3PXMA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKAIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B/Monellin chain A chimeric protein
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 22
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3pxmA00
1N5HA 5A0OB 1FA3A 3UL5A 1G96A 1WNHA 2O9UX 1A90A 4N6LA 4N6NB 4IT7A 4N6OB 4EYCA 4N6V0 3L0RA 2BO9B 1M9GA 1CYVA 1CEWI 1TIJA 1EQKA 1NB3I 2W9QA 1N9JA 1N5PA 3Q2PA 1DVCA 3PXMA 1GD3A 4ZM8A 2OCTA 4LZIA 3KFQC 3NX0A 5LC7A 3MWZA 5ELUA 3S67A 3QRDA 2W9PA 1IV7A 4CCVA 3PYJA 4TX4A 3GAXA 5EQLA 1STFI 1LXEA 1FUWA 1CYUA 1KWIA 1RN7A 3KSED 3IMAB 1R4CA 1MNLA 1YVBI 4N6TA 1NB5I 3K9MC 3PS8A 4N6UA 3LH4A 1PFPA 2KXGA 3UL6A 1DVDA 5LC6A 1MOLA 1ROAA 1IV9A 3SVAA 5ELJA 1GD4A 1A67A 4N6MA 2CH9A
chains in the Genus database with same CATH superfamily
5IG3A 1N5HA 1JBRA 1TJDA 2IYJA 4HOHA 3UL5A 3WMDA 1IVWA 2W6JH 3WOEB 2W0QA 2BU4A 2L1SA 3GZXB 4EV5A 1UCJA 2CFDA 2QGUA 3UNLA 4N6NB 3NHXA 4IT7A 3NQZA 1D6UA 3EN1B 1VQ93 2C10A 2FXTA 5IENA 5IEOA 2GBWB 4EYCA 1QVF2 3HZPA 1OCVA 4WHAA 2HOHA 4WWUC 1EG9B 1BUJA 3X42A 4G1MB 1CYVA 4FMAA 3NBBA 1C7HA 3A76A 3DGNA 4X2OA 1GOVA 5KP3A 4HKVB 5KP4A 1EQKA 4RNZA 4WYKB 2RSXA 3H51A 1N9JA 1D6YA 1O7NB 3NV0B 3PXMA 1RCKA 3X41A 2ZDJA 4FCZA 2WOHA 3CCE3 1JZDA 2WGQA 3T8NA 3U1WA 1Q40B 1VQN3 4HM8B 3DMCA 3G16A 4J8TA 3NX0A 4O02B 3EC9A 3V92A 1QMAA 1WMOA 5M19A 2OQEA 1RHLA 3FGYA 1YIT3 3PZWA 1I2EA 3ZG5A 3F8HA 1DMQA 1TFOA 3NV0A 3NQYA 3X3ZA 2RFRA 2OTJ3 1TFKA 3BLZA 1BUQA 2OQEC 5IG0A 3F7SA 1BRGA 1B3SA 1Q40A 3GZBA 4RNTA 1UGIA 1MGRA 2F99A 3PYJA 1UI8A 3B4OA 1EEJA 4KZ1A 3ROBA 2KF5A 4RNYA 1B2ZA 1JB4A 1FUTA 2KRTA 3SLUA 2SBLA 2CKFB 1M904 2BMRB 5I97A 6STDA 4RBNA 1RN7A 1RGHA 1ROVA 2FNQA 3CPOA 2KF3A 3RGAA 3VSYA 3CC23 1HZ1A 3NXJA 1LRAA 2KCDA 2CX1A 1R4CA 1OUNA 3SOYA 5D82A 1RKYA 1NU3A 1Q7HA 3VF1A 3K0ZA 1FGOA 4X2HA 3WHOA 2F4YA 1B21A 5AIIA 1GOYA 2A15A 1K9M4 1I3FA 3RGRA 2W04A 3NBRA 2I9WA 3IPTA 2XSHB 1MWSA 1SPUA 3OX9A 3GWRA 4JF8A 3KIIA 1UCIA 1BSDA 1JB2A 2IUKA 1RJOA 3GZYB 5IF6A 3I553 3WA3A 9RNTA 1YVSA 1BNSA 3F14A 1OF5B 5CK6A 3D79A 3WDGB 5AIHA 4XDVA 3NM2A 3UL6A 1FGMA 1VQK3 1YI23 1IT7A 4RZMA 5LC6A 3D3LA 3DGYA 1MOLA 1ROAA 1T2IA 4HAAA 5BVBA 3OW22 5G2GA 1IQXA 3M8CA 5CF1A 1VQP3 2L4VA 1O7WB 4OVMA 2E2UA 1JN5B 2F5WA 1GD4A 1OF5A 5D83A 4NHFA 1JB5A 5A0OB 1FZUA 1FA3A 1BRJA 1B27A 1W6YA 5JBSA 1X1XA 1GYBA 1UCLA 1BOXA 1MGWA 3UB1A 1FW7A 2O9UX 2HMKB 3BNBA 1EUIC 1SARA 3X40A 1Q7Y4 3LTCA 1RSNA 1E3VA 4AKZA 1GSPA 3EQQB 3T8UA 3JUQA 2QEX3 1Y4KA 1OACA 1UCKA 2XSOB 1C54A 1DMMA 2E2TA 2WGOA 3FLJA 3JUNA 1JV2B 5IW9A 1UUVB 1YJN3 2CWTA 1IU7A 5D81A 4HJLB 4R9LA 1NB3I 1SIIA 1GY6A 4HM0B 1AV4A 2W2CA 3E99A 3Q2PA 3K63A 2ML5A 5G1KA 2HMLB 3URPA 4EC6A 1K41A 1DVCA 1S5AA 3LTBA 5GSPA 5KP1A 1S723 3LOYA 1M1K4 1BRNL 2OOVA 1G0TA 1B2UA 4WFOA 1VQQA 3DGLA 4HM3B 4ZM8A 2CFWA 3FG1A 2OCTA 3I0YA 4QWTA 1G02A 2XF3A 3WOFB 1JKGB 2M7OA 3PCSA 1PY3A 4FCJA 2XEPA 4FMCA 2CK3H 1RGGA 4U13A 3LMLA 1Q42A 5AI1A 1GOUA 3WA2X 3EX9A 2YFLB 1GMQA 1GY7A 4HYZA 1I70A 3JUMA 1V57A 4EBGA 2INXA 1OGZA 1NO3A 1NNVA 1RNTA 1N8QA 1RTUA 2HMNB 1TU5A 4O8SA 1Q814 5AIFA 4CCVA 3HIGA 4CDLA 1B2SA 1MWTA 2GSPA 2H0IA 5JPUA 3FH1A 1RRHA 1FYSA 3AHWA 1BGSA 1W4NA 8CHOA 3G713 1B2MA 3QK9A 2HMOB 5FGOA 3CMA3 1BNEA 1HU9A 4STDA 1STFI 4H61A 5CLKA 3ALAA 3Q90A 1VQ73 1HYFA 1FUWA 4FMDA 1VQM3 1LOYA 4IPBA 1NWWA 6GSPA 1KWIA 3X3YA 3KSED 3G8ZA 3LTDA 5IG5A 1GMPA 4WYKA 3DM8A 2H0HA 3UJMA 4MMYB 2K0MA 3K7CA 3NUVA 5CF2A 2AADA 1BNFA 1BSAA 2HMMB 1BNJA 1YIJ3 2MC8A 3ER7A 2JDIH 1DETA 3EHCA 2PNCA 4L8PA 1YVBI 1VQL3 1TRPA 4R1KA 2IUJA 3PCRA 3SOAA 2B24B 3V98A 1T3BA 1YGEA 2KF6A 3F8XA 1IQ8A 1BU4A 1BRKA 1Z1SA 3DGOA 2SARA 1NB5I 1JZOA 3F40A 3BU4A 3MG1A 4XDWA 4J5GA 1RGEA 1RGKA 2P0MA 2Y73A 1HKXA 3KSPA 3Q1CA 1GS3A 4I4KA 3FSDA 4GSPA 3D4AA 1Q824 4J9AA 2R4IA 3MSOA 3RDEA 4BL3A 3CCU3 1OH0A 1TTOA 2CX0A 1NDOB 1RLSA 1U5OA 2Z77A 4PEJA 1VQ63 3CCQ3 4HM4B 1V74A 1ZX2A 1OHOA 1VQO3 1UW1A 1KSIA 1T2HA 4H3UA 7GSPA 3AMOB 1QVG2 3KZTA 3CNMA 5RNTA 3H3HA 4MMZB 4AEQA 2GEYA 1W2B2 3DXOA 3MKIA 6RNTA 1QJGA 2P05A 2OTL3 4NREA 1UGHI 2K54A 1YJ93 1W7CA 3NM7A 4N6MA 2CH9A 4HBRA 2RCDA 3CD63 1RN1A 1WNHA 3CME3 2ML6A 1W6CA 3I563 3G6E3 3JUOA 3AMOA 4N6LA 1I2GA 1LNHA 1LQGC 5CXOA 3CU3A 3B7CA 4N6OB 1IQYA 1K8A4 1BNIA 3V99A 1Q864 1BRSA 3JUPA 2GXFA 3DH2A 1K28A 3L0RA 4BTXA 2BO9B 4GHOA 1AQZA 3KE7A 1STDA 3OWSA 1IT8A 1I3IA 3DZLA 2CHCA 3BIRA 1CEWI 1X1WA 1IVVA 1WMPA 3HOHA 4HM5B 3D9RA 3DGMA 4ORLA 1N5PA 1N9EA 1O7GB 2PZVA 2ZA4A 1A2PA 2J8XB 4IIAA 3CXC2 4LZIA 5LC7A 1O7PB 4Q53A 3B4PA 5ELUA 3GRDA 1BIRA 4KVHA 5TGNA 4AKYA 3S67A 2D42A 1JN5A 3MHEA 2XR8B 1BRHA 2CG0A 1ULIB 3QRDA 1M1XB 3ECFA 1CH0A 3CC73 4XB5A 4MJDA 2BMQB 2RBIA 2W9PA 1A2VA 2Y74A 4HZBB 3S28A 5IERA 1K734 7STDA 1X1UA 1BVIA 2GU1A 1EA2A 1W5ZA 3F7XA 3SYUA 3T0UA 2FGTA 4O3VA 2B1XB 1QAKA 2WOFA 2CFKA 3LT9A 1VQ43 8RNTA 3ZFZA 4R9KA 3GAXA 4HM1B 5AYRB 2YFJB 5IG4A 1KD14 4FCMA 2XH9A 1O7MB 3SEDA 4L8OA 3BNCA 2XRXB 4KT3B 5STDA 4XM4A 3BB9A 3HX8A 1LXEA 1ZO2A 1W01A 2BNGA 3AGOA 4BTYA 1LNIA 1WTHA 2XFTA 1JBTA 4XBYA 2BIRA 1CYUA 1QALA 1IVUA 3IMAB 2OOVC 4KFDA 4HVNA 5BXQA 1U8CB 2IMJA 4K1UA 3K5TA 5EVHA 2P38A 1PYLA 4KFFA 5AEWB 1BSCA 1MNLA 3EB8A 4OK0A 2AAEA 4XBXA 2H0GA 1LOVA 1ZGXA 2LQVA 1RGFA 2BHMA 3EF8A 1D6ZA 1JKGA 3BNEA 1NJI4 4MMXB 4N6TA 4L7KA 3S29A 4KFEA 4BL2A 4HM7B 2F56A 2F86B 2JQ5A 3NBJA 3IJEB 1OPYA 3WR2A 1W02A 4K61A 1WQLB 4N6UA 1B20A 3HK4A 4FMBA 5DRVA 3OWUA 3LYGA 3CC43 1I8VA 1E3RA 1IDPA 1PFPA 3BNDA 4BTWA 1A2KA 1FUSA 4MEIA 1VQ83 4K90B 1YNVX 2KF4A 3CCS3 4OUQA 3CPW2 4R80A 3LXUX 2QA43 1OHPA 1V58A 3FKAA 3N9HA 4GB5A 1IV9A 3EN8A 2IY2A 3SXXA 4LSOA 4BU4A 3S27A 1JJ22 1MWRA 1RGCA 2RNTA 3EJVA 4LGQA 1A67A 4DKIA 1TUHA 1RGLA 2CW9A 3STDA 3CCM3 2F98A 3A5EA 2CWUA 2KAAA 1G96A 4CPKA 2P09A 2RGQA 3AGNA 3RNTA 3N8BA 3DY5A 1RNBA 1A90A 2P0XA 1JNQA 2V1LA 3G0KA 4ILFA 3TDGA 2W56B 5AYSC 2BMOB 1O7HB 3EE1A 2CFLA 2GU3A 2ZHXB 3LTAA 3SX1A 5M1AA 1LOWA 4LYLB 4J5KA 4N6V0 5AIGA 1YJW3 1SJWA 4EV2A 3B8LA 1RN4A 1UUWB 1ULJB 2CWVA 1RDSA 1J2BA 1L5GB 1M9GA 1IK3A 2C11A 4LMIA 3FZWA 1OHSA 3KKGA 5G1LA 3FG4A 1TIJA 2K3DA 1W2ZA 2UX0A 2W56A 4EW5A 3VGNA 2ZL8A 5JPPA 2W9QA 2HMJB 2QIYA 2WO0A 3N54B 3EBYA 4O2HA 7RNTA 1UDII 1IVXA 1GD3A 1VQ53 1I0VA 1W6GA 3KFQC 1TRQA 2STDA 3MWZA 2R41A 4EXRA 2YFIB 5M18A 1AVLA 1AVKA 2W03A 3Q3FA 1W00A 5BU4A 1FGRA 5HOHA 3MG3A 1LVNA 1KQS2 1DYUA 1KC84 1BSBA 1BAOA 4FR9A 3S5CA 1BNGA 3KN4A 5EEOA 1F8NA 1RGAA 3F9SA 1IV7A 4R4KA 3LZAA 3KCHA 4WP5A 3MG2A 3G4S3 1TP6A 2IA7A 1FGQA 3OV4A 3FG3A 1ASKA 2CG1A 1JBSA 2XGNA 2BT3A 4LEHA 3CNXA 1I2FA 5FW5A 3FCSB 4K1VA 2OWPA 4TX4A 3CCJ3 1US1A 2UGIA 1AY7A 5EQLA 4NPBA 1DMNA 1E97A 3OXAA 1OGXA 1CQSA 1LQMB 1X1YA 1YGWA 3U97A 1BRIA 1T5YA 1RRLA 1UUGB 2Z76A 3D5GA 1RMSA 2YX9A 4BIRA 1SIHA 3AHSA 2C4BA 1Q9EA 3DUKA 4I5QA 3CCR3 1N8R4 1FGTA 1UI7A 1ISKA 5AEUB 1BNRA 1RCLA 1BSEA 1EKMA 3EBTA 2CIUA 1GY5A 4GL6A 2GBXB 3HIIA 1DE3A 3GSPA 2D1WA 2Q07A 2XGLA 2XFSA 2Z7AA 5HGRA 3CCV3 2Z6BA 3OWYA 3J7Yd 1JRQA 3O8YA 1LOXA 3GZRA 1PU4A 4JRFA 2O3OA 3K9MC 2LYXA 3PS8A 3FF2A 3D5IA 1IYYA 3X3XA 1SQWA 1VZZA 3LH4A 4N3VA 5BIRA 1R4YA 2CFGA 2MF7A 3CCL3 2E2VA 2UUGC 3WODG 4HM2B 3MPHA 3ZG0A 3MYTA 2KXGA 3FF0A 1AR0A 2F5MA 1DVDA 5IEPA 4XBTA 1BANA 1GMRA 1QAFA 3LT8A 1WMNA 4HZ9B 1B2XA 1MWUA 4HM6B 3JVCA 3PGBA 3SVAA 3HI7A 4CJNA 1YHQ3 1ZS7A 5ELJA 2CC3A 1I0XA 2GEXA 5DREA
chains in the Genus database with same CATH topology
5IG3A 1N5HA 3UL5A 3WMDA 1IVWA 2W6JH 3WOEB 2W0QA 4EV5A 3GZXB 2CFDA 2QGUA 3UNLA 4N6NB 3NHXA 4IT7A 3NQZA 1D6UA 3EN1B 1VQ93 2C10A 2FXTA 5IENA 5IEOA 2GBWB 4EYCA 1QVF2 3HZPA 1OCVA 4WHAA 4WWUC 1EG9B 3X42A 4G1MB 1CYVA 4FMAA 3NBBA 1C7HA 3A76A 3DGNA 4X2OA 1EQKA 5KP3A 4HKVB 5KP4A 4RNZA 4WYKB 2RSXA 3H51A 1N9JA 1D6YA 1O7NB 3NV0B 3PXMA 3X41A 2ZDJA 4FCZA 2WOHA 3CCE3 2WGQA 3T8NA 3U1WA 1Q40B 1VQN3 4HM8B 3DMCA 3G16A 4J8TA 3NX0A 4O02B 3EC9A 3V92A 1QMAA 1WMOA 2OQEA 3FGYA 1YIT3 3PZWA 3F8HA 1DMQA 1TFOA 3NV0A 3NQYA 3X3ZA 2RFRA 2OTJ3 1TFKA 3BLZA 1BUQA 2OQEC 5IG0A 3F7SA 1Q40A 3GZBA 2F99A 3PYJA 1UI8A 3B4OA 4KZ1A 3ROBA 4RNYA 1JB4A 2KRTA 3SLUA 2SBLA 2CKFB 1M904 2BMRB 5I97A 6STDA 4RBNA 1RN7A 1ROVA 2FNQA 3CPOA 3RGAA 3VSYA 3CC23 3NXJA 2KCDA 1R4CA 1OUNA 3SOYA 5D82A 1RKYA 1NU3A 3VF1A 3K0ZA 1FGOA 4X2HA 5AIIA 2A15A 1K9M4 3RGRA 2W04A 3NBRA 2I9WA 3IPTA 2XSHB 1SPUA 3OX9A 3GWRA 4JF8A 3KIIA 2IUKA 1JB2A 3GZYB 1RJOA 5IF6A 3I553 3WA3A 3F14A 1OF5B 5CK6A 3WDGB 5AIHA 4XDVA 3NM2A 3UL6A 1FGMA 1VQK3 1YI23 1IT7A 4RZMA 5LC6A 3D3LA 1MOLA 1ROAA 3OW22 5BVBA 5G2GA 1IQXA 3M8CA 5CF1A 1VQP3 2L4VA 1O7WB 4OVMA 2E2UA 1JN5B 1GD4A 1OF5A 5D83A 4NHFA 1JB5A 5A0OB 1FA3A 1W6YA 5JBSA 1GYBA 3UB1A 2O9UX 2HMKB 3BNBA 3X40A 1Q7Y4 3LTCA 1E3VA 4AKZA 3EQQB 3T8UA 3JUQA 2QEX3 1Y4KA 1OACA 2XSOB 1DMMA 2E2TA 2WGOA 3FLJA 3JUNA 1JV2B 5IW9A 1UUVB 1YJN3 2CWTA 1IU7A 5D81A 4HJLB 4R9LA 1NB3I 1SIIA 1GY6A 4HM0B 1AV4A 2W2CA 3E99A 3Q2PA 3K63A 2ML5A 2HMLB 5KP1A 4EC6A 1K41A 1DVCA 1S5AA 3LTBA 1S723 3LOYA 1M1K4 2OOVA 4WFOA 4HM3B 3DGLA 4ZM8A 2CFWA 3FG1A 2OCTA 3I0YA 4QWTA 2XF3A 3WOFB 1Q824 1JKGB 2M7OA 3PCSA 4FCJA 4FMCA 2XEPA 4U13A 2CK3H 3LMLA 1Q42A 5AI1A 3WA2X 3EX9A 2YFLB 1GY7A 4HYZA 3JUMA 4EBGA 2INXA 1OGZA 1NO3A 1N8QA 2HMNB 1TU5A 4O8SA 1Q814 5AIFA 4CCVA 3HIGA 4CDLA 5JPUA 3FH1A 1RRHA 1W4NA 3G713 8CHOA 3QK9A 2HMOB 5FGOA 3CMA3 1HU9A 4STDA 1STFI 4H61A 5CLKA 3ALAA 3Q90A 1VQ73 1FUWA 4FMDA 1VQM3 4IPBA 1NWWA 1KWIA 3X3YA 3KSED 3G8ZA 3LTDA 5IG5A 4WYKA 3UJMA 3DM8A 4MMYB 2K0MA 3K7CA 3NUVA 5CF2A 2HMMB 1YIJ3 2MC8A 3ER7A 2JDIH 3EHCA 2PNCA 4L8PA 1YVBI 1VQL3 4R1KA 2IUJA 3PCRA 3SOAA 2B24B 3V98A 1YGEA 3F8XA 1IQ8A 1Z1SA 3DGOA 1NB5I 3F40A 3MG1A 4XDWA 2P0MA 2Y73A 1HKXA 3KSPA 3Q1CA 1GS3A 4I4KA 3FSDA 4J9AA 2R4IA 3MSOA 3RDEA 3CCU3 1OH0A 2Z77A 4PEJA 1NDOB 1U5OA 1VQ63 3CCQ3 4HM4B 1V74A 1ZX2A 1OHOA 1VQO3 1UW1A 1KSIA 4H3UA 3AMOB 1QVG2 3KZTA 3CNMA 3H3HA 4MMZB 4AEQA 2GEYA 1W2B2 3DXOA 3MKIA 1QJGA 2P05A 2OTL3 4NREA 2K54A 1YJ93 1W7CA 3NM7A 4N6MA 2CH9A 4HBRA 2RCDA 3CD63 1WNHA 3CME3 2ML6A 1W6CA 3I563 3G6E3 3JUOA 3AMOA 4N6LA 1LNHA 5CXOA 3CU3A 3B7CA 4N6OB 1IQYA 1K8A4 3V99A 1Q864 3JUPA 2GXFA 1K28A 3L0RA 4BTXA 2BO9B 3KE7A 1STDA 3OWSA 1IT8A 3DZLA 2CHCA 1CEWI 1IVVA 1WMPA 4HM5B 3D9RA 3DGMA 4ORLA 1N5PA 1N9EA 1O7GB 2PZVA 4IIAA 3CXC2 4LZIA 5LC7A 1O7PB 4Q53A 3B4PA 5ELUA 3GRDA 4KVHA 4AKYA 5TGNA 3S67A 2D42A 1JN5A 3MHEA 2XR8B 2CG0A 3QRDA 1ULIB 1M1XB 3ECFA 3CC73 4XB5A 4MJDA 2BMQB 2W9PA 1A2VA 4HZBB 3S28A 5IERA 1K734 7STDA 2GU1A 1EA2A 1W5ZA 3F7XA 3T0UA 2FGTA 4O3VA 2B1XB 1QAKA 2WOFA 2CFKA 3LT9A 1VQ43 4R9KA 3GAXA 4HM1B 5AYRB 2YFJB 5IG4A 1KD14 4FCMA 2XH9A 1O7MB 3SEDA 4L8OA 3BNCA 2XRXB 5STDA 4XM4A 3BB9A 3HX8A 1LXEA 1ZO2A 1W01A 2BNGA 4BTYA 1WTHA 2XFTA 4XBYA 1CYUA 1QALA 1IVUA 3IMAB 2OOVC 4KFDA 4HVNA 5BXQA 1U8CB 2IMJA 4K1UA 3K5TA 5EVHA 2P38A 4KFFA 5AEWB 1MNLA 3EB8A 4OK0A 4XBXA 2LQVA 1NJI4 2BHMA 3EF8A 1D6ZA 1JKGA 3BNEA 4MMXB 4N6TA 4L7KA 3S29A 4KFEA 4HM7B 2F86B 2JQ5A 3NBJA 3IJEB 1OPYA 1W02A 4K61A 1WQLB 4N6UA 3HK4A 4FMBA 5DRVA 3OWUA 3LYGA 3CC43 1E3RA 1IDPA 1PFPA 3BNDA 4BTWA 1A2KA 4MEIA 1VQ83 4K90B 3CCS3 4OUQA 3CPW2 4R80A 3LXUX 2QA43 1OHPA 3FKAA 3N9HA 4GB5A 1IV9A 3EN8A 3SXXA 4LSOA 3S27A 1JJ22 3EJVA 4LGQA 1A67A 1TUHA 2CW9A 3STDA 3CCM3 2F98A 2CWUA 1G96A 2P09A 2RGQA 3N8BA 3DY5A 1A90A 2P0XA 1JNQA 2V1LA 3G0KA 3TDGA 2W56B 5AYSC 2BMOB 1O7HB 3EE1A 2CFLA 2GU3A 3LTAA 3SX1A 4N6V0 5AIGA 1YJW3 1SJWA 4EV2A 3B8LA 1UUWB 1ULJB 2CWVA 1J2BA 1L5GB 1M9GA 1IK3A 2C11A 4LMIA 3FZWA 1OHSA 3KKGA 3FG4A 1TIJA 1W2ZA 2UX0A 2W56A 3VGNA 2ZL8A 5JPPA 2W9QA 2HMJB 2QIYA 2WO0A 3N54B 3EBYA 4O2HA 1IVXA 1GD3A 1VQ53 1W6GA 3KFQC 2STDA 3MWZA 4EXRA 2YFIB 1AVLA 1AVKA 2W03A 1W00A 1FGRA 3MG3A 1LVNA 1KQS2 1DYUA 1KC84 4FR9A 3S5CA 3KN4A 5EEOA 1F8NA 3F9SA 1IV7A 4R4KA 3LZAA 4WP5A 3MG2A 3G4S3 1TP6A 2IA7A 1FGQA 3OV4A 3FG3A 1ASKA 2CG1A 2XGNA 2BT3A 4LEHA 3CNXA 5FW5A 3FCSB 4K1VA 2OWPA 4TX4A 3CCJ3 1US1A 5EQLA 1DMNA 1E97A 3OXAA 1OGXA 1CQSA 3U97A 1T5YA 1RRLA 2Z76A 2YX9A 1SIHA 3DUKA 3CCR3 1N8R4 1FGTA 1UI7A 1ISKA 5AEUB 3EBTA 1EKMA 2CIUA 1GY5A 4GL6A 2GBXB 3HIIA 2D1WA 2Q07A 2XGLA 2XFSA 2Z7AA 5HGRA 3CCV3 2Z6BA 3OWYA 3J7Yd 1JRQA 3O8YA 1LOXA 3GZRA 1PU4A 4JRFA 2O3OA 3K9MC 2LYXA 3PS8A 3FF2A 3X3XA 1SQWA 1VZZA 3LH4A 4N3VA 2CFGA 2MF7A 3CCL3 2E2VA 3WODG 4HM2B 3MPHA 3MYTA 2KXGA 3FF0A 1AR0A 1DVDA 5IEPA 4XBTA 1QAFA 3LT8A 4HZ9B 1WMNA 4HM6B 3JVCA 3PGBA 3SVAA 3HI7A 1YHQ3 5ELJA 2CC3A 2Y74A 2GEXA 5DREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5H A;  5A0O B;  1FA3 A;  3UL5 A;  1G96 A;  1WNH A;  2O9U X;  1A90 A;  4N6L A;  4N6N B;  4IT7 A;  4N6O B;  4EYC A;  4N6V 0;  3L0R A;  2BO9 B;  1M9G A;  1CYV A;  1CEW I;  1TIJ A;  1EQK A;  1NB3 I;  2W9Q A;  1N9J A;  1N5P A;  3Q2P A;  1DVC A;  3PXM A;  1GD3 A;  4ZM8 A;  2OCT A;  4LZI A;  3KFQ C;  3NX0 A;  5LC7 A;  3MWZ A;  5ELU A;  3S67 A;  3QRD A;  2W9P A;  1IV7 A;  4CCV A;  3PYJ A;  4TX4 A;  3GAX A;  5EQL A;  1STF I;  1LXE A;  1FUW A;  1CYU A;  1KWI A;  1RN7 A;  3KSE D;  3IMA B;  1R4C A;  1MNL A;  1YVB I;  4N6T A;  1NB5 I;  3K9M C;  3PS8 A;  4N6U A;  3LH4 A;  1PFP A;  2KXG A;  3UL6 A;  1DVD A;  5LC6 A;  1MOL A;  1ROA A;  1IV9 A;  3SVA A;  5ELJ A;  1GD4 A;  1A67 A;  4N6M A;  2CH9 A; 
#chains in the Genus database with same CATH topology
 5IG3 A;  1N5H A;  1JBR A;  1TJD A;  2IYJ A;  4HOH A;  3UL5 A;  3WMD A;  1IVW A;  2W6J H;  3WOE B;  2W0Q A;  2BU4 A;  2L1S A;  3GZX B;  4EV5 A;  1UCJ A;  2CFD A;  2QGU A;  3UNL A;  4N6N B;  3NHX A;  4IT7 A;  3NQZ A;  1D6U A;  3EN1 B;  1VQ9 3;  2C10 A;  2FXT A;  5IEN A;  5IEO A;  2GBW B;  4EYC A;  1QVF 2;  3HZP A;  1OCV A;  4WHA A;  2HOH A;  4WWU C;  1EG9 B;  1BUJ A;  3X42 A;  4G1M B;  1CYV A;  4FMA A;  3NBB A;  1C7H A;  3A76 A;  3DGN A;  4X2O A;  1GOV A;  5KP3 A;  4HKV B;  5KP4 A;  1EQK A;  4RNZ A;  4WYK B;  2RSX A;  3H51 A;  1N9J A;  1D6Y A;  1O7N B;  3NV0 B;  3PXM A;  1RCK A;  3X41 A;  2ZDJ A;  4FCZ A;  2WOH A;  3CCE 3;  1JZD A;  2WGQ A;  3T8N A;  3U1W A;  1Q40 B;  1VQN 3;  4HM8 B;  3DMC A;  3G16 A;  4J8T A;  3NX0 A;  4O02 B;  3EC9 A;  3V92 A;  1QMA A;  1WMO A;  5M19 A;  2OQE A;  1RHL A;  3FGY A;  1YIT 3;  3PZW A;  1I2E A;  3ZG5 A;  3F8H A;  1DMQ A;  1TFO A;  3NV0 A;  3NQY A;  3X3Z A;  2RFR A;  2OTJ 3;  1TFK A;  3BLZ A;  1BUQ A;  2OQE C;  5IG0 A;  3F7S A;  1BRG A;  1B3S A;  1Q40 A;  3GZB A;  4RNT A;  1UGI A;  1MGR A;  2F99 A;  3PYJ A;  1UI8 A;  3B4O A;  1EEJ A;  4KZ1 A;  3ROB A;  2KF5 A;  4RNY A;  1B2Z A;  1JB4 A;  1FUT A;  2KRT A;  3SLU A;  2SBL A;  2CKF B;  1M90 4;  2BMR B;  5I97 A;  6STD A;  4RBN A;  1RN7 A;  1RGH A;  1ROV A;  2FNQ A;  3CPO A;  2KF3 A;  3RGA A;  3VSY A;  3CC2 3;  1HZ1 A;  3NXJ A;  1LRA A;  2KCD A;  2CX1 A;  1R4C A;  1OUN A;  3SOY A;  5D82 A;  1RKY A;  1NU3 A;  1Q7H A;  3VF1 A;  3K0Z A;  1FGO A;  4X2H A;  3WHO A;  2F4Y A;  1B21 A;  5AII A;  1GOY A;  2A15 A;  1K9M 4;  1I3F A;  3RGR A;  2W04 A;  3NBR A;  2I9W A;  3IPT A;  2XSH B;  1MWS A;  1SPU A;  3OX9 A;  3GWR A;  4JF8 A;  3KII A;  1UCI A;  1BSD A;  1JB2 A;  2IUK A;  1RJO A;  3GZY B;  5IF6 A;  3I55 3;  3WA3 A;  9RNT A;  1YVS A;  1BNS A;  3F14 A;  1OF5 B;  5CK6 A;  3D79 A;  3WDG B;  5AIH A;  4XDV A;  3NM2 A;  3UL6 A;  1FGM A;  1VQK 3;  1YI2 3;  1IT7 A;  4RZM A;  5LC6 A;  3D3L A;  3DGY A;  1MOL A;  1ROA A;  1T2I A;  4HAA A;  5BVB A;  3OW2 2;  5G2G A;  1IQX A;  3M8C A;  5CF1 A;  1VQP 3;  2L4V A;  1O7W B;  4OVM A;  2E2U A;  1JN5 B;  2F5W A;  1GD4 A;  1OF5 A;  5D83 A;  4NHF A;  1JB5 A;  5A0O B;  1FZU A;  1FA3 A;  1BRJ A;  1B27 A;  1W6Y A;  5JBS A;  1X1X A;  1GYB A;  1UCL A;  1BOX A;  1MGW A;  3UB1 A;  1FW7 A;  2O9U X;  2HMK B;  3BNB A;  1EUI C;  1SAR A;  3X40 A;  1Q7Y 4;  3LTC A;  1RSN A;  1E3V A;  4AKZ A;  1GSP A;  3EQQ B;  3T8U A;  3JUQ A;  2QEX 3;  1Y4K A;  1OAC A;  1UCK A;  2XSO B;  1C54 A;  1DMM A;  2E2T A;  2WGO A;  3FLJ A;  3JUN A;  1JV2 B;  5IW9 A;  1UUV B;  1YJN 3;  2CWT A;  1IU7 A;  5D81 A;  4HJL B;  4R9L A;  1NB3 I;  1SII A;  1GY6 A;  4HM0 B;  1AV4 A;  2W2C A;  3E99 A;  3Q2P A;  3K63 A;  2ML5 A;  5G1K A;  2HML B;  3URP A;  4EC6 A;  1K41 A;  1DVC A;  1S5A A;  3LTB A;  5GSP A;  5KP1 A;  1S72 3;  3LOY A;  1M1K 4;  1BRN L;  2OOV A;  1G0T A;  1B2U A;  4WFO A;  1VQQ A;  3DGL A;  4HM3 B;  4ZM8 A;  2CFW A;  3FG1 A;  2OCT A;  3I0Y A;  4QWT A;  1G02 A;  2XF3 A;  3WOF B;  1JKG B;  2M7O A;  3PCS A;  1PY3 A;  4FCJ A;  2XEP A;  4FMC A;  2CK3 H;  1RGG A;  4U13 A;  3LML A;  1Q42 A;  5AI1 A;  1GOU A;  3WA2 X;  3EX9 A;  2YFL B;  1GMQ A;  1GY7 A;  4HYZ A;  1I70 A;  3JUM A;  1V57 A;  4EBG A;  2INX A;  1OGZ A;  1NO3 A;  1NNV A;  1RNT A;  1N8Q A;  1RTU A;  2HMN B;  1TU5 A;  4O8S A;  1Q81 4;  5AIF A;  4CCV A;  3HIG A;  4CDL A;  1B2S A;  1MWT A;  2GSP A;  2H0I A;  5JPU A;  3FH1 A;  1RRH A;  1FYS A;  3AHW A;  1BGS A;  1W4N A;  8CHO A;  3G71 3;  1B2M A;  3QK9 A;  2HMO B;  5FGO A;  3CMA 3;  1BNE A;  1HU9 A;  4STD A;  1STF I;  4H61 A;  5CLK A;  3ALA A;  3Q90 A;  1VQ7 3;  1HYF A;  1FUW A;  4FMD A;  1VQM 3;  1LOY A;  4IPB A;  1NWW A;  6GSP A;  1KWI A;  3X3Y A;  3KSE D;  3G8Z A;  3LTD A;  5IG5 A;  1GMP A;  4WYK A;  3DM8 A;  2H0H A;  3UJM A;  4MMY B;  2K0M A;  3K7C A;  3NUV A;  5CF2 A;  2AAD A;  1BNF A;  1BSA A;  2HMM B;  1BNJ A;  1YIJ 3;  2MC8 A;  3ER7 A;  2JDI H;  1DET A;  3EHC A;  2PNC A;  4L8P A;  1YVB I;  1VQL 3;  1TRP A;  4R1K A;  2IUJ A;  3PCR A;  3SOA A;  2B24 B;  3V98 A;  1T3B A;  1YGE A;  2KF6 A;  3F8X A;  1IQ8 A;  1BU4 A;  1BRK A;  1Z1S A;  3DGO A;  2SAR A;  1NB5 I;  1JZO A;  3F40 A;  3BU4 A;  3MG1 A;  4XDW A;  4J5G A;  1RGE A;  1RGK A;  2P0M A;  2Y73 A;  1HKX A;  3KSP A;  3Q1C A;  1GS3 A;  4I4K A;  3FSD A;  4GSP A;  3D4A A;  1Q82 4;  4J9A A;  2R4I A;  3MSO A;  3RDE A;  4BL3 A;  3CCU 3;  1OH0 A;  1TTO A;  2CX0 A;  1NDO B;  1RLS A;  1U5O A;  2Z77 A;  4PEJ A;  1VQ6 3;  3CCQ 3;  4HM4 B;  1V74 A;  1ZX2 A;  1OHO A;  1VQO 3;  1UW1 A;  1KSI A;  1T2H A;  4H3U A;  7GSP A;  3AMO B;  1QVG 2;  3KZT A;  3CNM A;  5RNT A;  3H3H A;  4MMZ B;  4AEQ A;  2GEY A;  1W2B 2;  3DXO A;  3MKI A;  6RNT A;  1QJG A;  2P05 A;  2OTL 3;  4NRE A;  1UGH I;  2K54 A;  1YJ9 3;  1W7C A;  3NM7 A;  4N6M A;  2CH9 A;  4HBR A;  2RCD A;  3CD6 3;  1RN1 A;  1WNH A;  3CME 3;  2ML6 A;  1W6C A;  3I56 3;  3G6E 3;  3JUO A;  3AMO A;  4N6L A;  1I2G A;  1LNH A;  1LQG C;  5CXO A;  3CU3 A;  3B7C A;  4N6O B;  1IQY A;  1K8A 4;  1BNI A;  3V99 A;  1Q86 4;  1BRS A;  3JUP A;  2GXF A;  3DH2 A;  1K28 A;  3L0R A;  4BTX A;  2BO9 B;  4GHO A;  1AQZ A;  3KE7 A;  1STD A;  3OWS A;  1IT8 A;  1I3I A;  3DZL A;  2CHC A;  3BIR A;  1CEW I;  1X1W A;  1IVV A;  1WMP A;  3HOH A;  4HM5 B;  3D9R A;  3DGM A;  4ORL A;  1N5P A;  1N9E A;  1O7G B;  2PZV A;  2ZA4 A;  1A2P A;  2J8X B;  4IIA A;  3CXC 2;  4LZI A;  5LC7 A;  1O7P B;  4Q53 A;  3B4P A;  5ELU A;  3GRD A;  1BIR A;  4KVH A;  5TGN A;  4AKY A;  3S67 A;  2D42 A;  1JN5 A;  3MHE A;  2XR8 B;  1BRH A;  2CG0 A;  1ULI B;  3QRD A;  1M1X B;  3ECF A;  1CH0 A;  3CC7 3;  4XB5 A;  4MJD A;  2BMQ B;  2RBI A;  2W9P A;  1A2V A;  2Y74 A;  4HZB B;  3S28 A;  5IER A;  1K73 4;  7STD A;  1X1U A;  1BVI A;  2GU1 A;  1EA2 A;  1W5Z A;  3F7X A;  3SYU A;  3T0U A;  2FGT A;  4O3V A;  2B1X B;  1QAK A;  2WOF A;  2CFK A;  3LT9 A;  1VQ4 3;  8RNT A;  3ZFZ A;  4R9K A;  3GAX A;  4HM1 B;  5AYR B;  2YFJ B;  5IG4 A;  1KD1 4;  4FCM A;  2XH9 A;  1O7M B;  3SED A;  4L8O A;  3BNC A;  2XRX B;  4KT3 B;  5STD A;  4XM4 A;  3BB9 A;  3HX8 A;  1LXE A;  1ZO2 A;  1W01 A;  2BNG A;  3AGO A;  4BTY A;  1LNI A;  1WTH A;  2XFT A;  1JBT A;  4XBY A;  2BIR A;  1CYU A;  1QAL A;  1IVU A;  3IMA B;  2OOV C;  4KFD A;  4HVN A;  5BXQ A;  1U8C B;  2IMJ A;  4K1U A;  3K5T A;  5EVH A;  2P38 A;  1PYL A;  4KFF A;  5AEW B;  1BSC A;  1MNL A;  3EB8 A;  4OK0 A;  2AAE A;  4XBX A;  2H0G A;  1LOV A;  1ZGX A;  2LQV A;  1RGF A;  2BHM A;  3EF8 A;  1D6Z A;  1JKG A;  3BNE A;  1NJI 4;  4MMX B;  4N6T A;  4L7K A;  3S29 A;  4KFE A;  4BL2 A;  4HM7 B;  2F56 A;  2F86 B;  2JQ5 A;  3NBJ A;  3IJE B;  1OPY A;  3WR2 A;  1W02 A;  4K61 A;  1WQL B;  4N6U A;  1B20 A;  3HK4 A;  4FMB A;  5DRV A;  3OWU A;  3LYG A;  3CC4 3;  1I8V A;  1E3R A;  1IDP A;  1PFP A;  3BND A;  4BTW A;  1A2K A;  1FUS A;  4MEI A;  1VQ8 3;  4K90 B;  1YNV X;  2KF4 A;  3CCS 3;  4OUQ A;  3CPW 2;  4R80 A;  3LXU X;  2QA4 3;  1OHP A;  1V58 A;  3FKA A;  3N9H A;  4GB5 A;  1IV9 A;  3EN8 A;  2IY2 A;  3SXX A;  4LSO A;  4BU4 A;  3S27 A;  1JJ2 2;  1MWR A;  1RGC A;  2RNT A;  3EJV A;  4LGQ A;  1A67 A;  4DKI A;  1TUH A;  1RGL A;  2CW9 A;  3STD A;  3CCM 3;  2F98 A;  3A5E A;  2CWU A;  2KAA A;  1G96 A;  4CPK A;  2P09 A;  2RGQ A;  3AGN A;  3RNT A;  3N8B A;  3DY5 A;  1RNB A;  1A90 A;  2P0X A;  1JNQ A;  2V1L A;  3G0K A;  4ILF A;  3TDG A;  2W56 B;  5AYS C;  2BMO B;  1O7H B;  3EE1 A;  2CFL A;  2GU3 A;  2ZHX B;  3LTA A;  3SX1 A;  5M1A A;  1LOW A;  4LYL B;  4J5K A;  4N6V 0;  5AIG A;  1YJW 3;  1SJW A;  4EV2 A;  3B8L A;  1RN4 A;  1UUW B;  1ULJ B;  2CWV A;  1RDS A;  1J2B A;  1L5G B;  1M9G A;  1IK3 A;  2C11 A;  4LMI A;  3FZW A;  1OHS A;  3KKG A;  5G1L A;  3FG4 A;  1TIJ A;  2K3D A;  1W2Z A;  2UX0 A;  2W56 A;  4EW5 A;  3VGN A;  2ZL8 A;  5JPP A;  2W9Q A;  2HMJ B;  2QIY A;  2WO0 A;  3N54 B;  3EBY A;  4O2H A;  7RNT A;  1UDI I;  1IVX A;  1GD3 A;  1VQ5 3;  1I0V A;  1W6G A;  3KFQ C;  1TRQ A;  2STD A;  3MWZ A;  2R41 A;  4EXR A;  2YFI B;  5M18 A;  1AVL A;  1AVK A;  2W03 A;  3Q3F A;  1W00 A;  5BU4 A;  1FGR A;  5HOH A;  3MG3 A;  1LVN A;  1KQS 2;  1DYU A;  1KC8 4;  1BSB A;  1BAO A;  4FR9 A;  3S5C A;  1BNG A;  3KN4 A;  5EEO A;  1F8N A;  1RGA A;  3F9S A;  1IV7 A;  4R4K A;  3LZA A;  3KCH A;  4WP5 A;  3MG2 A;  3G4S 3;  1TP6 A;  2IA7 A;  1FGQ A;  3OV4 A;  3FG3 A;  1ASK A;  2CG1 A;  1JBS A;  2XGN A;  2BT3 A;  4LEH A;  3CNX A;  1I2F A;  5FW5 A;  3FCS B;  4K1V A;  2OWP A;  4TX4 A;  3CCJ 3;  1US1 A;  2UGI A;  1AY7 A;  5EQL A;  4NPB A;  1DMN A;  1E97 A;  3OXA A;  1OGX A;  1CQS A;  1LQM B;  1X1Y A;  1YGW A;  3U97 A;  1BRI A;  1T5Y A;  1RRL A;  1UUG B;  2Z76 A;  3D5G A;  1RMS A;  2YX9 A;  4BIR A;  1SIH A;  3AHS A;  2C4B A;  1Q9E A;  3DUK A;  4I5Q A;  3CCR 3;  1N8R 4;  1FGT A;  1UI7 A;  1ISK A;  5AEU B;  1BNR A;  1RCL A;  1BSE A;  1EKM A;  3EBT A;  2CIU A;  1GY5 A;  4GL6 A;  2GBX B;  3HII A;  1DE3 A;  3GSP A;  2D1W A;  2Q07 A;  2XGL A;  2XFS A;  2Z7A A;  5HGR A;  3CCV 3;  2Z6B A;  3OWY A;  3J7Y d;  1JRQ A;  3O8Y A;  1LOX A;  3GZR A;  1PU4 A;  4JRF A;  2O3O A;  3K9M C;  2LYX A;  3PS8 A;  3FF2 A;  3D5I A;  1IYY A;  3X3X A;  1SQW A;  1VZZ A;  3LH4 A;  4N3V A;  5BIR A;  1R4Y A;  2CFG A;  2MF7 A;  3CCL 3;  2E2V A;  2UUG C;  3WOD G;  4HM2 B;  3MPH A;  3ZG0 A;  3MYT A;  2KXG A;  3FF0 A;  1AR0 A;  2F5M A;  1DVD A;  5IEP A;  4XBT A;  1BAN A;  1GMR A;  1QAF A;  3LT8 A;  1WMN A;  4HZ9 B;  1B2X A;  1MWU A;  4HM6 B;  3JVC A;  3PGB A;  3SVA A;  3HI7 A;  4CJN A;  1YHQ 3;  1ZS7 A;  5ELJ A;  2CC3 A;  1I0X A;  2GEX A;  5DRE A; 
#chains in the Genus database with same CATH homology
 5IG3 A;  1N5H A;  3UL5 A;  3WMD A;  1IVW A;  2W6J H;  3WOE B;  2W0Q A;  4EV5 A;  3GZX B;  2CFD A;  2QGU A;  3UNL A;  4N6N B;  3NHX A;  4IT7 A;  3NQZ A;  1D6U A;  3EN1 B;  1VQ9 3;  2C10 A;  2FXT A;  5IEN A;  5IEO A;  2GBW B;  4EYC A;  1QVF 2;  3HZP A;  1OCV A;  4WHA A;  4WWU C;  1EG9 B;  3X42 A;  4G1M B;  1CYV A;  4FMA A;  3NBB A;  1C7H A;  3A76 A;  3DGN A;  4X2O A;  1EQK A;  5KP3 A;  4HKV B;  5KP4 A;  4RNZ A;  4WYK B;  2RSX A;  3H51 A;  1N9J A;  1D6Y A;  1O7N B;  3NV0 B;  3PXM A;  3X41 A;  2ZDJ A;  4FCZ A;  2WOH A;  3CCE 3;  2WGQ A;  3T8N A;  3U1W A;  1Q40 B;  1VQN 3;  4HM8 B;  3DMC A;  3G16 A;  4J8T A;  3NX0 A;  4O02 B;  3EC9 A;  3V92 A;  1QMA A;  1WMO A;  2OQE A;  3FGY A;  1YIT 3;  3PZW A;  3F8H A;  1DMQ A;  1TFO A;  3NV0 A;  3NQY A;  3X3Z A;  2RFR A;  2OTJ 3;  1TFK A;  3BLZ A;  1BUQ A;  2OQE C;  5IG0 A;  3F7S A;  1Q40 A;  3GZB A;  2F99 A;  3PYJ A;  1UI8 A;  3B4O A;  4KZ1 A;  3ROB A;  4RNY A;  1JB4 A;  2KRT A;  3SLU A;  2SBL A;  2CKF B;  1M90 4;  2BMR B;  5I97 A;  6STD A;  4RBN A;  1RN7 A;  1ROV A;  2FNQ A;  3CPO A;  3RGA A;  3VSY A;  3CC2 3;  3NXJ A;  2KCD A;  1R4C A;  1OUN A;  3SOY A;  5D82 A;  1RKY A;  1NU3 A;  3VF1 A;  3K0Z A;  1FGO A;  4X2H A;  5AII A;  2A15 A;  1K9M 4;  3RGR A;  2W04 A;  3NBR A;  2I9W A;  3IPT A;  2XSH B;  1SPU A;  3OX9 A;  3GWR A;  4JF8 A;  3KII A;  2IUK A;  1JB2 A;  3GZY B;  1RJO A;  5IF6 A;  3I55 3;  3WA3 A;  3F14 A;  1OF5 B;  5CK6 A;  3WDG B;  5AIH A;  4XDV A;  3NM2 A;  3UL6 A;  1FGM A;  1VQK 3;  1YI2 3;  1IT7 A;  4RZM A;  5LC6 A;  3D3L A;  1MOL A;  1ROA A;  3OW2 2;  5BVB A;  5G2G A;  1IQX A;  3M8C A;  5CF1 A;  1VQP 3;  2L4V A;  1O7W B;  4OVM A;  2E2U A;  1JN5 B;  1GD4 A;  1OF5 A;  5D83 A;  4NHF A;  1JB5 A;  5A0O B;  1FA3 A;  1W6Y A;  5JBS A;  1GYB A;  3UB1 A;  2O9U X;  2HMK B;  3BNB A;  3X40 A;  1Q7Y 4;  3LTC A;  1E3V A;  4AKZ A;  3EQQ B;  3T8U A;  3JUQ A;  2QEX 3;  1Y4K A;  1OAC A;  2XSO B;  1DMM A;  2E2T A;  2WGO A;  3FLJ A;  3JUN A;  1JV2 B;  5IW9 A;  1UUV B;  1YJN 3;  2CWT A;  1IU7 A;  5D81 A;  4HJL B;  4R9L A;  1NB3 I;  1SII A;  1GY6 A;  4HM0 B;  1AV4 A;  2W2C A;  3E99 A;  3Q2P A;  3K63 A;  2ML5 A;  2HML B;  5KP1 A;  4EC6 A;  1K41 A;  1DVC A;  1S5A A;  3LTB A;  1S72 3;  3LOY A;  1M1K 4;  2OOV A;  4WFO A;  4HM3 B;  3DGL A;  4ZM8 A;  2CFW A;  3FG1 A;  2OCT A;  3I0Y A;  4QWT A;  2XF3 A;  3WOF B;  1Q82 4;  1JKG B;  2M7O A;  3PCS A;  4FCJ A;  4FMC A;  2XEP A;  4U13 A;  2CK3 H;  3LML A;  1Q42 A;  5AI1 A;  3WA2 X;  3EX9 A;  2YFL B;  1GY7 A;  4HYZ A;  3JUM A;  4EBG A;  2INX A;  1OGZ A;  1NO3 A;  1N8Q A;  2HMN B;  1TU5 A;  4O8S A;  1Q81 4;  5AIF A;  4CCV A;  3HIG A;  4CDL A;  5JPU A;  3FH1 A;  1RRH A;  1W4N A;  3G71 3;  8CHO A;  3QK9 A;  2HMO B;  5FGO A;  3CMA 3;  1HU9 A;  4STD A;  1STF I;  4H61 A;  5CLK A;  3ALA A;  3Q90 A;  1VQ7 3;  1FUW A;  4FMD A;  1VQM 3;  4IPB A;  1NWW A;  1KWI A;  3X3Y A;  3KSE D;  3G8Z A;  3LTD A;  5IG5 A;  4WYK A;  3UJM A;  3DM8 A;  4MMY B;  2K0M A;  3K7C A;  3NUV A;  5CF2 A;  2HMM B;  1YIJ 3;  2MC8 A;  3ER7 A;  2JDI H;  3EHC A;  2PNC A;  4L8P A;  1YVB I;  1VQL 3;  4R1K A;  2IUJ A;  3PCR A;  3SOA A;  2B24 B;  3V98 A;  1YGE A;  3F8X A;  1IQ8 A;  1Z1S A;  3DGO A;  1NB5 I;  3F40 A;  3MG1 A;  4XDW A;  2P0M A;  2Y73 A;  1HKX A;  3KSP A;  3Q1C A;  1GS3 A;  4I4K A;  3FSD A;  4J9A A;  2R4I A;  3MSO A;  3RDE A;  3CCU 3;  1OH0 A;  2Z77 A;  4PEJ A;  1NDO B;  1U5O A;  1VQ6 3;  3CCQ 3;  4HM4 B;  1V74 A;  1ZX2 A;  1OHO A;  1VQO 3;  1UW1 A;  1KSI A;  4H3U A;  3AMO B;  1QVG 2;  3KZT A;  3CNM A;  3H3H A;  4MMZ B;  4AEQ A;  2GEY A;  1W2B 2;  3DXO A;  3MKI A;  1QJG A;  2P05 A;  2OTL 3;  4NRE A;  2K54 A;  1YJ9 3;  1W7C A;  3NM7 A;  4N6M A;  2CH9 A;  4HBR A;  2RCD A;  3CD6 3;  1WNH A;  3CME 3;  2ML6 A;  1W6C A;  3I56 3;  3G6E 3;  3JUO A;  3AMO A;  4N6L A;  1LNH A;  5CXO A;  3CU3 A;  3B7C A;  4N6O B;  1IQY A;  1K8A 4;  3V99 A;  1Q86 4;  3JUP A;  2GXF A;  1K28 A;  3L0R A;  4BTX A;  2BO9 B;  3KE7 A;  1STD A;  3OWS A;  1IT8 A;  3DZL A;  2CHC A;  1CEW I;  1IVV A;  1WMP A;  4HM5 B;  3D9R A;  3DGM A;  4ORL A;  1N5P A;  1N9E A;  1O7G B;  2PZV A;  4IIA A;  3CXC 2;  4LZI A;  5LC7 A;  1O7P B;  4Q53 A;  3B4P A;  5ELU A;  3GRD A;  4KVH A;  4AKY A;  5TGN A;  3S67 A;  2D42 A;  1JN5 A;  3MHE A;  2XR8 B;  2CG0 A;  3QRD A;  1ULI B;  1M1X B;  3ECF A;  3CC7 3;  4XB5 A;  4MJD A;  2BMQ B;  2W9P A;  1A2V A;  4HZB B;  3S28 A;  5IER A;  1K73 4;  7STD A;  2GU1 A;  1EA2 A;  1W5Z A;  3F7X A;  3T0U A;  2FGT A;  4O3V A;  2B1X B;  1QAK A;  2WOF A;  2CFK A;  3LT9 A;  1VQ4 3;  4R9K A;  3GAX A;  4HM1 B;  5AYR B;  2YFJ B;  5IG4 A;  1KD1 4;  4FCM A;  2XH9 A;  1O7M B;  3SED A;  4L8O A;  3BNC A;  2XRX B;  5STD A;  4XM4 A;  3BB9 A;  3HX8 A;  1LXE A;  1ZO2 A;  1W01 A;  2BNG A;  4BTY A;  1WTH A;  2XFT A;  4XBY A;  1CYU A;  1QAL A;  1IVU A;  3IMA B;  2OOV C;  4KFD A;  4HVN A;  5BXQ A;  1U8C B;  2IMJ A;  4K1U A;  3K5T A;  5EVH A;  2P38 A;  4KFF A;  5AEW B;  1MNL A;  3EB8 A;  4OK0 A;  4XBX A;  2LQV A;  1NJI 4;  2BHM A;  3EF8 A;  1D6Z A;  1JKG A;  3BNE A;  4MMX B;  4N6T A;  4L7K A;  3S29 A;  4KFE A;  4HM7 B;  2F86 B;  2JQ5 A;  3NBJ A;  3IJE B;  1OPY A;  1W02 A;  4K61 A;  1WQL B;  4N6U A;  3HK4 A;  4FMB A;  5DRV A;  3OWU A;  3LYG A;  3CC4 3;  1E3R A;  1IDP A;  1PFP A;  3BND A;  4BTW A;  1A2K A;  4MEI A;  1VQ8 3;  4K90 B;  3CCS 3;  4OUQ A;  3CPW 2;  4R80 A;  3LXU X;  2QA4 3;  1OHP A;  3FKA A;  3N9H A;  4GB5 A;  1IV9 A;  3EN8 A;  3SXX A;  4LSO A;  3S27 A;  1JJ2 2;  3EJV A;  4LGQ A;  1A67 A;  1TUH A;  2CW9 A;  3STD A;  3CCM 3;  2F98 A;  2CWU A;  1G96 A;  2P09 A;  2RGQ A;  3N8B A;  3DY5 A;  1A90 A;  2P0X A;  1JNQ A;  2V1L A;  3G0K A;  3TDG A;  2W56 B;  5AYS C;  2BMO B;  1O7H B;  3EE1 A;  2CFL A;  2GU3 A;  3LTA A;  3SX1 A;  4N6V 0;  5AIG A;  1YJW 3;  1SJW A;  4EV2 A;  3B8L A;  1UUW B;  1ULJ B;  2CWV A;  1J2B A;  1L5G B;  1M9G A;  1IK3 A;  2C11 A;  4LMI A;  3FZW A;  1OHS A;  3KKG A;  3FG4 A;  1TIJ A;  1W2Z A;  2UX0 A;  2W56 A;  3VGN A;  2ZL8 A;  5JPP A;  2W9Q A;  2HMJ B;  2QIY A;  2WO0 A;  3N54 B;  3EBY A;  4O2H A;  1IVX A;  1GD3 A;  1VQ5 3;  1W6G A;  3KFQ C;  2STD A;  3MWZ A;  4EXR A;  2YFI B;  1AVL A;  1AVK A;  2W03 A;  1W00 A;  1FGR A;  3MG3 A;  1LVN A;  1KQS 2;  1DYU A;  1KC8 4;  4FR9 A;  3S5C A;  3KN4 A;  5EEO A;  1F8N A;  3F9S A;  1IV7 A;  4R4K A;  3LZA A;  4WP5 A;  3MG2 A;  3G4S 3;  1TP6 A;  2IA7 A;  1FGQ A;  3OV4 A;  3FG3 A;  1ASK A;  2CG1 A;  2XGN A;  2BT3 A;  4LEH A;  3CNX A;  5FW5 A;  3FCS B;  4K1V A;  2OWP A;  4TX4 A;  3CCJ 3;  1US1 A;  5EQL A;  1DMN A;  1E97 A;  3OXA A;  1OGX A;  1CQS A;  3U97 A;  1T5Y A;  1RRL A;  2Z76 A;  2YX9 A;  1SIH A;  3DUK A;  3CCR 3;  1N8R 4;  1FGT A;  1UI7 A;  1ISK A;  5AEU B;  3EBT A;  1EKM A;  2CIU A;  1GY5 A;  4GL6 A;  2GBX B;  3HII A;  2D1W A;  2Q07 A;  2XGL A;  2XFS A;  2Z7A A;  5HGR A;  3CCV 3;  2Z6B A;  3OWY A;  3J7Y d;  1JRQ A;  3O8Y A;  1LOX A;  3GZR A;  1PU4 A;  4JRF A;  2O3O A;  3K9M C;  2LYX A;  3PS8 A;  3FF2 A;  3X3X A;  1SQW A;  1VZZ A;  3LH4 A;  4N3V A;  2CFG A;  2MF7 A;  3CCL 3;  2E2V A;  3WOD G;  4HM2 B;  3MPH A;  3MYT A;  2KXG A;  3FF0 A;  1AR0 A;  1DVD A;  5IEP A;  4XBT A;  1QAF A;  3LT8 A;  4HZ9 B;  1WMN A;  4HM6 B;  3JVC A;  3PGB A;  3SVA A;  3HI7 A;  1YHQ 3;  5ELJ A;  2CC3 A;  2Y74 A;  2GEX A;  5DRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...