3DH2A

Crystal structure of ribonuclease sa2 with guanosine-3'-cyclophosphate prepared by cocrystallization
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
ALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 24
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3dh2A00
1G02A 1RLSA 2RBIA 1BNJA 1RGHA 1UCJA 4HAAA 2F5WA 4RNTA 3AGNA 1I3FA 1FW7A 2AAEA 1A2PA 1X1XA 4GSPA 1BRGA 1X1YA 1BRNL 2KAAA 3DH2A 6RNTA 2C4BA 1BRJA 1BRHA 1LNIA 1RN4A 3WHOA 9RNTA 5BU4A 2HOHA 1CH0A 1UCLA 1BSEA 1RMSA 1BRKA 1I3IA 4HOHA 1Q9EA 1LOVA 3AGOA 1LRAA 1BRSA 1YNVX 4BU4A 1PY3A 1RGLA 3AHSA 3BU4A 1BNEA 1RGAA 1UCIA 4BIRA 1R4YA 1MGWA 6GSPA 1GMQA 1AQZA 3HOHA 1FUSA 1RGKA 3DGYA 8RNTA 1UCKA 1I0XA 1RGGA 5HOHA 1BNFA 1I2EA 2RNTA 1BNSA 5GSPA 3RNTA 1BANA 2GSPA 1GOYA 3AHWA 1BU4A 1TRQA 1I70A 1BSBA 1SARA 1GOUA 2AADA 4J5GA 1DETA 1GSPA 1B3SA 7RNTA 1HZ1A 2F56A 1DE3A 3WR2A 1JBTA 2KF6A 1TRPA 1BVIA 1GMPA 1FUTA 1RCLA 1BIRA 3A5EA 3D5GA 1RDSA 1BUJA 1I0VA 1B21A 1BRIA 3Q3FA 1B27A 1JBSA 1B2UA 1I2GA 1B2XA 1RGEA 1YVSA 4GHOA 1BOXA 5BIRA 3BIRA 3KCHA 1I8VA 1X1UA 2KF3A 1RN1A 1BNGA 4J5KA 1BSDA 2F5MA 1BSAA 1BGSA 1RHLA 1X1WA 1C54A 5RNTA 1BAOA 1JBRA 1MGRA 1RSNA 1RGCA 1RGFA 1IYYA 3D5IA 2ZA4A 1TTOA 1B2SA 1B2ZA 1ZGXA 3SYUA 1B2MA 1RNBA 2BU4A 1RNTA 1PYLA 1FZUA 3URPA 2F4YA 1AY7A 1BNIA 1GMRA 1RCKA 2KF4A 1HYFA 7GSPA 1B20A 1T2HA 3GSPA 1I2FA 2SARA 1BSCA 1T2IA 1YGWA 1LOYA 2KF5A 1GOVA 1RTUA 1BNRA 1LOWA 1FYSA 3D4AA 2BIRA
chains in the Genus database with same CATH superfamily
1IK3A 1YGEA 1JN5A 2CIUA 4U13A 1UGIA 3AMOA 4O2HA 1VQL3 3LXUX 3SLUA 1BRNL 1O7NB 2QEX3 2LQVA 4NPBA 1EG9B 4JF8A 3VGNA 6RNTA 1MNLA 2M7OA 2C4BA 3S27A 2D1WA 1L5GB 1HKXA 3HI7A 3E99A 1V58A 5BU4A 1FGQA 1TP6A 1OACA 3LYGA 1JJ22 4X2OA 3FCSB 3X41A 3GZXB 1I3IA 3LT9A 2W2CA 3VSYA 1EQKA 1S5AA 1OHSA 1YIJ3 2GU1A 2CFLA 2HMKB 1W6GA 3HZPA 3CCS3 3NV0B 2HMMB 2CK3H 1VQ63 2W6JH 2E2TA 1A90A 1CEWI 1RGAA 1UCIA 4LEHA 6GSPA 4PEJA 3CPW2 1VQM3 2OQEA 3LH4A 3FG4A 1I0XA 1QALA 5HOHA 1N8R4 2OTJ3 3ZG5A 1TIJA 2XSHB 2RNTA 4ORLA 1VQO3 4R4KA 2ZDJA 4MMZB 1JZDA 1BNSA 2ML5A 2OOVC 3B4OA 3ZG0A 1IVWA 5M18A 3JUOA 1BANA 2Y74A 3I563 1SIIA 2WO0A 1NO3A 1BU4A 4O3VA 1I70A 3VF1A 3EHCA 1GOUA 4AEQA 2F99A 3F8HA 3NBJA 4FMAA 4FCMA 5ELUA 3ZFZA 2QA43 5CLKA 4CPKA 3X3ZA 1JBTA 2KF6A 5FGOA 1BVIA 1Q864 1RCLA 1BIRA 3NHXA 5D82A 3A5EA 3NBRA 4NREA 4FMBA 3UNLA 2Z77A 3UL6A 1W7CA 2LYXA 3D5GA 3GWRA 4BL2A 3EE1A 6STDA 3EBTA 4HJLB 1VQK3 4RZMA 1WMPA 3EX9A 5IG5A 1F8NA 2CKFB 1DMQA 3LTAA 4FCZA 1JZOA 2W9QA 3LZAA 1YVSA 1IQ8A 1W6CA 2WGOA 4GHOA 3NM7A 4HM8B 3MHEA 1YVBI 2GBWB 1I8VA 3KSPA 5BIRA 1X1UA 1PFPA 2BO9B 4GL6A 1FGOA 4HM0B 2RSXA 3SOYA 4WYKA 4AKYA 1BSDA 1YJN3 5AIHA 2O9UX 1D6YA 1E97A 2KCDA 1RHLA 1ROVA 3DGMA 4BTYA 1C54A 2JDIH 4LMIA 3WOFB 1JBRA 1JV2B 1Q7Y4 1S723 4X2HA 5HGRA 1GD4A 2FNQA 1ZGXA 2CWTA 3EBYA 1JB5A 4CCVA 5AIIA 5TGNA 3MSOA 1NB3I 1FZUA 3FF0A 1ULIB 1AY7A 2XFTA 3BB9A 2BMRB 3JUNA 1RCKA 4DKIA 1O7GB 1B20A 3DZLA 4WFOA 1OHOA 1T2HA 1YJ93 1W6YA 1HU9A 5CF1A 5DREA 1D6ZA 1G0TA 1N5HA 2BHMA 1W2ZA 4IPBA 1YI23 1STDA 4EXRA 1RRLA 5DRVA 4K1UA 5IG3A 2UGIA 1BNRA 1GYBA 4RNYA 1ISKA 2BIRA 4OVMA 1G02A 1OF5A 2RBIA 3OWSA 1RGHA 3TDGA 3DM8A 3SX1A 3LT8A 3FLJA 1STFI 4RNTA 4MMXB 3AGNA 1I3FA 2W9PA 4WP5A 2IUKA 3KFQC 1X1XA 1BRGA 1X1YA 5AEUB 1IV7A 2K0MA 5IW9A 2KAAA 3DH2A 4I4KA 1IV9A 4MJDA 1KWIA 1IU7A 2QIYA 1BRJA 2F86B 1IVVA 3U1WA 9RNTA 3I0YA 2CFWA 3K5TA 3LTCA 1RKYA 1VQN3 2IA7A 1CH0A 1UCLA 1K41A 1RMSA 3GAXA 1FGMA 2GBXB 1GY5A 3GRDA 3RDEA 2W04A 1KC84 4I5QA 2V1LA 1ZO2A 2L4VA 4EYCA 2INXA 5I97A 1IVXA 3X42A 3CCU3 2UX0A 2P09A 3PCSA 2E2VA 2HMOB 2GXFA 1LRAA 3DGLA 2STDA 1K28A 1SPUA 2XF3A 1EA2A 1O7WB 1YNVX 3G6E3 2BNGA 3AHSA 2XRXB 2OQEC 2ZHXB 2IMJA 4EW5A 2CX0A 1R4YA 1RRHA 1GMQA 3IMAB 1ZX2A 2RFRA 1FUSA 3DGYA 3Q90A 1UCKA 3N54B 4FMDA 7STDA 1VQP3 1Q40B 1R4CA 2W03A 3D9RA 1W02A 1O7PB 3B7CA 1RN7A 2CG1A 5JBSA 3SOAA 3NBBA 3SEDA 1GOYA 3IPTA 3AHWA 4FCJA 1CYUA 4EC6A 1BSBA 1K9M4 5CK6A 1SQWA 4JRFA 2JQ5A 3V98A 5G1KA 4J5GA 5IG4A 3Q2PA 2C10A 1DE3A 3LOYA 1W5ZA 3LMLA 5EVHA 3MPHA 4BTWA 4L8OA 5AI1A 1NJI4 1PU4A 3FSDA 3NV0A 1V57A 5EEOA 3GZBA 1BUJA 5AYSC 4K61A 1VQQA 3GZYB 3O8YA 4N6V0 1LNHA 3K7CA 3UJMA 1RJOA 1QMAA 3JVCA 1JB4A 3Q3FA 1MWRA 3X3XA 1LQGC 2Z76A 1B2UA 3B4PA 3PGBA 1IQYA 4H3UA 1B2XA 1RGEA 4CDLA 1SJWA 3F14A 1T3BA 2CFGA 4HBRA 2YFLB 1U8CB 3HK4A 4NHFA 3EN1B 2IUJA 4MMYB 3F7SA 2RGQA 4XBTA 3RGRA 2F5MA 3LTBA 1UUWB 3FGYA 4H61A 5RNTA 2RCDA 2FXTA 1MGRA 2QGUA 5D83A 1Q42A 1SIHA 1RGFA 3QRDA 2BT3A 1JRQA 1M1XB 2ZA4A 4TX4A 1VQ43 1C7HA 2IY2A 3CU3A 1B2SA 2CFKA 3G0KA 1B2MA 2BU4A 1RNTA 2Q07A 3J7Yd 1FUWA 3URPA 3DMCA 1CYVA 5EQLA 4WHAA 4QWTA 1QAFA 1JNQA 4LZIA 1I2FA 2GU3A 3ECFA 4LSOA 3EC9A 3F9SA 5IEOA 1BSCA 1GS3A 1YGWA 4N6LA 3FH1A 4O02B 3S29A 2KF5A 5A0OB 4R1KA 3DY5A 1YJW3 1WQLB 1LOWA 1FYSA 4FMCA 4N6MA 2MC8A 3CD63 2BMQB 4BTXA 1RLSA 2XEPA 3S28A 3CCE3 4G1MB 3CCV3 1FW7A 3BNEA 2Z6BA 1UDII 2ZL8A 2AAEA 2P38A 4R9LA 5FW5A 4XM4A 4HM2B 1CQSA 1JKGB 2K3DA 5IEPA 2GEXA 1RN4A 1W2B2 4Q53A 2WOHA 4EV5A 4XBYA 1TFOA 3CNMA 1UUGB 3U97A 4R80A 2CH9A 1TU5A 1BSEA 5JPUA 3CCM3 2XGNA 3BNDA 1KQS2 2CX1A 1IVUA 4N3VA 4ILFA 3KKGA 4HM7B 1O7HB 3CCL3 3DXOA 1LOVA 1IT7A 1Q7HA 1N5PA 3S67A 3H51A 2H0HA 1AVKA 2HMJB 1BRSA 3PYJA 3CME3 3OWUA 2XGLA 2CW9A 3OWYA 4GB5A 1N9JA 3S5CA 1MWUA 3KN4A 4BIRA 2E2UA 1LVNA 1MGWA 3CNXA 4XDVA 1AQZA 2OTL3 1RGKA 8RNTA 2P0XA 3EN8A 2OWPA 4EV2A 3F7XA 5G2GA 3RGAA 1EUIC 3CCR3 4N6UA 5BVBA 1Y4KA 1Z1SA 4OUQA 5LC7A 3ROBA 3F40A 5IERA 2SBLA 1NU3A 1GY7A 3RNTA 5GSPA 2J8XB 2KXGA 2A15A 2MF7A 1MWSA 1TRQA 2PZVA 3LTDA 1M1K4 3FKAA 4N6NB 1IQXA 1VQ93 3SVAA 3CC73 1DETA 1B3SA 7RNTA 1A2VA 1HZ1A 2K54A 2L1SA 2W56B 3OW22 1OHPA 3CMA3 3KE7A 2BMOB 1T5YA 3WR2A 3EB8A 1GMPA 3QK9A 5IENA 1MOLA 4J9AA 2D42A 3NX0A 4R9KA 2GEYA 3PXMA 1NWWA 5G1LA 1I0VA 2CG0A 2YFIB 3ER7A 3CC43 1VZZA 1B27A 3NM2A 1W00A 2C11A 1BOXA 3BLZA 1N9EA 4O8SA 3V92A 3WOEB 1BNGA 1JN5B 4WWUC 2XSOB 5AIGA 1Q40A 1JB2A 1OUNA 2HMNB 4EBGA 3AMOB 1BSAA 3STDA 4STDA 1DMMA 2W0QA 1X1WA 1BAOA 1RSNA 2O3OA 1IYYA 3L0RA 4HM4B 3V99A 5JPPA 3I553 4FR9A 1OCVA 1TTOA 1RNBA 1B2ZA 4HM5B 3CCQ3 2F98A 2OCTA 2CC3A 1PYLA 2R4IA 2F4YA 3SXXA 1TFKA 3FZWA 1BNIA 1GMRA 5STDA 2KF4A 5KP1A 1E3RA 1FGTA 3Q1CA 2FGTA 3PS8A 1QVG2 1DVCA 3GSPA 3FG1A 1DYUA 4HZBB 3CPOA 1D6UA 1IDPA 2SARA 3MG1A 1Q824 2ML6A 2B1XB 4KZ1A 1LOYA 5D81A 5KP4A 4HZ9B 1N8QA 3OX9A 3NQYA 3D3LA 2YFJB 3A76A 4KFFA 2UUGC 1UW1A 2F5WA 5AYRB 5LC6A 4BL3A 1TJDA 1OGZA 3D4AA 1LQMB 4RBNA 3G4S3 3F8XA 4IT7A 4OK0A 1MWTA 1BNJA 3N8BA 1UCJA 3IJEB 4HAAA 1W01A 2Z7AA 3T0UA 5M1AA 3NUVA 4GSPA 1A2PA 1ASKA 2P0MA 3BNBA 2HMLB 3K0ZA 1A2KA 3UB1A 1ZS7A 3WA3A 3WDGB 4KFDA 3KZTA 4KVHA 3CC23 1BRHA 1LNIA 1LXEA 3WHOA 3WODG 3MYTA 2H0IA 3BNCA 1NDOB 3WA2X 2HOHA 3DGOA 3MG3A 1US1A 1NNVA 1WMNA 4KT3B 5KP3A 3G713 1BRKA 3WMDA 3DGNA 3DUKA 4N6OB 2PNCA 3OV4A 4HOHA 3MWZA 3MKIA 1K8A4 1Q9EA 3K63A 1FA3A 3X40A 3FG3A 1W4NA 3AGOA 1AR0A 2H0GA 1QAKA 3EQQB 1UI8A 2IYJA 3KSED 2YX9A 4HVNA 4N6TA 3X3YA 3G16A 4BU4A 1PY3A 1RGLA 3BU4A 4IIAA 3M8CA 4K90B 1QVF2 3CXC2 1BNEA 5CXOA 3ALAA 4MEIA 3JUQA 3HOHA 3HX8A 4XB5A 5CF2A 5IF6A 4XBXA 1GD3A 1E3VA 3JUPA 3NXJA 1RGGA 1BNFA 1I2EA 3UL5A 4LGQA 4WYKB 5ELJA 1WTHA 2CFDA 2Y73A 4RNZA 1JKGA 1U5OA 2KRTA 1V74A 1VQ73 1OPYA 2CWUA 2GSPA 1GY6A 3JUMA 4HM1B 3T8UA 2WGQA 2OOVA 1ROAA 1SARA 1Q814 1IT8A 2AADA 2B24B 1NB5I 3B8LA 3EJVA 4HM6B 4HYZA 1EEJA 1GSPA 2F56A 3H3HA 3MG2A 1TRPA 1FUTA 1VQ53 1LOXA 3G8ZA 1RDSA 1YIT3 2CWVA 1UI7A 2P05A 1B21A 1TUHA 8CHOA 1BRIA 1DMNA 2XH9A 2WOFA 3GZRA 2CHCA 1JBSA 3PZWA 1I2GA 4KFEA 1WMOA 4XDWA 4L8PA 3BIRA 1EKMA 3KCHA 3D79A 2KF3A 1M9GA 1OF5B 1RN1A 1BUQA 3T8NA 1AVLA 2XR8B 3HIGA 1ULJB 4AKZA 3N9HA 1VQ83 1G96A 1DVDA 2XFSA 4L7KA 4J5KA 3NQZA 4K1VA 1BGSA 1K734 1FGRA 3PCRA 4HKVB 4HM3B 4ZM8A 2R41A 5AEWB 1KSIA 1RGCA 3KIIA 3D5IA 1AV4A 3SYUA 4CJNA 2I9WA 5BXQA 1QJGA 5IG0A 3K9MC 2W56A 1YHQ3 1HYFA 7GSPA 3CCJ3 4LYLB 1O7MB 3FF2A 1OGXA 1UUVB 5AIFA 1T2IA 4J8TA 5M19A 1KD14 1WNHA 1J2BA 1M904 1UGHI 1GOVA 1RTUA 3HIIA 1OH0A 1A67A 3OXAA 3EF8A
chains in the Genus database with same CATH topology
1G02A 1RLSA 2RBIA 1BNJA 1RGHA 1UCJA 4HAAA 2F5WA 4RNTA 3AGNA 1I3FA 1FW7A 2AAEA 1A2PA 1X1XA 4GSPA 1BRGA 1X1YA 1BRNL 2KAAA 3DH2A 6RNTA 2C4BA 1BRJA 1BRHA 1LNIA 1RN4A 3WHOA 9RNTA 5BU4A 2HOHA 1CH0A 1UCLA 1BSEA 1RMSA 1BRKA 1I3IA 4HOHA 1Q9EA 1LOVA 3AGOA 1LRAA 1BRSA 1YNVX 4BU4A 1PY3A 1RGLA 3AHSA 3BU4A 1BNEA 1RGAA 1UCIA 4BIRA 1R4YA 1MGWA 6GSPA 1GMQA 1AQZA 3HOHA 1FUSA 1RGKA 3DGYA 8RNTA 1UCKA 1I0XA 1RGGA 5HOHA 1BNFA 1I2EA 2RNTA 1BNSA 5GSPA 3RNTA 1BANA 2GSPA 1GOYA 3AHWA 1BU4A 1TRQA 1I70A 1BSBA 1SARA 1GOUA 2AADA 4J5GA 1DETA 1GSPA 1B3SA 7RNTA 1HZ1A 2F56A 1DE3A 3WR2A 1JBTA 2KF6A 1TRPA 1BVIA 1GMPA 1FUTA 1RCLA 1BIRA 3A5EA 3D5GA 1RDSA 1BUJA 1I0VA 1B21A 1BRIA 3Q3FA 1B27A 1JBSA 1B2UA 1I2GA 1B2XA 1RGEA 1YVSA 4GHOA 1BOXA 5BIRA 3BIRA 3KCHA 1I8VA 1X1UA 2KF3A 1RN1A 1BNGA 4J5KA 1BSDA 2F5MA 1BSAA 1BGSA 1RHLA 1X1WA 1C54A 5RNTA 1BAOA 1JBRA 1MGRA 1RSNA 1RGCA 1RGFA 1IYYA 3D5IA 2ZA4A 1TTOA 1B2SA 1B2ZA 1ZGXA 3SYUA 1B2MA 1RNBA 2BU4A 1RNTA 1PYLA 1FZUA 3URPA 2F4YA 1AY7A 1BNIA 1GMRA 1RCKA 2KF4A 1HYFA 7GSPA 1B20A 1T2HA 3GSPA 1I2FA 2SARA 1BSCA 1T2IA 1YGWA 1LOYA 2KF5A 1GOVA 1RTUA 1BNRA 1LOWA 1FYSA 3D4AA 2BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G02 A;  1RLS A;  2RBI A;  1BNJ A;  1RGH A;  1UCJ A;  4HAA A;  2F5W A;  4RNT A;  3AGN A;  1I3F A;  1FW7 A;  2AAE A;  1A2P A;  1X1X A;  4GSP A;  1BRG A;  1X1Y A;  1BRN L;  2KAA A;  3DH2 A;  6RNT A;  2C4B A;  1BRJ A;  1BRH A;  1LNI A;  1RN4 A;  3WHO A;  9RNT A;  5BU4 A;  2HOH A;  1CH0 A;  1UCL A;  1BSE A;  1RMS A;  1BRK A;  1I3I A;  4HOH A;  1Q9E A;  1LOV A;  3AGO A;  1LRA A;  1BRS A;  1YNV X;  4BU4 A;  1PY3 A;  1RGL A;  3AHS A;  3BU4 A;  1BNE A;  1RGA A;  1UCI A;  4BIR A;  1R4Y A;  1MGW A;  6GSP A;  1GMQ A;  1AQZ A;  3HOH A;  1FUS A;  1RGK A;  3DGY A;  8RNT A;  1UCK A;  1I0X A;  1RGG A;  5HOH A;  1BNF A;  1I2E A;  2RNT A;  1BNS A;  5GSP A;  3RNT A;  1BAN A;  2GSP A;  1GOY A;  3AHW A;  1BU4 A;  1TRQ A;  1I70 A;  1BSB A;  1SAR A;  1GOU A;  2AAD A;  4J5G A;  1DET A;  1GSP A;  1B3S A;  7RNT A;  1HZ1 A;  2F56 A;  1DE3 A;  3WR2 A;  1JBT A;  2KF6 A;  1TRP A;  1BVI A;  1GMP A;  1FUT A;  1RCL A;  1BIR A;  3A5E A;  3D5G A;  1RDS A;  1BUJ A;  1I0V A;  1B21 A;  1BRI A;  3Q3F A;  1B27 A;  1JBS A;  1B2U A;  1I2G A;  1B2X A;  1RGE A;  1YVS A;  4GHO A;  1BOX A;  5BIR A;  3BIR A;  3KCH A;  1I8V A;  1X1U A;  2KF3 A;  1RN1 A;  1BNG A;  4J5K A;  1BSD A;  2F5M A;  1BSA A;  1BGS A;  1RHL A;  1X1W A;  1C54 A;  5RNT A;  1BAO A;  1JBR A;  1MGR A;  1RSN A;  1RGC A;  1RGF A;  1IYY A;  3D5I A;  2ZA4 A;  1TTO A;  1B2S A;  1B2Z A;  1ZGX A;  3SYU A;  1B2M A;  1RNB A;  2BU4 A;  1RNT A;  1PYL A;  1FZU A;  3URP A;  2F4Y A;  1AY7 A;  1BNI A;  1GMR A;  1RCK A;  2KF4 A;  1HYF A;  7GSP A;  1B20 A;  1T2H A;  3GSP A;  1I2F A;  2SAR A;  1BSC A;  1T2I A;  1YGW A;  1LOY A;  2KF5 A;  1GOV A;  1RTU A;  1BNR A;  1LOW A;  1FYS A;  3D4A A;  2BIR A; 
#chains in the Genus database with same CATH topology
 1IK3 A;  1YGE A;  1JN5 A;  2CIU A;  4U13 A;  1UGI A;  3AMO A;  4O2H A;  1VQL 3;  3LXU X;  3SLU A;  1BRN L;  1O7N B;  2QEX 3;  2LQV A;  4NPB A;  1EG9 B;  4JF8 A;  3VGN A;  6RNT A;  1MNL A;  2M7O A;  2C4B A;  3S27 A;  2D1W A;  1L5G B;  1HKX A;  3HI7 A;  3E99 A;  1V58 A;  5BU4 A;  1FGQ A;  1TP6 A;  1OAC A;  3LYG A;  1JJ2 2;  4X2O A;  3FCS B;  3X41 A;  3GZX B;  1I3I A;  3LT9 A;  2W2C A;  3VSY A;  1EQK A;  1S5A A;  1OHS A;  1YIJ 3;  2GU1 A;  2CFL A;  2HMK B;  1W6G A;  3HZP A;  3CCS 3;  3NV0 B;  2HMM B;  2CK3 H;  1VQ6 3;  2W6J H;  2E2T A;  1A90 A;  1CEW I;  1RGA A;  1UCI A;  4LEH A;  6GSP A;  4PEJ A;  3CPW 2;  1VQM 3;  2OQE A;  3LH4 A;  3FG4 A;  1I0X A;  1QAL A;  5HOH A;  1N8R 4;  2OTJ 3;  3ZG5 A;  1TIJ A;  2XSH B;  2RNT A;  4ORL A;  1VQO 3;  4R4K A;  2ZDJ A;  4MMZ B;  1JZD A;  1BNS A;  2ML5 A;  2OOV C;  3B4O A;  3ZG0 A;  1IVW A;  5M18 A;  3JUO A;  1BAN A;  2Y74 A;  3I56 3;  1SII A;  2WO0 A;  1NO3 A;  1BU4 A;  4O3V A;  1I70 A;  3VF1 A;  3EHC A;  1GOU A;  4AEQ A;  2F99 A;  3F8H A;  3NBJ A;  4FMA A;  4FCM A;  5ELU A;  3ZFZ A;  2QA4 3;  5CLK A;  4CPK A;  3X3Z A;  1JBT A;  2KF6 A;  5FGO A;  1BVI A;  1Q86 4;  1RCL A;  1BIR A;  3NHX A;  5D82 A;  3A5E A;  3NBR A;  4NRE A;  4FMB A;  3UNL A;  2Z77 A;  3UL6 A;  1W7C A;  2LYX A;  3D5G A;  3GWR A;  4BL2 A;  3EE1 A;  6STD A;  3EBT A;  4HJL B;  1VQK 3;  4RZM A;  1WMP A;  3EX9 A;  5IG5 A;  1F8N A;  2CKF B;  1DMQ A;  3LTA A;  4FCZ A;  1JZO A;  2W9Q A;  3LZA A;  1YVS A;  1IQ8 A;  1W6C A;  2WGO A;  4GHO A;  3NM7 A;  4HM8 B;  3MHE A;  1YVB I;  2GBW B;  1I8V A;  3KSP A;  5BIR A;  1X1U A;  1PFP A;  2BO9 B;  4GL6 A;  1FGO A;  4HM0 B;  2RSX A;  3SOY A;  4WYK A;  4AKY A;  1BSD A;  1YJN 3;  5AIH A;  2O9U X;  1D6Y A;  1E97 A;  2KCD A;  1RHL A;  1ROV A;  3DGM A;  4BTY A;  1C54 A;  2JDI H;  4LMI A;  3WOF B;  1JBR A;  1JV2 B;  1Q7Y 4;  1S72 3;  4X2H A;  5HGR A;  1GD4 A;  2FNQ A;  1ZGX A;  2CWT A;  3EBY A;  1JB5 A;  4CCV A;  5AII A;  5TGN A;  3MSO A;  1NB3 I;  1FZU A;  3FF0 A;  1ULI B;  1AY7 A;  2XFT A;  3BB9 A;  2BMR B;  3JUN A;  1RCK A;  4DKI A;  1O7G B;  1B20 A;  3DZL A;  4WFO A;  1OHO A;  1T2H A;  1YJ9 3;  1W6Y A;  1HU9 A;  5CF1 A;  5DRE A;  1D6Z A;  1G0T A;  1N5H A;  2BHM A;  1W2Z A;  4IPB A;  1YI2 3;  1STD A;  4EXR A;  1RRL A;  5DRV A;  4K1U A;  5IG3 A;  2UGI A;  1BNR A;  1GYB A;  4RNY A;  1ISK A;  2BIR A;  4OVM A;  1G02 A;  1OF5 A;  2RBI A;  3OWS A;  1RGH A;  3TDG A;  3DM8 A;  3SX1 A;  3LT8 A;  3FLJ A;  1STF I;  4RNT A;  4MMX B;  3AGN A;  1I3F A;  2W9P A;  4WP5 A;  2IUK A;  3KFQ C;  1X1X A;  1BRG A;  1X1Y A;  5AEU B;  1IV7 A;  2K0M A;  5IW9 A;  2KAA A;  3DH2 A;  4I4K A;  1IV9 A;  4MJD A;  1KWI A;  1IU7 A;  2QIY A;  1BRJ A;  2F86 B;  1IVV A;  3U1W A;  9RNT A;  3I0Y A;  2CFW A;  3K5T A;  3LTC A;  1RKY A;  1VQN 3;  2IA7 A;  1CH0 A;  1UCL A;  1K41 A;  1RMS A;  3GAX A;  1FGM A;  2GBX B;  1GY5 A;  3GRD A;  3RDE A;  2W04 A;  1KC8 4;  4I5Q A;  2V1L A;  1ZO2 A;  2L4V A;  4EYC A;  2INX A;  5I97 A;  1IVX A;  3X42 A;  3CCU 3;  2UX0 A;  2P09 A;  3PCS A;  2E2V A;  2HMO B;  2GXF A;  1LRA A;  3DGL A;  2STD A;  1K28 A;  1SPU A;  2XF3 A;  1EA2 A;  1O7W B;  1YNV X;  3G6E 3;  2BNG A;  3AHS A;  2XRX B;  2OQE C;  2ZHX B;  2IMJ A;  4EW5 A;  2CX0 A;  1R4Y A;  1RRH A;  1GMQ A;  3IMA B;  1ZX2 A;  2RFR A;  1FUS A;  3DGY A;  3Q90 A;  1UCK A;  3N54 B;  4FMD A;  7STD A;  1VQP 3;  1Q40 B;  1R4C A;  2W03 A;  3D9R A;  1W02 A;  1O7P B;  3B7C A;  1RN7 A;  2CG1 A;  5JBS A;  3SOA A;  3NBB A;  3SED A;  1GOY A;  3IPT A;  3AHW A;  4FCJ A;  1CYU A;  4EC6 A;  1BSB A;  1K9M 4;  5CK6 A;  1SQW A;  4JRF A;  2JQ5 A;  3V98 A;  5G1K A;  4J5G A;  5IG4 A;  3Q2P A;  2C10 A;  1DE3 A;  3LOY A;  1W5Z A;  3LML A;  5EVH A;  3MPH A;  4BTW A;  4L8O A;  5AI1 A;  1NJI 4;  1PU4 A;  3FSD A;  3NV0 A;  1V57 A;  5EEO A;  3GZB A;  1BUJ A;  5AYS C;  4K61 A;  1VQQ A;  3GZY B;  3O8Y A;  4N6V 0;  1LNH A;  3K7C A;  3UJM A;  1RJO A;  1QMA A;  3JVC A;  1JB4 A;  3Q3F A;  1MWR A;  3X3X A;  1LQG C;  2Z76 A;  1B2U A;  3B4P A;  3PGB A;  1IQY A;  4H3U A;  1B2X A;  1RGE A;  4CDL A;  1SJW A;  3F14 A;  1T3B A;  2CFG A;  4HBR A;  2YFL B;  1U8C B;  3HK4 A;  4NHF A;  3EN1 B;  2IUJ A;  4MMY B;  3F7S A;  2RGQ A;  4XBT A;  3RGR A;  2F5M A;  3LTB A;  1UUW B;  3FGY A;  4H61 A;  5RNT A;  2RCD A;  2FXT A;  1MGR A;  2QGU A;  5D83 A;  1Q42 A;  1SIH A;  1RGF A;  3QRD A;  2BT3 A;  1JRQ A;  1M1X B;  2ZA4 A;  4TX4 A;  1VQ4 3;  1C7H A;  2IY2 A;  3CU3 A;  1B2S A;  2CFK A;  3G0K A;  1B2M A;  2BU4 A;  1RNT A;  2Q07 A;  3J7Y d;  1FUW A;  3URP A;  3DMC A;  1CYV A;  5EQL A;  4WHA A;  4QWT A;  1QAF A;  1JNQ A;  4LZI A;  1I2F A;  2GU3 A;  3ECF A;  4LSO A;  3EC9 A;  3F9S A;  5IEO A;  1BSC A;  1GS3 A;  1YGW A;  4N6L A;  3FH1 A;  4O02 B;  3S29 A;  2KF5 A;  5A0O B;  4R1K A;  3DY5 A;  1YJW 3;  1WQL B;  1LOW A;  1FYS A;  4FMC A;  4N6M A;  2MC8 A;  3CD6 3;  2BMQ B;  4BTX A;  1RLS A;  2XEP A;  3S28 A;  3CCE 3;  4G1M B;  3CCV 3;  1FW7 A;  3BNE A;  2Z6B A;  1UDI I;  2ZL8 A;  2AAE A;  2P38 A;  4R9L A;  5FW5 A;  4XM4 A;  4HM2 B;  1CQS A;  1JKG B;  2K3D A;  5IEP A;  2GEX A;  1RN4 A;  1W2B 2;  4Q53 A;  2WOH A;  4EV5 A;  4XBY A;  1TFO A;  3CNM A;  1UUG B;  3U97 A;  4R80 A;  2CH9 A;  1TU5 A;  1BSE A;  5JPU A;  3CCM 3;  2XGN A;  3BND A;  1KQS 2;  2CX1 A;  1IVU A;  4N3V A;  4ILF A;  3KKG A;  4HM7 B;  1O7H B;  3CCL 3;  3DXO A;  1LOV A;  1IT7 A;  1Q7H A;  1N5P A;  3S67 A;  3H51 A;  2H0H A;  1AVK A;  2HMJ B;  1BRS A;  3PYJ A;  3CME 3;  3OWU A;  2XGL A;  2CW9 A;  3OWY A;  4GB5 A;  1N9J A;  3S5C A;  1MWU A;  3KN4 A;  4BIR A;  2E2U A;  1LVN A;  1MGW A;  3CNX A;  4XDV A;  1AQZ A;  2OTL 3;  1RGK A;  8RNT A;  2P0X A;  3EN8 A;  2OWP A;  4EV2 A;  3F7X A;  5G2G A;  3RGA A;  1EUI C;  3CCR 3;  4N6U A;  5BVB A;  1Y4K A;  1Z1S A;  4OUQ A;  5LC7 A;  3ROB A;  3F40 A;  5IER A;  2SBL A;  1NU3 A;  1GY7 A;  3RNT A;  5GSP A;  2J8X B;  2KXG A;  2A15 A;  2MF7 A;  1MWS A;  1TRQ A;  2PZV A;  3LTD A;  1M1K 4;  3FKA A;  4N6N B;  1IQX A;  1VQ9 3;  3SVA A;  3CC7 3;  1DET A;  1B3S A;  7RNT A;  1A2V A;  1HZ1 A;  2K54 A;  2L1S A;  2W56 B;  3OW2 2;  1OHP A;  3CMA 3;  3KE7 A;  2BMO B;  1T5Y A;  3WR2 A;  3EB8 A;  1GMP A;  3QK9 A;  5IEN A;  1MOL A;  4J9A A;  2D42 A;  3NX0 A;  4R9K A;  2GEY A;  3PXM A;  1NWW A;  5G1L A;  1I0V A;  2CG0 A;  2YFI B;  3ER7 A;  3CC4 3;  1VZZ A;  1B27 A;  3NM2 A;  1W00 A;  2C11 A;  1BOX A;  3BLZ A;  1N9E A;  4O8S A;  3V92 A;  3WOE B;  1BNG A;  1JN5 B;  4WWU C;  2XSO B;  5AIG A;  1Q40 A;  1JB2 A;  1OUN A;  2HMN B;  4EBG A;  3AMO B;  1BSA A;  3STD A;  4STD A;  1DMM A;  2W0Q A;  1X1W A;  1BAO A;  1RSN A;  2O3O A;  1IYY A;  3L0R A;  4HM4 B;  3V99 A;  5JPP A;  3I55 3;  4FR9 A;  1OCV A;  1TTO A;  1RNB A;  1B2Z A;  4HM5 B;  3CCQ 3;  2F98 A;  2OCT A;  2CC3 A;  1PYL A;  2R4I A;  2F4Y A;  3SXX A;  1TFK A;  3FZW A;  1BNI A;  1GMR A;  5STD A;  2KF4 A;  5KP1 A;  1E3R A;  1FGT A;  3Q1C A;  2FGT A;  3PS8 A;  1QVG 2;  1DVC A;  3GSP A;  3FG1 A;  1DYU A;  4HZB B;  3CPO A;  1D6U A;  1IDP A;  2SAR A;  3MG1 A;  1Q82 4;  2ML6 A;  2B1X B;  4KZ1 A;  1LOY A;  5D81 A;  5KP4 A;  4HZ9 B;  1N8Q A;  3OX9 A;  3NQY A;  3D3L A;  2YFJ B;  3A76 A;  4KFF A;  2UUG C;  1UW1 A;  2F5W A;  5AYR B;  5LC6 A;  4BL3 A;  1TJD A;  1OGZ A;  3D4A A;  1LQM B;  4RBN A;  3G4S 3;  3F8X A;  4IT7 A;  4OK0 A;  1MWT A;  1BNJ A;  3N8B A;  1UCJ A;  3IJE B;  4HAA A;  1W01 A;  2Z7A A;  3T0U A;  5M1A A;  3NUV A;  4GSP A;  1A2P A;  1ASK A;  2P0M A;  3BNB A;  2HML B;  3K0Z A;  1A2K A;  3UB1 A;  1ZS7 A;  3WA3 A;  3WDG B;  4KFD A;  3KZT A;  4KVH A;  3CC2 3;  1BRH A;  1LNI A;  1LXE A;  3WHO A;  3WOD G;  3MYT A;  2H0I A;  3BNC A;  1NDO B;  3WA2 X;  2HOH A;  3DGO A;  3MG3 A;  1US1 A;  1NNV A;  1WMN A;  4KT3 B;  5KP3 A;  3G71 3;  1BRK A;  3WMD A;  3DGN A;  3DUK A;  4N6O B;  2PNC A;  3OV4 A;  4HOH A;  3MWZ A;  3MKI A;  1K8A 4;  1Q9E A;  3K63 A;  1FA3 A;  3X40 A;  3FG3 A;  1W4N A;  3AGO A;  1AR0 A;  2H0G A;  1QAK A;  3EQQ B;  1UI8 A;  2IYJ A;  3KSE D;  2YX9 A;  4HVN A;  4N6T A;  3X3Y A;  3G16 A;  4BU4 A;  1PY3 A;  1RGL A;  3BU4 A;  4IIA A;  3M8C A;  4K90 B;  1QVF 2;  3CXC 2;  1BNE A;  5CXO A;  3ALA A;  4MEI A;  3JUQ A;  3HOH A;  3HX8 A;  4XB5 A;  5CF2 A;  5IF6 A;  4XBX A;  1GD3 A;  1E3V A;  3JUP A;  3NXJ A;  1RGG A;  1BNF A;  1I2E A;  3UL5 A;  4LGQ A;  4WYK B;  5ELJ A;  1WTH A;  2CFD A;  2Y73 A;  4RNZ A;  1JKG A;  1U5O A;  2KRT A;  1V74 A;  1VQ7 3;  1OPY A;  2CWU A;  2GSP A;  1GY6 A;  3JUM A;  4HM1 B;  3T8U A;  2WGQ A;  2OOV A;  1ROA A;  1SAR A;  1Q81 4;  1IT8 A;  2AAD A;  2B24 B;  1NB5 I;  3B8L A;  3EJV A;  4HM6 B;  4HYZ A;  1EEJ A;  1GSP A;  2F56 A;  3H3H A;  3MG2 A;  1TRP A;  1FUT A;  1VQ5 3;  1LOX A;  3G8Z A;  1RDS A;  1YIT 3;  2CWV A;  1UI7 A;  2P05 A;  1B21 A;  1TUH A;  8CHO A;  1BRI A;  1DMN A;  2XH9 A;  2WOF A;  3GZR A;  2CHC A;  1JBS A;  3PZW A;  1I2G A;  4KFE A;  1WMO A;  4XDW A;  4L8P A;  3BIR A;  1EKM A;  3KCH A;  3D79 A;  2KF3 A;  1M9G A;  1OF5 B;  1RN1 A;  1BUQ A;  3T8N A;  1AVL A;  2XR8 B;  3HIG A;  1ULJ B;  4AKZ A;  3N9H A;  1VQ8 3;  1G96 A;  1DVD A;  2XFS A;  4L7K A;  4J5K A;  3NQZ A;  4K1V A;  1BGS A;  1K73 4;  1FGR A;  3PCR A;  4HKV B;  4HM3 B;  4ZM8 A;  2R41 A;  5AEW B;  1KSI A;  1RGC A;  3KII A;  3D5I A;  1AV4 A;  3SYU A;  4CJN A;  2I9W A;  5BXQ A;  1QJG A;  5IG0 A;  3K9M C;  2W56 A;  1YHQ 3;  1HYF A;  7GSP A;  3CCJ 3;  4LYL B;  1O7M B;  3FF2 A;  1OGX A;  1UUV B;  5AIF A;  1T2I A;  4J8T A;  5M19 A;  1KD1 4;  1WNH A;  1J2B A;  1M90 4;  1UGH I;  1GOV A;  1RTU A;  3HII A;  1OH0 A;  1A67 A;  3OXA A;  3EF8 A; 
#chains in the Genus database with same CATH homology
 1G02 A;  1RLS A;  2RBI A;  1BNJ A;  1RGH A;  1UCJ A;  4HAA A;  2F5W A;  4RNT A;  3AGN A;  1I3F A;  1FW7 A;  2AAE A;  1A2P A;  1X1X A;  4GSP A;  1BRG A;  1X1Y A;  1BRN L;  2KAA A;  3DH2 A;  6RNT A;  2C4B A;  1BRJ A;  1BRH A;  1LNI A;  1RN4 A;  3WHO A;  9RNT A;  5BU4 A;  2HOH A;  1CH0 A;  1UCL A;  1BSE A;  1RMS A;  1BRK A;  1I3I A;  4HOH A;  1Q9E A;  1LOV A;  3AGO A;  1LRA A;  1BRS A;  1YNV X;  4BU4 A;  1PY3 A;  1RGL A;  3AHS A;  3BU4 A;  1BNE A;  1RGA A;  1UCI A;  4BIR A;  1R4Y A;  1MGW A;  6GSP A;  1GMQ A;  1AQZ A;  3HOH A;  1FUS A;  1RGK A;  3DGY A;  8RNT A;  1UCK A;  1I0X A;  1RGG A;  5HOH A;  1BNF A;  1I2E A;  2RNT A;  1BNS A;  5GSP A;  3RNT A;  1BAN A;  2GSP A;  1GOY A;  3AHW A;  1BU4 A;  1TRQ A;  1I70 A;  1BSB A;  1SAR A;  1GOU A;  2AAD A;  4J5G A;  1DET A;  1GSP A;  1B3S A;  7RNT A;  1HZ1 A;  2F56 A;  1DE3 A;  3WR2 A;  1JBT A;  2KF6 A;  1TRP A;  1BVI A;  1GMP A;  1FUT A;  1RCL A;  1BIR A;  3A5E A;  3D5G A;  1RDS A;  1BUJ A;  1I0V A;  1B21 A;  1BRI A;  3Q3F A;  1B27 A;  1JBS A;  1B2U A;  1I2G A;  1B2X A;  1RGE A;  1YVS A;  4GHO A;  1BOX A;  5BIR A;  3BIR A;  3KCH A;  1I8V A;  1X1U A;  2KF3 A;  1RN1 A;  1BNG A;  4J5K A;  1BSD A;  2F5M A;  1BSA A;  1BGS A;  1RHL A;  1X1W A;  1C54 A;  5RNT A;  1BAO A;  1JBR A;  1MGR A;  1RSN A;  1RGC A;  1RGF A;  1IYY A;  3D5I A;  2ZA4 A;  1TTO A;  1B2S A;  1B2Z A;  1ZGX A;  3SYU A;  1B2M A;  1RNB A;  2BU4 A;  1RNT A;  1PYL A;  1FZU A;  3URP A;  2F4Y A;  1AY7 A;  1BNI A;  1GMR A;  1RCK A;  2KF4 A;  1HYF A;  7GSP A;  1B20 A;  1T2H A;  3GSP A;  1I2F A;  2SAR A;  1BSC A;  1T2I A;  1YGW A;  1LOY A;  2KF5 A;  1GOV A;  1RTU A;  1BNR A;  1LOW A;  1FYS A;  3D4A A;  2BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...