 4FMDA 3FG1A 5IW9A 4LSOA 5KP3A 1LXEA 3CMA3 1RRLA 1STDA 3FG4A 1TFKA 2CG0A 4EXRA 4GB5A 2Z77A 3B8LA 2INXA 2CFWA 4R1KA 4HM0B 1JNQA 3F8HA 4QWTA 4U13A 1VQ53 4N6LA 1Q814 3ALAA 3K63A 2F98A 3MWZA 3NBJA 3G0KA 3S27A 1QVG2 1VQ83 4LEHA 1WMPA 2CWUA 1L5GB 1VQ43 3VF1A 2QEX3 1D6YA 1JN5B 1WMNA 5AYSC 2YX9A 3CNMA 3KKGA 3S29A 1VQ93 2GBXB 5D81A 1GY6A 3K9MC 2OTJ3 3F8XA 2HMJB 1VQ73 3UNLA 5IERA 3HK4A 3LYGA 1CQSA 4G1MB 3NBBA 4TX4A 3I553 1DMMA 4O2HA 1ULIB 2GXFA 1N9JA 5AIGA 2C11A 2R4IA 1W7CA 4MJDA 3U97A 1K9M4 1UW1A 1SIHA 4JRFA 2WO0A 4XB5A 1T5YA 3H3HA 3DGNA 1IVXA 5IEOA 3OWUA 2W6JH 3EBYA 4K90B 1KQS2 1GY5A 3F14A 2XF3A 3CCS3 2BO9B 3S5CA 3O8YA 2BT3A 1VZZA 3CME3 3EE1A 3RGRA 2XFSA 1VQL3 3OV4A 1W6CA 3CU3A 4OK0A 2CH9A 2OOVC 2W56A 3UL6A 1QJGA 2P09A 1YJN3 2UX0A 3EBTA 5AEWB 2D42A 1JKGB 1OHSA 2GEYA 1A2VA 3X3YA 3CCE3 4MEIA 1DMQA 1LNHA 3LMLA 3T0UA 4H61A 3T8NA 3JUNA 1GYBA 4N6NB 3DY5A 3MG3A 5STDA 5TGNA 4KFDA 2W2CA 1K8A4 1OUNA 3BNEA 3EN8A 3WOFB 1W2ZA 3LTDA 3NM7A 3X40A 1O7MB 1IU7A 3MSOA 1NO3A 3OXAA 5CF1A 1WMOA 4X2HA 4EV2A 3G16A 4PEJA 5IG4A 1FGTA 3CC23 1O7WB 2Y73A 4WYKA 2CFGA 3V99A 2CHCA 1MOLA 1YVBI 3SLUA 1TU5A 5G2GA 1DYUA 3WMDA 2K54A 3DZLA 1IK3A 1N5PA 3DGLA 1IQYA 2XRXB 3EN1B 2K0MA 2CW9A 2XGNA 3K0ZA 2KRTA 1QMAA 1Q7Y4 3I0YA 2GU3A 3I563 2GBWB 5AIFA 4AEQA 4HZ9B 2XGLA 1ROAA 3NV0A 1M1XB 2Y74A 3CXC2 1U5OA 2WOFA 1GY7A 4J9AA 3LT8A 1Q824 1WNHA 3AMOA 4XBYA 1N5HA 3LOYA 3CCM3 4WWUC 4R9KA 3MYTA 3X42A 4ORLA 2Z7AA 3EHCA 1ISKA 3KFQC 4HM4B 5FW5A 3GZBA 4EV5A 1VQN3 1GS3A 4CDLA 4HM3B 1N8QA 1Q864 1IQXA 3SOYA 2OQEC 1YGEA 4N6V0 3IPTA 5EQLA 1Z1SA 3X41A 3S67A 1Q42A 2CFDA 2JDIH 3JVCA 1JRQA 4FCJA 1N8R4 1E3RA 1FGRA 1R4CA 1RN7A 2BHMA 2PZVA 2IMJA 3FH1A 2QIYA 2E2TA 3OX9A 1E97A 3RDEA 2GEXA 4XM4A 3B4OA 3KE7A 3K5TA 2KCDA 1D6ZA 3EC9A 3G4S3 1IT7A 3NM2A 1AR0A 3U1WA 2W0QA 1HKXA 3B7CA 3K7CA 5AIIA 3HIGA 2RCDA 4IIAA 1ZO2A 1AVKA 4BTWA 2W56B 1CYVA 4NREA 1VQM3 1WQLB 1NJI4 1D6UA 3DMCA 2B1XB 4K1VA 4L8PA 4STDA 3BNDA 1O7NB 2ZL8A 5A0OB 1OF5A 1VQP3 2YFIB 4R80A 4BTYA 1KD14 3FSDA 1OHPA 1VQK3 3NX0A 1J2BA 5AIHA 3G713 1YI23 2HMOB 1N9EA 4NHFA 4FMBA 4L8OA 3F9SA 4N6UA 1LOXA 4WYKB 1C7HA 3EF8A 1AV4A 3MPHA 2MC8A 2YFLB 3GZXB 1NDOB 3Q2PA 1A2KA 1DVCA 3CC73 5AEUB 2OTL3 2BMRB 3JUPA 4HKVB 3DM8A 1RJOA 3V92A 3SXXA 4CCVA 2CC3A 3CPOA 5D83A 4KZ1A 3GRDA 4FCMA 3IJEB 3GAXA 3FLJA 1O7HB 1IVWA 2BMOB 5CF2A 2KXGA 2O3OA 2L4VA 3NV0B 3BB9A 3DXOA 1W6YA 3CC43 4HM8B 3T8UA 1UUWB 1FA3A 3Q1CA 1UI8A 1W02A 2XR8B 1SJWA 4OUQA 3AMOB 2WGQA 3CCV3 5JPPA 2OQEA 2ML6A 1W01A 1BUQA 2LYXA 2JQ5A 3SX1A 1JV2B 1IV7A 4FR9A 4GL6A 3NHXA 1LVNA 1M1K4 1YJW3 3OW22 3CPW2 2HMMB 3CCQ3 2D1WA 1NB3I 1Q40A 1YJ93 1GD4A 1PFPA 2Z76A 3DGMA 3NQYA 3NQZA 3NXJA 1VQO3 1EKMA 1NWWA 3X3XA 3ER7A 3QK9A 5FGOA 3QRDA 1W2B2 3Q90A 1IQ8A 3D3LA 3GWRA 4LMIA 1ULJB 3FKAA 2RGQA 1RRHA 1STFI 1O7PB 3SOAA 2XFTA 1UUVB 4MMZB 5IG5A 1A67A 4KFEA 5D82A 4WHAA 2ZDJA 4HM7B 2P0MA 4O02B 1TUHA 1FGOA 2XEPA 3TDGA 5BXQA 5IENA 3KIIA 4AKZA 1ROVA 4IT7A 2BMQB 1S5AA 6STDA 3NBRA 3LH4A 4I4KA 3KSPA 3UB1A 4IPBA 3NUVA 3F40A 3RGAA 3PCSA 4R9LA 4L7KA 1KC84 1JB2A 2V1LA 3FF0A 3X3ZA 3FG3A 4JF8A 2XH9A 3IMAB 2OWPA 1OPYA 4RNZA 2O9UX 2W04A 1OF5B 5EVHA 3LTBA 1IVVA 1WTHA 1JB4A 1QAKA 1SPUA 1W00A 4XBTA 1OGZA 5KP4A 1Y4KA 2CKFB 2LQVA 4H3UA 4O3VA 4X2OA 1F8NA 1FGMA 3OWSA 1JB5A 4R4KA 4RZMA 2B24B 3GZYB 3JUMA 3CCJ3 4HYZA 5DRVA 1IVUA 4XBXA 2OOVA 3GZRA 2W9PA 3HZPA 2C10A 4OVMA 1YHQ3 3CCU3 1SQWA 1QALA 3N9HA 5AI1A 7STDA 4N6MA 3MG2A 4BTXA 5LC7A 4RBNA 3STDA 2ML5A 5ELJA 3S28A 5HGRA 2STDA 2I9WA 3CD63 1YIJ3 4WFOA 1IV9A 3ROBA 1W6GA 3A76A 2A15A 2W03A 5IEPA 4HM6B 2GU1A 3HI7A 3EQQB 3HIIA 3OWYA 4LGQA 3WOEB 2PNCA 2IA7A 5IF6A 4AKYA 3F7SA 1AVLA 2CWVA 2CFLA 3JUQA 3DGOA 2P05A 4HM5B 5DREA 3B4PA 1M9GA 2P0XA 3BNCA 3EX9A 4XDVA 4HM2B 2F99A 3WDGB 1KWIA 1K28A 2E2UA 2QGUA 1Q40B 2W9QA 2RFRA 5LC6A 1K41A 1IDPA 2HMLB 5ELUA 5IG0A 4K1UA 3DUKA 3PYJA 1DVDA 4HM1B 1QAFA 2E2VA 2YFJB 2FGTA 4HZBB 2HMNB 3PGBA 1HU9A 3UJMA 3J7Yd 4HJLB 4KFFA 3ECFA 8CHOA 1KSIA 2P38A 3HX8A 3PXMA 5CK6A 1EQKA 3H51A 4KVHA 4N6TA 5IG3A 1OACA 3D9RA 1MNLA 3G6E3 3F7XA 1VQ63 2FXTA 1SIIA 3LXUX 4FMAA 1NU3A 1EA2A 3EJVA 1K734 1M904 5CLKA 3EB8A 3FGYA 1GD3A 1E3VA 1JN5A 1O7GB 2Q07A 1A90A 3VSYA 3KZTA 1TFOA 1G96A 4N3VA 2CWTA 3KN4A 4MMYB 4HVNA 4ZM8A 2IUJA 2XSHB 4EBGA 5KP1A 4O8SA 4RNYA 3WODG 5BVBA 1FGQA 3SVAA 2MF7A 4Q53A 3M8CA 2SBLA 3V98A 3MG1A 2XSOB 2WOHA 2HMKB 3L0RA 3MKIA 5I97A 3BNBA 3SEDA 1ASKA 3PCRA 4EC6A 4FCZA 4J8TA 3CCR3 3FF2A 1IT8A 2IUKA 1RKYA 3E99A 1OCVA 1TP6A 3N54B 4XDWA 1NB5I 1U8CB 4MMXB 2BNGA 1W5ZA 4FMCA 2CFKA 2Z6BA 4LZIA 4WP5A 5AYRB 3FZWA 1W4NA 3MHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2P A;  1DVC A;  5ELJ A;  1FUW A;  1IV9 A;  4CCV A;  1CYU A;  3UL5 A;  3KSE D;  3GAX A;  1MOL A;  1YVB I;  1TIJ A;  2KXG A;  1FA3 A;  1N5P A;  4N6O B;  1M9G A;  1ROA A;  4EYC A;  1KWI A;  1IV7 A;  1CEW I;  5LC6 A;  2W9Q A;  3PS8 A;  5ELU A;  2OCT A;  1WNH A;  1LXE A;  3PYJ A;  1N5H A;  1DVD A;  1NB3 I;  3KFQ C;  1GD4 A;  1PFP A;  4N6L A;  3MWZ A;  3QRD A;  4N6V 0;  1STF I;  3PXM A;  5EQL A;  1A67 A;  1EQK A;  3S67 A;  4N6T A;  3K9M C;  1MNL A;  1R4C A;  1RN7 A;  4IT7 A;  3LH4 A;  1GD3 A;  4TX4 A;  1A90 A;  1G96 A;  1N9J A;  4ZM8 A;  3IMA B;  2O9U X;  3SVA A;  1CYV A;  2BO9 B;  3L0R A;  5A0O B;  2CH9 A;  3UL6 A;  2W9P A;  3NX0 A;  1NB5 I;  4LZI A;  4N6U A;  4N6M A;  4N6N B;  5LC7 A; 
#chains in the Genus database with same CATH topology
 2RSX A;  3WA2 X;  3BIR A;  4EW5 A;  3D5I A;  2FNQ A;  1YIT 3;  1CH0 A;  1FUW A;  1JKG A;  3WA3 A;  8RNT A;  1JBS A;  1OH0 A;  5EEO A;  1EG9 B;  2F86 B;  3BLZ A;  1QVF 2;  1CYU A;  3CNX A;  3UL5 A;  1S72 3;  3CCL 3;  3D79 A;  3LTA A;  3KSE D;  1B2U A;  1V74 A;  3BU4 A;  1UI7 A;  1DMN A;  1ZX2 A;  2CIU A;  1TIJ A;  4K61 A;  4HBR A;  1C54 A;  1B2X A;  5BU4 A;  3VGN A;  2CG1 A;  5JBS A;  1LQG C;  1B2S A;  1OGX A;  3LTC A;  1RGL A;  3JUO A;  2AAE A;  1US1 A;  1JJ2 2;  1RGC A;  2C4B A;  3G8Z A;  1TRP A;  4N6O B;  2M7O A;  2WGO A;  5JPU A;  3FCS B;  3PZW A;  4EYC A;  1PU4 A;  5CXO A;  1CEW I;  2QA4 3;  1OHO A;  3PS8 A;  1BU4 A;  3LT9 A;  3N8B A;  2CK3 H;  2OCT A;  3A5E A;  3LZA A;  4FMD A;  3FG1 A;  5IW9 A;  4LSO A;  5KP3 A;  1LXE A;  1PYL A;  3CMA 3;  1RRL A;  2L1S A;  1STD A;  3FG4 A;  1TFK A;  2CG0 A;  4EXR A;  4GB5 A;  2Z77 A;  5M1A A;  5M18 A;  3B8L A;  2INX A;  2CFW A;  4ILF A;  4R1K A;  4HM0 B;  1JNQ A;  3F8H A;  4QWT A;  4U13 A;  1VQ5 3;  4N6L A;  1Q81 4;  3ALA A;  3K63 A;  2F98 A;  3MWZ A;  3NBJ A;  3G0K A;  3S27 A;  1QVG 2;  1VQ8 3;  4LEH A;  1WMP A;  2KF3 A;  1BAN A;  2CWU A;  1L5G B;  1VQ4 3;  3VF1 A;  1RN4 A;  2KF6 A;  2QEX 3;  1D6Y A;  1JN5 B;  1LRA A;  1WMN A;  2H0G A;  2YX9 A;  1MWU A;  5AYS C;  3CNM A;  3KKG A;  3S29 A;  1VQ9 3;  2GBX B;  1RGF A;  1GY6 A;  3K9M C;  5D81 A;  2OTJ 3;  2F5W A;  1DE3 A;  3F8X A;  2HMJ B;  1GMP A;  1VQ7 3;  3UNL A;  5IER A;  3HK4 A;  4HOH A;  3LYG A;  1CQS A;  1BNE A;  4G1M B;  3NBB A;  4TX4 A;  1UCI A;  3I55 3;  1DMM A;  4O2H A;  1ULI B;  2GXF A;  1N9J A;  1RN1 A;  5AIG A;  3ZG5 A;  2C11 A;  2R4I A;  3Q3F A;  1W7C A;  4MJD A;  3U97 A;  1K9M 4;  1UW1 A;  1SIH A;  2KAA A;  4JRF A;  2WO0 A;  4XB5 A;  1BSE A;  1T5Y A;  3H3H A;  1G0T A;  9RNT A;  3DGN A;  1IVX A;  5IEO A;  3OWU A;  1LOY A;  2W6J H;  3EBY A;  4K90 B;  1KQS 2;  1GY5 A;  3F14 A;  2XF3 A;  3CCS 3;  2BO9 B;  4DKI A;  3S5C A;  1AY7 A;  3O8Y A;  3DGY A;  2BT3 A;  1VZZ A;  3CME 3;  3EE1 A;  3RGR A;  2XFS A;  1Q7H A;  1RCL A;  1VQL 3;  3OV4 A;  1W6C A;  7RNT A;  3CU3 A;  4OK0 A;  2CH9 A;  2OOV C;  2W56 A;  3UL6 A;  1QJG A;  2P09 A;  1YJN 3;  2UX0 A;  1G02 A;  3EBT A;  5AEW B;  2D42 A;  1JKG B;  3SYU A;  1OHS A;  1X1Y A;  2GEY A;  1A2V A;  1RGH A;  3X3Y A;  3CCE 3;  4MEI A;  1DMQ A;  1LNH A;  3LML A;  3T0U A;  4H61 A;  3T8N A;  1B21 A;  3JUN A;  1GYB A;  4N6N B;  3DY5 A;  1BRG A;  3MG3 A;  5STD A;  5TGN A;  4KFD A;  2W2C A;  5HOH A;  1K8A 4;  1OUN A;  3BNE A;  3EN8 A;  3WOF B;  1W2Z A;  3LTD A;  3NM7 A;  2RNT A;  1O7M B;  3X40 A;  1IU7 A;  3MSO A;  1NO3 A;  3OXA A;  5CF1 A;  1WMO A;  4X2H A;  4EV2 A;  3G16 A;  4PEJ A;  5IG4 A;  1FGT A;  3CC2 3;  1GOV A;  3ZG0 A;  1O7W B;  2Y73 A;  4WYK A;  1BAO A;  2CFG A;  3V99 A;  3ZFZ A;  2CHC A;  1MOL A;  1YVB I;  3SLU A;  1TU5 A;  5G2G A;  1DYU A;  3WMD A;  2K54 A;  2AAD A;  3DZL A;  4KT3 B;  1IK3 A;  1N5P A;  3DGL A;  1IQY A;  1BRI A;  2XRX B;  3EN1 B;  2K0M A;  2CX0 A;  2CW9 A;  2XGN A;  3K0Z A;  2KRT A;  1QMA A;  1Q7Y 4;  3I0Y A;  2GU3 A;  3I56 3;  2GBW B;  1I0X A;  1RDS A;  4HZ9 B;  2XGL A;  5AIF A;  1ROA A;  4AEQ A;  3NV0 A;  1M1X B;  2Y74 A;  4CJN A;  3CXC 2;  1FZU A;  1RGK A;  1U5O A;  2KF4 A;  2WOF A;  1GY7 A;  1R4Y A;  4HAA A;  3LT8 A;  4J9A A;  3AGN A;  1Q82 4;  1WNH A;  3AMO A;  4XBY A;  1N5H A;  1FW7 A;  3LOY A;  3CCM 3;  1A2P A;  4R9K A;  4WWU C;  3MYT A;  7GSP A;  2UGI A;  4ORL A;  3X42 A;  1RNT A;  2Z7A A;  3EHC A;  1TJD A;  1ISK A;  3KFQ C;  4HM4 B;  5FW5 A;  3GZB A;  4EV5 A;  1VQN 3;  1GS3 A;  4CDL A;  4HM3 B;  1N8Q A;  1Q86 4;  1IQX A;  3SOY A;  2K3D A;  2OQE C;  1YGE A;  4N6V 0;  1V58 A;  3IPT A;  1GOU A;  5EQL A;  1Z1S A;  3X41 A;  2F56 A;  3S67 A;  4LYL B;  1Q42 A;  2CFD A;  2JDI H;  2BIR A;  3JVC A;  1JRQ A;  4FCJ A;  1N8R 4;  1E3R A;  1FGR A;  1R4C A;  1RN7 A;  1BNI A;  2BHM A;  4J5G A;  4NPB A;  2PZV A;  2IMJ A;  3FH1 A;  2QIY A;  1RHL A;  2E2T A;  3OX9 A;  1E97 A;  3HOH A;  3RDE A;  2GEX A;  4XM4 A;  3B4O A;  3KE7 A;  3K5T A;  2KCD A;  1D6Z A;  3EC9 A;  3G4S 3;  1BSC A;  3WR2 A;  1IT7 A;  3NM2 A;  1I2G A;  1AR0 A;  3U1W A;  2W0Q A;  1HKX A;  3B7C A;  3K7C A;  5AII A;  3HIG A;  2RCD A;  4IIA A;  1ZO2 A;  1AVK A;  2R41 A;  4BTW A;  2W56 B;  1CYV A;  4NRE A;  2CX1 A;  1VQM 3;  1WQL B;  1NJI 4;  1D6U A;  3DMC A;  1BRN L;  2B1X B;  4K1V A;  4BL2 A;  4L8P A;  1BNF A;  4STD A;  1YGW A;  1V57 A;  1O7N B;  2ZL8 A;  1RGE A;  3BND A;  5A0O B;  1OF5 A;  1RGA A;  2YFI B;  4R80 A;  1VQP 3;  4BTY A;  1KD1 4;  3FSD A;  1OHP A;  1VQK 3;  2ZA4 A;  3NX0 A;  1J2B A;  5AIH A;  3G71 3;  1YI2 3;  4CPK A;  2HMO B;  1N9E A;  1GOY A;  4NHF A;  4FMB A;  4L8O A;  3F9S A;  1RLS A;  4N6U A;  1LOX A;  4WYK B;  3DH2 A;  1GMR A;  1C7H A;  3EF8 A;  1AV4 A;  3MPH A;  2MC8 A;  1T3B A;  2YFL B;  1NDO B;  3GZX B;  1A2K A;  1DVC A;  3Q2P A;  3CC7 3;  5AEU B;  2OTL 3;  2BMR B;  3JUP A;  4HKV B;  3DM8 A;  1RJO A;  3V92 A;  1MWT A;  3SXX A;  4CCV A;  2CC3 A;  3CPO A;  5D83 A;  4KZ1 A;  3GRD A;  4FCM A;  3IJE B;  3GAX A;  1BOX A;  3FLJ A;  1O7H B;  1IVW A;  2BMO B;  5CF2 A;  1UUG B;  2KXG A;  1JBT A;  1JBR A;  2O3O A;  2F4Y A;  2L4V A;  3NV0 B;  3BB9 A;  3DXO A;  1W6Y A;  3CC4 3;  4HM8 B;  3T8U A;  1MWR A;  1UUW B;  1FA3 A;  3Q1C A;  1HZ1 A;  1UI8 A;  1W02 A;  1X1X A;  2H0I A;  1SJW A;  2XR8 B;  3D4A A;  4OUQ A;  3AMO B;  2WGQ A;  3CCV 3;  5JPP A;  2OQE A;  4I5Q A;  2ML6 A;  1W01 A;  1NNV A;  2LYX A;  1BUQ A;  2JQ5 A;  2BU4 A;  3SX1 A;  1JV2 B;  1IV7 A;  4BL3 A;  1T2H A;  1DET A;  4FR9 A;  4GL6 A;  2HOH A;  3NHX A;  1LVN A;  1M1K 4;  1YJW 3;  1B20 A;  3MHE A;  3OW2 2;  3CPW 2;  2HMM B;  3CCQ 3;  1FUS A;  2D1W A;  1NB3 I;  4BU4 A;  1UCK A;  1Q40 A;  1LOW A;  1YJ9 3;  4GHO A;  1GD4 A;  1EEJ A;  1PFP A;  2Z76 A;  3DGM A;  3NQY A;  3NQZ A;  3NXJ A;  1VQO 3;  1BRS A;  1EKM A;  1I2E A;  1NWW A;  1UDI I;  3ER7 A;  3QK9 A;  5FGO A;  3QRD A;  3X3X A;  1W2B 2;  3AHW A;  3Q90 A;  2RBI A;  1IQ8 A;  3D3L A;  3GWR A;  4LMI A;  1B3S A;  1ULJ B;  2RGQ A;  1RRH A;  1UGI A;  3FKA A;  1STF I;  1O7P B;  3SOA A;  1YVS A;  2XFT A;  1UUV B;  4MMZ B;  5IG5 A;  1A67 A;  1B2Z A;  4KFE A;  5D82 A;  4WHA A;  2ZDJ A;  4HM7 B;  2P0M A;  4O02 B;  1T2I A;  1FGO A;  1TUH A;  2XEP A;  5RNT A;  3TDG A;  5BXQ A;  5IEN A;  2SAR A;  3KII A;  4AKZ A;  1ROV A;  4IT7 A;  2BMQ B;  1S5A A;  6STD A;  1RNB A;  1BIR A;  3NBR A;  3LH4 A;  4I4K A;  3KSP A;  3UB1 A;  1I3F A;  4IPB A;  1I8V A;  3NUV A;  2KF5 A;  3F40 A;  3RGA A;  3PCS A;  4R9L A;  4L7K A;  1KC8 4;  1JB2 A;  1MGR A;  2V1L A;  1RSN A;  3FF0 A;  3X3Z A;  3FG3 A;  4JF8 A;  2XH9 A;  5GSP A;  1UCL A;  3IMA B;  2OWP A;  1OPY A;  4RNZ A;  1B27 A;  2O9U X;  2W04 A;  1OF5 B;  1BSD A;  5EVH A;  3LTB A;  5M19 A;  1IVV A;  2GSP A;  1WTH A;  1JB4 A;  1QAK A;  1SPU A;  1W00 A;  4XBT A;  1BSA A;  1SAR A;  1OGZ A;  5KP4 A;  1Y4K A;  2CKF B;  2LQV A;  4H3U A;  4O3V A;  2J8X B;  4X2O A;  1BNJ A;  1F8N A;  1FGM A;  1Q9E A;  1JB5 A;  3OWS A;  4R4K A;  2B24 B;  3GZY B;  3JUM A;  4RZM A;  3CCJ 3;  4HYZ A;  4RNT A;  5DRV A;  1RTU A;  1IVU A;  1EUI C;  4XBX A;  2OOV A;  3GZR A;  2W9P A;  1I70 A;  3HZP A;  1FYS A;  2C10 A;  3AHS A;  4OVM A;  1YHQ 3;  3CCU 3;  1SQW A;  1QAL A;  1MGW A;  1BRK A;  3N9H A;  5AI1 A;  7STD A;  4N6M A;  1ZGX A;  3MG2 A;  4BTX A;  5LC7 A;  4RBN A;  3STD A;  2ML5 A;  5ELJ A;  3S28 A;  5HGR A;  2STD A;  2I9W A;  3CD6 3;  1YIJ 3;  4WFO A;  1IV9 A;  1RCK A;  3ROB A;  1W6G A;  3A76 A;  2A15 A;  2W03 A;  3WHO A;  5IEP A;  4HM6 B;  2GU1 A;  3HI7 A;  3EQQ B;  3HII A;  3OWY A;  4LGQ A;  3WOE B;  2PNC A;  2IA7 A;  5IF6 A;  4AKY A;  3F7S A;  1AVL A;  2CWV A;  2CFL A;  3JUQ A;  4J5K A;  3DGO A;  2P05 A;  4HM5 B;  5DRE A;  3B4P A;  1M9G A;  2P0X A;  2ZHX B;  3BNC A;  3EX9 A;  4XDV A;  4HM2 B;  1FUT A;  2F99 A;  3WDG B;  3D5G A;  1KWI A;  1K28 A;  1RMS A;  2E2U A;  2QGU A;  1Q40 B;  2W9Q A;  2RFR A;  5LC6 A;  1K41 A;  1IDP A;  1YNV X;  2HML B;  5ELU A;  5IG0 A;  4K1U A;  3DUK A;  1TTO A;  3PYJ A;  1DVD A;  4HM1 B;  1QAF A;  1JZO A;  2E2V A;  2YFJ B;  2FGT A;  4HZB B;  2HMN B;  1BRH A;  1PY3 A;  3RNT A;  1IYY A;  1LNI A;  5G1L A;  1GMQ A;  3PGB A;  1HU9 A;  3UJM A;  3J7Y d;  4HJL B;  1BNG A;  1X1U A;  3KCH A;  4KFF A;  3ECF A;  8CHO A;  6GSP A;  1KSI A;  2P38 A;  3HX8 A;  1MWS A;  3PXM A;  1I0V A;  1TRQ A;  5CK6 A;  1LQM B;  1EQK A;  3H51 A;  4KVH A;  4N6T A;  5IG3 A;  1OAC A;  3D9R A;  1MNL A;  5G1K A;  3G6E 3;  3F7X A;  1VQ6 3;  2FXT A;  1SII A;  3LXU X;  4FMA A;  1NU3 A;  1EA2 A;  3EJV A;  1K73 4;  1BNR A;  1BUJ A;  1M90 4;  1BSB A;  1RGG A;  3EB8 A;  5CLK A;  1BRJ A;  3FGY A;  1GD3 A;  1I3I A;  1E3V A;  1JN5 A;  1O7G B;  2Q07 A;  6RNT A;  3AGO A;  1ZS7 A;  1A90 A;  3VSY A;  3KZT A;  1TFO A;  1G96 A;  4N3V A;  2CWT A;  1I2F A;  1LOV A;  3KN4 A;  4MMY B;  4HVN A;  4ZM8 A;  2IUJ A;  3URP A;  2XSH B;  2H0H A;  1UGH I;  4EBG A;  5KP1 A;  4O8S A;  4RNY A;  3WOD G;  5BVB A;  1FGQ A;  3SVA A;  2MF7 A;  1BGS A;  4Q53 A;  3M8C A;  2SBL A;  3V98 A;  1AQZ A;  3MG1 A;  1VQQ A;  1BNS A;  2XSO B;  5BIR A;  2WOH A;  2HMK B;  2IYJ A;  3L0R A;  3MKI A;  5I97 A;  3BNB A;  3SED A;  1ASK A;  1HYF A;  3PCR A;  4GSP A;  4EC6 A;  1JZD A;  4FCZ A;  4J8T A;  2F5M A;  3CCR 3;  3FF2 A;  1IT8 A;  2IUK A;  1RKY A;  3E99 A;  1OCV A;  1TP6 A;  1BVI A;  3N54 B;  4XDW A;  1U8C B;  4MMX B;  1NB5 I;  2BNG A;  2UUG C;  1W5Z A;  4FMC A;  1B2M A;  1X1W A;  2CFK A;  4BIR A;  2IY2 A;  2Z6B A;  4LZI A;  4WP5 A;  3GSP A;  5AYR B;  1GSP A;  3FZW A;  1W4N A;  1UCJ A; 
#chains in the Genus database with same CATH homology
 2RSX A;  3WA2 X;  1YIT 3;  2FNQ A;  1FUW A;  1JKG A;  3WA3 A;  1OH0 A;  5EEO A;  1EG9 B;  2F86 B;  3BLZ A;  1QVF 2;  1CYU A;  3CNX A;  3UL5 A;  1S72 3;  3CCL 3;  3LTA A;  3KSE D;  1V74 A;  1UI7 A;  1DMN A;  1ZX2 A;  2CIU A;  1TIJ A;  4K61 A;  4HBR A;  3VGN A;  2CG1 A;  5JBS A;  1OGX A;  3LTC A;  3JUO A;  1US1 A;  1JJ2 2;  3G8Z A;  4N6O B;  2M7O A;  2WGO A;  5JPU A;  3FCS B;  3PZW A;  4EYC A;  1PU4 A;  5CXO A;  1CEW I;  2QA4 3;  1OHO A;  3PS8 A;  3LT9 A;  3N8B A;  2CK3 H;  2OCT A;  3LZA A;  4FMD A;  3FG1 A;  5IW9 A;  4LSO A;  5KP3 A;  1LXE A;  3CMA 3;  1RRL A;  1STD A;  3FG4 A;  1TFK A;  2CG0 A;  4EXR A;  4GB5 A;  2Z77 A;  3B8L A;  2INX A;  2CFW A;  4R1K A;  4HM0 B;  1JNQ A;  3F8H A;  4QWT A;  4U13 A;  1VQ5 3;  4N6L A;  1Q81 4;  3ALA A;  3K63 A;  2F98 A;  3MWZ A;  3NBJ A;  3G0K A;  3S27 A;  1QVG 2;  1VQ8 3;  4LEH A;  1WMP A;  2CWU A;  1L5G B;  1VQ4 3;  3VF1 A;  2QEX 3;  1D6Y A;  1JN5 B;  1WMN A;  5AYS C;  2YX9 A;  3CNM A;  3KKG A;  3S29 A;  1VQ9 3;  2GBX B;  5D81 A;  1GY6 A;  3K9M C;  2OTJ 3;  3F8X A;  2HMJ B;  1VQ7 3;  3UNL A;  5IER A;  3HK4 A;  3LYG A;  1CQS A;  4G1M B;  3NBB A;  4TX4 A;  3I55 3;  1DMM A;  4O2H A;  1ULI B;  2GXF A;  1N9J A;  5AIG A;  2C11 A;  2R4I A;  1W7C A;  4MJD A;  3U97 A;  1K9M 4;  1UW1 A;  1SIH A;  4JRF A;  2WO0 A;  4XB5 A;  1T5Y A;  3H3H A;  3DGN A;  1IVX A;  5IEO A;  3OWU A;  2W6J H;  3EBY A;  4K90 B;  1KQS 2;  1GY5 A;  3F14 A;  2XF3 A;  3CCS 3;  2BO9 B;  3S5C A;  3O8Y A;  2BT3 A;  1VZZ A;  3CME 3;  3EE1 A;  3RGR A;  2XFS A;  1VQL 3;  3OV4 A;  1W6C A;  3CU3 A;  4OK0 A;  2CH9 A;  2OOV C;  2W56 A;  3UL6 A;  1QJG A;  2P09 A;  1YJN 3;  2UX0 A;  3EBT A;  5AEW B;  2D42 A;  1JKG B;  1OHS A;  2GEY A;  1A2V A;  3X3Y A;  3CCE 3;  4MEI A;  1DMQ A;  1LNH A;  3LML A;  3T0U A;  4H61 A;  3T8N A;  3JUN A;  1GYB A;  4N6N B;  3DY5 A;  3MG3 A;  5STD A;  5TGN A;  4KFD A;  2W2C A;  1K8A 4;  1OUN A;  3BNE A;  3EN8 A;  3WOF B;  1W2Z A;  3LTD A;  3NM7 A;  3X40 A;  1O7M B;  1IU7 A;  3MSO A;  1NO3 A;  3OXA A;  5CF1 A;  1WMO A;  4X2H A;  4EV2 A;  3G16 A;  4PEJ A;  5IG4 A;  1FGT A;  3CC2 3;  1O7W B;  2Y73 A;  4WYK A;  2CFG A;  3V99 A;  2CHC A;  1MOL A;  1YVB I;  3SLU A;  1TU5 A;  5G2G A;  1DYU A;  3WMD A;  2K54 A;  3DZL A;  1IK3 A;  1N5P A;  3DGL A;  1IQY A;  2XRX B;  3EN1 B;  2K0M A;  2CW9 A;  2XGN A;  3K0Z A;  2KRT A;  1QMA A;  1Q7Y 4;  3I0Y A;  2GU3 A;  3I56 3;  2GBW B;  5AIF A;  4AEQ A;  4HZ9 B;  2XGL A;  1ROA A;  3NV0 A;  1M1X B;  2Y74 A;  3CXC 2;  1U5O A;  2WOF A;  1GY7 A;  4J9A A;  3LT8 A;  1Q82 4;  1WNH A;  3AMO A;  4XBY A;  1N5H A;  3LOY A;  3CCM 3;  4WWU C;  4R9K A;  3MYT A;  3X42 A;  4ORL A;  2Z7A A;  3EHC A;  1ISK A;  3KFQ C;  4HM4 B;  5FW5 A;  3GZB A;  4EV5 A;  1VQN 3;  1GS3 A;  4CDL A;  4HM3 B;  1N8Q A;  1Q86 4;  1IQX A;  3SOY A;  2OQE C;  1YGE A;  4N6V 0;  3IPT A;  5EQL A;  1Z1S A;  3X41 A;  3S67 A;  1Q42 A;  2CFD A;  2JDI H;  3JVC A;  1JRQ A;  4FCJ A;  1N8R 4;  1E3R A;  1FGR A;  1R4C A;  1RN7 A;  2BHM A;  2PZV A;  2IMJ A;  3FH1 A;  2QIY A;  2E2T A;  3OX9 A;  1E97 A;  3RDE A;  2GEX A;  4XM4 A;  3B4O A;  3KE7 A;  3K5T A;  2KCD A;  1D6Z A;  3EC9 A;  3G4S 3;  1IT7 A;  3NM2 A;  1AR0 A;  3U1W A;  2W0Q A;  1HKX A;  3B7C A;  3K7C A;  5AII A;  3HIG A;  2RCD A;  4IIA A;  1ZO2 A;  1AVK A;  4BTW A;  2W56 B;  1CYV A;  4NRE A;  1VQM 3;  1WQL B;  1NJI 4;  1D6U A;  3DMC A;  2B1X B;  4K1V A;  4L8P A;  4STD A;  3BND A;  1O7N B;  2ZL8 A;  5A0O B;  1OF5 A;  1VQP 3;  2YFI B;  4R80 A;  4BTY A;  1KD1 4;  3FSD A;  1OHP A;  1VQK 3;  3NX0 A;  1J2B A;  5AIH A;  3G71 3;  1YI2 3;  2HMO B;  1N9E A;  4NHF A;  4FMB A;  4L8O A;  3F9S A;  4N6U A;  1LOX A;  4WYK B;  1C7H A;  3EF8 A;  1AV4 A;  3MPH A;  2MC8 A;  2YFL B;  3GZX B;  1NDO B;  3Q2P A;  1A2K A;  1DVC A;  3CC7 3;  5AEU B;  2OTL 3;  2BMR B;  3JUP A;  4HKV B;  3DM8 A;  1RJO A;  3V92 A;  3SXX A;  4CCV A;  2CC3 A;  3CPO A;  5D83 A;  4KZ1 A;  3GRD A;  4FCM A;  3IJE B;  3GAX A;  3FLJ A;  1O7H B;  1IVW A;  2BMO B;  5CF2 A;  2KXG A;  2O3O A;  2L4V A;  3NV0 B;  3BB9 A;  3DXO A;  1W6Y A;  3CC4 3;  4HM8 B;  3T8U A;  1UUW B;  1FA3 A;  3Q1C A;  1UI8 A;  1W02 A;  2XR8 B;  1SJW A;  4OUQ A;  3AMO B;  2WGQ A;  3CCV 3;  5JPP A;  2OQE A;  2ML6 A;  1W01 A;  1BUQ A;  2LYX A;  2JQ5 A;  3SX1 A;  1JV2 B;  1IV7 A;  4FR9 A;  4GL6 A;  3NHX A;  1LVN A;  1M1K 4;  1YJW 3;  3OW2 2;  3CPW 2;  2HMM B;  3CCQ 3;  2D1W A;  1NB3 I;  1Q40 A;  1YJ9 3;  1GD4 A;  1PFP A;  2Z76 A;  3DGM A;  3NQY A;  3NQZ A;  3NXJ A;  1VQO 3;  1EKM A;  1NWW A;  3X3X A;  3ER7 A;  3QK9 A;  5FGO A;  3QRD A;  1W2B 2;  3Q90 A;  1IQ8 A;  3D3L A;  3GWR A;  4LMI A;  1ULJ B;  3FKA A;  2RGQ A;  1RRH A;  1STF I;  1O7P B;  3SOA A;  2XFT A;  1UUV B;  4MMZ B;  5IG5 A;  1A67 A;  4KFE A;  5D82 A;  4WHA A;  2ZDJ A;  4HM7 B;  2P0M A;  4O02 B;  1TUH A;  1FGO A;  2XEP A;  3TDG A;  5BXQ A;  5IEN A;  3KII A;  4AKZ A;  1ROV A;  4IT7 A;  2BMQ B;  1S5A A;  6STD A;  3NBR A;  3LH4 A;  4I4K A;  3KSP A;  3UB1 A;  4IPB A;  3NUV A;  3F40 A;  3RGA A;  3PCS A;  4R9L A;  4L7K A;  1KC8 4;  1JB2 A;  2V1L A;  3FF0 A;  3X3Z A;  3FG3 A;  4JF8 A;  2XH9 A;  3IMA B;  2OWP A;  1OPY A;  4RNZ A;  2O9U X;  2W04 A;  1OF5 B;  5EVH A;  3LTB A;  1IVV A;  1WTH A;  1JB4 A;  1QAK A;  1SPU A;  1W00 A;  4XBT A;  1OGZ A;  5KP4 A;  1Y4K A;  2CKF B;  2LQV A;  4H3U A;  4O3V A;  4X2O A;  1F8N A;  1FGM A;  3OWS A;  1JB5 A;  4R4K A;  4RZM A;  2B24 B;  3GZY B;  3JUM A;  3CCJ 3;  4HYZ A;  5DRV A;  1IVU A;  4XBX A;  2OOV A;  3GZR A;  2W9P A;  3HZP A;  2C10 A;  4OVM A;  1YHQ 3;  3CCU 3;  1SQW A;  1QAL A;  3N9H A;  5AI1 A;  7STD A;  4N6M A;  3MG2 A;  4BTX A;  5LC7 A;  4RBN A;  3STD A;  2ML5 A;  5ELJ A;  3S28 A;  5HGR A;  2STD A;  2I9W A;  3CD6 3;  1YIJ 3;  4WFO A;  1IV9 A;  3ROB A;  1W6G A;  3A76 A;  2A15 A;  2W03 A;  5IEP A;  4HM6 B;  2GU1 A;  3HI7 A;  3EQQ B;  3HII A;  3OWY A;  4LGQ A;  3WOE B;  2PNC A;  2IA7 A;  5IF6 A;  4AKY A;  3F7S A;  1AVL A;  2CWV A;  2CFL A;  3JUQ A;  3DGO A;  2P05 A;  4HM5 B;  5DRE A;  3B4P A;  1M9G A;  2P0X A;  3BNC A;  3EX9 A;  4XDV A;  4HM2 B;  2F99 A;  3WDG B;  1KWI A;  1K28 A;  2E2U A;  2QGU A;  1Q40 B;  2W9Q A;  2RFR A;  5LC6 A;  1K41 A;  1IDP A;  2HML B;  5ELU A;  5IG0 A;  4K1U A;  3DUK A;  3PYJ A;  1DVD A;  4HM1 B;  1QAF A;  2E2V A;  2YFJ B;  2FGT A;  4HZB B;  2HMN B;  3PGB A;  1HU9 A;  3UJM A;  3J7Y d;  4HJL B;  4KFF A;  3ECF A;  8CHO A;  1KSI A;  2P38 A;  3HX8 A;  3PXM A;  5CK6 A;  1EQK A;  3H51 A;  4KVH A;  4N6T A;  5IG3 A;  1OAC A;  3D9R A;  1MNL A;  3G6E 3;  3F7X A;  1VQ6 3;  2FXT A;  1SII A;  3LXU X;  4FMA A;  1NU3 A;  1EA2 A;  3EJV A;  1K73 4;  1M90 4;  5CLK A;  3EB8 A;  3FGY A;  1GD3 A;  1E3V A;  1JN5 A;  1O7G B;  2Q07 A;  1A90 A;  3VSY A;  3KZT A;  1TFO A;  1G96 A;  4N3V A;  2CWT A;  3KN4 A;  4MMY B;  4HVN A;  4ZM8 A;  2IUJ A;  2XSH B;  4EBG A;  5KP1 A;  4O8S A;  4RNY A;  3WOD G;  5BVB A;  1FGQ A;  3SVA A;  2MF7 A;  4Q53 A;  3M8C A;  2SBL A;  3V98 A;  3MG1 A;  2XSO B;  2WOH A;  2HMK B;  3L0R A;  3MKI A;  5I97 A;  3BNB A;  3SED A;  1ASK A;  3PCR A;  4EC6 A;  4FCZ A;  4J8T A;  3CCR 3;  3FF2 A;  1IT8 A;  2IUK A;  1RKY A;  3E99 A;  1OCV A;  1TP6 A;  3N54 B;  4XDW A;  1NB5 I;  1U8C B;  4MMX B;  2BNG A;  1W5Z A;  4FMC A;  2CFK A;  2Z6B A;  4LZI A;  4WP5 A;  5AYR B;  3FZW A;  1W4N A;  3MHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...