3PXMA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
b'GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKAIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B/Monellin chain A chimeric protein
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 22
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3pxmA00
1FUWA 3Q2PA 1LXEA 1IV7A 4N6V0 5LC7A 2KXGA 1G96A 3PXMA 1A67A 1CEWI 5ELJA 1CYUA 2OCTA 1MOLA 3S67A 1PFPA 4N6MA 4N6LA 1GD4A 1N5HA 1NB5I 4IT7A 3NX0A 4TX4A 1CYVA 1FA3A 1N5PA 5EQLA 5LC6A 3K9MC 1IV9A 1N9JA 1TIJA 4LZIA 1A90A 4ZM8A 1MNLA 4CCVA 3KSED 1ROAA 3IMAB 1NB3I 3KFQC 1DVCA 4N6NB 3QRDA 3UL5A 1YVBI 1STFI 2O9UX 3L0RA 2W9QA 1EQKA 1M9GA 4N6OB 1DVDA 1RN7A 3PYJA 1KWIA 5ELUA 3UL6A 2BO9B 2CH9A 3LH4A 4N6TA 4EYCA 2W9PA 5A0OB 3SVAA 1WNHA 1GD3A 3GAXA 3MWZA 1R4CA 3PS8A 4N6UA
chains in the Genus database with same CATH superfamily
4HBRA 1FGMA 2BMOB 3X42A 3F8HA 3NBJA 5STDA 3NUVA 3WA2X 2CG0A 3CCU3 4WP5A 2F86B 2XH9A 1RGHA 1W00A 2W0QA 1LXEA 1JB5A 4HM8B 1BSCA 5IG4A 1BRJA 1SJWA 1VQM3 1UCLA 1K9M4 4KFDA 5FGOA 1I3IA 2GSPA 2XSOB 1SPUA 1B21A 1IDPA 1LOXA 3DGMA 5M1AA 1FGTA 1UUVB 4H61A 1T3BA 2KXGA 3IJEB 4K1VA 1RMSA 3MG1A 3M8CA 3T8UA 3I0YA 5JPUA 5DRVA 2CHCA 1BRIA 1AY7A 1HYFA 3DUKA 1BSAA 3HIIA 4XDWA 2BMRB 4R4KA 3H3HA 1VQQA 7RNTA 2W6JH 2W04A 4HVNA 1ASKA 7STDA 1VQ53 4WWUC 1B20A 4O02B 2XFSA 1YI23 1NB5I 3AGOA 5IG3A 1O7NB 4CJNA 1UCKA 3UB1A 1BGSA 1MWTA 3I563 1N8QA 1YHQ3 1GOYA 1Z1SA 1BNJA 5CF1A 1FA3A 3V92A 1IVVA 1QAFA 1AVLA 3AHSA 3OWSA 3SOYA 1AR0A 3DM8A 1TU5A 3CCM3 2CKFB 3GRDA 3FGYA 1IV9A 3OWUA 5I97A 1EKMA 1TIJA 3FCSB 3JUMA 2Z77A 1CH0A 1IT8A 1FGRA 1W6GA 3EBTA 1VQK3 1V58A 2ML6A 1A90A 4ZM8A 1I2FA 2O3OA 3EN1B 1IQXA 1JJ22 2W56B 1RDSA 3OWYA 1NNVA 1DMMA 2KRTA 4R80A 2ZL8A 2LYXA 2D1WA 3IMAB 1AV4A 3KFQC 1K734 1FW7A 3AGNA 3A5EA 1TFOA 2OOVC 1B3SA 1DETA 2K3DA 4HM0B 1EA2A 1Q40B 1F8NA 1W2B2 5KP1A 3LTDA 1NWWA 3GZRA 4O2HA 1JBTA 2I9WA 1RHLA 2MC8A 3NM7A 5BVBA 3CU3A 2W9QA 5IF6A 2H0HA 4FCZA 3G6E3 1QVF2 1DMQA 5DREA 3LTAA 4HM5B 4GSPA 1DE3A 3MG3A 1PU4A 2D42A 1IVXA 3WOEB 1Q824 1BSBA 1LVNA 2BHMA 2F5MA 3STDA 3WODG 2GU3A 4FCJA 3F7SA 3HIGA 1ZS7A 3CXC2 3N54B 3UL6A 3LYGA 4O8SA 1OF5B 1HU9A 2CH9A 3IPTA 1YGEA 5JBSA 3LH4A 2UGIA 4NPBA 1L5GB 2QA43 2W9PA 1BRGA 3MHEA 1WMOA 4R9KA 3URPA 1GY6A 4HKVB 1E3RA 1MWRA 1WNHA 1I2GA 3SOAA 1E97A 1JKGB 2P0XA 2FXTA 4FMDA 3OXAA 1BNIA 1NJI4 1T2HA 2C11A 4X2OA 1R4CA 3CCE3 5AEWB 4G1MB 3X41A 4U13A 3ZFZA 3G4S3 1VZZA 1D6YA 1X1WA 1GOVA 5RNTA 3QK9A 1FUWA 1OGXA 3KE7A 5G1KA 1VQ63 1IV7A 1PYLA 2W56A 1SQWA 1FGQA 4K90B 1OHSA 2ZHXB 2C4BA 4JF8A 1GYBA 2P0MA 2OOVA 3DXOA 3PXMA 2JQ5A 3KCHA 3MG2A 4QWTA 1CEWI 4RZMA 1BUJA 1Q40A 2LQVA 2CWUA 4J5KA 1BAOA 2E2VA 4EW5A 1LQMB 1C54A 1MWUA 1TUHA 8CHOA 2B1XB 2KF3A 2XR8B 2OCTA 2GEXA 1NO3A 2CG1A 3CCQ3 2Z6BA 3GZYB 1MOLA 1EUIC 1TRPA 1YVSA 3MSOA 4MMYB 5FW5A 1UI7A 3MPHA 2CWVA 5D83A 5AEUB 4ORLA 1JNQA 1LOWA 4XBXA 4XM4A 2M7OA 1M904 1GS3A 2MF7A 1IQ8A 1B2MA 1CYVA 4KFFA 2QEX3 2HMOB 3F40A 1MGRA 2QGUA 1UCJA 1BUQA 4NHFA 1SIHA 1OF5A 1NU3A 1EG9B 1OCVA 3GSPA 3K9MC 1LRAA 5LC6A 1U8CB 5TGNA 4HZBB 1BNEA 2YX9A 3RDEA 3SEDA 2WOFA 3B4OA 1LQGC 4LZIA 3DGOA 1W6CA 3TDGA 3OW22 1I2EA 4DKIA 1UUWB 3FLJA 1JKGA 2E2UA 2QIYA 2Q07A 4OVMA 4L8PA 2BNGA 4I5QA 3FSDA 1Q42A 1QVG2 1K28A 1CQSA 3CME3 1D6UA 3RGRA 1KC84 1NB3I 3K5TA 2XGNA 4N3VA 1D6ZA 4HM2B 1LOVA 1QJGA 2J8XB 3VSYA 2GBXB 3EX9A 4AKYA 3JVCA 9RNTA 1ULIB 1GMPA 4FMAA 2H0IA 2FNQA 4N6NB 4N6UA 3UL5A 5IG0A 3SLUA 2P09A 1YVBI 1JB2A 1RCKA 3EQQB 2GXFA 4L8OA 1A2PA 1O7MB 3KN4A 4LEHA 5JPPA 1OUNA 1U5OA 4BU4A 1A2KA 3BNCA 4GB5A 1IT7A 1EQKA 3EHCA 1US1A 1RGEA 3H51A 3BNEA 4MEIA 1B2XA 2RCDA 1RN7A 3SXXA 3PGBA 1AQZA 3OX9A 3PYJA 3AMOB 3N8BA 5BU4A 5CXOA 3G713 3NM2A 1V57A 4AEQA 2ML5A 1R4YA 3LTCA 4WFOA 2KF5A 3B7CA 1GY7A 5M19A 5BIRA 3CD63 2CFDA 1W7CA 2A15A 4N6TA 3U97A 1YNVX 3K63A 1UW1A 3PCRA 2CW9A 2PNCA 3CNMA 3S28A 5IENA 2OTL3 2HMNB 3MYTA 3UJMA 5AYRB 1X1UA 4XBYA 2YFIB 3BIRA 1IQYA 2RSXA 2BT3A 2CFKA 1JB4A 1OGZA 4HM3B 4WYKB 1TJDA 3FZWA 4X2HA 6RNTA 1VQN3 3X3XA 1RKYA 1OPYA 5CK6A 1Q864 4KFEA 5KP4A 1QMAA 1UUGB 2F99A 3GZXB 4GL6A 3DGNA 3OV4A 1C7HA 3LOYA 1BRSA 1JZDA 4BL2A 2KCDA 3HOHA 4N6V0 3EF8A 3N9HA 1JN5B 2CFLA 3NQZA 3KIIA 1VQO3 3FF2A 4HM1B 4J8TA 1G96A 3F14A 4MMZB 3EC9A 3DY5A 4MMXB 1BRNL 1BSDA 1TFKA 4LMIA 1QALA 3VF1A 1X1YA 5ELJA 1DYUA 4L7KA 3G8ZA 1LOYA 1RGLA 1G0TA 1YIT3 1FGOA 4HM6B 3EN8A 4RNTA 3S67A 4WHAA 1PFPA 1FUTA 3FF0A 4O3VA 2F5WA 2XEPA 1W4NA 4FMBA 1GD4A 1N5HA 1KSIA 4R9LA 2OWPA 3F9SA 1WMPA 1MWSA 3AMOA 2CC3A 3ALAA 3D3LA 4TX4A 4EV5A 4HJLB 1K8A4 1SIIA 2W2CA 3V99A 3CCS3 4XBTA 2L1SA 1RRHA 3FG3A 4LSOA 4XDVA 7GSPA 2HOHA 4R1KA 3DH2A 1FYSA 2E2TA 4BIRA 4KVHA 1GSPA 1T5YA 4HAAA 1O7HB 1O7PB 2AADA 1BVIA 2R4IA 1RGKA 3NQYA 4XB5A 5HGRA 3FH1A 5AIGA 5HOHA 2BU4A 1UI8A 2OQEA 1FZUA 1E3VA 3K0ZA 5AYSC 3CCJ3 2KAAA 3CPOA 3LTBA 5GSPA 1JBSA 1W01A 1MGWA 2WGOA 2OTJ3 3EE1A 2IY2A 2IYJA 3Q90A 2ZDJA 2FGTA 1BNSA 2IUJA 5IERA 1YJN3 3KZTA 3WR2A 4WYKA 1ROAA 3E99A 1UCIA 4BTWA 4BTYA 3EBYA 1DMNA 2RFRA 3PCSA 4CPKA 1RNBA 2P05A 2C10A 3BNBA 3CC73 1OHPA 3QRDA 2CFGA 1IVWA 3NXJA 1O7GB 4J5GA 3GZBA 1B2SA 2BIRA 1ZGXA 1K41A 1STFI 2O9UX 2WGQA 3X3YA 1W6YA 1OACA 2H0GA 3A76A 4HM4B 4AKZA 1JRQA 4LYLB 1YJW3 4OUQA 1M9GA 3WDGB 4FMCA 1JN5A 2CX0A 3LMLA 4N6OB 2WO0A 2F98A 2AAEA 3D5GA 3NBRA 3UNLA 1YJ93 3X40A 3JUNA 3SYUA 1B27A 4RBNA 2F4YA 3X3ZA 1IK3A 1KWIA 1RN4A 1Q7Y4 1LNHA 2HMJB 4RNZA 2IUKA 4MJDA 3EJVA 2UUGC 2RGQA 2RNTA 3KSPA 1S723 3BLZA 2YFLB 4GHOA 2BO9B 1OHOA 3KKGA 4EV2A 1JV2B 1TTOA 1Q9EA 2PZVA 3CPW2 3B4PA 2CK3H 1W02A 2Z7AA 1Y4KA 3FKAA 3JUOA 3O8YA 4EYCA 1ZX2A 2CFWA 1BNGA 1M1K4 1IU7A 1ROVA 3T0UA 3RNTA 4RNYA 2Z76A 3CCV3 1RSNA 1W2ZA 3VGNA 1AVKA 1RTUA 3MWZA 2WOHA 1KQS2 1PY3A 4LGQA 5AIHA 2ZA4A 2F56A 1G02A 4KZ1A 4HZ9B 3S29A 3LT9A 1TRQA 2SBLA 2W03A 2Y74A 3U1WA 2GU1A 1BSEA 3ECFA 1BRKA 1VQL3 2KF6A 3Q2PA 3NV0B 3CCL3 1J2BA 2R41A 3CMA3 1RNTA 1V74A 1I0VA 3D9RA 8RNTA 3WHOA 3D4AA 4H3UA 2JDIH 5LC7A 1ISKA 2K54A 3G16A 3JUPA 5IEPA 1A67A 3ZG0A 1HKXA 2OQEC 4STDA 3WA3A 1JZOA 2XSHB 4CDLA 1CYUA 4FCMA 2HMLB 3NBBA 2XFTA 5AIFA 2HMKB 5CF2A 5AIIA 3WMDA 5M18A 1I70A 3NHXA 5D81A 4EC6A 1NDOB 4NREA 4BTXA 3T8NA 1WQLB 1RCLA 1BU4A 1RGGA 2INXA 4N6MA 1WMNA 5BXQA 3B8LA 4N6LA 4J9AA 1BIRA 1Q814 2CWTA 3DMCA 4I4KA 5CLKA 4IT7A 2XF3A 4FR9A 1UDII 3LXUX 3NX0A 1YGWA 2CX1A 3FG1A 2CIUA 2YFJB 5D82A 1VQ83 6GSPA 2STDA 4IPBA 2KF4A 1BNFA 1FUSA 4IIAA 1EEJA 2B24B 1HZ1A 1RJOA 5EQLA 1YIJ3 2GEYA 1VQ73 3V98A 1Q7HA 2IA7A 1TP6A 3JUQA 1N9JA 5KP3A 1VQ43 1IYYA 1GY5A 1X1XA 5EVHA 1RGAA 1WTHA 1JBRA 4HM7B 1B2UA 3MKIA 4BL3A 3I553 3FG4A 3LT8A 1MNLA 3ER7A 5G2GA 1O7WB 1S5AA 3HK4A 3Q3FA 4CCVA 1KD14 2UX0A 3KSED 1GMQA 3DGLA 4ILFA 1M1XB 3DZLA 1UGHI 4HYZA 2XGLA 1N8R4 3GWRA 1DVCA 1RRLA 2V1LA 4K1UA 4KT3B 1UGIA 3ROBA 1N9EA 3BU4A 3RGAA 1IVUA 1W5ZA 1I0XA 4HOHA 5EEOA 3NV0A 5AI1A 1GOUA 3L0RA 1BOXA 3CCR3 3AHWA 6STDA 2IMJA 2XRXB 1LNIA 1B2ZA 3CC43 1DVDA 1OH0A 4JRFA 2K0MA 3BB9A 5IEOA 3HX8A 3ZG5A 3G0KA 5ELUA 3HZPA 3PZWA 1RLSA 3S27A 2SARA 2RBIA 3BNDA 3SX1A 4OK0A 2BMQB 3WOFB 1STDA 3D79A 4K61A 1I3FA 3EB8A 1VQ93 2GBWB 2L4VA 1I8VA 2HMMB 3LZAA 1RGCA 4PEJA 3Q1CA 5A0OB 1RN1A 3F7XA 4EXRA 2Y73A 3SVAA 3K7CA 3CC23 1ULJB 4Q53A 3F8XA 1A2VA 1GD3A 1GMRA 2P38A 3DGYA 3GAXA 4EBGA 1BNRA 1QAKA 5IG5A 1ZO2A 1VQP3 3J7Yd 5G1LA 3CNXA 1T2IA 5IW9A 1BANA 1BRHA 1SARA 3PS8A 3D5IA 3S5CA 3HI7A 1N5PA 1RGFA
chains in the Genus database with same CATH topology
4HBRA 1FGMA 2BMOB 3X42A 3F8HA 3NBJA 5STDA 3NUVA 3WA2X 2CG0A 3CCU3 4WP5A 2F86B 2XH9A 1W00A 2W0QA 1LXEA 1JB5A 4HM8B 5IG4A 1SJWA 1VQM3 1K9M4 4KFDA 5FGOA 2XSOB 1SPUA 3DGMA 1IDPA 1LOXA 1FGTA 1UUVB 4H61A 2KXGA 3IJEB 4K1VA 3MG1A 3M8CA 3T8UA 3I0YA 5JPUA 5DRVA 2CHCA 3DUKA 3HIIA 4XDWA 2BMRB 4R4KA 3H3HA 2W6JH 2W04A 4HVNA 1ASKA 7STDA 1VQ53 4WWUC 4O02B 2XFSA 1YI23 1NB5I 5IG3A 1O7NB 3UB1A 3I563 1N8QA 1YHQ3 1FA3A 1Z1SA 5CF1A 3V92A 1IVVA 1QAFA 1AVLA 3OWSA 3SOYA 1AR0A 3DM8A 1TU5A 3CCM3 2CKFB 3GRDA 3FGYA 1IV9A 3OWUA 5I97A 1EKMA 1TIJA 3FCSB 3JUMA 2Z77A 1IT8A 1FGRA 1W6GA 3EBTA 1VQK3 2ML6A 1A90A 4ZM8A 2O3OA 3EN1B 1IQXA 1JJ22 2W56B 3OWYA 4R80A 2KRTA 1DMMA 2ZL8A 2LYXA 2D1WA 3IMAB 1AV4A 3KFQC 1K734 1TFOA 2OOVC 4HM0B 1W2B2 1EA2A 1Q40B 1F8NA 5KP1A 3LTDA 1NWWA 3GZRA 4O2HA 2I9WA 2MC8A 5BVBA 3NM7A 3CU3A 2W9QA 5IF6A 4FCZA 3G6E3 1QVF2 1DMQA 5DREA 3LTAA 4HM5B 3MG3A 1PU4A 2D42A 1IVXA 3WOEB 1Q824 1LVNA 2BHMA 3STDA 3WODG 2GU3A 4FCJA 3F7SA 3HIGA 3CXC2 3N54B 3UL6A 3LYGA 4O8SA 1OF5B 1HU9A 2CH9A 3IPTA 1YGEA 5JBSA 3LH4A 1L5GB 2QA43 2W9PA 3MHEA 4R9KA 1WMOA 1GY6A 4HKVB 1E3RA 1WNHA 3SOAA 1E97A 1JKGB 2P0XA 2FXTA 4FMDA 3OXAA 1NJI4 2C11A 4X2OA 1R4CA 3CCE3 5AEWB 4G1MB 3X41A 4U13A 3G4S3 1VZZA 1D6YA 3QK9A 1FUWA 1OGXA 3KE7A 1VQ63 1IV7A 2W56A 1SQWA 1FGQA 4K90B 1OHSA 4JF8A 1GYBA 2P0MA 2OOVA 3DXOA 3PXMA 2JQ5A 3MG2A 4QWTA 1CEWI 4RZMA 1Q40A 2LQVA 2CWUA 2E2VA 1TUHA 8CHOA 2B1XB 2XR8B 3CCQ3 2OCTA 2GEXA 1NO3A 2CG1A 2Z6BA 3GZYB 1MOLA 3MSOA 4MMYB 5FW5A 1UI7A 3MPHA 2CWVA 5D83A 5AEUB 4ORLA 1JNQA 4XBXA 4XM4A 2M7OA 1M904 1GS3A 2MF7A 1IQ8A 1CYVA 4KFFA 2QEX3 2HMOB 3F40A 2QGUA 1BUQA 4NHFA 1SIHA 1OF5A 1NU3A 1EG9B 1OCVA 3K9MC 5LC6A 1U8CB 5TGNA 4HZBB 2YX9A 3RDEA 3SEDA 2WOFA 3B4OA 4LZIA 3DGOA 1W6CA 3TDGA 3OW22 1UUWB 3FLJA 1JKGA 2E2UA 2QIYA 2Q07A 4OVMA 4L8PA 2BNGA 3FSDA 1Q42A 1QVG2 1K28A 1CQSA 3CME3 1D6UA 3RGRA 1KC84 1NB3I 3K5TA 2XGNA 4N3VA 1D6ZA 4HM2B 1QJGA 3VSYA 4AKYA 2GBXB 3EX9A 3JVCA 1ULIB 4FMAA 2FNQA 4N6NB 4N6UA 3UL5A 3SLUA 2P09A 1YVBI 1JB2A 3EQQB 2GXFA 4L8OA 1O7MB 3KN4A 4LEHA 5JPPA 1OUNA 1U5OA 1A2KA 3BNCA 4GB5A 1IT7A 1EQKA 3EHCA 1US1A 3H51A 3BNEA 4MEIA 2RCDA 1RN7A 3SXXA 3PGBA 3OX9A 3PYJA 3AMOB 3N8BA 5CXOA 3G713 3NM2A 4AEQA 2ML5A 3LTCA 4WFOA 3B7CA 1GY7A 3CD63 2CFDA 1W7CA 2A15A 4N6TA 3U97A 3K63A 1UW1A 3PCRA 2CW9A 2PNCA 3CNMA 3S28A 5IENA 2OTL3 2HMNB 3MYTA 3UJMA 5AYRB 4XBYA 2YFIB 1IQYA 2RSXA 2BT3A 2CFKA 1JB4A 1OGZA 4HM3B 4WYKB 4X2HA 3FZWA 1VQN3 3X3XA 1RKYA 1OPYA 5CK6A 1Q864 4KFEA 5KP4A 1QMAA 2F99A 3GZXB 4GL6A 3DGNA 3OV4A 1C7HA 3LOYA 2KCDA 4N6V0 3EF8A 3N9HA 1JN5B 2CFLA 3NQZA 3KIIA 1VQO3 3FF2A 4HM1B 4J8TA 1G96A 3F14A 4MMZB 3EC9A 3DY5A 4MMXB 1TFKA 4LMIA 1QALA 3VF1A 5ELJA 1DYUA 4L7KA 3G8ZA 1YIT3 1FGOA 4HM6B 3EN8A 3S67A 4WHAA 1PFPA 4O3VA 3FF0A 2XEPA 1W4NA 4FMBA 1GD4A 1N5HA 1KSIA 4R9LA 2OWPA 3F9SA 1WMPA 3AMOA 2CC3A 3ALAA 3D3LA 4TX4A 4EV5A 4HJLB 1K8A4 1SIIA 2W2CA 3V99A 3CCS3 4XBTA 4LSOA 1RRHA 3FG3A 4XDVA 4R1KA 2E2TA 4KVHA 1T5YA 1O7HB 1O7PB 3NQYA 2R4IA 5IG0A 5HGRA 4XB5A 3FH1A 5AIGA 1UI8A 2OQEA 3K0ZA 1E3VA 5AYSC 3CCJ3 3CPOA 3LTBA 1W01A 2WGOA 2OTJ3 3EE1A 3Q90A 2ZDJA 2FGTA 2IUJA 5IERA 1YJN3 3KZTA 4WYKA 1ROAA 3E99A 4BTWA 4BTYA 3EBYA 1DMNA 2RFRA 3PCSA 2P05A 2C10A 3BNBA 3CC73 1OHPA 3QRDA 2CFGA 1IVWA 3NXJA 1O7GB 3GZBA 2WGQA 1K41A 1STFI 2O9UX 3X3YA 1W6YA 1OACA 3A76A 4HM4B 4AKZA 1JRQA 1YJW3 4OUQA 1M9GA 3WDGB 4FMCA 1JN5A 3LMLA 4N6OB 2WO0A 2F98A 3NBRA 3UNLA 1YJ93 3X40A 3JUNA 4RBNA 3X3ZA 1IK3A 1KWIA 1Q7Y4 1LNHA 2HMJB 4RNZA 2IUKA 4MJDA 3EJVA 2RGQA 3KSPA 1S723 3BLZA 2YFLB 2BO9B 1OHOA 3KKGA 4EV2A 1JV2B 2PZVA 3CPW2 3B4PA 2CK3H 1W02A 2Z7AA 1Y4KA 3FKAA 3JUOA 3O8YA 4EYCA 1ZX2A 2CFWA 1M1K4 1IU7A 1ROVA 3T0UA 4RNYA 2Z76A 3CCV3 1W2ZA 3VGNA 1AVKA 3MWZA 2WOHA 1KQS2 4LGQA 5AIHA 4KZ1A 4HZ9B 3S29A 3LT9A 2SBLA 2W03A 2Y74A 3U1WA 2GU1A 3ECFA 1VQL3 3Q2PA 3NV0B 3CCL3 1J2BA 3CMA3 1V74A 3D9RA 4H3UA 2JDIH 5LC7A 1ISKA 2K54A 3G16A 3JUPA 5IEPA 1A67A 1HKXA 2OQEC 4STDA 3WA3A 2XSHB 4CDLA 1CYUA 4FCMA 2HMLB 3NBBA 2XFTA 5AIFA 2HMKB 5CF2A 5AIIA 3WMDA 3NHXA 5D81A 4EC6A 1NDOB 4NREA 4BTXA 3T8NA 1WQLB 4N6MA 2INXA 1WMNA 5BXQA 3B8LA 4N6LA 4J9AA 1Q814 2CWTA 3DMCA 4I4KA 5CLKA 4IT7A 2XF3A 4FR9A 3LXUX 3NX0A 3FG1A 2CIUA 2YFJB 5D82A 1VQ83 2STDA 4IPBA 4IIAA 2B24B 1RJOA 1YIJ3 5EQLA 2GEYA 1VQ73 3V98A 2IA7A 1TP6A 3JUQA 1N9JA 5KP3A 1VQ43 1GY5A 5EVHA 1WTHA 4HM7B 3MKIA 3I553 3FG4A 3LT8A 1MNLA 3ER7A 5G2GA 4CCVA 1S5AA 3HK4A 1KD14 2UX0A 3KSED 3DGLA 1M1XB 3DZLA 4HYZA 2XGLA 1N8R4 3GWRA 1DVCA 1RRLA 2V1LA 4K1UA 3ROBA 1N9EA 3RGAA 1IVUA 1W5ZA 5EEOA 3NV0A 5AI1A 3L0RA 3CCR3 6STDA 2IMJA 2XRXB 3CC43 1DVDA 1OH0A 4JRFA 2K0MA 3BB9A 5IEOA 3HX8A 3G0KA 5ELUA 3HZPA 3PZWA 3S27A 3BNDA 3SX1A 4OK0A 2BMQB 3WOFB 1STDA 4K61A 3EB8A 1VQ93 2GBWB 2L4VA 2HMMB 3LZAA 4PEJA 3Q1CA 5A0OB 3F7XA 4EXRA 2Y73A 3SVAA 3K7CA 3CC23 1ULJB 4Q53A 3F8XA 1A2VA 1GD3A 2P38A 4EBGA 3GAXA 1QAKA 5IG5A 1ZO2A 1VQP3 3J7Yd 3CNXA 5IW9A 3PS8A 3S5CA 3HI7A 1N5PA 1O7WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUW A;  3Q2P A;  1LXE A;  1IV7 A;  4N6V 0;  5LC7 A;  2KXG A;  1G96 A;  3PXM A;  1A67 A;  1CEW I;  5ELJ A;  1CYU A;  2OCT A;  1MOL A;  3S67 A;  1PFP A;  4N6M A;  4N6L A;  1GD4 A;  1N5H A;  1NB5 I;  4IT7 A;  3NX0 A;  4TX4 A;  1CYV A;  1FA3 A;  1N5P A;  5EQL A;  5LC6 A;  3K9M C;  1IV9 A;  1N9J A;  1TIJ A;  4LZI A;  1A90 A;  4ZM8 A;  1MNL A;  4CCV A;  3KSE D;  1ROA A;  3IMA B;  1NB3 I;  3KFQ C;  1DVC A;  4N6N B;  3QRD A;  3UL5 A;  1YVB I;  1STF I;  2O9U X;  3L0R A;  2W9Q A;  1EQK A;  1M9G A;  4N6O B;  1DVD A;  1RN7 A;  3PYJ A;  1KWI A;  5ELU A;  3UL6 A;  2BO9 B;  2CH9 A;  3LH4 A;  4N6T A;  4EYC A;  2W9P A;  5A0O B;  3SVA A;  1WNH A;  1GD3 A;  3GAX A;  3MWZ A;  1R4C A;  3PS8 A;  4N6U A; 
#chains in the Genus database with same CATH topology
 4HBR A;  1FGM A;  2BMO B;  3X42 A;  3F8H A;  3NBJ A;  5STD A;  3NUV A;  3WA2 X;  2CG0 A;  3CCU 3;  4WP5 A;  2F86 B;  2XH9 A;  1RGH A;  1W00 A;  2W0Q A;  1LXE A;  1JB5 A;  4HM8 B;  1BSC A;  5IG4 A;  1BRJ A;  1SJW A;  1VQM 3;  1UCL A;  1K9M 4;  4KFD A;  5FGO A;  1I3I A;  2GSP A;  2XSO B;  1SPU A;  1B21 A;  1IDP A;  1LOX A;  3DGM A;  5M1A A;  1FGT A;  1UUV B;  4H61 A;  1T3B A;  2KXG A;  3IJE B;  4K1V A;  1RMS A;  3MG1 A;  3M8C A;  3T8U A;  3I0Y A;  5JPU A;  5DRV A;  2CHC A;  1BRI A;  1AY7 A;  1HYF A;  3DUK A;  1BSA A;  3HII A;  4XDW A;  2BMR B;  4R4K A;  3H3H A;  1VQQ A;  7RNT A;  2W6J H;  2W04 A;  4HVN A;  1ASK A;  7STD A;  1VQ5 3;  4WWU C;  1B20 A;  4O02 B;  2XFS A;  1YI2 3;  1NB5 I;  3AGO A;  5IG3 A;  1O7N B;  4CJN A;  1UCK A;  3UB1 A;  1BGS A;  1MWT A;  3I56 3;  1N8Q A;  1YHQ 3;  1GOY A;  1Z1S A;  1BNJ A;  5CF1 A;  1FA3 A;  3V92 A;  1IVV A;  1QAF A;  1AVL A;  3AHS A;  3OWS A;  3SOY A;  1AR0 A;  3DM8 A;  1TU5 A;  3CCM 3;  2CKF B;  3GRD A;  3FGY A;  1IV9 A;  3OWU A;  5I97 A;  1EKM A;  1TIJ A;  3FCS B;  3JUM A;  2Z77 A;  1CH0 A;  1IT8 A;  1FGR A;  1W6G A;  3EBT A;  1VQK 3;  1V58 A;  2ML6 A;  1A90 A;  4ZM8 A;  1I2F A;  2O3O A;  3EN1 B;  1IQX A;  1JJ2 2;  2W56 B;  1RDS A;  3OWY A;  1NNV A;  1DMM A;  2KRT A;  4R80 A;  2ZL8 A;  2LYX A;  2D1W A;  3IMA B;  1AV4 A;  3KFQ C;  1K73 4;  1FW7 A;  3AGN A;  3A5E A;  1TFO A;  2OOV C;  1B3S A;  1DET A;  2K3D A;  4HM0 B;  1EA2 A;  1Q40 B;  1F8N A;  1W2B 2;  5KP1 A;  3LTD A;  1NWW A;  3GZR A;  4O2H A;  1JBT A;  2I9W A;  1RHL A;  2MC8 A;  3NM7 A;  5BVB A;  3CU3 A;  2W9Q A;  5IF6 A;  2H0H A;  4FCZ A;  3G6E 3;  1QVF 2;  1DMQ A;  5DRE A;  3LTA A;  4HM5 B;  4GSP A;  1DE3 A;  3MG3 A;  1PU4 A;  2D42 A;  1IVX A;  3WOE B;  1Q82 4;  1BSB A;  1LVN A;  2BHM A;  2F5M A;  3STD A;  3WOD G;  2GU3 A;  4FCJ A;  3F7S A;  3HIG A;  1ZS7 A;  3CXC 2;  3N54 B;  3UL6 A;  3LYG A;  4O8S A;  1OF5 B;  1HU9 A;  2CH9 A;  3IPT A;  1YGE A;  5JBS A;  3LH4 A;  2UGI A;  4NPB A;  1L5G B;  2QA4 3;  2W9P A;  1BRG A;  3MHE A;  1WMO A;  4R9K A;  3URP A;  1GY6 A;  4HKV B;  1E3R A;  1MWR A;  1WNH A;  1I2G A;  3SOA A;  1E97 A;  1JKG B;  2P0X A;  2FXT A;  4FMD A;  3OXA A;  1BNI A;  1NJI 4;  1T2H A;  2C11 A;  4X2O A;  1R4C A;  3CCE 3;  5AEW B;  4G1M B;  3X41 A;  4U13 A;  3ZFZ A;  3G4S 3;  1VZZ A;  1D6Y A;  1X1W A;  1GOV A;  5RNT A;  3QK9 A;  1FUW A;  1OGX A;  3KE7 A;  5G1K A;  1VQ6 3;  1IV7 A;  1PYL A;  2W56 A;  1SQW A;  1FGQ A;  4K90 B;  1OHS A;  2ZHX B;  2C4B A;  4JF8 A;  1GYB A;  2P0M A;  2OOV A;  3DXO A;  3PXM A;  2JQ5 A;  3KCH A;  3MG2 A;  4QWT A;  1CEW I;  4RZM A;  1BUJ A;  1Q40 A;  2LQV A;  2CWU A;  4J5K A;  1BAO A;  2E2V A;  4EW5 A;  1LQM B;  1C54 A;  1MWU A;  1TUH A;  8CHO A;  2B1X B;  2KF3 A;  2XR8 B;  2OCT A;  2GEX A;  1NO3 A;  2CG1 A;  3CCQ 3;  2Z6B A;  3GZY B;  1MOL A;  1EUI C;  1TRP A;  1YVS A;  3MSO A;  4MMY B;  5FW5 A;  1UI7 A;  3MPH A;  2CWV A;  5D83 A;  5AEU B;  4ORL A;  1JNQ A;  1LOW A;  4XBX A;  4XM4 A;  2M7O A;  1M90 4;  1GS3 A;  2MF7 A;  1IQ8 A;  1B2M A;  1CYV A;  4KFF A;  2QEX 3;  2HMO B;  3F40 A;  1MGR A;  2QGU A;  1UCJ A;  1BUQ A;  4NHF A;  1SIH A;  1OF5 A;  1NU3 A;  1EG9 B;  1OCV A;  3GSP A;  3K9M C;  1LRA A;  5LC6 A;  1U8C B;  5TGN A;  4HZB B;  1BNE A;  2YX9 A;  3RDE A;  3SED A;  2WOF A;  3B4O A;  1LQG C;  4LZI A;  3DGO A;  1W6C A;  3TDG A;  3OW2 2;  1I2E A;  4DKI A;  1UUW B;  3FLJ A;  1JKG A;  2E2U A;  2QIY A;  2Q07 A;  4OVM A;  4L8P A;  2BNG A;  4I5Q A;  3FSD A;  1Q42 A;  1QVG 2;  1K28 A;  1CQS A;  3CME 3;  1D6U A;  3RGR A;  1KC8 4;  1NB3 I;  3K5T A;  2XGN A;  4N3V A;  1D6Z A;  4HM2 B;  1LOV A;  1QJG A;  2J8X B;  3VSY A;  2GBX B;  3EX9 A;  4AKY A;  3JVC A;  9RNT A;  1ULI B;  1GMP A;  4FMA A;  2H0I A;  2FNQ A;  4N6N B;  4N6U A;  3UL5 A;  5IG0 A;  3SLU A;  2P09 A;  1YVB I;  1JB2 A;  1RCK A;  3EQQ B;  2GXF A;  4L8O A;  1A2P A;  1O7M B;  3KN4 A;  4LEH A;  5JPP A;  1OUN A;  1U5O A;  4BU4 A;  1A2K A;  3BNC A;  4GB5 A;  1IT7 A;  1EQK A;  3EHC A;  1US1 A;  1RGE A;  3H51 A;  3BNE A;  4MEI A;  1B2X A;  2RCD A;  1RN7 A;  3SXX A;  3PGB A;  1AQZ A;  3OX9 A;  3PYJ A;  3AMO B;  3N8B A;  5BU4 A;  5CXO A;  3G71 3;  3NM2 A;  1V57 A;  4AEQ A;  2ML5 A;  1R4Y A;  3LTC A;  4WFO A;  2KF5 A;  3B7C A;  1GY7 A;  5M19 A;  5BIR A;  3CD6 3;  2CFD A;  1W7C A;  2A15 A;  4N6T A;  3U97 A;  1YNV X;  3K63 A;  1UW1 A;  3PCR A;  2CW9 A;  2PNC A;  3CNM A;  3S28 A;  5IEN A;  2OTL 3;  2HMN B;  3MYT A;  3UJM A;  5AYR B;  1X1U A;  4XBY A;  2YFI B;  3BIR A;  1IQY A;  2RSX A;  2BT3 A;  2CFK A;  1JB4 A;  1OGZ A;  4HM3 B;  4WYK B;  1TJD A;  3FZW A;  4X2H A;  6RNT A;  1VQN 3;  3X3X A;  1RKY A;  1OPY A;  5CK6 A;  1Q86 4;  4KFE A;  5KP4 A;  1QMA A;  1UUG B;  2F99 A;  3GZX B;  4GL6 A;  3DGN A;  3OV4 A;  1C7H A;  3LOY A;  1BRS A;  1JZD A;  4BL2 A;  2KCD A;  3HOH A;  4N6V 0;  3EF8 A;  3N9H A;  1JN5 B;  2CFL A;  3NQZ A;  3KII A;  1VQO 3;  3FF2 A;  4HM1 B;  4J8T A;  1G96 A;  3F14 A;  4MMZ B;  3EC9 A;  3DY5 A;  4MMX B;  1BRN L;  1BSD A;  1TFK A;  4LMI A;  1QAL A;  3VF1 A;  1X1Y A;  5ELJ A;  1DYU A;  4L7K A;  3G8Z A;  1LOY A;  1RGL A;  1G0T A;  1YIT 3;  1FGO A;  4HM6 B;  3EN8 A;  4RNT A;  3S67 A;  4WHA A;  1PFP A;  1FUT A;  3FF0 A;  4O3V A;  2F5W A;  2XEP A;  1W4N A;  4FMB A;  1GD4 A;  1N5H A;  1KSI A;  4R9L A;  2OWP A;  3F9S A;  1WMP A;  1MWS A;  3AMO A;  2CC3 A;  3ALA A;  3D3L A;  4TX4 A;  4EV5 A;  4HJL B;  1K8A 4;  1SII A;  2W2C A;  3V99 A;  3CCS 3;  4XBT A;  2L1S A;  1RRH A;  3FG3 A;  4LSO A;  4XDV A;  7GSP A;  2HOH A;  4R1K A;  3DH2 A;  1FYS A;  2E2T A;  4BIR A;  4KVH A;  1GSP A;  1T5Y A;  4HAA A;  1O7H B;  1O7P B;  2AAD A;  1BVI A;  2R4I A;  1RGK A;  3NQY A;  4XB5 A;  5HGR A;  3FH1 A;  5AIG A;  5HOH A;  2BU4 A;  1UI8 A;  2OQE A;  1FZU A;  1E3V A;  3K0Z A;  5AYS C;  3CCJ 3;  2KAA A;  3CPO A;  3LTB A;  5GSP A;  1JBS A;  1W01 A;  1MGW A;  2WGO A;  2OTJ 3;  3EE1 A;  2IY2 A;  2IYJ A;  3Q90 A;  2ZDJ A;  2FGT A;  1BNS A;  2IUJ A;  5IER A;  1YJN 3;  3KZT A;  3WR2 A;  4WYK A;  1ROA A;  3E99 A;  1UCI A;  4BTW A;  4BTY A;  3EBY A;  1DMN A;  2RFR A;  3PCS A;  4CPK A;  1RNB A;  2P05 A;  2C10 A;  3BNB A;  3CC7 3;  1OHP A;  3QRD A;  2CFG A;  1IVW A;  3NXJ A;  1O7G B;  4J5G A;  3GZB A;  1B2S A;  2BIR A;  1ZGX A;  1K41 A;  1STF I;  2O9U X;  2WGQ A;  3X3Y A;  1W6Y A;  1OAC A;  2H0G A;  3A76 A;  4HM4 B;  4AKZ A;  1JRQ A;  4LYL B;  1YJW 3;  4OUQ A;  1M9G A;  3WDG B;  4FMC A;  1JN5 A;  2CX0 A;  3LML A;  4N6O B;  2WO0 A;  2F98 A;  2AAE A;  3D5G A;  3NBR A;  3UNL A;  1YJ9 3;  3X40 A;  3JUN A;  3SYU A;  1B27 A;  4RBN A;  2F4Y A;  3X3Z A;  1IK3 A;  1KWI A;  1RN4 A;  1Q7Y 4;  1LNH A;  2HMJ B;  4RNZ A;  2IUK A;  4MJD A;  3EJV A;  2UUG C;  2RGQ A;  2RNT A;  3KSP A;  1S72 3;  3BLZ A;  2YFL B;  4GHO A;  2BO9 B;  1OHO A;  3KKG A;  4EV2 A;  1JV2 B;  1TTO A;  1Q9E A;  2PZV A;  3CPW 2;  3B4P A;  2CK3 H;  1W02 A;  2Z7A A;  1Y4K A;  3FKA A;  3JUO A;  3O8Y A;  4EYC A;  1ZX2 A;  2CFW A;  1BNG A;  1M1K 4;  1IU7 A;  1ROV A;  3T0U A;  3RNT A;  4RNY A;  2Z76 A;  3CCV 3;  1RSN A;  1W2Z A;  3VGN A;  1AVK A;  1RTU A;  3MWZ A;  2WOH A;  1KQS 2;  1PY3 A;  4LGQ A;  5AIH A;  2ZA4 A;  2F56 A;  1G02 A;  4KZ1 A;  4HZ9 B;  3S29 A;  3LT9 A;  1TRQ A;  2SBL A;  2W03 A;  2Y74 A;  3U1W A;  2GU1 A;  1BSE A;  3ECF A;  1BRK A;  1VQL 3;  2KF6 A;  3Q2P A;  3NV0 B;  3CCL 3;  1J2B A;  2R41 A;  3CMA 3;  1RNT A;  1V74 A;  1I0V A;  3D9R A;  8RNT A;  3WHO A;  3D4A A;  4H3U A;  2JDI H;  5LC7 A;  1ISK A;  2K54 A;  3G16 A;  3JUP A;  5IEP A;  1A67 A;  3ZG0 A;  1HKX A;  2OQE C;  4STD A;  3WA3 A;  1JZO A;  2XSH B;  4CDL A;  1CYU A;  4FCM A;  2HML B;  3NBB A;  2XFT A;  5AIF A;  2HMK B;  5CF2 A;  5AII A;  3WMD A;  5M18 A;  1I70 A;  3NHX A;  5D81 A;  4EC6 A;  1NDO B;  4NRE A;  4BTX A;  3T8N A;  1WQL B;  1RCL A;  1BU4 A;  1RGG A;  2INX A;  4N6M A;  1WMN A;  5BXQ A;  3B8L A;  4N6L A;  4J9A A;  1BIR A;  1Q81 4;  2CWT A;  3DMC A;  4I4K A;  5CLK A;  4IT7 A;  2XF3 A;  4FR9 A;  1UDI I;  3LXU X;  3NX0 A;  1YGW A;  2CX1 A;  3FG1 A;  2CIU A;  2YFJ B;  5D82 A;  1VQ8 3;  6GSP A;  2STD A;  4IPB A;  2KF4 A;  1BNF A;  1FUS A;  4IIA A;  1EEJ A;  2B24 B;  1HZ1 A;  1RJO A;  5EQL A;  1YIJ 3;  2GEY A;  1VQ7 3;  3V98 A;  1Q7H A;  2IA7 A;  1TP6 A;  3JUQ A;  1N9J A;  5KP3 A;  1VQ4 3;  1IYY A;  1GY5 A;  1X1X A;  5EVH A;  1RGA A;  1WTH A;  1JBR A;  4HM7 B;  1B2U A;  3MKI A;  4BL3 A;  3I55 3;  3FG4 A;  3LT8 A;  1MNL A;  3ER7 A;  5G2G A;  1O7W B;  1S5A A;  3HK4 A;  3Q3F A;  4CCV A;  1KD1 4;  2UX0 A;  3KSE D;  1GMQ A;  3DGL A;  4ILF A;  1M1X B;  3DZL A;  1UGH I;  4HYZ A;  2XGL A;  1N8R 4;  3GWR A;  1DVC A;  1RRL A;  2V1L A;  4K1U A;  4KT3 B;  1UGI A;  3ROB A;  1N9E A;  3BU4 A;  3RGA A;  1IVU A;  1W5Z A;  1I0X A;  4HOH A;  5EEO A;  3NV0 A;  5AI1 A;  1GOU A;  3L0R A;  1BOX A;  3CCR 3;  3AHW A;  6STD A;  2IMJ A;  2XRX B;  1LNI A;  1B2Z A;  3CC4 3;  1DVD A;  1OH0 A;  4JRF A;  2K0M A;  3BB9 A;  5IEO A;  3HX8 A;  3ZG5 A;  3G0K A;  5ELU A;  3HZP A;  3PZW A;  1RLS A;  3S27 A;  2SAR A;  2RBI A;  3BND A;  3SX1 A;  4OK0 A;  2BMQ B;  3WOF B;  1STD A;  3D79 A;  4K61 A;  1I3F A;  3EB8 A;  1VQ9 3;  2GBW B;  2L4V A;  1I8V A;  2HMM B;  3LZA A;  1RGC A;  4PEJ A;  3Q1C A;  5A0O B;  1RN1 A;  3F7X A;  4EXR A;  2Y73 A;  3SVA A;  3K7C A;  3CC2 3;  1ULJ B;  4Q53 A;  3F8X A;  1A2V A;  1GD3 A;  1GMR A;  2P38 A;  3DGY A;  3GAX A;  4EBG A;  1BNR A;  1QAK A;  5IG5 A;  1ZO2 A;  1VQP 3;  3J7Y d;  5G1L A;  3CNX A;  1T2I A;  5IW9 A;  1BAN A;  1BRH A;  1SAR A;  3PS8 A;  3D5I A;  3S5C A;  3HI7 A;  1N5P A;  1RGF A; 
#chains in the Genus database with same CATH homology
 4HBR A;  1FGM A;  2BMO B;  3X42 A;  3F8H A;  3NBJ A;  5STD A;  3NUV A;  3WA2 X;  2CG0 A;  3CCU 3;  4WP5 A;  2F86 B;  2XH9 A;  1W00 A;  2W0Q A;  1LXE A;  1JB5 A;  4HM8 B;  5IG4 A;  1SJW A;  1VQM 3;  1K9M 4;  4KFD A;  5FGO A;  2XSO B;  1SPU A;  3DGM A;  1IDP A;  1LOX A;  1FGT A;  1UUV B;  4H61 A;  2KXG A;  3IJE B;  4K1V A;  3MG1 A;  3M8C A;  3T8U A;  3I0Y A;  5JPU A;  5DRV A;  2CHC A;  3DUK A;  3HII A;  4XDW A;  2BMR B;  4R4K A;  3H3H A;  2W6J H;  2W04 A;  4HVN A;  1ASK A;  7STD A;  1VQ5 3;  4WWU C;  4O02 B;  2XFS A;  1YI2 3;  1NB5 I;  5IG3 A;  1O7N B;  3UB1 A;  3I56 3;  1N8Q A;  1YHQ 3;  1FA3 A;  1Z1S A;  5CF1 A;  3V92 A;  1IVV A;  1QAF A;  1AVL A;  3OWS A;  3SOY A;  1AR0 A;  3DM8 A;  1TU5 A;  3CCM 3;  2CKF B;  3GRD A;  3FGY A;  1IV9 A;  3OWU A;  5I97 A;  1EKM A;  1TIJ A;  3FCS B;  3JUM A;  2Z77 A;  1IT8 A;  1FGR A;  1W6G A;  3EBT A;  1VQK 3;  2ML6 A;  1A90 A;  4ZM8 A;  2O3O A;  3EN1 B;  1IQX A;  1JJ2 2;  2W56 B;  3OWY A;  4R80 A;  2KRT A;  1DMM A;  2ZL8 A;  2LYX A;  2D1W A;  3IMA B;  1AV4 A;  3KFQ C;  1K73 4;  1TFO A;  2OOV C;  4HM0 B;  1W2B 2;  1EA2 A;  1Q40 B;  1F8N A;  5KP1 A;  3LTD A;  1NWW A;  3GZR A;  4O2H A;  2I9W A;  2MC8 A;  5BVB A;  3NM7 A;  3CU3 A;  2W9Q A;  5IF6 A;  4FCZ A;  3G6E 3;  1QVF 2;  1DMQ A;  5DRE A;  3LTA A;  4HM5 B;  3MG3 A;  1PU4 A;  2D42 A;  1IVX A;  3WOE B;  1Q82 4;  1LVN A;  2BHM A;  3STD A;  3WOD G;  2GU3 A;  4FCJ A;  3F7S A;  3HIG A;  3CXC 2;  3N54 B;  3UL6 A;  3LYG A;  4O8S A;  1OF5 B;  1HU9 A;  2CH9 A;  3IPT A;  1YGE A;  5JBS A;  3LH4 A;  1L5G B;  2QA4 3;  2W9P A;  3MHE A;  4R9K A;  1WMO A;  1GY6 A;  4HKV B;  1E3R A;  1WNH A;  3SOA A;  1E97 A;  1JKG B;  2P0X A;  2FXT A;  4FMD A;  3OXA A;  1NJI 4;  2C11 A;  4X2O A;  1R4C A;  3CCE 3;  5AEW B;  4G1M B;  3X41 A;  4U13 A;  3G4S 3;  1VZZ A;  1D6Y A;  3QK9 A;  1FUW A;  1OGX A;  3KE7 A;  1VQ6 3;  1IV7 A;  2W56 A;  1SQW A;  1FGQ A;  4K90 B;  1OHS A;  4JF8 A;  1GYB A;  2P0M A;  2OOV A;  3DXO A;  3PXM A;  2JQ5 A;  3MG2 A;  4QWT A;  1CEW I;  4RZM A;  1Q40 A;  2LQV A;  2CWU A;  2E2V A;  1TUH A;  8CHO A;  2B1X B;  2XR8 B;  3CCQ 3;  2OCT A;  2GEX A;  1NO3 A;  2CG1 A;  2Z6B A;  3GZY B;  1MOL A;  3MSO A;  4MMY B;  5FW5 A;  1UI7 A;  3MPH A;  2CWV A;  5D83 A;  5AEU B;  4ORL A;  1JNQ A;  4XBX A;  4XM4 A;  2M7O A;  1M90 4;  1GS3 A;  2MF7 A;  1IQ8 A;  1CYV A;  4KFF A;  2QEX 3;  2HMO B;  3F40 A;  2QGU A;  1BUQ A;  4NHF A;  1SIH A;  1OF5 A;  1NU3 A;  1EG9 B;  1OCV A;  3K9M C;  5LC6 A;  1U8C B;  5TGN A;  4HZB B;  2YX9 A;  3RDE A;  3SED A;  2WOF A;  3B4O A;  4LZI A;  3DGO A;  1W6C A;  3TDG A;  3OW2 2;  1UUW B;  3FLJ A;  1JKG A;  2E2U A;  2QIY A;  2Q07 A;  4OVM A;  4L8P A;  2BNG A;  3FSD A;  1Q42 A;  1QVG 2;  1K28 A;  1CQS A;  3CME 3;  1D6U A;  3RGR A;  1KC8 4;  1NB3 I;  3K5T A;  2XGN A;  4N3V A;  1D6Z A;  4HM2 B;  1QJG A;  3VSY A;  4AKY A;  2GBX B;  3EX9 A;  3JVC A;  1ULI B;  4FMA A;  2FNQ A;  4N6N B;  4N6U A;  3UL5 A;  3SLU A;  2P09 A;  1YVB I;  1JB2 A;  3EQQ B;  2GXF A;  4L8O A;  1O7M B;  3KN4 A;  4LEH A;  5JPP A;  1OUN A;  1U5O A;  1A2K A;  3BNC A;  4GB5 A;  1IT7 A;  1EQK A;  3EHC A;  1US1 A;  3H51 A;  3BNE A;  4MEI A;  2RCD A;  1RN7 A;  3SXX A;  3PGB A;  3OX9 A;  3PYJ A;  3AMO B;  3N8B A;  5CXO A;  3G71 3;  3NM2 A;  4AEQ A;  2ML5 A;  3LTC A;  4WFO A;  3B7C A;  1GY7 A;  3CD6 3;  2CFD A;  1W7C A;  2A15 A;  4N6T A;  3U97 A;  3K63 A;  1UW1 A;  3PCR A;  2CW9 A;  2PNC A;  3CNM A;  3S28 A;  5IEN A;  2OTL 3;  2HMN B;  3MYT A;  3UJM A;  5AYR B;  4XBY A;  2YFI B;  1IQY A;  2RSX A;  2BT3 A;  2CFK A;  1JB4 A;  1OGZ A;  4HM3 B;  4WYK B;  4X2H A;  3FZW A;  1VQN 3;  3X3X A;  1RKY A;  1OPY A;  5CK6 A;  1Q86 4;  4KFE A;  5KP4 A;  1QMA A;  2F99 A;  3GZX B;  4GL6 A;  3DGN A;  3OV4 A;  1C7H A;  3LOY A;  2KCD A;  4N6V 0;  3EF8 A;  3N9H A;  1JN5 B;  2CFL A;  3NQZ A;  3KII A;  1VQO 3;  3FF2 A;  4HM1 B;  4J8T A;  1G96 A;  3F14 A;  4MMZ B;  3EC9 A;  3DY5 A;  4MMX B;  1TFK A;  4LMI A;  1QAL A;  3VF1 A;  5ELJ A;  1DYU A;  4L7K A;  3G8Z A;  1YIT 3;  1FGO A;  4HM6 B;  3EN8 A;  3S67 A;  4WHA A;  1PFP A;  4O3V A;  3FF0 A;  2XEP A;  1W4N A;  4FMB A;  1GD4 A;  1N5H A;  1KSI A;  4R9L A;  2OWP A;  3F9S A;  1WMP A;  3AMO A;  2CC3 A;  3ALA A;  3D3L A;  4TX4 A;  4EV5 A;  4HJL B;  1K8A 4;  1SII A;  2W2C A;  3V99 A;  3CCS 3;  4XBT A;  4LSO A;  1RRH A;  3FG3 A;  4XDV A;  4R1K A;  2E2T A;  4KVH A;  1T5Y A;  1O7H B;  1O7P B;  3NQY A;  2R4I A;  5IG0 A;  5HGR A;  4XB5 A;  3FH1 A;  5AIG A;  1UI8 A;  2OQE A;  3K0Z A;  1E3V A;  5AYS C;  3CCJ 3;  3CPO A;  3LTB A;  1W01 A;  2WGO A;  2OTJ 3;  3EE1 A;  3Q90 A;  2ZDJ A;  2FGT A;  2IUJ A;  5IER A;  1YJN 3;  3KZT A;  4WYK A;  1ROA A;  3E99 A;  4BTW A;  4BTY A;  3EBY A;  1DMN A;  2RFR A;  3PCS A;  2P05 A;  2C10 A;  3BNB A;  3CC7 3;  1OHP A;  3QRD A;  2CFG A;  1IVW A;  3NXJ A;  1O7G B;  3GZB A;  2WGQ A;  1K41 A;  1STF I;  2O9U X;  3X3Y A;  1W6Y A;  1OAC A;  3A76 A;  4HM4 B;  4AKZ A;  1JRQ A;  1YJW 3;  4OUQ A;  1M9G A;  3WDG B;  4FMC A;  1JN5 A;  3LML A;  4N6O B;  2WO0 A;  2F98 A;  3NBR A;  3UNL A;  1YJ9 3;  3X40 A;  3JUN A;  4RBN A;  3X3Z A;  1IK3 A;  1KWI A;  1Q7Y 4;  1LNH A;  2HMJ B;  4RNZ A;  2IUK A;  4MJD A;  3EJV A;  2RGQ A;  3KSP A;  1S72 3;  3BLZ A;  2YFL B;  2BO9 B;  1OHO A;  3KKG A;  4EV2 A;  1JV2 B;  2PZV A;  3CPW 2;  3B4P A;  2CK3 H;  1W02 A;  2Z7A A;  1Y4K A;  3FKA A;  3JUO A;  3O8Y A;  4EYC A;  1ZX2 A;  2CFW A;  1M1K 4;  1IU7 A;  1ROV A;  3T0U A;  4RNY A;  2Z76 A;  3CCV 3;  1W2Z A;  3VGN A;  1AVK A;  3MWZ A;  2WOH A;  1KQS 2;  4LGQ A;  5AIH A;  4KZ1 A;  4HZ9 B;  3S29 A;  3LT9 A;  2SBL A;  2W03 A;  2Y74 A;  3U1W A;  2GU1 A;  3ECF A;  1VQL 3;  3Q2P A;  3NV0 B;  3CCL 3;  1J2B A;  3CMA 3;  1V74 A;  3D9R A;  4H3U A;  2JDI H;  5LC7 A;  1ISK A;  2K54 A;  3G16 A;  3JUP A;  5IEP A;  1A67 A;  1HKX A;  2OQE C;  4STD A;  3WA3 A;  2XSH B;  4CDL A;  1CYU A;  4FCM A;  2HML B;  3NBB A;  2XFT A;  5AIF A;  2HMK B;  5CF2 A;  5AII A;  3WMD A;  3NHX A;  5D81 A;  4EC6 A;  1NDO B;  4NRE A;  4BTX A;  3T8N A;  1WQL B;  4N6M A;  2INX A;  1WMN A;  5BXQ A;  3B8L A;  4N6L A;  4J9A A;  1Q81 4;  2CWT A;  3DMC A;  4I4K A;  5CLK A;  4IT7 A;  2XF3 A;  4FR9 A;  3LXU X;  3NX0 A;  3FG1 A;  2CIU A;  2YFJ B;  5D82 A;  1VQ8 3;  2STD A;  4IPB A;  4IIA A;  2B24 B;  1RJO A;  1YIJ 3;  5EQL A;  2GEY A;  1VQ7 3;  3V98 A;  2IA7 A;  1TP6 A;  3JUQ A;  1N9J A;  5KP3 A;  1VQ4 3;  1GY5 A;  5EVH A;  1WTH A;  4HM7 B;  3MKI A;  3I55 3;  3FG4 A;  3LT8 A;  1MNL A;  3ER7 A;  5G2G A;  4CCV A;  1S5A A;  3HK4 A;  1KD1 4;  2UX0 A;  3KSE D;  3DGL A;  1M1X B;  3DZL A;  4HYZ A;  2XGL A;  1N8R 4;  3GWR A;  1DVC A;  1RRL A;  2V1L A;  4K1U A;  3ROB A;  1N9E A;  3RGA A;  1IVU A;  1W5Z A;  5EEO A;  3NV0 A;  5AI1 A;  3L0R A;  3CCR 3;  6STD A;  2IMJ A;  2XRX B;  3CC4 3;  1DVD A;  1OH0 A;  4JRF A;  2K0M A;  3BB9 A;  5IEO A;  3HX8 A;  3G0K A;  5ELU A;  3HZP A;  3PZW A;  3S27 A;  3BND A;  3SX1 A;  4OK0 A;  2BMQ B;  3WOF B;  1STD A;  4K61 A;  3EB8 A;  1VQ9 3;  2GBW B;  2L4V A;  2HMM B;  3LZA A;  4PEJ A;  3Q1C A;  5A0O B;  3F7X A;  4EXR A;  2Y73 A;  3SVA A;  3K7C A;  3CC2 3;  1ULJ B;  4Q53 A;  3F8X A;  1A2V A;  1GD3 A;  2P38 A;  4EBG A;  3GAX A;  1QAK A;  5IG5 A;  1ZO2 A;  1VQP 3;  3J7Y d;  3CNX A;  5IW9 A;  3PS8 A;  3S5C A;  3HI7 A;  1N5P A;  1O7W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...