5CXOA

Intriguing role of epoxide hydrolase/cyclase-like enzyme salbiii in pyran ring formation in polyether salinomycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
129
structure length
129
Chain Sequence
MQDEQKRKEIVAEYFRKVNEGDVDAIVEMFTENATIEDPVGKDVREGRAAQREYFNSNVTAEVTIEPGHLSAGQDGKSVAVALAAEMTNILDPNRTRVKINAVDVFTLTPEGKIDSMRVFWGMTDIGVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Epoxide hydrolase
publication title Enzymology of Pyran Ring A Formation in Salinomycin Biosynthesis.
pubmed doi rcsb
source organism Streptomyces albus
total genus 39
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5cxoA00
1ULIB 3DM8A 3OWUA 6STDA 3JUOA 5KP1A 3FF2A 5TGNA 1GY5A 5D82A 3WMDA 2GXFA 1OGZA 3B4PA 4HM3B 1ZO2A 1TP6A 4R9KA 2GBWB 4X2OA 4N3VA 4HZBB 5AEUB 4HM8B 1OF5B 3F8XA 3FKAA 2R4IA 4XM4A 5JPPA 5G2GA 1O7WB 5CXOA 3GWRA 3DUKA 4Q53A 1JB2A 3EHCA 1STDA 5AIGA 1ULJB 2XSHB 1W00A 1OPYA 3LYGA 3EQQB 2GEYA 4FCMA 4OUQA 3S5CA 3EN8A 3GZRA 1K41A 2XR8B 3GZXB 1GY7A 3JUQA 5IERA 3BLZA 2F99A 5DREA 1OH0A 3KKGA 4R1KA 4WWUC 1ASKA 1OCVA 5AI1A 4LGQA 4OVMA 3FGYA 1E3RA 4XDWA 1EA2A 3M8CA 4HKVB 3F8HA 2QIYA 3IPTA 3OV4A 3K0ZA 3NXJA 4PEJA 3HX8A 5AIFA 3EBYA 1GY6A 2QGUA 1CQSA 3H51A 3I0YA 3FLJA 3MSOA 4X2HA 2Z7AA 3SOYA 5AIIA 3VSYA 5BVBA 1O7GB 2A15A 4H3UA 3CNXA 5D83A 1DMQA 2XRXB 2K54A 3G16A 3K7CA 3Q90A 3G8ZA 2I9WA 1NWWA 3NHXA 3A76A 4WYKA 3CNMA 2STDA 3DMCA 5IEPA 4XBTA 1JKGB 3D9RA 3JUMA 1OUNA 2BMOB 3F7SA 5AEWB 1O7PB 4HM5B 3EBTA 1NDOB 1O7MB 1DMMA 1OHSA 5FW5A 1GYBA 1NU3A 3GZBA 3E99A 3JUPA 3UNLA 1E97A 4HM4B 3ROBA 3SEDA 3HZPA 5IEOA 3SOAA 3B7CA 5CF2A 3NV0B 2HMMB 1OF5A 2BMRB 2HMOB 2GBXB 2YFJB 3OWSA 1IDPA 2HMLB 4STDA 2YFIB 2OWPA 5HGRA 4FCJA 3KSPA 1JB4A 2HMJB 1HKXA 3F7XA 4L8PA 1JN5B 3F14A 3ER7A 4IIAA 2BNGA 3MHEA 1BUQA 2INXA 3T8UA 5IG4A 2Z77A 5KP4A 3FF0A 4U13A 3GZYB 3EX9A 2B1XB 4K1UA 2Z76A 2RGQA 4CDLA 1WQLB 4HVNA 1S5AA 3EC9A 2GEXA 4XB5A 3MG2A 3NBRA 3FH1A 2RFRA 3G0KA 3B4OA 5BXQA 3FZWA 4LEHA 5IG3A 2BMQB 3T8NA 3MYTA 1O7HB 1TUHA 3RGAA 4L8OA 2YFLB 2HMNB 3MG3A 4MJDA 1W01A 3LZAA 1UUVB 4ORLA 3RGRA 3BB9A 5JPUA 5D81A 3H3HA 5IF6A 1W02A 3DXOA 7STDA 5IENA 2RCDA 3STDA 1AR0A 3CU3A 3KE7A 4HZ9B 4HM6B 4LMIA 3EJVA 5IG0A 1U5OA 1OHPA 1JKGA 2UX0A 4WP5A 1A2KA 2IMJA 2B24B 4J9AA 1VZZA 3OWYA 1OGXA 3EF8A 1QMAA 5AIHA 4HJLB 3CPOA 4K1VA 3GRDA 3F40A 5EVHA 1ISKA 3JUNA 4KVHA 2CHCA 1ZX2A 5CK6A 4I4KA 3VGNA 4HM1B 4XBXA 1Q40B 3EN1B 4J8TA 5CLKA 1GS3A 2HMKB 3NUVA 5STDA 5IG5A 3NV0A 3DZLA 3FSDA 5CF1A 4XBYA 4GB5A 3KZTA 5DRVA 2W2CA 4L7KA 4RZMA 4XDVA 1DMNA 4R9LA 3ECFA 1W6YA 2JQ5A 1JB5A 3MKIA 1C7HA 1EG9B 2F86B 4HM2B 3B8LA 1SJWA 4HM0B 1JN5A 1E3VA 2XSOB 3F9SA 1UUWB 4WYKB 3MG1A 1Q40A 5KP3A 1Q42A 3OXAA 8CHOA 3NM2A 1Z1SA 3UJMA 3HK4A 2CKFB 1OHOA 1QJGA 4HM7B 2PZVA 2F98A 1O7NB 3OX9A
chains in the Genus database with same CATH superfamily
1K28A 1ULIB 3DM8A 3OWUA 4BTXA 1RGCA 2CFGA 1QALA 4LZIA 6STDA 3JUOA 5KP1A 1F8NA 3FF2A 3G4S3 3SX1A 5TGNA 4RNTA 2HOHA 1GY5A 5ELUA 1MWTA 5D82A 1YIT3 4HOHA 3WMDA 3FG3A 2FXTA 1IQ8A 1B3SA 2GXFA 1GOUA 1OGZA 2CWUA 3B4PA 4HM3B 4RBNA 2IUKA 4OK0A 1ZO2A 1FW7A 4N6OB 1TJDA 1EQKA 1FYSA 2BU4A 1TP6A 1TFOA 3PYJA 2PNCA 4R9KA 5G1KA 1VQK3 1VQ63 2GBWB 3PGBA 4X2OA 3NQYA 3PCSA 2FNQA 4N3VA 4HZBB 5AEUB 4HM8B 1GD4A 1ROVA 3I563 2XFSA 5BIRA 3U1WA 1BRSA 1RSNA 1OF5B 3F8XA 3FKAA 3N54B 1AVLA 2KF6A 2R4IA 4XM4A 5GSPA 1WMPA 5LC7A 3S29A 3D4AA 1IK3A 2CWTA 1I3FA 5JPPA 3Q1CA 1N9JA 5G2GA 2ZL8A 1CEWI 2C4BA 3ZG0A 1O7WB 1JRQA 4O02B 1B2UA 1B2ZA 4QWTA 4WFOA 5CXOA 1I2FA 2RNTA 2W56A 3ZG5A 3GWRA 2RBIA 3DUKA 1VQ73 2FGTA 4Q53A 3V92A 1BRHA 3LXUX 4EV5A 1JB2A 4EV2A 3EHCA 1STDA 1DVDA 5AIGA 3KSED 1ULJB 3LOYA 5M18A 1AVKA 3SVAA 2XSHB 5FGOA 3T0UA 1RGEA 1I2GA 1PU4A 3SYUA 1LXEA 1W00A 1OPYA 3LYGA 4I5QA 1U8CB 1WTHA 3EQQB 4CCVA 2GEYA 4FCMA 4OUQA 3FCSB 3S5CA 1B2XA 2GU1A 1BNJA 2JDIH 2RSXA 3EN8A 1Q7HA 3FG4A 1LNIA 1QAKA 3GZRA 5AYSC 1RNBA 1VQ43 1K41A 2XR8B 2C11A 1RGAA 1VQQA 1WMNA 2OOVC 1ZGXA 2H0IA 4LYLB 4CJNA 2P05A 1RGGA 2O9UX 3GZXB 1GY7A 3JUQA 4FMBA 1RGLA 1BSAA 6GSPA 3TDGA 1KC84 4FMAA 2CC3A 2IY2A 3DGOA 3CCU3 2KAAA 1WNHA 5IERA 2YX9A 3BLZA 2F99A 5DREA 1OH0A 1LVNA 1FUWA 4FMDA 1K8A4 3KKGA 2F5MA 2WO0A 4R1KA 1OACA 4WWUC 2Z6BA 1STFI 1ASKA 1RTUA 1YJW3 4MMXB 1OCVA 1IU7A 4J5KA 1SPUA 5AI1A 3CC23 1B21A 3IJEB 4LGQA 4OVMA 4KZ1A 5HOHA 2CK3H 1SARA 1MWRA 3FGYA 2LQVA 1E3RA 4XDWA 1RCLA 1AV4A 3NQZA 1EA2A 1UCKA 2CFLA 1LNHA 3F8HA 3M8CA 2QIYA 3NM7A 3IPTA 4H61A 4HKVB 2BHMA 3OV4A 2OTL3 1JBRA 3K0ZA 3NXJA 2BO9B 1LOYA 1BUJA 1RJOA 1CH0A 3KIIA 3HOHA 4JRFA 4PEJA 3HX8A 5AIFA 3EBYA 1IV9A 2IA7A 1N5HA 1TTOA 1GY6A 1ROAA 1TU5A 5A0OB 1RHLA 1RRHA 3GSPA 2QGUA 3MPHA 1UCJA 2XFTA 4WHAA 1CYVA 2W6JH 1CQSA 3H51A 3I0YA 1X1UA 3FLJA 2P0XA 3MSOA 4HAAA 3K9MC 4X2HA 4DKIA 2F56A 2Z7AA 3SOYA 5AIIA 1MOLA 2F5WA 3VSYA 4EC6A 1RGKA 2W9PA 3L0RA 5BVBA 1O7GB 1V58A 2A15A 1Q864 1MWSA 4IPBA 1Q7Y4 4N6NB 4H3UA 3CNXA 5D83A 1DMQA 4BL3A 2XRXB 1D6UA 1DETA 1D6YA 1DVCA 3DGLA 4HBRA 4N6MA 1MWUA 2K54A 3QRDA 1TRPA 1BSEA 1HU9A 3G16A 3K7CA 3Q90A 1X1WA 3CCL3 1JV2B 3G8ZA 2KF5A 2MC8A 1MNLA 1FZUA 1BRNL 2I9WA 4IT7A 3CCV3 1NWWA 3S28A 1IQXA 1LOXA 1US1A 3NHXA 4JF8A 1BSCA 3A76A 4WYKA 1VQ53 3CNMA 1IVXA 2W03A 3G6E3 1YI23 2STDA 2UUGC 3DMCA 3D79A 5IEPA 9RNTA 1IT8A 4XBTA 1JKGB 1YHQ3 5IW9A 3D9RA 3JUMA 3S27A 1RN7A 1OUNA 3Q3FA 2BMOB 1IQYA 3F7SA 3PCRA 1SIHA 5AEWB 1BSBA 1RLSA 3CCS3 1N5PA 2CFWA 1O7PB 2J8XB 1W6CA 4HM5B 3K5TA 1YVSA 2UGIA 1I70A 1FUSA 3KN4A 1HZ1A 3EBTA 2KCDA 1NDOB 1NB3I 3KFQC 3KCHA 1O7MB 1Q9EA 1I3IA 1V57A 1DMMA 1OHSA 3LT8A 1B20A 1BAOA 1RGFA 1UUGB 3PS8A 4N6LA 3UL6A 3FG1A 4AKZA 1FGMA 1BOXA 2D42A 5FW5A 1UCIA 1N8R4 1S723 1RNTA 1T2HA 1JBSA 1BNSA 1GYBA 2W0QA 1NNVA 2K3DA 1NU3A 1BU4A 1RRLA 3GZBA 3LTAA 3E99A 3JUPA 5EEOA 1E97A 3SLUA 3UNLA 1B2SA 4HM4B 3ROBA 2XF3A 4KFDA 3CCE3 3X3ZA 3SEDA 3HZPA 5IEOA 1YGWA 3B7CA 3SOAA 5CF2A 3NV0B 3N8BA 2HMMB 2CX0A 2ZDJA 2H0HA 1OF5A 2BMRB 2HMOB 3U97A 1WMOA 2GBXB 1HYFA 5EQLA 2YFJB 3OWSA 2OTJ3 2CW9A 1IDPA 1GOYA 3NX0A 3HIIA 1L5GB 1EEJA 1M904 1FUTA 3LTBA 2CIUA 3LTDA 1M1XB 1N8QA 1GMRA 3AMOB 2HMLB 2Y74A 1IVUA 4STDA 2R41A 2YFIB 1T2IA 2CFDA 2OWPA 3AGNA 3SXXA 1VQO3 5HGRA 4FCJA 3KSPA 5RNTA 1JB4A 2CH9A 2HMJB 3ALAA 1HKXA 3X3XA 7GSPA 3BNEA 3F7XA 4HYZA 4FCZA 4L8PA 1NB5I 1JN5B 1FGTA 4N6V0 4BIRA 1IVVA 3LT9A 1A67A 2D1WA 1W2ZA 4EXRA 1G96A 1RKYA 4G1MB 3F14A 3ER7A 2GU3A 4IIAA 3UB1A 8RNTA 3X3YA 2CG1A 2BNGA 1BGSA 3MHEA 1UW1A 4MMYB 1GOVA 1BUQA 2INXA 3T8UA 1RCKA 3CCQ3 1RN4A 5IG4A 1I8VA 2XH9A 2Z77A 4GHOA 5KP4A 3DGMA 3FF0A 4U13A 3CME3 2GSPA 1YJN3 1VQL3 3GZYB 3EX9A 2B1XB 4K1UA 2AAEA 3BNDA 1Y4KA 2Z76A 1BVIA 2RGQA 4N6TA 5JBSA 4CDLA 1WQLB 3GAXA 4HVNA 1KSIA 1S5AA 4RNYA 2H0GA 2V1LA 1N9EA 4KT3B 3EC9A 3V98A 1I2EA 3WODG 3J7Yd 3CCM3 1V74A 4AEQA 2AADA 2O3OA 3CD63 2GEXA 3EE1A 4XB5A 3MG2A 3NBRA 3FH1A 3LTCA 3Q2PA 3RNTA 4MEIA 2RFRA 3G0KA 1IT7A 4EYCA 1BNGA 1KWIA 3B4OA 5BXQA 4AKYA 6RNTA 3FZWA 4LEHA 5IG3A 1VQ93 2M7OA 3AGOA 3WOEB 2K0MA 3X42A 1YNVX 2BMQB 2BIRA 1CYUA 3T8NA 3MYTA 1I0XA 1O7HB 2ML5A 3MWZA 1UGHI 3NBBA 1KD14 1A90A 3CCR3 1TUHA 4TX4A 3RGAA 2LYXA 1VQP3 3WA2X 3HIGA 1C54A 1RN1A 2Q07A 4GSPA 1BNFA 1UI7A 3DGYA 1QVG2 2SBLA 4K90B 1YIJ3 4L8OA 7RNTA 2WGOA 1BNEA 4FMCA 1EUIC 4O8SA 3V99A 2YFLB 1B27A 1NO3A 1A2PA 2OQEA 3CMA3 2SARA 4NHFA 2HMNB 1X1YA 1GSPA 2W56B 3X41A 3MG3A 2E2VA 1W2B2 4MJDA 2C10A 4BL2A 1BRJA 1W01A 1LOWA 2WOFA 1UUVB 3LZAA 4ORLA 4FR9A 3RGRA 3RDEA 4EW5A 2ML6A 2W04A 1DYUA 2P09A 3BB9A 5JPUA 2W9QA 1JNQA 1M9GA 3H3HA 5D81A 5IF6A 1JBTA 3LMLA 2F4YA 3O8YA 1BRIA 1YJ93 2KXGA 1W02A 3DXOA 4GL6A 5G1LA 7STDA 5IENA 1SQWA 1K734 4KFFA 1BIRA 1GD3A 1UI8A 2WGQA 3WDGB 2BT3A 3HI7A 3K63A 2L1SA 4LSOA 2RCDA 1FGRA 2ZHXB 1W7CA 3STDA 4BU4A 3CPW2 1RMSA 1RDSA 1AR0A 1VQ83 4O2HA 1BNRA 2XGLA 2E2TA 3CCJ3 3CU3A 2CG0A 5ELJA 1MGRA 1GMQA 1QVF2 3S67A 2L4VA 3KE7A 1A2VA 1LRAA 3CC73 4HZ9B 1VQM3 4HM6B 4LMIA 3EJVA 2WOHA 4CPKA 5AYRB 1YVBI 5IG0A 1IVWA 1U5OA 3G713 1BRGA 3D5GA 1OHPA 1IYYA 1JKGA 1JJ22 2UX0A 3UL5A 1KQS2 4WP5A 1A2KA 3JVCA 3VF1A 3LH4A 2E2UA 1Q814 3WOFB 3X40A 4O3VA 2IMJA 2B24B 1LOVA 4J9AA 1VZZA 3OWYA 1OGXA 3EF8A 4NREA 1Q824 1QMAA 3BNCA 3I553 2P38A 2Y73A 5AIHA 3WHOA 4HJLB 3BU4A 1RGHA 2CFKA 3CPOA 5M19A 1W6GA 4K1VA 3GRDA 3D3LA 3F40A 4RNZA 4BTWA 2CWVA 5EVHA 2P0MA 3BIRA 1ISKA 4KFEA 3CXC2 1ZS7A 3JUNA 4KVHA 1K9M4 2CHCA 3DGNA 1BANA 1X1XA 1ZX2A 4I4KA 3A5EA 5CK6A 2IUJA 3VGNA 1W4NA 1TFKA 3PXMA 4HM1B 4XBXA 1Q40B 1BNIA 3DY5A 3EN1B 1B2MA 3IMAB 1PYLA 2KRTA 3QK9A 1YGEA 1AY7A 1BRKA 1PFPA 3N9HA 5LC6A 4J8TA 1VQN3 5BU4A 4NPBA 5CLKA 1GS3A 1UDII 2HMKB 3NUVA 4ZM8A 3OW22 1MGWA 5STDA 5IG5A 2XEPA 1G02A 1IV7A 3NV0A 3CC43 1J2BA 2OQEC 3DH2A 4ILFA 4K61A 3DZLA 3FSDA 5CF1A 4XBYA 4GB5A 2KF3A 3KZTA 1M1K4 5DRVA 2W2CA 4L7KA 4RZMA 4XDVA 1LQMB 3ZFZA 1GMPA 1DMNA 4R9LA 1I0VA 1TRQA 3ECFA 1W6YA 4EBGA 1FGOA 1T3BA 5M1AA 2JQ5A 2KF4A 1JZDA 1JB5A 3AMOA 3MKIA 1R4CA 1R4YA 1AQZA 5I97A 1JZOA 1G0TA 1C7HA 3BNBA 4R4KA 1EG9B 1UGIA 2OCTA 4N6UA 2F86B 3WR2A 4BTYA 2QEX3 3WA3A 4R80A 4HM2B 3B8LA 1SJWA 1BSDA 4HM0B 1JN5A 3NBJA 1UCLA 1E3VA 4J5GA 2XSOB 2ZA4A 3F9SA 3URPA 1UUWB 4WYKB 3MG1A 3AHSA 1FA3A 1Q40A 1FGQA 5KP3A 1DE3A 2IYJA 1Q42A 3OXAA 8CHOA 4MMZB 2XGNA 1NJI4 1QAFA 3NM2A 2QA43 1T5YA 1Z1SA 3UJMA 3D5IA 3HK4A 2CKFB 1PY3A 3EB8A 1EKMA 3PZWA 2OOVA 1LQGC 1OHOA 1QJGA 1TIJA 2CX1A 2MF7A 4HM7B 1W5ZA 2PZVA 1D6ZA 2F98A 1O7NB 3OX9A 1SIIA 3AHWA
chains in the Genus database with same CATH topology
1K28A 1ULIB 3DM8A 3OWUA 4BTXA 2CFGA 1QALA 4LZIA 6STDA 3JUOA 5KP1A 1F8NA 3FF2A 3G4S3 3SX1A 5TGNA 1GY5A 5ELUA 5D82A 1YIT3 3WMDA 3FG3A 2FXTA 1IQ8A 2GXFA 1OGZA 2CWUA 3B4PA 4HM3B 4RBNA 2IUKA 4OK0A 1ZO2A 4N6OB 1EQKA 1TP6A 1TFOA 3PYJA 2PNCA 4R9KA 1VQ63 2GBWB 3PGBA 4X2OA 3NQYA 3PCSA 2FNQA 4N3VA 4HZBB 5AEUB 4HM8B 1GD4A 1ROVA 3I563 2XFSA 3U1WA 1OF5B 3F8XA 3FKAA 3N54B 1AVLA 3S29A 2R4IA 4XM4A 5LC7A 1WMPA 1IK3A 2CWTA 5JPPA 3Q1CA 1N9JA 5G2GA 2ZL8A 1CEWI 1O7WB 1JRQA 4O02B 4WFOA 4QWTA 5CXOA 2W56A 3GWRA 3DUKA 1VQ73 2FGTA 4Q53A 3V92A 3LXUX 4EV5A 1JB2A 4EV2A 3EHCA 1STDA 1DVDA 5AIGA 3KSED 1ULJB 3LOYA 1AVKA 3SVAA 2XSHB 5FGOA 3T0UA 1PU4A 1LXEA 1W00A 1OPYA 3LYGA 1U8CB 1WTHA 3EQQB 4CCVA 2GEYA 4FCMA 4OUQA 3FCSB 3S5CA 3EN8A 2GU1A 2JDIH 2RSXA 3FG4A 3GZRA 5AYSC 1QAKA 1VQ43 1K41A 2XR8B 2C11A 1WMNA 2OOVC 2P05A 2O9UX 3GZXB 1GY7A 3JUQA 4FMBA 3TDGA 1KC84 4FMAA 2CC3A 3DGOA 3CCU3 1WNHA 5IERA 2YX9A 3BLZA 2F99A 5DREA 1OH0A 1LVNA 1FUWA 4FMDA 1K8A4 3KKGA 2WO0A 4R1KA 1OACA 4WWUC 2Z6BA 1STFI 1ASKA 1YJW3 4MMXB 1OCVA 1IU7A 1SPUA 5AI1A 3CC23 3IJEB 4LGQA 4OVMA 4KZ1A 2CK3H 3FGYA 2LQVA 1E3RA 4XDWA 1AV4A 3NQZA 1EA2A 2CFLA 1LNHA 3F8HA 3M8CA 2QIYA 3NM7A 3IPTA 4H61A 4HKVB 2BHMA 3OV4A 2OTL3 3K0ZA 3NXJA 2BO9B 1RJOA 3KIIA 4JRFA 4PEJA 3HX8A 5AIFA 3EBYA 1IV9A 2IA7A 1N5HA 1GY6A 1ROAA 1TU5A 5A0OB 1RRHA 2QGUA 3MPHA 2XFTA 4WHAA 1CYVA 2W6JH 1CQSA 3H51A 3I0YA 3FLJA 2P0XA 3MSOA 3K9MC 4X2HA 2Z7AA 3SOYA 5AIIA 1MOLA 3VSYA 4EC6A 2W9PA 3L0RA 5BVBA 1O7GB 2A15A 1Q864 4IPBA 1Q7Y4 4N6NB 4H3UA 3CNXA 5D83A 1DMQA 2XRXB 1D6UA 1DVCA 1D6YA 3DGLA 4HBRA 4N6MA 2K54A 3QRDA 1HU9A 3G16A 3K7CA 3Q90A 3CCL3 1JV2B 3G8ZA 2MC8A 1MNLA 2I9WA 4IT7A 3CCV3 1NWWA 3S28A 1IQXA 1LOXA 1US1A 3NHXA 4JF8A 3A76A 4WYKA 1VQ53 3CNMA 1IVXA 2W03A 3G6E3 1YI23 2STDA 3DMCA 5IEPA 1IT8A 4XBTA 1JKGB 1YHQ3 5IW9A 3D9RA 3JUMA 3S27A 1RN7A 1OUNA 2BMOB 1IQYA 3F7SA 3PCRA 1SIHA 5AEWB 3CCS3 1N5PA 2CFWA 1O7PB 1W6CA 4HM5B 3K5TA 3KN4A 3EBTA 2KCDA 1NDOB 1NB3I 3KFQC 1O7MB 1DMMA 1OHSA 3LT8A 3PS8A 4N6LA 3UL6A 3FG1A 4AKZA 1FGMA 2D42A 5FW5A 1N8R4 1S723 2W0QA 1GYBA 1NU3A 4EXRA 1RRLA 3GZBA 3LTAA 3E99A 3JUPA 5EEOA 1E97A 3SLUA 3UNLA 4HM4B 3ROBA 2XF3A 4KFDA 3CCE3 3X3ZA 3SEDA 3HZPA 5IEOA 3SOAA 3B7CA 5CF2A 3NV0B 3N8BA 2HMMB 2ZDJA 1OF5A 2BMRB 2HMOB 3U97A 1WMOA 2GBXB 5EQLA 2YFJB 3OWSA 2OTJ3 2CW9A 1IDPA 3NX0A 3HIIA 1L5GB 1M904 3LTBA 2CIUA 3LTDA 1M1XB 1N8QA 3AMOB 2HMLB 2Y74A 1IVUA 4STDA 2YFIB 3UB1A 2CFDA 2OWPA 3SXXA 1VQO3 5HGRA 4FCJA 3KSPA 1JB4A 2CH9A 2HMJB 3ALAA 1HKXA 3X3XA 3BNEA 3F7XA 4HYZA 4FCZA 4L8PA 1NB5I 1JN5B 1FGTA 4N6V0 1A67A 1IVVA 3LT9A 2D1WA 1W2ZA 1G96A 1RKYA 4G1MB 3F14A 3ER7A 2GU3A 4IIAA 3X3YA 2CG1A 2BNGA 3MHEA 1UW1A 4MMYB 1BUQA 2INXA 3T8UA 3CCQ3 5IG4A 2XH9A 2Z77A 5KP4A 1VQL3 3CME3 3DGMA 3FF0A 4U13A 1YJN3 3GZYB 3EX9A 2B1XB 4K1UA 3BNDA 1Y4KA 2Z76A 2RGQA 4N6TA 5JBSA 4CDLA 1WQLB 3GAXA 4HVNA 1KSIA 1S5AA 4RNYA 1VQK3 2V1LA 1N9EA 3EC9A 3V98A 3WODG 3J7Yd 3CCM3 1V74A 4AEQA 2O3OA 3CD63 2GEXA 3EE1A 4XB5A 3MG2A 3NBRA 3FH1A 3LTCA 3Q2PA 4MEIA 2RFRA 3G0KA 1IT7A 4EYCA 1KWIA 3B4OA 5BXQA 4AKYA 3FZWA 4LEHA 5IG3A 1VQ93 2M7OA 3WOEB 3X42A 2K0MA 2BMQB 1CYUA 3T8NA 3MYTA 1O7HB 2ML5A 3MWZA 1A90A 3NBBA 1KD14 3CCR3 1TUHA 4TX4A 3RGAA 2LYXA 1VQP3 3WA2X 3HIGA 2Q07A 1UI7A 1QVG2 2SBLA 4K90B 1YIJ3 4L8OA 2WGOA 4FMCA 4O8SA 3V99A 2YFLB 1NO3A 3CMA3 2OQEA 4NHFA 2HMNB 2W56B 3X41A 3MG3A 2E2VA 1W2B2 4MJDA 2C10A 2WOFA 1W01A 3LZAA 1UUVB 4ORLA 4FR9A 3RGRA 3RDEA 2ML6A 2W04A 1DYUA 2P09A 3BB9A 5JPUA 2W9QA 1JNQA 1M9GA 3H3HA 5D81A 5IF6A 3LMLA 3O8YA 1YJ93 2KXGA 1W02A 3DXOA 4GL6A 7STDA 1K734 5IENA 1SQWA 4KFFA 1GD3A 1UI8A 2WGQA 3WDGB 2BT3A 3HI7A 3K63A 4LSOA 2RCDA 1FGRA 3CPW2 1W7CA 3STDA 1AR0A 1VQ83 4O2HA 2XGLA 2E2TA 3CCJ3 3CU3A 2CG0A 5ELJA 1QVF2 3S67A 2L4VA 3KE7A 1A2VA 3CC73 4HZ9B 1VQM3 4HM6B 4LMIA 3EJVA 2WOHA 5AYRB 1YVBI 5IG0A 1IVWA 1U5OA 3G713 1OHPA 1JKGA 1JJ22 2UX0A 3UL5A 1KQS2 4WP5A 1A2KA 3JVCA 3VF1A 3LH4A 2E2UA 1Q814 3WOFB 3X40A 4O3VA 2IMJA 2B24B 4J9AA 1VZZA 3OWYA 1OGXA 3EF8A 4NREA 1Q824 1QMAA 3BNCA 3I553 2P38A 2Y73A 5AIHA 4HJLB 3CPOA 2CFKA 1W6GA 4K1VA 3GRDA 3D3LA 3F40A 4RNZA 4BTWA 2CWVA 5EVHA 2P0MA 1ISKA 4KFEA 3CXC2 3JUNA 4KVHA 1K9M4 2CHCA 3DGNA 1ZX2A 5CK6A 4I4KA 2IUJA 3VGNA 1W4NA 1TFKA 3PXMA 4HM1B 4XBXA 1Q40B 3DY5A 3EN1B 3IMAB 2KRTA 3QK9A 1YGEA 1PFPA 3N9HA 5LC6A 1VQN3 4J8TA 5CLKA 1GS3A 2HMKB 3NUVA 4ZM8A 3OW22 5STDA 5IG5A 2XEPA 3NV0A 1IV7A 3CC43 1J2BA 2OQEC 4K61A 3DZLA 3FSDA 5CF1A 4XBYA 4GB5A 3KZTA 1M1K4 5DRVA 2W2CA 4L7KA 4RZMA 4XDVA 1DMNA 4R9LA 3ECFA 1W6YA 4EBGA 1FGOA 2JQ5A 1JB5A 3AMOA 3MKIA 1R4CA 5I97A 1C7HA 3BNBA 4R4KA 1EG9B 2OCTA 4N6UA 2F86B 4BTYA 2QEX3 3WA3A 4R80A 4HM2B 3B8LA 1SJWA 4HM0B 1JN5A 3NBJA 1E3VA 2XSOB 3F9SA 1UUWB 4WYKB 3MG1A 1FA3A 1Q40A 1FGQA 5KP3A 1Q42A 3OXAA 8CHOA 4MMZB 2XGNA 1NJI4 1QAFA 3NM2A 2QA43 1T5YA 1Z1SA 3UJMA 3HK4A 2CKFB 3EB8A 1EKMA 3PZWA 2OOVA 1OHOA 1QJGA 1TIJA 2MF7A 4HM7B 1W5ZA 2PZVA 1D6ZA 2F98A 1O7NB 3OX9A 1SIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULI B;  3DM8 A;  3OWU A;  6STD A;  3JUO A;  5KP1 A;  3FF2 A;  5TGN A;  1GY5 A;  5D82 A;  3WMD A;  2GXF A;  1OGZ A;  3B4P A;  4HM3 B;  1ZO2 A;  1TP6 A;  4R9K A;  2GBW B;  4X2O A;  4N3V A;  4HZB B;  5AEU B;  4HM8 B;  1OF5 B;  3F8X A;  3FKA A;  2R4I A;  4XM4 A;  5JPP A;  5G2G A;  1O7W B;  5CXO A;  3GWR A;  3DUK A;  4Q53 A;  1JB2 A;  3EHC A;  1STD A;  5AIG A;  1ULJ B;  2XSH B;  1W00 A;  1OPY A;  3LYG A;  3EQQ B;  2GEY A;  4FCM A;  4OUQ A;  3S5C A;  3EN8 A;  3GZR A;  1K41 A;  2XR8 B;  3GZX B;  1GY7 A;  3JUQ A;  5IER A;  3BLZ A;  2F99 A;  5DRE A;  1OH0 A;  3KKG A;  4R1K A;  4WWU C;  1ASK A;  1OCV A;  5AI1 A;  4LGQ A;  4OVM A;  3FGY A;  1E3R A;  4XDW A;  1EA2 A;  3M8C A;  4HKV B;  3F8H A;  2QIY A;  3IPT A;  3OV4 A;  3K0Z A;  3NXJ A;  4PEJ A;  3HX8 A;  5AIF A;  3EBY A;  1GY6 A;  2QGU A;  1CQS A;  3H51 A;  3I0Y A;  3FLJ A;  3MSO A;  4X2H A;  2Z7A A;  3SOY A;  5AII A;  3VSY A;  5BVB A;  1O7G B;  2A15 A;  4H3U A;  3CNX A;  5D83 A;  1DMQ A;  2XRX B;  2K54 A;  3G16 A;  3K7C A;  3Q90 A;  3G8Z A;  2I9W A;  1NWW A;  3NHX A;  3A76 A;  4WYK A;  3CNM A;  2STD A;  3DMC A;  5IEP A;  4XBT A;  1JKG B;  3D9R A;  3JUM A;  1OUN A;  2BMO B;  3F7S A;  5AEW B;  1O7P B;  4HM5 B;  3EBT A;  1NDO B;  1O7M B;  1DMM A;  1OHS A;  5FW5 A;  1GYB A;  1NU3 A;  3GZB A;  3E99 A;  3JUP A;  3UNL A;  1E97 A;  4HM4 B;  3ROB A;  3SED A;  3HZP A;  5IEO A;  3SOA A;  3B7C A;  5CF2 A;  3NV0 B;  2HMM B;  1OF5 A;  2BMR B;  2HMO B;  2GBX B;  2YFJ B;  3OWS A;  1IDP A;  2HML B;  4STD A;  2YFI B;  2OWP A;  5HGR A;  4FCJ A;  3KSP A;  1JB4 A;  2HMJ B;  1HKX A;  3F7X A;  4L8P A;  1JN5 B;  3F14 A;  3ER7 A;  4IIA A;  2BNG A;  3MHE A;  1BUQ A;  2INX A;  3T8U A;  5IG4 A;  2Z77 A;  5KP4 A;  3FF0 A;  4U13 A;  3GZY B;  3EX9 A;  2B1X B;  4K1U A;  2Z76 A;  2RGQ A;  4CDL A;  1WQL B;  4HVN A;  1S5A A;  3EC9 A;  2GEX A;  4XB5 A;  3MG2 A;  3NBR A;  3FH1 A;  2RFR A;  3G0K A;  3B4O A;  5BXQ A;  3FZW A;  4LEH A;  5IG3 A;  2BMQ B;  3T8N A;  3MYT A;  1O7H B;  1TUH A;  3RGA A;  4L8O A;  2YFL B;  2HMN B;  3MG3 A;  4MJD A;  1W01 A;  3LZA A;  1UUV B;  4ORL A;  3RGR A;  3BB9 A;  5JPU A;  5D81 A;  3H3H A;  5IF6 A;  1W02 A;  3DXO A;  7STD A;  5IEN A;  2RCD A;  3STD A;  1AR0 A;  3CU3 A;  3KE7 A;  4HZ9 B;  4HM6 B;  4LMI A;  3EJV A;  5IG0 A;  1U5O A;  1OHP A;  1JKG A;  2UX0 A;  4WP5 A;  1A2K A;  2IMJ A;  2B24 B;  4J9A A;  1VZZ A;  3OWY A;  1OGX A;  3EF8 A;  1QMA A;  5AIH A;  4HJL B;  3CPO A;  4K1V A;  3GRD A;  3F40 A;  5EVH A;  1ISK A;  3JUN A;  4KVH A;  2CHC A;  1ZX2 A;  5CK6 A;  4I4K A;  3VGN A;  4HM1 B;  4XBX A;  1Q40 B;  3EN1 B;  4J8T A;  5CLK A;  1GS3 A;  2HMK B;  3NUV A;  5STD A;  5IG5 A;  3NV0 A;  3DZL A;  3FSD A;  5CF1 A;  4XBY A;  4GB5 A;  3KZT A;  5DRV A;  2W2C A;  4L7K A;  4RZM A;  4XDV A;  1DMN A;  4R9L A;  3ECF A;  1W6Y A;  2JQ5 A;  1JB5 A;  3MKI A;  1C7H A;  1EG9 B;  2F86 B;  4HM2 B;  3B8L A;  1SJW A;  4HM0 B;  1JN5 A;  1E3V A;  2XSO B;  3F9S A;  1UUW B;  4WYK B;  3MG1 A;  1Q40 A;  5KP3 A;  1Q42 A;  3OXA A;  8CHO A;  3NM2 A;  1Z1S A;  3UJM A;  3HK4 A;  2CKF B;  1OHO A;  1QJG A;  4HM7 B;  2PZV A;  2F98 A;  1O7N B;  3OX9 A; 
#chains in the Genus database with same CATH topology
 1K28 A;  1ULI B;  3DM8 A;  3OWU A;  4BTX A;  1RGC A;  2CFG A;  1QAL A;  4LZI A;  6STD A;  3JUO A;  5KP1 A;  1F8N A;  3FF2 A;  3G4S 3;  3SX1 A;  5TGN A;  4RNT A;  2HOH A;  1GY5 A;  5ELU A;  1MWT A;  5D82 A;  1YIT 3;  4HOH A;  3WMD A;  3FG3 A;  2FXT A;  1IQ8 A;  1B3S A;  2GXF A;  1GOU A;  1OGZ A;  2CWU A;  3B4P A;  4HM3 B;  4RBN A;  2IUK A;  4OK0 A;  1ZO2 A;  1FW7 A;  4N6O B;  1TJD A;  1EQK A;  1FYS A;  2BU4 A;  1TP6 A;  1TFO A;  3PYJ A;  2PNC A;  4R9K A;  5G1K A;  1VQK 3;  1VQ6 3;  2GBW B;  3PGB A;  4X2O A;  3NQY A;  3PCS A;  2FNQ A;  4N3V A;  4HZB B;  5AEU B;  4HM8 B;  1GD4 A;  1ROV A;  3I56 3;  2XFS A;  5BIR A;  3U1W A;  1BRS A;  1RSN A;  1OF5 B;  3F8X A;  3FKA A;  3N54 B;  1AVL A;  2KF6 A;  2R4I A;  4XM4 A;  5GSP A;  1WMP A;  5LC7 A;  3S29 A;  3D4A A;  1IK3 A;  2CWT A;  1I3F A;  5JPP A;  3Q1C A;  1N9J A;  5G2G A;  2ZL8 A;  1CEW I;  2C4B A;  3ZG0 A;  1O7W B;  1JRQ A;  4O02 B;  1B2U A;  1B2Z A;  4QWT A;  4WFO A;  5CXO A;  1I2F A;  2RNT A;  2W56 A;  3ZG5 A;  3GWR A;  2RBI A;  3DUK A;  1VQ7 3;  2FGT A;  4Q53 A;  3V92 A;  1BRH A;  3LXU X;  4EV5 A;  1JB2 A;  4EV2 A;  3EHC A;  1STD A;  1DVD A;  5AIG A;  3KSE D;  1ULJ B;  3LOY A;  5M18 A;  1AVK A;  3SVA A;  2XSH B;  5FGO A;  3T0U A;  1RGE A;  1I2G A;  1PU4 A;  3SYU A;  1LXE A;  1W00 A;  1OPY A;  3LYG A;  4I5Q A;  1U8C B;  1WTH A;  3EQQ B;  4CCV A;  2GEY A;  4FCM A;  4OUQ A;  3FCS B;  3S5C A;  1B2X A;  2GU1 A;  1BNJ A;  2JDI H;  2RSX A;  3EN8 A;  1Q7H A;  3FG4 A;  1LNI A;  1QAK A;  3GZR A;  5AYS C;  1RNB A;  1VQ4 3;  1K41 A;  2XR8 B;  2C11 A;  1RGA A;  1VQQ A;  1WMN A;  2OOV C;  1ZGX A;  2H0I A;  4LYL B;  4CJN A;  2P05 A;  1RGG A;  2O9U X;  3GZX B;  1GY7 A;  3JUQ A;  4FMB A;  1RGL A;  1BSA A;  6GSP A;  3TDG A;  1KC8 4;  4FMA A;  2CC3 A;  2IY2 A;  3DGO A;  3CCU 3;  2KAA A;  1WNH A;  5IER A;  2YX9 A;  3BLZ A;  2F99 A;  5DRE A;  1OH0 A;  1LVN A;  1FUW A;  4FMD A;  1K8A 4;  3KKG A;  2F5M A;  2WO0 A;  4R1K A;  1OAC A;  4WWU C;  2Z6B A;  1STF I;  1ASK A;  1RTU A;  1YJW 3;  4MMX B;  1OCV A;  1IU7 A;  4J5K A;  1SPU A;  5AI1 A;  3CC2 3;  1B21 A;  3IJE B;  4LGQ A;  4OVM A;  4KZ1 A;  5HOH A;  2CK3 H;  1SAR A;  1MWR A;  3FGY A;  2LQV A;  1E3R A;  4XDW A;  1RCL A;  1AV4 A;  3NQZ A;  1EA2 A;  1UCK A;  2CFL A;  1LNH A;  3F8H A;  3M8C A;  2QIY A;  3NM7 A;  3IPT A;  4H61 A;  4HKV B;  2BHM A;  3OV4 A;  2OTL 3;  1JBR A;  3K0Z A;  3NXJ A;  2BO9 B;  1LOY A;  1BUJ A;  1RJO A;  1CH0 A;  3KII A;  3HOH A;  4JRF A;  4PEJ A;  3HX8 A;  5AIF A;  3EBY A;  1IV9 A;  2IA7 A;  1N5H A;  1TTO A;  1GY6 A;  1ROA A;  1TU5 A;  5A0O B;  1RHL A;  1RRH A;  3GSP A;  2QGU A;  3MPH A;  1UCJ A;  2XFT A;  4WHA A;  1CYV A;  2W6J H;  1CQS A;  3H51 A;  3I0Y A;  1X1U A;  3FLJ A;  2P0X A;  3MSO A;  4HAA A;  3K9M C;  4X2H A;  4DKI A;  2F56 A;  2Z7A A;  3SOY A;  5AII A;  1MOL A;  2F5W A;  3VSY A;  4EC6 A;  1RGK A;  2W9P A;  3L0R A;  5BVB A;  1O7G B;  1V58 A;  2A15 A;  1Q86 4;  1MWS A;  4IPB A;  1Q7Y 4;  4N6N B;  4H3U A;  3CNX A;  5D83 A;  1DMQ A;  4BL3 A;  2XRX B;  1D6U A;  1DET A;  1D6Y A;  1DVC A;  3DGL A;  4HBR A;  4N6M A;  1MWU A;  2K54 A;  3QRD A;  1TRP A;  1BSE A;  1HU9 A;  3G16 A;  3K7C A;  3Q90 A;  1X1W A;  3CCL 3;  1JV2 B;  3G8Z A;  2KF5 A;  2MC8 A;  1MNL A;  1FZU A;  1BRN L;  2I9W A;  4IT7 A;  3CCV 3;  1NWW A;  3S28 A;  1IQX A;  1LOX A;  1US1 A;  3NHX A;  4JF8 A;  1BSC A;  3A76 A;  4WYK A;  1VQ5 3;  3CNM A;  1IVX A;  2W03 A;  3G6E 3;  1YI2 3;  2STD A;  2UUG C;  3DMC A;  3D79 A;  5IEP A;  9RNT A;  1IT8 A;  4XBT A;  1JKG B;  1YHQ 3;  5IW9 A;  3D9R A;  3JUM A;  3S27 A;  1RN7 A;  1OUN A;  3Q3F A;  2BMO B;  1IQY A;  3F7S A;  3PCR A;  1SIH A;  5AEW B;  1BSB A;  1RLS A;  3CCS 3;  1N5P A;  2CFW A;  1O7P B;  2J8X B;  1W6C A;  4HM5 B;  3K5T A;  1YVS A;  2UGI A;  1I70 A;  1FUS A;  3KN4 A;  1HZ1 A;  3EBT A;  2KCD A;  1NDO B;  1NB3 I;  3KFQ C;  3KCH A;  1O7M B;  1Q9E A;  1I3I A;  1V57 A;  1DMM A;  1OHS A;  3LT8 A;  1B20 A;  1BAO A;  1RGF A;  1UUG B;  3PS8 A;  4N6L A;  3UL6 A;  3FG1 A;  4AKZ A;  1FGM A;  1BOX A;  2D42 A;  5FW5 A;  1UCI A;  1N8R 4;  1S72 3;  1RNT A;  1T2H A;  1JBS A;  1BNS A;  1GYB A;  2W0Q A;  1NNV A;  2K3D A;  1NU3 A;  1BU4 A;  1RRL A;  3GZB A;  3LTA A;  3E99 A;  3JUP A;  5EEO A;  1E97 A;  3SLU A;  3UNL A;  1B2S A;  4HM4 B;  3ROB A;  2XF3 A;  4KFD A;  3CCE 3;  3X3Z A;  3SED A;  3HZP A;  5IEO A;  1YGW A;  3B7C A;  3SOA A;  5CF2 A;  3NV0 B;  3N8B A;  2HMM B;  2CX0 A;  2ZDJ A;  2H0H A;  1OF5 A;  2BMR B;  2HMO B;  3U97 A;  1WMO A;  2GBX B;  1HYF A;  5EQL A;  2YFJ B;  3OWS A;  2OTJ 3;  2CW9 A;  1IDP A;  1GOY A;  3NX0 A;  3HII A;  1L5G B;  1EEJ A;  1M90 4;  1FUT A;  3LTB A;  2CIU A;  3LTD A;  1M1X B;  1N8Q A;  1GMR A;  3AMO B;  2HML B;  2Y74 A;  1IVU A;  4STD A;  2R41 A;  2YFI B;  1T2I A;  2CFD A;  2OWP A;  3AGN A;  3SXX A;  1VQO 3;  5HGR A;  4FCJ A;  3KSP A;  5RNT A;  1JB4 A;  2CH9 A;  2HMJ B;  3ALA A;  1HKX A;  3X3X A;  7GSP A;  3BNE A;  3F7X A;  4HYZ A;  4FCZ A;  4L8P A;  1NB5 I;  1JN5 B;  1FGT A;  4N6V 0;  4BIR A;  1IVV A;  3LT9 A;  1A67 A;  2D1W A;  1W2Z A;  4EXR A;  1G96 A;  1RKY A;  4G1M B;  3F14 A;  3ER7 A;  2GU3 A;  4IIA A;  3UB1 A;  8RNT A;  3X3Y A;  2CG1 A;  2BNG A;  1BGS A;  3MHE A;  1UW1 A;  4MMY B;  1GOV A;  1BUQ A;  2INX A;  3T8U A;  1RCK A;  3CCQ 3;  1RN4 A;  5IG4 A;  1I8V A;  2XH9 A;  2Z77 A;  4GHO A;  5KP4 A;  3DGM A;  3FF0 A;  4U13 A;  3CME 3;  2GSP A;  1YJN 3;  1VQL 3;  3GZY B;  3EX9 A;  2B1X B;  4K1U A;  2AAE A;  3BND A;  1Y4K A;  2Z76 A;  1BVI A;  2RGQ A;  4N6T A;  5JBS A;  4CDL A;  1WQL B;  3GAX A;  4HVN A;  1KSI A;  1S5A A;  4RNY A;  2H0G A;  2V1L A;  1N9E A;  4KT3 B;  3EC9 A;  3V98 A;  1I2E A;  3WOD G;  3J7Y d;  3CCM 3;  1V74 A;  4AEQ A;  2AAD A;  2O3O A;  3CD6 3;  2GEX A;  3EE1 A;  4XB5 A;  3MG2 A;  3NBR A;  3FH1 A;  3LTC A;  3Q2P A;  3RNT A;  4MEI A;  2RFR A;  3G0K A;  1IT7 A;  4EYC A;  1BNG A;  1KWI A;  3B4O A;  5BXQ A;  4AKY A;  6RNT A;  3FZW A;  4LEH A;  5IG3 A;  1VQ9 3;  2M7O A;  3AGO A;  3WOE B;  2K0M A;  3X42 A;  1YNV X;  2BMQ B;  2BIR A;  1CYU A;  3T8N A;  3MYT A;  1I0X A;  1O7H B;  2ML5 A;  3MWZ A;  1UGH I;  3NBB A;  1KD1 4;  1A90 A;  3CCR 3;  1TUH A;  4TX4 A;  3RGA A;  2LYX A;  1VQP 3;  3WA2 X;  3HIG A;  1C54 A;  1RN1 A;  2Q07 A;  4GSP A;  1BNF A;  1UI7 A;  3DGY A;  1QVG 2;  2SBL A;  4K90 B;  1YIJ 3;  4L8O A;  7RNT A;  2WGO A;  1BNE A;  4FMC A;  1EUI C;  4O8S A;  3V99 A;  2YFL B;  1B27 A;  1NO3 A;  1A2P A;  2OQE A;  3CMA 3;  2SAR A;  4NHF A;  2HMN B;  1X1Y A;  1GSP A;  2W56 B;  3X41 A;  3MG3 A;  2E2V A;  1W2B 2;  4MJD A;  2C10 A;  4BL2 A;  1BRJ A;  1W01 A;  1LOW A;  2WOF A;  1UUV B;  3LZA A;  4ORL A;  4FR9 A;  3RGR A;  3RDE A;  4EW5 A;  2ML6 A;  2W04 A;  1DYU A;  2P09 A;  3BB9 A;  5JPU A;  2W9Q A;  1JNQ A;  1M9G A;  3H3H A;  5D81 A;  5IF6 A;  1JBT A;  3LML A;  2F4Y A;  3O8Y A;  1BRI A;  1YJ9 3;  2KXG A;  1W02 A;  3DXO A;  4GL6 A;  5G1L A;  7STD A;  5IEN A;  1SQW A;  1K73 4;  4KFF A;  1BIR A;  1GD3 A;  1UI8 A;  2WGQ A;  3WDG B;  2BT3 A;  3HI7 A;  3K63 A;  2L1S A;  4LSO A;  2RCD A;  1FGR A;  2ZHX B;  1W7C A;  3STD A;  4BU4 A;  3CPW 2;  1RMS A;  1RDS A;  1AR0 A;  1VQ8 3;  4O2H A;  1BNR A;  2XGL A;  2E2T A;  3CCJ 3;  3CU3 A;  2CG0 A;  5ELJ A;  1MGR A;  1GMQ A;  1QVF 2;  3S67 A;  2L4V A;  3KE7 A;  1A2V A;  1LRA A;  3CC7 3;  4HZ9 B;  1VQM 3;  4HM6 B;  4LMI A;  3EJV A;  2WOH A;  4CPK A;  5AYR B;  1YVB I;  5IG0 A;  1IVW A;  1U5O A;  3G71 3;  1BRG A;  3D5G A;  1OHP A;  1IYY A;  1JKG A;  1JJ2 2;  2UX0 A;  3UL5 A;  1KQS 2;  4WP5 A;  1A2K A;  3JVC A;  3VF1 A;  3LH4 A;  2E2U A;  1Q81 4;  3WOF B;  3X40 A;  4O3V A;  2IMJ A;  2B24 B;  1LOV A;  4J9A A;  1VZZ A;  3OWY A;  1OGX A;  3EF8 A;  4NRE A;  1Q82 4;  1QMA A;  3BNC A;  3I55 3;  2P38 A;  2Y73 A;  5AIH A;  3WHO A;  4HJL B;  3BU4 A;  1RGH A;  2CFK A;  3CPO A;  5M19 A;  1W6G A;  4K1V A;  3GRD A;  3D3L A;  3F40 A;  4RNZ A;  4BTW A;  2CWV A;  5EVH A;  2P0M A;  3BIR A;  1ISK A;  4KFE A;  3CXC 2;  1ZS7 A;  3JUN A;  4KVH A;  1K9M 4;  2CHC A;  3DGN A;  1BAN A;  1X1X A;  1ZX2 A;  4I4K A;  3A5E A;  5CK6 A;  2IUJ A;  3VGN A;  1W4N A;  1TFK A;  3PXM A;  4HM1 B;  4XBX A;  1Q40 B;  1BNI A;  3DY5 A;  3EN1 B;  1B2M A;  3IMA B;  1PYL A;  2KRT A;  3QK9 A;  1YGE A;  1AY7 A;  1BRK A;  1PFP A;  3N9H A;  5LC6 A;  4J8T A;  1VQN 3;  5BU4 A;  4NPB A;  5CLK A;  1GS3 A;  1UDI I;  2HMK B;  3NUV A;  4ZM8 A;  3OW2 2;  1MGW A;  5STD A;  5IG5 A;  2XEP A;  1G02 A;  1IV7 A;  3NV0 A;  3CC4 3;  1J2B A;  2OQE C;  3DH2 A;  4ILF A;  4K61 A;  3DZL A;  3FSD A;  5CF1 A;  4XBY A;  4GB5 A;  2KF3 A;  3KZT A;  1M1K 4;  5DRV A;  2W2C A;  4L7K A;  4RZM A;  4XDV A;  1LQM B;  3ZFZ A;  1GMP A;  1DMN A;  4R9L A;  1I0V A;  1TRQ A;  3ECF A;  1W6Y A;  4EBG A;  1FGO A;  1T3B A;  5M1A A;  2JQ5 A;  2KF4 A;  1JZD A;  1JB5 A;  3AMO A;  3MKI A;  1R4C A;  1R4Y A;  1AQZ A;  5I97 A;  1JZO A;  1G0T A;  1C7H A;  3BNB A;  4R4K A;  1EG9 B;  1UGI A;  2OCT A;  4N6U A;  2F86 B;  3WR2 A;  4BTY A;  2QEX 3;  3WA3 A;  4R80 A;  4HM2 B;  3B8L A;  1SJW A;  1BSD A;  4HM0 B;  1JN5 A;  3NBJ A;  1UCL A;  1E3V A;  4J5G A;  2XSO B;  2ZA4 A;  3F9S A;  3URP A;  1UUW B;  4WYK B;  3MG1 A;  3AHS A;  1FA3 A;  1Q40 A;  1FGQ A;  5KP3 A;  1DE3 A;  2IYJ A;  1Q42 A;  3OXA A;  8CHO A;  4MMZ B;  2XGN A;  1NJI 4;  1QAF A;  3NM2 A;  2QA4 3;  1T5Y A;  1Z1S A;  3UJM A;  3D5I A;  3HK4 A;  2CKF B;  1PY3 A;  3EB8 A;  1EKM A;  3PZW A;  2OOV A;  1LQG C;  1OHO A;  1QJG A;  1TIJ A;  2CX1 A;  2MF7 A;  4HM7 B;  1W5Z A;  2PZV A;  1D6Z A;  2F98 A;  1O7N B;  3OX9 A;  1SII A;  3AHW A; 
#chains in the Genus database with same CATH homology
 1K28 A;  1ULI B;  3DM8 A;  3OWU A;  4BTX A;  2CFG A;  1QAL A;  4LZI A;  6STD A;  3JUO A;  5KP1 A;  1F8N A;  3FF2 A;  3G4S 3;  3SX1 A;  5TGN A;  1GY5 A;  5ELU A;  5D82 A;  1YIT 3;  3WMD A;  3FG3 A;  2FXT A;  1IQ8 A;  2GXF A;  1OGZ A;  2CWU A;  3B4P A;  4HM3 B;  4RBN A;  2IUK A;  4OK0 A;  1ZO2 A;  4N6O B;  1EQK A;  1TP6 A;  1TFO A;  3PYJ A;  2PNC A;  4R9K A;  1VQ6 3;  2GBW B;  3PGB A;  4X2O A;  3NQY A;  3PCS A;  2FNQ A;  4N3V A;  4HZB B;  5AEU B;  4HM8 B;  1GD4 A;  1ROV A;  3I56 3;  2XFS A;  3U1W A;  1OF5 B;  3F8X A;  3FKA A;  3N54 B;  1AVL A;  3S29 A;  2R4I A;  4XM4 A;  5LC7 A;  1WMP A;  1IK3 A;  2CWT A;  5JPP A;  3Q1C A;  1N9J A;  5G2G A;  2ZL8 A;  1CEW I;  1O7W B;  1JRQ A;  4O02 B;  4WFO A;  4QWT A;  5CXO A;  2W56 A;  3GWR A;  3DUK A;  1VQ7 3;  2FGT A;  4Q53 A;  3V92 A;  3LXU X;  4EV5 A;  1JB2 A;  4EV2 A;  3EHC A;  1STD A;  1DVD A;  5AIG A;  3KSE D;  1ULJ B;  3LOY A;  1AVK A;  3SVA A;  2XSH B;  5FGO A;  3T0U A;  1PU4 A;  1LXE A;  1W00 A;  1OPY A;  3LYG A;  1U8C B;  1WTH A;  3EQQ B;  4CCV A;  2GEY A;  4FCM A;  4OUQ A;  3FCS B;  3S5C A;  3EN8 A;  2GU1 A;  2JDI H;  2RSX A;  3FG4 A;  3GZR A;  5AYS C;  1QAK A;  1VQ4 3;  1K41 A;  2XR8 B;  2C11 A;  1WMN A;  2OOV C;  2P05 A;  2O9U X;  3GZX B;  1GY7 A;  3JUQ A;  4FMB A;  3TDG A;  1KC8 4;  4FMA A;  2CC3 A;  3DGO A;  3CCU 3;  1WNH A;  5IER A;  2YX9 A;  3BLZ A;  2F99 A;  5DRE A;  1OH0 A;  1LVN A;  1FUW A;  4FMD A;  1K8A 4;  3KKG A;  2WO0 A;  4R1K A;  1OAC A;  4WWU C;  2Z6B A;  1STF I;  1ASK A;  1YJW 3;  4MMX B;  1OCV A;  1IU7 A;  1SPU A;  5AI1 A;  3CC2 3;  3IJE B;  4LGQ A;  4OVM A;  4KZ1 A;  2CK3 H;  3FGY A;  2LQV A;  1E3R A;  4XDW A;  1AV4 A;  3NQZ A;  1EA2 A;  2CFL A;  1LNH A;  3F8H A;  3M8C A;  2QIY A;  3NM7 A;  3IPT A;  4H61 A;  4HKV B;  2BHM A;  3OV4 A;  2OTL 3;  3K0Z A;  3NXJ A;  2BO9 B;  1RJO A;  3KII A;  4JRF A;  4PEJ A;  3HX8 A;  5AIF A;  3EBY A;  1IV9 A;  2IA7 A;  1N5H A;  1GY6 A;  1ROA A;  1TU5 A;  5A0O B;  1RRH A;  2QGU A;  3MPH A;  2XFT A;  4WHA A;  1CYV A;  2W6J H;  1CQS A;  3H51 A;  3I0Y A;  3FLJ A;  2P0X A;  3MSO A;  3K9M C;  4X2H A;  2Z7A A;  3SOY A;  5AII A;  1MOL A;  3VSY A;  4EC6 A;  2W9P A;  3L0R A;  5BVB A;  1O7G B;  2A15 A;  1Q86 4;  4IPB A;  1Q7Y 4;  4N6N B;  4H3U A;  3CNX A;  5D83 A;  1DMQ A;  2XRX B;  1D6U A;  1DVC A;  1D6Y A;  3DGL A;  4HBR A;  4N6M A;  2K54 A;  3QRD A;  1HU9 A;  3G16 A;  3K7C A;  3Q90 A;  3CCL 3;  1JV2 B;  3G8Z A;  2MC8 A;  1MNL A;  2I9W A;  4IT7 A;  3CCV 3;  1NWW A;  3S28 A;  1IQX A;  1LOX A;  1US1 A;  3NHX A;  4JF8 A;  3A76 A;  4WYK A;  1VQ5 3;  3CNM A;  1IVX A;  2W03 A;  3G6E 3;  1YI2 3;  2STD A;  3DMC A;  5IEP A;  1IT8 A;  4XBT A;  1JKG B;  1YHQ 3;  5IW9 A;  3D9R A;  3JUM A;  3S27 A;  1RN7 A;  1OUN A;  2BMO B;  1IQY A;  3F7S A;  3PCR A;  1SIH A;  5AEW B;  3CCS 3;  1N5P A;  2CFW A;  1O7P B;  1W6C A;  4HM5 B;  3K5T A;  3KN4 A;  3EBT A;  2KCD A;  1NDO B;  1NB3 I;  3KFQ C;  1O7M B;  1DMM A;  1OHS A;  3LT8 A;  3PS8 A;  4N6L A;  3UL6 A;  3FG1 A;  4AKZ A;  1FGM A;  2D42 A;  5FW5 A;  1N8R 4;  1S72 3;  2W0Q A;  1GYB A;  1NU3 A;  4EXR A;  1RRL A;  3GZB A;  3LTA A;  3E99 A;  3JUP A;  5EEO A;  1E97 A;  3SLU A;  3UNL A;  4HM4 B;  3ROB A;  2XF3 A;  4KFD A;  3CCE 3;  3X3Z A;  3SED A;  3HZP A;  5IEO A;  3SOA A;  3B7C A;  5CF2 A;  3NV0 B;  3N8B A;  2HMM B;  2ZDJ A;  1OF5 A;  2BMR B;  2HMO B;  3U97 A;  1WMO A;  2GBX B;  5EQL A;  2YFJ B;  3OWS A;  2OTJ 3;  2CW9 A;  1IDP A;  3NX0 A;  3HII A;  1L5G B;  1M90 4;  3LTB A;  2CIU A;  3LTD A;  1M1X B;  1N8Q A;  3AMO B;  2HML B;  2Y74 A;  1IVU A;  4STD A;  2YFI B;  3UB1 A;  2CFD A;  2OWP A;  3SXX A;  1VQO 3;  5HGR A;  4FCJ A;  3KSP A;  1JB4 A;  2CH9 A;  2HMJ B;  3ALA A;  1HKX A;  3X3X A;  3BNE A;  3F7X A;  4HYZ A;  4FCZ A;  4L8P A;  1NB5 I;  1JN5 B;  1FGT A;  4N6V 0;  1A67 A;  1IVV A;  3LT9 A;  2D1W A;  1W2Z A;  1G96 A;  1RKY A;  4G1M B;  3F14 A;  3ER7 A;  2GU3 A;  4IIA A;  3X3Y A;  2CG1 A;  2BNG A;  3MHE A;  1UW1 A;  4MMY B;  1BUQ A;  2INX A;  3T8U A;  3CCQ 3;  5IG4 A;  2XH9 A;  2Z77 A;  5KP4 A;  1VQL 3;  3CME 3;  3DGM A;  3FF0 A;  4U13 A;  1YJN 3;  3GZY B;  3EX9 A;  2B1X B;  4K1U A;  3BND A;  1Y4K A;  2Z76 A;  2RGQ A;  4N6T A;  5JBS A;  4CDL A;  1WQL B;  3GAX A;  4HVN A;  1KSI A;  1S5A A;  4RNY A;  1VQK 3;  2V1L A;  1N9E A;  3EC9 A;  3V98 A;  3WOD G;  3J7Y d;  3CCM 3;  1V74 A;  4AEQ A;  2O3O A;  3CD6 3;  2GEX A;  3EE1 A;  4XB5 A;  3MG2 A;  3NBR A;  3FH1 A;  3LTC A;  3Q2P A;  4MEI A;  2RFR A;  3G0K A;  1IT7 A;  4EYC A;  1KWI A;  3B4O A;  5BXQ A;  4AKY A;  3FZW A;  4LEH A;  5IG3 A;  1VQ9 3;  2M7O A;  3WOE B;  3X42 A;  2K0M A;  2BMQ B;  1CYU A;  3T8N A;  3MYT A;  1O7H B;  2ML5 A;  3MWZ A;  1A90 A;  3NBB A;  1KD1 4;  3CCR 3;  1TUH A;  4TX4 A;  3RGA A;  2LYX A;  1VQP 3;  3WA2 X;  3HIG A;  2Q07 A;  1UI7 A;  1QVG 2;  2SBL A;  4K90 B;  1YIJ 3;  4L8O A;  2WGO A;  4FMC A;  4O8S A;  3V99 A;  2YFL B;  1NO3 A;  3CMA 3;  2OQE A;  4NHF A;  2HMN B;  2W56 B;  3X41 A;  3MG3 A;  2E2V A;  1W2B 2;  4MJD A;  2C10 A;  2WOF A;  1W01 A;  3LZA A;  1UUV B;  4ORL A;  4FR9 A;  3RGR A;  3RDE A;  2ML6 A;  2W04 A;  1DYU A;  2P09 A;  3BB9 A;  5JPU A;  2W9Q A;  1JNQ A;  1M9G A;  3H3H A;  5D81 A;  5IF6 A;  3LML A;  3O8Y A;  1YJ9 3;  2KXG A;  1W02 A;  3DXO A;  4GL6 A;  7STD A;  1K73 4;  5IEN A;  1SQW A;  4KFF A;  1GD3 A;  1UI8 A;  2WGQ A;  3WDG B;  2BT3 A;  3HI7 A;  3K63 A;  4LSO A;  2RCD A;  1FGR A;  3CPW 2;  1W7C A;  3STD A;  1AR0 A;  1VQ8 3;  4O2H A;  2XGL A;  2E2T A;  3CCJ 3;  3CU3 A;  2CG0 A;  5ELJ A;  1QVF 2;  3S67 A;  2L4V A;  3KE7 A;  1A2V A;  3CC7 3;  4HZ9 B;  1VQM 3;  4HM6 B;  4LMI A;  3EJV A;  2WOH A;  5AYR B;  1YVB I;  5IG0 A;  1IVW A;  1U5O A;  3G71 3;  1OHP A;  1JKG A;  1JJ2 2;  2UX0 A;  3UL5 A;  1KQS 2;  4WP5 A;  1A2K A;  3JVC A;  3VF1 A;  3LH4 A;  2E2U A;  1Q81 4;  3WOF B;  3X40 A;  4O3V A;  2IMJ A;  2B24 B;  4J9A A;  1VZZ A;  3OWY A;  1OGX A;  3EF8 A;  4NRE A;  1Q82 4;  1QMA A;  3BNC A;  3I55 3;  2P38 A;  2Y73 A;  5AIH A;  4HJL B;  3CPO A;  2CFK A;  1W6G A;  4K1V A;  3GRD A;  3D3L A;  3F40 A;  4RNZ A;  4BTW A;  2CWV A;  5EVH A;  2P0M A;  1ISK A;  4KFE A;  3CXC 2;  3JUN A;  4KVH A;  1K9M 4;  2CHC A;  3DGN A;  1ZX2 A;  5CK6 A;  4I4K A;  2IUJ A;  3VGN A;  1W4N A;  1TFK A;  3PXM A;  4HM1 B;  4XBX A;  1Q40 B;  3DY5 A;  3EN1 B;  3IMA B;  2KRT A;  3QK9 A;  1YGE A;  1PFP A;  3N9H A;  5LC6 A;  1VQN 3;  4J8T A;  5CLK A;  1GS3 A;  2HMK B;  3NUV A;  4ZM8 A;  3OW2 2;  5STD A;  5IG5 A;  2XEP A;  3NV0 A;  1IV7 A;  3CC4 3;  1J2B A;  2OQE C;  4K61 A;  3DZL A;  3FSD A;  5CF1 A;  4XBY A;  4GB5 A;  3KZT A;  1M1K 4;  5DRV A;  2W2C A;  4L7K A;  4RZM A;  4XDV A;  1DMN A;  4R9L A;  3ECF A;  1W6Y A;  4EBG A;  1FGO A;  2JQ5 A;  1JB5 A;  3AMO A;  3MKI A;  1R4C A;  5I97 A;  1C7H A;  3BNB A;  4R4K A;  1EG9 B;  2OCT A;  4N6U A;  2F86 B;  4BTY A;  2QEX 3;  3WA3 A;  4R80 A;  4HM2 B;  3B8L A;  1SJW A;  4HM0 B;  1JN5 A;  3NBJ A;  1E3V A;  2XSO B;  3F9S A;  1UUW B;  4WYK B;  3MG1 A;  1FA3 A;  1Q40 A;  1FGQ A;  5KP3 A;  1Q42 A;  3OXA A;  8CHO A;  4MMZ B;  2XGN A;  1NJI 4;  1QAF A;  3NM2 A;  2QA4 3;  1T5Y A;  1Z1S A;  3UJM A;  3HK4 A;  2CKF B;  3EB8 A;  1EKM A;  3PZW A;  2OOV A;  1OHO A;  1QJG A;  1TIJ A;  2MF7 A;  4HM7 B;  1W5Z A;  2PZV A;  1D6Z A;  2F98 A;  1O7N B;  3OX9 A;  1SII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...