3DH2A

Crystal structure of ribonuclease sa2 with guanosine-3'-cyclophosphate prepared by cocrystallization
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
ALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Structure of RNase Sa2 complexes with mononucleotides - new aspects of catalytic reaction and substrate recognition
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 24
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3dh2A00
3URPA 2SARA 5BU4A 1JBTA 1LOWA 1BSBA 3AHSA 1RHLA 3AGOA 1YNVX 4HOHA 4J5KA 7GSPA 2F4YA 1T2IA 1YVSA 1HYFA 1I3FA 4BIRA 1BNIA 1B2UA 1B2ZA 1JBRA 1BU4A 1GMQA 1BIRA 2KF6A 1I3IA 1B21A 1X1YA 2RNTA 2RBIA 1G02A 2KF5A 1BOXA 1RGKA 1RGHA 1BSAA 1GOVA 1RLSA 1I2EA 1TTOA 2BIRA 1BNSA 3D5GA 1I0VA 1X1UA 1BRKA 1LRAA 3D4AA 1BRIA 1LNIA 3D5IA 2BU4A 3SYUA 1CH0A 1GSPA 1MGWA 3KCHA 1YGWA 7RNTA 1UCLA 1B2SA 1BSDA 1BSEA 1RN1A 1HZ1A 1B27A 1BRSA 1BNRA 1LOYA 1GOUA 5BIRA 1RSNA 3AHWA 1BRHA 1MGRA 1GOYA 1C54A 2AADA 1RGAA 1B20A 3WHOA 1BNJA 1I2GA 3A5EA 1RTUA 1GMPA 1RNBA 1SARA 3WR2A 6RNTA 3RNTA 1UCJA 1BNEA 1I2FA 2C4BA 2KF4A 1BVIA 1FUTA 1UCKA 1I0XA 3Q3FA 4RNTA 1DE3A 6GSPA 1UCIA 2AAEA 1I8VA 1RGLA 1BSCA 1B3SA 1PYLA 2F5MA 3BIRA 3DGYA 1RMSA 3AGNA 1DETA 1Q9EA 1ZGXA 1RCKA 1I70A 1B2XA 1BRJA 1RNTA 1RN4A 2HOHA 3BU4A 5HOHA 1BANA 2KF3A 9RNTA 2GSPA 1AY7A 1B2MA 4HAAA 1JBSA 1RCLA 1RGCA 1RGFA 1RGGA 1FZUA 1T2HA 3HOHA 2KAAA 1BNFA 1RDSA 1AQZA 1A2PA 4GSPA 1TRPA 2ZA4A 4GHOA 1BRNL 3GSPA 1TRQA 2F56A 5GSPA 1FW7A 1RGEA 2F5WA 8RNTA 5RNTA 1BRGA 1X1XA 1R4YA 3DH2A 1GMRA 1BGSA 1LOVA 1PY3A 1BUJA 1X1WA 1BNGA 4J5GA 4BU4A 1FYSA 1IYYA 1BAOA 1FUSA
chains in the Genus database with same CATH superfamily
1LQGC 1FGQA 4BTXA 2XGNA 3X40A 1WMPA 4O02B 3PGBA 2CKFB 3IJEB 1EQKA 3K0ZA 1I3FA 4HYZA 2RGQA 2SBLA 2XFTA 1B2ZA 2XFSA 2XH9A 3ECFA 3BNCA 3GRDA 4L7KA 2RNTA 4XBTA 3FSDA 3HX8A 3LTDA 4N6OB 2RBIA 1CEWI 2IUJA 3LZAA 3HZPA 2CWVA 1RGHA 3F8XA 1GD3A 2KCDA 2IUKA 2YFIB 3UJMA 4DKIA 1IT8A 1QAKA 2CWUA 3N8BA 3UNLA 4HM1B 3NBJA 4HJLB 3VSYA 2YFJB 3X41A 2BHMA 3RGRA 3D5GA 1T3BA 3ALAA 3AMOB 4O8SA 1X1UA 2WOFA 3K5TA 2H0GA 1IVXA 4WP5A 1LRAA 4CDLA 2BO9B 3CD63 3CNXA 2C10A 3SYUA 1D6UA 4HBRA 1YGWA 1OF5A 1JKGB 1SPUA 3Q90A 2OWPA 2STDA 4K1UA 1UCLA 1BSDA 1ULJB 2V1LA 3EC9A 2W2CA 4XB5A 1AVLA 1BSEA 4MMZB 3NQYA 2ZDJA 1B27A 3G6E3 1BRSA 1OGZA 3D3LA 2WOHA 1PFPA 2K3DA 1W2ZA 3AHWA 4WFOA 1MGRA 5IF6A 3HK4A 5AEWB 1RGAA 3PZWA 1W02A 1EKMA 3KSPA 3V98A 1UDII 2F98A 2PZVA 3CU3A 1UUWB 2W56A 4K90B 2L1SA 3STDA 3DGLA 2CK3H 4HM3B 2IA7A 5HGRA 3T8NA 2QA43 1I0XA 1GY5A 1LOXA 3NHXA 4KFFA 4HM7B 3G713 1DE3A 3CCV3 1YJW3 1RGLA 1BSCA 2BMRB 2F5MA 4RNYA 1VQQA 1IK3A 3DGYA 5I97A 3AGNA 1W6YA 3JVCA 3NM2A 4R4KA 1Q9EA 2XSHB 1OPYA 3SLUA 4LZIA 1I70A 3BU4A 1YHQ3 1RN4A 1DMMA 1OACA 1YGEA 1BANA 3Q1CA 1Q824 1VQK3 1B2MA 3LTCA 1Q7HA 3I563 3ER7A 3FLJA 2CIUA 3KFQC 1Q814 3CCR3 1BNFA 2IY2A 3SEDA 4GSPA 1E3VA 2F86B 3KN4A 1D6YA 1RRLA 1VQ53 2Z6BA 2F56A 4HM8B 5GSPA 1TFKA 1VQ63 5IERA 1YVBI 1BRGA 3JUPA 2Y73A 3CCL3 3EJVA 1NJI4 4EBGA 4CPKA 2OTJ3 4WWUC 2JQ5A 3L0RA 1X1WA 1O7NB 1BNGA 1CYVA 3EX9A 2W0QA 3ZFZA 1OH0A 4J5GA 3T8UA 5AYSC 4N6TA 1WTHA 1W00A 1V58A 5CF2A 1YJN3 1GYBA 3X3YA 1QVF2 2KXGA 3WOEB 1IVUA 5BU4A 1LOWA 1IT7A 2JDIH 3F14A 1ULIB 3NXJA 1AR0A 5CF1A 4HOHA 6STDA 3LMLA 1O7WB 4J5KA 1KQS2 2P0XA 1HYFA 4BIRA 4RBNA 3QRDA 1IV9A 1V74A 2K0MA 1JBRA 5ELJA 3WDGB 1GMQA 2KF6A 3DZLA 4HM4B 2IMJA 1JJ22 1SQWA 1OHOA 4FMBA 1NO3A 1ROVA 1E3RA 3MG1A 1BOXA 1RGKA 1ROAA 2OQEA 5AIIA 4LMIA 3GAXA 4MEIA 1IVVA 1GOVA 3BB9A 4L8PA 2I9WA 4H61A 1A90A 1YIJ3 2XR8B 3TDGA 4N3VA 3S5CA 3G16A 3S27A 1VQ93 3I0YA 1MNLA 5AI1A 5CLKA 1JZOA 3U97A 1WMOA 3D5IA 3CCJ3 4KT3B 1IU7A 1GSPA 2J8XB 2CWTA 5A0OB 7RNTA 1LVNA 1W6GA 2B1XB 3PXMA 2IYJA 4FCJA 1B2SA 4R9LA 5JPPA 2GEXA 1NWWA 3CNMA 1Q42A 4XBXA 2XRXB 2BNGA 3NV0A 5G1KA 5KP1A 3BNDA 5KP4A 3OW22 3OX9A 3LTAA 3DMCA 4FMCA 1K8A4 1KWIA 1JN5B 1WQLB 3HIGA 1M904 5FGOA 1GOUA 5ELUA 1TP6A 1BRHA 1Q864 1Q40B 1C54A 3WHOA 1SIIA 2GEYA 3DGMA 4NPBA 1TU5A 2HMJB 4EXRA 3V92A 1UUGB 3DY5A 2CH9A 5M18A 1FGRA 2P05A 3BNBA 3OXAA 1D6ZA 3E99A 3X3XA 3JUMA 1DYUA 1UGHI 1JV2B 1AV4A 2A15A 1UCJA 1STDA 2Z77A 2Z7AA 4L8OA 2KF4A 4KVHA 4STDA 4EYCA 4LGQA 3A76A 3IPTA 1UCKA 3NM7A 2QIYA 5EVHA 4HZ9B 1VQO3 4N6V0 1RKYA 1I8VA 1B3SA 4NREA 1MWSA 1DETA 4JRFA 1M1K4 1O7PB 1YIT3 3NUVA 2YX9A 1TUHA 3EHCA 3PCSA 1UI7A 1UI8A 9RNTA 2E2TA 1AY7A 3FZWA 1EA2A 4X2OA 1QMAA 3F8HA 4BTWA 1QAFA 1WMNA 5IG0A 3S29A 1ASKA 1FZUA 2UX0A 3CCS3 1DVDA 4MMYB 1HKXA 1U8CB 4H3UA 1RDSA 1A2PA 1AQZA 3WA2X 3WA3A 3F7SA 2UGIA 4N6UA 3OWYA 4XM4A 4MMXB 4GHOA 3SXXA 2RSXA 1FW7A 4HM6B 1IQYA 2CFWA 3FCSB 1T5YA 1X1XA 1R4YA 2F99A 2L4VA 5FW5A 1LOVA 2PNCA 1Y4KA 3OWSA 1R4CA 5IG4A 3HIIA 3K63A 4WYKA 3NQZA 4R9KA 1IYYA 1BAOA 3CMA3 2FGTA 3QK9A 4LYLB 1OHSA 3UB1A 2SARA 3URPA 2ML6A 1EUIC 2XSOB 3LOYA 1YJ93 1KC84 1DMQA 3AHSA 3GZBA 3F7XA 4PEJA 3AGOA 1EG9B 4I4KA 3MHEA 3JUQA 4R1KA 1W01A 3VGNA 1YNVX 5CXOA 4EV2A 7GSPA 2XF3A 3CCU3 1VZZA 1A2KA 1T2IA 1NNVA 1YVSA 3B7CA 5LC7A 2R41A 1K734 5EEOA 4N6LA 1B2UA 2MC8A 3SX1A 1BU4A 2Z76A 3DXOA 1OGXA 2CFGA 2ML5A 1I3IA 4HVNA 1B21A 1X1YA 1W4NA 1FA3A 1WNHA 1MWUA 2CX1A 5TGNA 3KIIA 3FG4A 3OWUA 1HU9A 4AKZA 1MWRA 4RNZA 7STDA 1VQN3 1RN7A 3CCE3 2HMOB 2XEPA 1ISKA 2RFRA 5EQLA 1JB4A 3F40A 3HI7A 4JF8A 1TTOA 1BNSA 3F9SA 4K1VA 1VQP3 1KSIA 4O3VA 1QJGA 1I0VA 2FNQA 3I553 1TIJA 2KRTA 1UUVB 2WGQA 3S67A 1BRKA 1OF5B 3IMAB 4N6MA 2B24B 2P0MA 1LNHA 3AMOA 3FG3A 1CH0A 3MG2A 2OQEC 1STFI 2D1WA 4KFDA 3EBTA 5D83A 1US1A 1JKGA 1L5GB 1OCVA 1RN1A 1HZ1A 4FR9A 5DREA 4EC6A 5IEPA 4CCVA 2LQVA 2C11A 2HMLB 3NBRA 1DVCA 1BNRA 2E2VA 1LOYA 2YFLB 1RSNA 2CX0A 4MJDA 2P09A 3UL5A 3CME3 3G0KA 2AADA 2LYXA 1ZX2A 4XDVA 3H51A 1G0TA 2W56B 3K7CA 1W5ZA 1Z1SA 1F8NA 1JZDA 1BNJA 3A5EA 1E97A 3B4OA 3FH1A 1GMPA 3EB8A 1SARA 3EF8A 2CG1A 5D82A 4AEQA 2BMQB 4NHFA 3SOAA 1RNBA 4R80A 3GZRA 1IV7A 1JB5A 1GD4A 1BNEA 4TX4A 1I2FA 2C4BA 3KE7A 1GY6A 2E2UA 5KP3A 2Q07A 3LYGA 3BIRA 1PYLA 1C7HA 1SIHA 2W6JH 4HKVB 1RMSA 4CJNA 1OUNA 4AKYA 1AVKA 2CFDA 1DMNA 1LQMB 1ZGXA 2M7OA 1RCKA 3GWRA 5HOHA 1B2XA 1CQSA 2HOHA 3RGAA 1NB5I 1J2BA 3NBBA 2CFLA 4HM0B 1RCLA 1RGCA 3CCQ3 4I5QA 1T2HA 2K54A 3MWZA 1FGTA 4N6NB 3FGYA 3LT8A 3FF2A 1RRHA 3OV4A 3EBYA 4FCZA 1YI23 5G1LA 3DGNA 3MSOA 3B8LA 3FKAA 1BRNL 2O9UX 1TRQA 4KZ1A 5LC6A 1VQL3 2F5WA 8RNTA 3RDEA 5RNTA 3LH4A 3DH2A 1UGIA 3PCRA 4RZMA 5M19A 2HMNB 3PYJA 1UW1A 4WHAA 1PU4A 4EV5A 2HMKB 3NX0A 1G96A 5IEOA 1JB2A 3T0UA 4BU4A 5AIGA 1FUSA 3EE1A 3GZYB 1O7GB 1IQXA 1TJDA 1JBTA 8CHOA 2H0HA 1BSBA 4J9AA 5DRVA 3N9HA 1RHLA 5D81A 2WGOA 3DM8A 3JUNA 3SVAA 2F4YA 3N54B 4OUQA 1GY7A 2ZL8A 2CHCA 1BNIA 2BMOB 2XGLA 2GU1A 4HM5B 3WODG 4ILFA 2GBWB 2ZHXB 3S28A 3ZG0A 3CC23 1BIRA 3MKIA 1U5OA 2UUGC 4IIAA 3G4S3 1N5PA 1NDOB 2OOVC 3MG3A 1G02A 2KF5A 1GS3A 3FF0A 5BVBA 3CXC2 2WO0A 1BSAA 1RLSA 1I2EA 4HM2B 1A2VA 1JRQA 2BIRA 3Q2PA 2OOVA 1SJWA 5IENA 1K28A 3ROBA 4FCMA 2CG0A 1N8R4 1LXEA 4Q53A 3D4AA 1BRIA 1LNIA 2BU4A 3DGOA 4K61A 4IT7A 1MGWA 3KCHA 3VF1A 4LEHA 4LSOA 2GXFA 2HMMB 2CFKA 3NV0B 2GBXB 1M1XB 3CPW2 1N8QA 5AYRB 1N9EA 2W04A 1ZO2A 1N5HA 1IDPA 4GB5A 3KKGA 4OVMA 1VQ73 1M9GA 3WMDA 5BIRA 3CC43 3DUKA 5JPUA 1KD14 4FMAA 1FUWA 1GOYA 3D9RA 5AIHA 2W9PA 1JN5A 1VQ43 1B20A 3J7Yd 2W03A 3O8YA 1O7MB 3MPHA 4EW5A 3CC73 4GL6A 1I2GA 5M1AA 1Q40A 1RTUA 5STDA 2QEX3 2CW9A 3WR2A 6RNTA 1K9M4 2O3OA 1BUQA 2Y74A 1RJOA 1V57A 2D42A 3B4PA 3RNTA 2OTL3 2MF7A 3JUOA 3EQQB 3MYTA 1QALA 1BVIA 1FUTA 3ZG5A 3Q3FA 1MOLA 3CPOA 3LTBA 3PS8A 1ZS7A 4RNTA 4X2HA 5CK6A 4U13A 5G2GA 6GSPA 1UCIA 2AAEA 5BXQA 5IG5A 3X42A 1S723 4IPBA 3M8CA 3H3HA 3GZXB 4ZM8A 2GU3A 2BT3A 1CYUA 3K9MC 1K41A 1W7CA 4G1MB 1VQM3 3U1WA 4FMDA 4O2HA 4KFEA 3V99A 3EN8A 4QWTA 2H0IA 4BTYA 1IVWA 1BRJA 1RNTA 2OCTA 3G8ZA 1FGOA 3SOYA 2KF3A 1EEJA 2GSPA 2W9QA 5AIFA 3UL6A 3D79A 4HAAA 1JBSA 1W6CA 4XDWA 2P38A 2INXA 1RGFA 1FGMA 1MWTA 1RGGA 1IQ8A 3HOHA 2KAAA 3BNEA 4XBYA 5IG3A 3CCM3 1O7HB 4HZBB 1TFOA 2FXTA 4OK0A 1N9JA 1QVG2 5IW9A 1NB3I 1TRPA 2ZA4A 1VQ83 2QGUA 3BLZA 3GSPA 3WOFB 4ORLA 1RGEA 3EN1B 3LT9A 3LXUX 1OHPA 2R4IA 4WYKB 1GMRA 1BGSA 2CC3A 1W2B2 1NU3A 1PY3A 3KSED 3X3ZA 1JNQA 1A67A 1BUJA 1Q7Y4 4BL3A 4BL2A 5JBSA 5AEUB 3KZTA 1FYSA 1S5AA 4J8TA 3FG1A 2RCDA
chains in the Genus database with same CATH topology
3URPA 2SARA 5BU4A 1JBTA 1LOWA 1BSBA 3AHSA 1RHLA 3AGOA 1YNVX 4HOHA 4J5KA 7GSPA 2F4YA 1T2IA 1YVSA 1HYFA 1I3FA 4BIRA 1BNIA 1B2UA 1B2ZA 1JBRA 1BU4A 1GMQA 1BIRA 2KF6A 1I3IA 1B21A 1X1YA 2RNTA 2RBIA 1G02A 2KF5A 1BOXA 1RGKA 1RGHA 1BSAA 1GOVA 1RLSA 1I2EA 1TTOA 2BIRA 1BNSA 3D5GA 1I0VA 1X1UA 1BRKA 1LRAA 3D4AA 1BRIA 1LNIA 3D5IA 2BU4A 3SYUA 1CH0A 1GSPA 1MGWA 3KCHA 1YGWA 7RNTA 1UCLA 1B2SA 1BSDA 1BSEA 1RN1A 1HZ1A 1B27A 1BRSA 1BNRA 1LOYA 1GOUA 5BIRA 1RSNA 3AHWA 1BRHA 1MGRA 1GOYA 1C54A 2AADA 1RGAA 1B20A 3WHOA 1BNJA 1I2GA 3A5EA 1RTUA 1GMPA 1RNBA 1SARA 3WR2A 6RNTA 3RNTA 1UCJA 1BNEA 1I2FA 2C4BA 2KF4A 1BVIA 1FUTA 1UCKA 1I0XA 3Q3FA 4RNTA 1DE3A 6GSPA 1UCIA 2AAEA 1I8VA 1RGLA 1BSCA 1B3SA 1PYLA 2F5MA 3BIRA 3DGYA 1RMSA 3AGNA 1DETA 1Q9EA 1ZGXA 1RCKA 1I70A 1B2XA 1BRJA 1RNTA 1RN4A 2HOHA 3BU4A 5HOHA 1BANA 2KF3A 9RNTA 2GSPA 1AY7A 1B2MA 4HAAA 1JBSA 1RCLA 1RGCA 1RGFA 1RGGA 1FZUA 1T2HA 3HOHA 2KAAA 1BNFA 1RDSA 1AQZA 1A2PA 4GSPA 1TRPA 2ZA4A 4GHOA 1BRNL 3GSPA 1TRQA 2F56A 5GSPA 1FW7A 1RGEA 2F5WA 8RNTA 5RNTA 1BRGA 1X1XA 1R4YA 3DH2A 1GMRA 1BGSA 1LOVA 1PY3A 1BUJA 1X1WA 1BNGA 4J5GA 4BU4A 1FYSA 1IYYA 1BAOA 1FUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3URP A;  2SAR A;  5BU4 A;  1JBT A;  1LOW A;  1BSB A;  3AHS A;  1RHL A;  3AGO A;  1YNV X;  4HOH A;  4J5K A;  7GSP A;  2F4Y A;  1T2I A;  1YVS A;  1HYF A;  1I3F A;  4BIR A;  1BNI A;  1B2U A;  1B2Z A;  1JBR A;  1BU4 A;  1GMQ A;  1BIR A;  2KF6 A;  1I3I A;  1B21 A;  1X1Y A;  2RNT A;  2RBI A;  1G02 A;  2KF5 A;  1BOX A;  1RGK A;  1RGH A;  1BSA A;  1GOV A;  1RLS A;  1I2E A;  1TTO A;  2BIR A;  1BNS A;  3D5G A;  1I0V A;  1X1U A;  1BRK A;  1LRA A;  3D4A A;  1BRI A;  1LNI A;  3D5I A;  2BU4 A;  3SYU A;  1CH0 A;  1GSP A;  1MGW A;  3KCH A;  1YGW A;  7RNT A;  1UCL A;  1B2S A;  1BSD A;  1BSE A;  1RN1 A;  1HZ1 A;  1B27 A;  1BRS A;  1BNR A;  1LOY A;  1GOU A;  5BIR A;  1RSN A;  3AHW A;  1BRH A;  1MGR A;  1GOY A;  1C54 A;  2AAD A;  1RGA A;  1B20 A;  3WHO A;  1BNJ A;  1I2G A;  3A5E A;  1RTU A;  1GMP A;  1RNB A;  1SAR A;  3WR2 A;  6RNT A;  3RNT A;  1UCJ A;  1BNE A;  1I2F A;  2C4B A;  2KF4 A;  1BVI A;  1FUT A;  1UCK A;  1I0X A;  3Q3F A;  4RNT A;  1DE3 A;  6GSP A;  1UCI A;  2AAE A;  1I8V A;  1RGL A;  1BSC A;  1B3S A;  1PYL A;  2F5M A;  3BIR A;  3DGY A;  1RMS A;  3AGN A;  1DET A;  1Q9E A;  1ZGX A;  1RCK A;  1I70 A;  1B2X A;  1BRJ A;  1RNT A;  1RN4 A;  2HOH A;  3BU4 A;  5HOH A;  1BAN A;  2KF3 A;  9RNT A;  2GSP A;  1AY7 A;  1B2M A;  4HAA A;  1JBS A;  1RCL A;  1RGC A;  1RGF A;  1RGG A;  1FZU A;  1T2H A;  3HOH A;  2KAA A;  1BNF A;  1RDS A;  1AQZ A;  1A2P A;  4GSP A;  1TRP A;  2ZA4 A;  4GHO A;  1BRN L;  3GSP A;  1TRQ A;  2F56 A;  5GSP A;  1FW7 A;  1RGE A;  2F5W A;  8RNT A;  5RNT A;  1BRG A;  1X1X A;  1R4Y A;  3DH2 A;  1GMR A;  1BGS A;  1LOV A;  1PY3 A;  1BUJ A;  1X1W A;  1BNG A;  4J5G A;  4BU4 A;  1FYS A;  1IYY A;  1BAO A;  1FUS A; 
#chains in the Genus database with same CATH topology
 1LQG C;  1FGQ A;  4BTX A;  2XGN A;  3X40 A;  1WMP A;  4O02 B;  3PGB A;  2CKF B;  3IJE B;  1EQK A;  3K0Z A;  1I3F A;  4HYZ A;  2RGQ A;  2SBL A;  2XFT A;  1B2Z A;  2XFS A;  2XH9 A;  3ECF A;  3BNC A;  3GRD A;  4L7K A;  2RNT A;  4XBT A;  3FSD A;  3HX8 A;  3LTD A;  4N6O B;  2RBI A;  1CEW I;  2IUJ A;  3LZA A;  3HZP A;  2CWV A;  1RGH A;  3F8X A;  1GD3 A;  2KCD A;  2IUK A;  2YFI B;  3UJM A;  4DKI A;  1IT8 A;  1QAK A;  2CWU A;  3N8B A;  3UNL A;  4HM1 B;  3NBJ A;  4HJL B;  3VSY A;  2YFJ B;  3X41 A;  2BHM A;  3RGR A;  3D5G A;  1T3B A;  3ALA A;  3AMO B;  4O8S A;  1X1U A;  2WOF A;  3K5T A;  2H0G A;  1IVX A;  4WP5 A;  1LRA A;  4CDL A;  2BO9 B;  3CD6 3;  3CNX A;  2C10 A;  3SYU A;  1D6U A;  4HBR A;  1YGW A;  1OF5 A;  1JKG B;  1SPU A;  3Q90 A;  2OWP A;  2STD A;  4K1U A;  1UCL A;  1BSD A;  1ULJ B;  2V1L A;  3EC9 A;  2W2C A;  4XB5 A;  1AVL A;  1BSE A;  4MMZ B;  3NQY A;  2ZDJ A;  1B27 A;  3G6E 3;  1BRS A;  1OGZ A;  3D3L A;  2WOH A;  1PFP A;  2K3D A;  1W2Z A;  3AHW A;  4WFO A;  1MGR A;  5IF6 A;  3HK4 A;  5AEW B;  1RGA A;  3PZW A;  1W02 A;  1EKM A;  3KSP A;  3V98 A;  1UDI I;  2F98 A;  2PZV A;  3CU3 A;  1UUW B;  2W56 A;  4K90 B;  2L1S A;  3STD A;  3DGL A;  2CK3 H;  4HM3 B;  2IA7 A;  5HGR A;  3T8N A;  2QA4 3;  1I0X A;  1GY5 A;  1LOX A;  3NHX A;  4KFF A;  4HM7 B;  3G71 3;  1DE3 A;  3CCV 3;  1YJW 3;  1RGL A;  1BSC A;  2BMR B;  2F5M A;  4RNY A;  1VQQ A;  1IK3 A;  3DGY A;  5I97 A;  3AGN A;  1W6Y A;  3JVC A;  3NM2 A;  4R4K A;  1Q9E A;  2XSH B;  1OPY A;  3SLU A;  4LZI A;  1I70 A;  3BU4 A;  1YHQ 3;  1RN4 A;  1DMM A;  1OAC A;  1YGE A;  1BAN A;  3Q1C A;  1Q82 4;  1VQK 3;  1B2M A;  3LTC A;  1Q7H A;  3I56 3;  3ER7 A;  3FLJ A;  2CIU A;  3KFQ C;  1Q81 4;  3CCR 3;  1BNF A;  2IY2 A;  3SED A;  4GSP A;  1E3V A;  2F86 B;  3KN4 A;  1D6Y A;  1RRL A;  1VQ5 3;  2Z6B A;  2F56 A;  4HM8 B;  5GSP A;  1TFK A;  1VQ6 3;  5IER A;  1YVB I;  1BRG A;  3JUP A;  2Y73 A;  3CCL 3;  3EJV A;  1NJI 4;  4EBG A;  4CPK A;  2OTJ 3;  4WWU C;  2JQ5 A;  3L0R A;  1X1W A;  1O7N B;  1BNG A;  1CYV A;  3EX9 A;  2W0Q A;  3ZFZ A;  1OH0 A;  4J5G A;  3T8U A;  5AYS C;  4N6T A;  1WTH A;  1W00 A;  1V58 A;  5CF2 A;  1YJN 3;  1GYB A;  3X3Y A;  1QVF 2;  2KXG A;  3WOE B;  1IVU A;  5BU4 A;  1LOW A;  1IT7 A;  2JDI H;  3F14 A;  1ULI B;  3NXJ A;  1AR0 A;  5CF1 A;  4HOH A;  6STD A;  3LML A;  1O7W B;  4J5K A;  1KQS 2;  2P0X A;  1HYF A;  4BIR A;  4RBN A;  3QRD A;  1IV9 A;  1V74 A;  2K0M A;  1JBR A;  5ELJ A;  3WDG B;  1GMQ A;  2KF6 A;  3DZL A;  4HM4 B;  2IMJ A;  1JJ2 2;  1SQW A;  1OHO A;  4FMB A;  1NO3 A;  1ROV A;  1E3R A;  3MG1 A;  1BOX A;  1RGK A;  1ROA A;  2OQE A;  5AII A;  4LMI A;  3GAX A;  4MEI A;  1IVV A;  1GOV A;  3BB9 A;  4L8P A;  2I9W A;  4H61 A;  1A90 A;  1YIJ 3;  2XR8 B;  3TDG A;  4N3V A;  3S5C A;  3G16 A;  3S27 A;  1VQ9 3;  3I0Y A;  1MNL A;  5AI1 A;  5CLK A;  1JZO A;  3U97 A;  1WMO A;  3D5I A;  3CCJ 3;  4KT3 B;  1IU7 A;  1GSP A;  2J8X B;  2CWT A;  5A0O B;  7RNT A;  1LVN A;  1W6G A;  2B1X B;  3PXM A;  2IYJ A;  4FCJ A;  1B2S A;  4R9L A;  5JPP A;  2GEX A;  1NWW A;  3CNM A;  1Q42 A;  4XBX A;  2XRX B;  2BNG A;  3NV0 A;  5G1K A;  5KP1 A;  3BND A;  5KP4 A;  3OW2 2;  3OX9 A;  3LTA A;  3DMC A;  4FMC A;  1K8A 4;  1KWI A;  1JN5 B;  1WQL B;  3HIG A;  1M90 4;  5FGO A;  1GOU A;  5ELU A;  1TP6 A;  1BRH A;  1Q86 4;  1Q40 B;  1C54 A;  3WHO A;  1SII A;  2GEY A;  3DGM A;  4NPB A;  1TU5 A;  2HMJ B;  4EXR A;  3V92 A;  1UUG B;  3DY5 A;  2CH9 A;  5M18 A;  1FGR A;  2P05 A;  3BNB A;  3OXA A;  1D6Z A;  3E99 A;  3X3X A;  3JUM A;  1DYU A;  1UGH I;  1JV2 B;  1AV4 A;  2A15 A;  1UCJ A;  1STD A;  2Z77 A;  2Z7A A;  4L8O A;  2KF4 A;  4KVH A;  4STD A;  4EYC A;  4LGQ A;  3A76 A;  3IPT A;  1UCK A;  3NM7 A;  2QIY A;  5EVH A;  4HZ9 B;  1VQO 3;  4N6V 0;  1RKY A;  1I8V A;  1B3S A;  4NRE A;  1MWS A;  1DET A;  4JRF A;  1M1K 4;  1O7P B;  1YIT 3;  3NUV A;  2YX9 A;  1TUH A;  3EHC A;  3PCS A;  1UI7 A;  1UI8 A;  9RNT A;  2E2T A;  1AY7 A;  3FZW A;  1EA2 A;  4X2O A;  1QMA A;  3F8H A;  4BTW A;  1QAF A;  1WMN A;  5IG0 A;  3S29 A;  1ASK A;  1FZU A;  2UX0 A;  3CCS 3;  1DVD A;  4MMY B;  1HKX A;  1U8C B;  4H3U A;  1RDS A;  1A2P A;  1AQZ A;  3WA2 X;  3WA3 A;  3F7S A;  2UGI A;  4N6U A;  3OWY A;  4XM4 A;  4MMX B;  4GHO A;  3SXX A;  2RSX A;  1FW7 A;  4HM6 B;  1IQY A;  2CFW A;  3FCS B;  1T5Y A;  1X1X A;  1R4Y A;  2F99 A;  2L4V A;  5FW5 A;  1LOV A;  2PNC A;  1Y4K A;  3OWS A;  1R4C A;  5IG4 A;  3HII A;  3K63 A;  4WYK A;  3NQZ A;  4R9K A;  1IYY A;  1BAO A;  3CMA 3;  2FGT A;  3QK9 A;  4LYL B;  1OHS A;  3UB1 A;  2SAR A;  3URP A;  2ML6 A;  1EUI C;  2XSO B;  3LOY A;  1YJ9 3;  1KC8 4;  1DMQ A;  3AHS A;  3GZB A;  3F7X A;  4PEJ A;  3AGO A;  1EG9 B;  4I4K A;  3MHE A;  3JUQ A;  4R1K A;  1W01 A;  3VGN A;  1YNV X;  5CXO A;  4EV2 A;  7GSP A;  2XF3 A;  3CCU 3;  1VZZ A;  1A2K A;  1T2I A;  1NNV A;  1YVS A;  3B7C A;  5LC7 A;  2R41 A;  1K73 4;  5EEO A;  4N6L A;  1B2U A;  2MC8 A;  3SX1 A;  1BU4 A;  2Z76 A;  3DXO A;  1OGX A;  2CFG A;  2ML5 A;  1I3I A;  4HVN A;  1B21 A;  1X1Y A;  1W4N A;  1FA3 A;  1WNH A;  1MWU A;  2CX1 A;  5TGN A;  3KII A;  3FG4 A;  3OWU A;  1HU9 A;  4AKZ A;  1MWR A;  4RNZ A;  7STD A;  1VQN 3;  1RN7 A;  3CCE 3;  2HMO B;  2XEP A;  1ISK A;  2RFR A;  5EQL A;  1JB4 A;  3F40 A;  3HI7 A;  4JF8 A;  1TTO A;  1BNS A;  3F9S A;  4K1V A;  1VQP 3;  1KSI A;  4O3V A;  1QJG A;  1I0V A;  2FNQ A;  3I55 3;  1TIJ A;  2KRT A;  1UUV B;  2WGQ A;  3S67 A;  1BRK A;  1OF5 B;  3IMA B;  4N6M A;  2B24 B;  2P0M A;  1LNH A;  3AMO A;  3FG3 A;  1CH0 A;  3MG2 A;  2OQE C;  1STF I;  2D1W A;  4KFD A;  3EBT A;  5D83 A;  1US1 A;  1JKG A;  1L5G B;  1OCV A;  1RN1 A;  1HZ1 A;  4FR9 A;  5DRE A;  4EC6 A;  5IEP A;  4CCV A;  2LQV A;  2C11 A;  2HML B;  3NBR A;  1DVC A;  1BNR A;  2E2V A;  1LOY A;  2YFL B;  1RSN A;  2CX0 A;  4MJD A;  2P09 A;  3UL5 A;  3CME 3;  3G0K A;  2AAD A;  2LYX A;  1ZX2 A;  4XDV A;  3H51 A;  1G0T A;  2W56 B;  3K7C A;  1W5Z A;  1Z1S A;  1F8N A;  1JZD A;  1BNJ A;  3A5E A;  1E97 A;  3B4O A;  3FH1 A;  1GMP A;  3EB8 A;  1SAR A;  3EF8 A;  2CG1 A;  5D82 A;  4AEQ A;  2BMQ B;  4NHF A;  3SOA A;  1RNB A;  4R80 A;  3GZR A;  1IV7 A;  1JB5 A;  1GD4 A;  1BNE A;  4TX4 A;  1I2F A;  2C4B A;  3KE7 A;  1GY6 A;  2E2U A;  5KP3 A;  2Q07 A;  3LYG A;  3BIR A;  1PYL A;  1C7H A;  1SIH A;  2W6J H;  4HKV B;  1RMS A;  4CJN A;  1OUN A;  4AKY A;  1AVK A;  2CFD A;  1DMN A;  1LQM B;  1ZGX A;  2M7O A;  1RCK A;  3GWR A;  5HOH A;  1B2X A;  1CQS A;  2HOH A;  3RGA A;  1NB5 I;  1J2B A;  3NBB A;  2CFL A;  4HM0 B;  1RCL A;  1RGC A;  3CCQ 3;  4I5Q A;  1T2H A;  2K54 A;  3MWZ A;  1FGT A;  4N6N B;  3FGY A;  3LT8 A;  3FF2 A;  1RRH A;  3OV4 A;  3EBY A;  4FCZ A;  1YI2 3;  5G1L A;  3DGN A;  3MSO A;  3B8L A;  3FKA A;  1BRN L;  2O9U X;  1TRQ A;  4KZ1 A;  5LC6 A;  1VQL 3;  2F5W A;  8RNT A;  3RDE A;  5RNT A;  3LH4 A;  3DH2 A;  1UGI A;  3PCR A;  4RZM A;  5M19 A;  2HMN B;  3PYJ A;  1UW1 A;  4WHA A;  1PU4 A;  4EV5 A;  2HMK B;  3NX0 A;  1G96 A;  5IEO A;  1JB2 A;  3T0U A;  4BU4 A;  5AIG A;  1FUS A;  3EE1 A;  3GZY B;  1O7G B;  1IQX A;  1TJD A;  1JBT A;  8CHO A;  2H0H A;  1BSB A;  4J9A A;  5DRV A;  3N9H A;  1RHL A;  5D81 A;  2WGO A;  3DM8 A;  3JUN A;  3SVA A;  2F4Y A;  3N54 B;  4OUQ A;  1GY7 A;  2ZL8 A;  2CHC A;  1BNI A;  2BMO B;  2XGL A;  2GU1 A;  4HM5 B;  3WOD G;  4ILF A;  2GBW B;  2ZHX B;  3S28 A;  3ZG0 A;  3CC2 3;  1BIR A;  3MKI A;  1U5O A;  2UUG C;  4IIA A;  3G4S 3;  1N5P A;  1NDO B;  2OOV C;  3MG3 A;  1G02 A;  2KF5 A;  1GS3 A;  3FF0 A;  5BVB A;  3CXC 2;  2WO0 A;  1BSA A;  1RLS A;  1I2E A;  4HM2 B;  1A2V A;  1JRQ A;  2BIR A;  3Q2P A;  2OOV A;  1SJW A;  5IEN A;  1K28 A;  3ROB A;  4FCM A;  2CG0 A;  1N8R 4;  1LXE A;  4Q53 A;  3D4A A;  1BRI A;  1LNI A;  2BU4 A;  3DGO A;  4K61 A;  4IT7 A;  1MGW A;  3KCH A;  3VF1 A;  4LEH A;  4LSO A;  2GXF A;  2HMM B;  2CFK A;  3NV0 B;  2GBX B;  1M1X B;  3CPW 2;  1N8Q A;  5AYR B;  1N9E A;  2W04 A;  1ZO2 A;  1N5H A;  1IDP A;  4GB5 A;  3KKG A;  4OVM A;  1VQ7 3;  1M9G A;  3WMD A;  5BIR A;  3CC4 3;  3DUK A;  5JPU A;  1KD1 4;  4FMA A;  1FUW A;  1GOY A;  3D9R A;  5AIH A;  2W9P A;  1JN5 A;  1VQ4 3;  1B20 A;  3J7Y d;  2W03 A;  3O8Y A;  1O7M B;  3MPH A;  4EW5 A;  3CC7 3;  4GL6 A;  1I2G A;  5M1A A;  1Q40 A;  1RTU A;  5STD A;  2QEX 3;  2CW9 A;  3WR2 A;  6RNT A;  1K9M 4;  2O3O A;  1BUQ A;  2Y74 A;  1RJO A;  1V57 A;  2D42 A;  3B4P A;  3RNT A;  2OTL 3;  2MF7 A;  3JUO A;  3EQQ B;  3MYT A;  1QAL A;  1BVI A;  1FUT A;  3ZG5 A;  3Q3F A;  1MOL A;  3CPO A;  3LTB A;  3PS8 A;  1ZS7 A;  4RNT A;  4X2H A;  5CK6 A;  4U13 A;  5G2G A;  6GSP A;  1UCI A;  2AAE A;  5BXQ A;  5IG5 A;  3X42 A;  1S72 3;  4IPB A;  3M8C A;  3H3H A;  3GZX B;  4ZM8 A;  2GU3 A;  2BT3 A;  1CYU A;  3K9M C;  1K41 A;  1W7C A;  4G1M B;  1VQM 3;  3U1W A;  4FMD A;  4O2H A;  4KFE A;  3V99 A;  3EN8 A;  4QWT A;  2H0I A;  4BTY A;  1IVW A;  1BRJ A;  1RNT A;  2OCT A;  3G8Z A;  1FGO A;  3SOY A;  2KF3 A;  1EEJ A;  2GSP A;  2W9Q A;  5AIF A;  3UL6 A;  3D79 A;  4HAA A;  1JBS A;  1W6C A;  4XDW A;  2P38 A;  2INX A;  1RGF A;  1FGM A;  1MWT A;  1RGG A;  1IQ8 A;  3HOH A;  2KAA A;  3BNE A;  4XBY A;  5IG3 A;  3CCM 3;  1O7H B;  4HZB B;  1TFO A;  2FXT A;  4OK0 A;  1N9J A;  1QVG 2;  5IW9 A;  1NB3 I;  1TRP A;  2ZA4 A;  1VQ8 3;  2QGU A;  3BLZ A;  3GSP A;  3WOF B;  4ORL A;  1RGE A;  3EN1 B;  3LT9 A;  3LXU X;  1OHP A;  2R4I A;  4WYK B;  1GMR A;  1BGS A;  2CC3 A;  1W2B 2;  1NU3 A;  1PY3 A;  3KSE D;  3X3Z A;  1JNQ A;  1A67 A;  1BUJ A;  1Q7Y 4;  4BL3 A;  4BL2 A;  5JBS A;  5AEU B;  3KZT A;  1FYS A;  1S5A A;  4J8T A;  3FG1 A;  2RCD A; 
#chains in the Genus database with same CATH homology
 3URP A;  2SAR A;  5BU4 A;  1JBT A;  1LOW A;  1BSB A;  3AHS A;  1RHL A;  3AGO A;  1YNV X;  4HOH A;  4J5K A;  7GSP A;  2F4Y A;  1T2I A;  1YVS A;  1HYF A;  1I3F A;  4BIR A;  1BNI A;  1B2U A;  1B2Z A;  1JBR A;  1BU4 A;  1GMQ A;  1BIR A;  2KF6 A;  1I3I A;  1B21 A;  1X1Y A;  2RNT A;  2RBI A;  1G02 A;  2KF5 A;  1BOX A;  1RGK A;  1RGH A;  1BSA A;  1GOV A;  1RLS A;  1I2E A;  1TTO A;  2BIR A;  1BNS A;  3D5G A;  1I0V A;  1X1U A;  1BRK A;  1LRA A;  3D4A A;  1BRI A;  1LNI A;  3D5I A;  2BU4 A;  3SYU A;  1CH0 A;  1GSP A;  1MGW A;  3KCH A;  1YGW A;  7RNT A;  1UCL A;  1B2S A;  1BSD A;  1BSE A;  1RN1 A;  1HZ1 A;  1B27 A;  1BRS A;  1BNR A;  1LOY A;  1GOU A;  5BIR A;  1RSN A;  3AHW A;  1BRH A;  1MGR A;  1GOY A;  1C54 A;  2AAD A;  1RGA A;  1B20 A;  3WHO A;  1BNJ A;  1I2G A;  3A5E A;  1RTU A;  1GMP A;  1RNB A;  1SAR A;  3WR2 A;  6RNT A;  3RNT A;  1UCJ A;  1BNE A;  1I2F A;  2C4B A;  2KF4 A;  1BVI A;  1FUT A;  1UCK A;  1I0X A;  3Q3F A;  4RNT A;  1DE3 A;  6GSP A;  1UCI A;  2AAE A;  1I8V A;  1RGL A;  1BSC A;  1B3S A;  1PYL A;  2F5M A;  3BIR A;  3DGY A;  1RMS A;  3AGN A;  1DET A;  1Q9E A;  1ZGX A;  1RCK A;  1I70 A;  1B2X A;  1BRJ A;  1RNT A;  1RN4 A;  2HOH A;  3BU4 A;  5HOH A;  1BAN A;  2KF3 A;  9RNT A;  2GSP A;  1AY7 A;  1B2M A;  4HAA A;  1JBS A;  1RCL A;  1RGC A;  1RGF A;  1RGG A;  1FZU A;  1T2H A;  3HOH A;  2KAA A;  1BNF A;  1RDS A;  1AQZ A;  1A2P A;  4GSP A;  1TRP A;  2ZA4 A;  4GHO A;  1BRN L;  3GSP A;  1TRQ A;  2F56 A;  5GSP A;  1FW7 A;  1RGE A;  2F5W A;  8RNT A;  5RNT A;  1BRG A;  1X1X A;  1R4Y A;  3DH2 A;  1GMR A;  1BGS A;  1LOV A;  1PY3 A;  1BUJ A;  1X1W A;  1BNG A;  4J5G A;  4BU4 A;  1FYS A;  1IYY A;  1BAO A;  1FUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...