5IF6A

Structure of a computationally designed 17-ohp binder
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
b'TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OHP9_1c
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 32
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5if6A00
4XM4A 1O7NB 1GY7A 1O7MB 4XDWA 3VGNA 2HMMB 1JB2A 5STDA 2K54A 3OXAA 1STDA 1UUVB 2XSOB 5AIFA 4GB5A 2YFJB 1NWWA 2B1XB 1OH0A 2HMOB 2I9WA 1S5AA 3RGRA 3B4OA 1OGXA 3D9RA 2STDA 3OV4A 5D81A 3EN1B 3B4PA 3F8XA 3MSOA 1JB5A 4XDVA 4LGQA 4L8PA 3WMDA 1Z1SA 3HK4A 4HM4B 3GZBA 3SEDA 3G16A 1GY5A 4HM3B 4HM6B 2BMRB 3JUMA 1ISKA 4HM7B 4WP5A 3STDA 5CK6A 3CPOA 5IG5A 1GYBA 5CLKA 2BMQB 3EBTA 5IENA 4HM5B 2F99A 1JKGB 3CU3A 2RCDA 4HZ9B 3JUOA 1JB4A 3FF0A 3IPTA 3CNXA 1SJWA 4R9KA 2GEYA 3HX8A 5TGNA 7STDA 1E3VA 3DXOA 3GZRA 1AR0A 1ZX2A 2YFLB 3GZXB 4HM8B 4HM0B 5IG0A 5AEWB 1QMAA 4LMIA 4CDLA 2XR8B 1W6YA 4ORLA 3EJVA 4OVMA 2HMJB 1E97A 1E3RA 2QIYA 3K0ZA 4IIAA 2BMOB 5AEUB 5D82A 2HMKB 4KVHA 3JUQA 4I4KA 1W02A 1GS3A 4HKVB 1W01A 5AI1A 5FW5A 4MJDA 3OWYA 3Q90A 1JKGA 3OX9A 5IERA 2UX0A 2Z7AA 5IEPA 3NUVA 3EN8A 4WYKB 5IF6A 1TUHA 1VZZA 3BB9A 3LYGA 3K7CA 2RGQA 4RZMA 2RFRA 3EHCA 1O7PB 2CKFB 5DRVA 2GEXA 3MYTA 3NHXA 3BLZA 4R1KA 5KP3A 5G2GA 4X2HA 3KE7A 3F14A 5IG3A 5JPUA 3LZAA 3MG1A 5IG4A 1OF5A 3NXJA 5CF2A 3ECFA 3H51A 3DM8A 2HMNB 4FCMA 3EBYA 3SOAA 3G8ZA 1OCVA 2GBXB 3JUPA 3GWRA 2HMLB 3I0YA 2QGUA 3ER7A 5EVHA 4WYKA 1NDOB 3FZWA 3NBRA 3NM2A 1NU3A 3E99A 5IEOA 4XBXA 3OWSA 3T8UA 1DMNA 2CHCA 5AIHA 4WWUC 4XBTA 5CF1A 4K1VA 1Q40B 2B24B 4STDA 4K1UA 2W2CA 4XB5A 3GZYB 1U5OA 3S5CA 4LEHA 1A2KA 1OPYA 1K41A 2GBWB 4U13A 3ROBA 4HZBB 5CXOA 4L8OA 1HKXA 4X2OA 3CNMA 1TP6A 5KP1A 1UUWB 3EC9A 3KKGA 4OUQA 3MKIA 1CQSA 1W00A 1OUNA 1GY6A 4PEJA 3F7XA 3EQQB 5AIIA 2XSHB 3DUKA 1Q40A 3EF8A 3FH1A 4J8TA 5AIGA 3G0KA 1ZO2A 4HM2B 4HVNA 5BXQA 4HJLB 3H3HA 2YFIB 2Z76A 1ULJB 3FKAA 2JQ5A 1ASKA 3OWUA 3F40A 1EG9B 6STDA 3UNLA 1Q42A 3KSPA 8CHOA 1OHPA 3F8HA 3T8NA 3B7CA 3F7SA 3RGAA 1DMQA 2XRXB 3NV0B 1OHSA 3MG3A 4FCJA 5D83A 1EA2A 3A76A 2GXFA 3FLJA 5KP4A 3JUNA 1BUQA 2INXA 2BNGA 3GRDA 1JN5B 2F86B 3SOYA 1O7GB 3FSDA 1QJGA 3F9SA 4H3UA 2IMJA 4R9LA 1DMMA 3UJMA 1C7HA 1IDPA 1OGZA 2OWPA 3FF2A 1OHOA 3M8CA 5JPPA 5DREA 1O7HB 3MHEA 3HZPA 4J9AA 2R4IA 3DZLA 3NV0A 2Z77A 3FGYA 5BVBA 5HGRA 4Q53A 3KZTA 3MG2A 1ULIB 3VSYA 1OF5B 3DMCA 3EX9A 4N3VA 2PZVA 2F98A 1JN5A 2A15A 4XBYA 4L7KA 1O7WB 3B8LA 1WQLB 4HM1B
chains in the Genus database with same CATH superfamily
1YJ93 1D6UA 4XM4A 1O7NB 1GY7A 1O7MB 4XDWA 2SBLA 2AAEA 2CW9A 3KN4A 1VQ73 1N8R4 3QRDA 3S29A 4N6NB 4FMAA 3VGNA 3Q3FA 2HMMB 3LTDA 4NREA 1JB2A 2BO9B 5I97A 2W56A 4N6LA 5STDA 2CH9A 2K54A 1X1WA 3N8BA 2KCDA 3OXAA 1YJW3 3LXUX 1PY3A 1VQO3 3VF1A 2W03A 3DGMA 4JF8A 2W9QA 2WO0A 1STDA 1IVVA 1UUVB 1EQKA 1I2EA 3PS8A 3CCU3 2ZL8A 2XSOB 2K0MA 3FG1A 5AIFA 4GB5A 1FYSA 1S723 2P05A 2YFJB 1BRSA 1BSBA 1W7CA 1NWWA 2V1LA 3LTBA 5LC7A 1I0VA 2B1XB 2Y74A 1OH0A 2HMOB 2I9WA 1S5AA 1WMPA 4EV5A 3CC23 3RGRA 3CME3 1LQMB 4EYCA 3DGOA 1RSNA 3B4OA 1N8QA 1J2BA 1OGXA 4LYLB 3D9RA 1G0TA 1RTUA 2STDA 3OV4A 1BSAA 5D81A 3UL6A 4EBGA 3EN1B 4WHAA 3SYUA 3B4PA 1RGCA 3F8XA 2W04A 3MSOA 1VQP3 1JB5A 4XDVA 1ROAA 4LGQA 4L8PA 1GOYA 2CG1A 4JRFA 1Z1SA 3AHSA 3HK4A 1AQZA 3WMDA 1JNQA 1RGAA 4HM4B 1B2ZA 3GZBA 3SEDA 1YNVX 3CCS3 3Q1CA 1B2XA 3G16A 3U97A 1GY5A 4HM3B 3WOFB 1BRNL 4HM6B 1MWUA 3D4AA 2IYJA 2BMRB 3JUMA 3AMOA 4J5GA 1NJI4 1ISKA 2IUKA 4HM7B 4WP5A 3STDA 1IVUA 1EUIC 5CK6A 1K734 1BNSA 1GMQA 3CPOA 4N6MA 1GYBA 2OOVA 5IG5A 3CD63 1VQ53 2CFDA 1B21A 2CK3H 4HOHA 2ZDJA 3K5TA 5CLKA 1SPUA 2MF7A 1M904 5HOHA 2BMQB 3EBTA 1IQ8A 2RBIA 2OCTA 5IENA 1BRKA 2F99A 4HM5B 1JKGB 1WMOA 4WFOA 3CU3A 1TRPA 1BRJA 1YIT3 2RCDA 3ZG0A 4HZ9B 2AADA 3JUOA 1TFOA 1JB4A 2KF4A 3FF0A 1MGWA 1JRQA 3IPTA 3PZWA 5AYRB 3CNXA 4BU4A 3LTAA 3CCR3 4J5KA 1SJWA 1VQN3 4R9KA 4KFFA 1MWSA 2GEYA 1C54A 3HX8A 3IMAB 4GHOA 5TGNA 1ROVA 1DVDA 1BOXA 1UGIA 3ZG5A 3NQYA 2ZHXB 7STDA 1E3VA 1LOYA 3LMLA 1I2GA 1TIJA 1BNFA 1BNIA 6RNTA 3DXOA 3GZRA 1AR0A 1ZX2A 2YFLB 3LOYA 3GZXB 3CCV3 1I3IA 4HM8B 1BNRA 2UGIA 4HM0B 1SIHA 5IG0A 3I563 5AEWB 1QMAA 4LMIA 1T3BA 2XGLA 1CYUA 4AKZA 4CDLA 2XR8B 4ZM8A 2FGTA 4KFEA 1F8NA 4FR9A 1W6YA 4ORLA 3V98A 3SVAA 1T2IA 1GOUA 2PNCA 1TFKA 3EJVA 1UCKA 4AKYA 4OVMA 2HMJB 1E97A 1RN4A 1CYVA 3BU4A 1U8CB 3RNTA 4BTYA 1N5HA 4BTWA 3WA3A 1E3RA 2QIYA 3K63A 6GSPA 1UDII 7GSPA 3CCM3 3KSED 3K0ZA 1BSCA 4IIAA 2WOHA 2BMOB 4AEQA 1CH0A 5AEUB 1FGQA 2IY2A 3NBBA 5D82A 1W6GA 2HMKB 4KVHA 3JUQA 3L0RA 5EEOA 3AGNA 1HU9A 4I4KA 1A90A 1W02A 1GS3A 4O3VA 1B2UA 1QAFA 2Q07A 3X3YA 1KC84 4HKVB 1W01A 5AI1A 1RGEA 1IV7A 1DETA 4MJDA 3MPHA 5FW5A 1IU7A 4CJNA 1VQ43 2KXGA 3OWYA 2CFWA 3Q90A 1JKGA 1KWIA 1RN7A 3OX9A 5IERA 2UX0A 2D42A 2Z7AA 1AY7A 3WR2A 1RGLA 1R4YA 2FXTA 3NUVA 5IEPA 3FCSB 1JBTA 3EN8A 3HI7A 1A2PA 1I70A 1X1XA 4WYKB 5IF6A 1TUHA 1VZZA 3BB9A 3LYGA 1EKMA 1YJN3 3K7CA 3D3LA 4HYZA 1RCLA 1DVCA 1W5ZA 2RGQA 1Q7HA 4MMYB 2M7OA 4QWTA 1W4NA 1GD4A 4RZMA 2RFRA 1JZDA 3G713 4N6UA 1LQGC 1O7PB 2CKFB 3EHCA 1YGEA 4FCZA 2OQEA 5JBSA 1IT7A 3NQZA 5DRVA 2GEXA 3MYTA 1HZ1A 3NHXA 3BLZA 4N6TA 4R1KA 3CC73 5KP3A 5G2GA 1SIIA 1LRAA 1EEJA 1PYLA 1US1A 3KE7A 4X2HA 1I0XA 4FMDA 3F14A 5IG3A 2CWTA 5JPUA 1YVBI 3LZAA 2E2VA 3QK9A 4BL2A 1WTHA 3MG1A 1RLSA 5IG4A 1GD3A 3CPW2 1OF5A 1JV2B 1NB5I 4O2HA 4BTXA 7RNTA 4IPBA 1BNJA 3NXJA 3N54B 2RNTA 2L4VA 5M19A 3SLUA 2F5WA 5CF2A 3D5GA 3NM7A 4GSPA 2GU3A 1LOXA 1MNLA 3ECFA 3ZFZA 3H51A 1IVWA 1VQK3 1MOLA 4R80A 1BRGA 3DM8A 3T0UA 2HMNB 3FG4A 1K28A 1W6CA 4EW5A 1MWRA 2W6JH 3DY5A 5ELJA 5A0OB 1SARA 2BU4A 4FCMA 2UUGC 3EBYA 2YX9A 3SXXA 1Q824 3HOHA 2R41A 3SOAA 3G8ZA 1RNBA 1OCVA 1FW7A 2GBXB 1BSEA 1BANA 3JUPA 1RRLA 1I2FA 2D1WA 3GWRA 3V92A 2HMLB 3URPA 4I5QA 9RNTA 3I0YA 2QGUA 3UB1A 3CCQ3 2XH9A 3ER7A 5EVHA 4WYKA 1NDOB 1MGRA 1D6YA 2WGOA 1RHLA 3FZWA 3PCSA 5M1AA 3NBRA 3NM2A 1B2SA 4KFDA 3S67A 1NU3A 3E99A 5IEOA 2L1SA 1DYUA 1YVSA 4XBXA 1VQ93 1FGMA 1A2VA 3OWSA 1W2ZA 1VQQA 1DMNA 3SX1A 3T8UA 1G96A 1AVLA 1RN1A 2CHCA 2E2UA 5AIHA 1M1XB 2H0GA 2WGQA 4WWUC 4XBTA 5CF1A 4K1VA 3D5IA 2CC3A 1RMSA 1Q40B 2BT3A 2LQVA 4O8SA 3DGYA 1IYYA 1HYFA 2B24B 2LYXA 1B27A 2CX1A 4K1UA 2W2CA 4STDA 2J8XB 1QALA 1UCLA 4XB5A 3UL5A 1KSIA 4CCVA 5AYSC 3X41A 1LXEA 3GZYB 4KZ1A 1AVKA 3JVCA 4BL3A 1RGGA 2BIRA 2F4YA 1U5OA 2H0IA 3IJEB 4FMCA 3S5CA 3ALAA 3V99A 1IK3A 1QVG2 4LEHA 1YGWA 1A2KA 1WNHA 5RNTA 2Y73A 1OPYA 1K41A 1RGHA 3S27A 2GBWB 4U13A 3ROBA 3WODG 1VQL3 2BHMA 1FGOA 3PGBA 1V58A 4RNTA 1FUTA 4HZBB 1IVXA 3PXMA 5CXOA 4EXRA 4L8OA 1HKXA 4X2OA 5BU4A 1RDSA 2F56A 3CNMA 3RDEA 1PU4A 1GOVA 2XFTA 2P38A 3BNEA 3DH2A 8RNTA 1TP6A 1VQ83 2OOVC 1UI7A 5KP1A 1UUWB 3EC9A 3KKGA 4OUQA 1FGRA 3DGNA 4N6OB 1N9JA 5LC6A 2OTL3 3BNBA 3EE1A 3PCRA 3MKIA 1IV9A 4G1MB 3O8YA 1N9EA 4FMBA 2W9PA 1CQSA 1R4CA 4HBRA 2XEPA 1W00A 2O3OA 1OUNA 2CFLA 4RNZA 1FUWA 1GY6A 3KCHA 1TU5A 1QAKA 4PEJA 1BVIA 3F7XA 3EQQB 5AIIA 1NO3A 4IT7A 1Q7Y4 1Q864 1B2MA 4ILFA 4LZIA 4BIRA 1M9GA 1NB3I 2HOHA 2XSHB 4KT3B 1D6ZA 3DUKA 1JBRA 1RGFA 3AHWA 1Q40A 1GMRA 2E2TA 3U1WA 3DGLA 3EF8A 3FH1A 4J8TA 1RCKA 3PYJA 5AIGA 1JBSA 3AMOB 1B3SA 2P09A 3BNDA 2W0QA 3G0KA 3KIIA 1UCJA 1ZO2A 1BNGA 3BNCA 4HM2B 4HVNA 1YI23 5BXQA 4HJLB 1V57A 2CWUA 3H3HA 2FNQA 4RBNA 1JZOA 2CG0A 2YFIB 3AGOA 3HIGA 2Z76A 1N5PA 2ZA4A 4LSOA 5GSPA 3TDGA 1LOWA 1BRHA 1ULJB 2IUJA 3FKAA 5EQLA 3CCL3 3OW22 1L5GB 3X40A 3LH4A 1CEWI 2IA7A 2JQ5A 1BUJA 1ASKA 4OK0A 4O02B 3X3ZA 3OWUA 3F40A 1EG9B 6STDA 2CWVA 3WA2X 1UI8A 3GSPA 4NPBA 3UNLA 1Q42A 1LNIA 1KQS2 1LOVA 3KSPA 1X1YA 3BIRA 4EC6A 2KF5A 8CHOA 5BIRA 4K90B 3EB8A 1OHPA 1K8A4 1LVNA 3F8HA 3NX0A 3T8NA 3B7CA 2RSXA 1A67A 1IQYA 1TTOA 1UW1A 3GAXA 2QA43 3F7SA 1WMNA 1Q814 2O9UX 3RGAA 1K9M4 1DMQA 2XFSA 2F5MA 1AV4A 2XRXB 4R4KA 5ELUA 3NV0B 2QEX3 2K3DA 1OHSA 3K9MC 1BSDA 1PFPA 1ZGXA 1T2HA 3CC43 1X1UA 3MG3A 4FCJA 3I553 1I8VA 5D83A 3CCJ3 1EA2A 1IQXA 3A76A 2GXFA 3FLJA 3KFQC 5KP4A 1BRIA 3JUNA 3LT8A 1BUQA 2Z6BA 1BAOA 2INXA 2BNGA 1M1K4 1RKYA 3GRDA 2OQEC 1LNHA 1RGKA 3WOEB 1JN5B 3S28A 2F86B 1BIRA 1FUSA 1RNTA 2CFKA 3CCE3 2KAAA 3G4S3 2H0HA 1BGSA 3SOYA 1YHQ3 1O7GB 3FSDA 1BU4A 1QJGA 4NHFA 2XF3A 2SARA 1JJ22 3LTCA 5G1LA 3WDGB 1KD14 4RNYA 3X3XA 2CFGA 1NNVA 3F9SA 4GL6A 4H3UA 4CPKA 1STFI 1B20A 2C4BA 1GMPA 3MWZA 2OTJ3 2IMJA 4MMXB 4R9LA 2GU1A 1DMMA 1Q9EA 3G6E3 1ZS7A 2C10A 1UUGB 3LT9A 3UJMA 2W56B 3FG3A 1C7HA 1IDPA 3CMA3 2ML6A 1OGZA 1SQWA 2OWPA 2WOFA 4DKIA 1MWTA 3CXC2 4EV2A 3FF2A 1OHOA 4N6V0 5G1KA 3NBJA 2XGNA 1OACA 3J7Yd 1I3FA 1YIJ3 1DE3A 3M8CA 4MEIA 2P0MA 4HAAA 5JPPA 1RRHA 5DREA 3WHOA 1O7HB 3MHEA 3HZPA 4J9AA 1VQ63 2KF3A 2ML5A 2GSPA 5FGOA 2R4IA 1GSPA 4TX4A 1FA3A 1W2B2 1G02A 3N9HA 3DZLA 3NV0A 1TJDA 2Z77A 1IT8A 3X42A 1Y4KA 1RJOA 1TRQA 5IW9A 3FGYA 5BVBA 2C11A 5HGRA 2KRTA 3KZTA 4Q53A 3MG2A 1ULIB 4K61A 1BNEA 3VSYA 3A5EA 2P0XA 1OF5B 3DMCA 3EX9A 1T5YA 3D79A 4N3VA 2KF6A 2F98A 2PZVA 3Q2PA 1QVF2 2CIUA 1FGTA 1FZUA 1UGHI 1JN5A 2A15A 4XBYA 4L7KA 5M18A 1UCIA 1O7WB 4H61A 4MMZB 1V74A 3B8LA 1VQM3 1WQLB 3HIIA 4HM1B 2MC8A 2CX0A 2JDIH
chains in the Genus database with same CATH topology
1YJ93 1D6UA 4XM4A 1O7NB 1GY7A 1O7MB 4XDWA 2SBLA 2CW9A 3KN4A 1VQ73 1N8R4 3QRDA 3S29A 4N6NB 4FMAA 3VGNA 2HMMB 3LTDA 4NREA 2BO9B 1JB2A 5I97A 2W56A 4N6LA 5STDA 2CH9A 2K54A 3N8BA 3OXAA 2KCDA 1YJW3 3LXUX 1VQO3 3VF1A 2W03A 3DGMA 4JF8A 2W9QA 2WO0A 1STDA 1IVVA 1UUVB 1EQKA 3PS8A 3CCU3 2ZL8A 2XSOB 2K0MA 3FG1A 5AIFA 4GB5A 1S723 2P05A 2YFJB 1W7CA 3LTBA 2V1LA 1NWWA 5LC7A 2B1XB 2Y74A 1OH0A 2HMOB 2I9WA 1S5AA 1WMPA 4EV5A 3CC23 3RGRA 3CME3 4EYCA 3DGOA 3B4OA 1N8QA 1J2BA 1OGXA 3D9RA 2STDA 3OV4A 5D81A 3UL6A 4EBGA 3EN1B 4WHAA 3B4PA 3F8XA 2W04A 3MSOA 1VQP3 1JB5A 4XDVA 1ROAA 4LGQA 4L8PA 2CG1A 3WMDA 4JRFA 1Z1SA 3HK4A 1JNQA 4HM4B 3GZBA 3SEDA 3CCS3 3Q1CA 3G16A 3U97A 1GY5A 4HM3B 3WOFB 4HM6B 2BMRB 3JUMA 3AMOA 1ISKA 1NJI4 2IUKA 4HM7B 4WP5A 3STDA 1IVUA 1K734 5CK6A 3CPOA 4N6MA 1GYBA 2OOVA 5IG5A 3CD63 1VQ53 2CFDA 2CK3H 2ZDJA 3K5TA 5CLKA 1SPUA 2MF7A 1M904 2BMQB 3EBTA 1IQ8A 2OCTA 5IENA 4HM5B 2F99A 1JKGB 1WMOA 4WFOA 3CU3A 1YIT3 2RCDA 4HZ9B 3JUOA 1TFOA 1JB4A 3FF0A 3PZWA 3IPTA 1JRQA 5AYRB 3CCR3 1VQN3 3CNXA 3LTAA 1SJWA 4R9KA 4KFFA 2GEYA 3HX8A 3IMAB 5TGNA 1ROVA 1DVDA 3NQYA 7STDA 1E3VA 3LMLA 1TIJA 3DXOA 3GZRA 1AR0A 1ZX2A 2YFLB 3LOYA 3GZXB 3CCV3 4HM8B 4HM0B 1SIHA 5IG0A 3I563 5AEWB 1QMAA 4LMIA 2XGLA 1CYUA 4AKZA 4CDLA 2XR8B 4ZM8A 2FGTA 4KFEA 1F8NA 4FR9A 1W6YA 4ORLA 3V98A 3SVAA 2PNCA 1TFKA 3EJVA 4AKYA 4OVMA 2HMJB 1E97A 1CYVA 1U8CB 4BTYA 1N5HA 4BTWA 3WA3A 1E3RA 2QIYA 3K63A 3CCM3 3KSED 3K0ZA 4IIAA 2WOHA 2BMOB 4AEQA 5AEUB 1FGQA 3NBBA 5D82A 1W6GA 2HMKB 4KVHA 3JUQA 3L0RA 5EEOA 1A90A 1HU9A 4I4KA 1W02A 1GS3A 4O3VA 1QAFA 2Q07A 3X3YA 1KC84 4HKVB 1W01A 5AI1A 5FW5A 1IV7A 4MJDA 3MPHA 1VQ43 1IU7A 2KXGA 3OWYA 2CFWA 3Q90A 1JKGA 1KWIA 1RN7A 3OX9A 5IERA 2UX0A 2D42A 2Z7AA 2FXTA 3NUVA 5IEPA 3FCSB 3EN8A 3HI7A 4WYKB 5IF6A 1TUHA 1VZZA 3BB9A 3LYGA 1EKMA 1YJN3 3K7CA 3D3LA 4HYZA 1DVCA 1W5ZA 2RGQA 4MMYB 2M7OA 4QWTA 1W4NA 1GD4A 4RZMA 2RFRA 3G713 4N6UA 3EHCA 1O7PB 2CKFB 1YGEA 4FCZA 2OQEA 5JBSA 1IT7A 3NQZA 5DRVA 2GEXA 3MYTA 3NHXA 4N6TA 3BLZA 4R1KA 3CC73 5KP3A 5G2GA 1SIIA 1US1A 4X2HA 3KE7A 4FMDA 3F14A 5IG3A 2CWTA 5JPUA 1YVBI 3LZAA 2E2VA 3QK9A 1WTHA 3MG1A 5IG4A 1GD3A 3CPW2 1OF5A 1JV2B 1NB5I 4O2HA 4BTXA 4IPBA 3NXJA 3N54B 2L4VA 3SLUA 5CF2A 3NM7A 2GU3A 1LOXA 1MNLA 3ECFA 3H51A 1IVWA 1VQK3 1MOLA 4R80A 3DM8A 3T0UA 2HMNB 3FG4A 1K28A 1W6CA 2W6JH 3DY5A 5ELJA 5A0OB 4FCMA 3EBYA 2YX9A 3SXXA 1Q824 3SOAA 3G8ZA 1OCVA 2GBXB 3JUPA 1RRLA 2D1WA 3GWRA 3V92A 2HMLB 3CCQ3 3I0YA 2QGUA 3UB1A 2XH9A 3ER7A 5EVHA 4WYKA 1NDOB 1D6YA 2WGOA 3FZWA 3PCSA 3NBRA 3NM2A 4KFDA 3S67A 1NU3A 3E99A 5IEOA 1DYUA 4XBXA 1FGMA 1A2VA 3OWSA 1W2ZA 3T8UA 1DMNA 3SX1A 1G96A 1AVLA 2CHCA 2E2UA 5AIHA 1M1XB 4WWUC 2WGQA 4XBTA 5CF1A 4K1VA 2CC3A 1Q40B 2BT3A 2LQVA 4O8SA 2B24B 2LYXA 4K1UA 4STDA 2W2CA 4CCVA 1QALA 4XB5A 3UL5A 1KSIA 5AYSC 3X41A 1LXEA 3GZYB 4KZ1A 1AVKA 3JVCA 1U5OA 4FMCA 3IJEB 3V99A 3S5CA 3ALAA 1IK3A 1QVG2 4LEHA 1A2KA 1WNHA 2Y73A 1OPYA 1K41A 3S27A 2GBWB 4U13A 3ROBA 3WODG 1VQL3 2BHMA 1FGOA 3PGBA 4HZBB 1IVXA 3PXMA 5CXOA 4EXRA 4L8OA 1HKXA 4X2OA 3CNMA 3RDEA 1PU4A 2XFTA 2P38A 3BNEA 1TP6A 1VQ83 2OOVC 1UI7A 5KP1A 1UUWB 3EC9A 3KKGA 4OUQA 1FGRA 3DGNA 4N6OB 1N9JA 5LC6A 2OTL3 3BNBA 3EE1A 3PCRA 3MKIA 1IV9A 4G1MB 3O8YA 1N9EA 4FMBA 2W9PA 1CQSA 1R4CA 4HBRA 2XEPA 1W00A 2O3OA 1OUNA 2CFLA 4RNZA 1FUWA 1GY6A 1TU5A 1QAKA 4PEJA 3F7XA 3EQQB 5AIIA 1NO3A 4IT7A 1Q7Y4 1Q864 4LZIA 1M9GA 1NB3I 2XSHB 1D6ZA 3DUKA 1Q40A 2E2TA 3U1WA 3DGLA 3EF8A 3FH1A 4J8TA 3PYJA 5AIGA 3AMOB 2P09A 3BNDA 2W0QA 3G0KA 3KIIA 1ZO2A 3BNCA 4HM2B 4HVNA 1YI23 5BXQA 4HJLB 2CWUA 3H3HA 2FNQA 4RBNA 2YFIB 2CG0A 3HIGA 2Z76A 1N5PA 4LSOA 3TDGA 2IUJA 3CCL3 1ULJB 3FKAA 5EQLA 3OW22 1L5GB 3X40A 3LH4A 1CEWI 2IA7A 2JQ5A 1ASKA 4OK0A 4O02B 3X3ZA 3OWUA 3F40A 1EG9B 6STDA 2CWVA 3WA2X 1UI8A 3UNLA 1Q42A 1KQS2 3KSPA 4EC6A 8CHOA 4K90B 3EB8A 1OHPA 1K8A4 1LVNA 3F8HA 3NX0A 3T8NA 3B7CA 2RSXA 1A67A 1IQYA 1UW1A 3GAXA 2QA43 3F7SA 1WMNA 1Q814 2O9UX 3RGAA 1K9M4 1DMQA 2XFSA 2XRXB 1AV4A 4R4KA 5ELUA 3NV0B 2QEX3 1OHSA 3K9MC 1PFPA 3CC43 3MG3A 4FCJA 3I553 5D83A 3CCJ3 1EA2A 1IQXA 3A76A 2GXFA 3FLJA 3KFQC 5KP4A 3JUNA 3LT8A 1BUQA 2Z6BA 2INXA 2BNGA 1M1K4 1RKYA 3GRDA 2OQEC 1LNHA 3WOEB 1JN5B 3S28A 2F86B 2CFKA 3CCE3 3G4S3 3SOYA 1YHQ3 1O7GB 3FSDA 1QJGA 4NHFA 2XF3A 1JJ22 3LTCA 3WDGB 1KD14 4RNYA 3X3XA 2CFGA 3F9SA 4GL6A 4H3UA 1STFI 3MWZA 2OTJ3 2IMJA 4MMXB 4R9LA 2GU1A 1DMMA 3G6E3 2C10A 3UJMA 3LT9A 2W56B 3FG3A 1C7HA 1IDPA 3CMA3 2ML6A 1OGZA 1SQWA 2OWPA 2WOFA 3CXC2 1VQ93 4EV2A 3FF2A 1OHOA 4N6V0 3NBJA 2XGNA 1OACA 3J7Yd 1YIJ3 3M8CA 4MEIA 2P0MA 5JPPA 1RRHA 5DREA 1O7HB 3MHEA 3HZPA 4J9AA 1VQ63 2ML5A 5FGOA 2R4IA 4TX4A 1FA3A 1W2B2 3N9HA 3DZLA 3NV0A 2Z77A 1IT8A 3X42A 1Y4KA 1RJOA 5IW9A 3FGYA 5BVBA 2C11A 5HGRA 2KRTA 3KZTA 4Q53A 3MG2A 1ULIB 4K61A 3VSYA 2P0XA 1OF5B 3DMCA 3EX9A 1T5YA 4N3VA 2PZVA 2F98A 1QVF2 3Q2PA 2CIUA 1FGTA 1JN5A 2A15A 4XBYA 4L7KA 1O7WB 4H61A 4MMZB 1V74A 3B8LA 1VQM3 1WQLB 3HIIA 4HM1B 2MC8A 2JDIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XM4 A;  1O7N B;  1GY7 A;  1O7M B;  4XDW A;  3VGN A;  2HMM B;  1JB2 A;  5STD A;  2K54 A;  3OXA A;  1STD A;  1UUV B;  2XSO B;  5AIF A;  4GB5 A;  2YFJ B;  1NWW A;  2B1X B;  1OH0 A;  2HMO B;  2I9W A;  1S5A A;  3RGR A;  3B4O A;  1OGX A;  3D9R A;  2STD A;  3OV4 A;  5D81 A;  3EN1 B;  3B4P A;  3F8X A;  3MSO A;  1JB5 A;  4XDV A;  4LGQ A;  4L8P A;  3WMD A;  1Z1S A;  3HK4 A;  4HM4 B;  3GZB A;  3SED A;  3G16 A;  1GY5 A;  4HM3 B;  4HM6 B;  2BMR B;  3JUM A;  1ISK A;  4HM7 B;  4WP5 A;  3STD A;  5CK6 A;  3CPO A;  5IG5 A;  1GYB A;  5CLK A;  2BMQ B;  3EBT A;  5IEN A;  4HM5 B;  2F99 A;  1JKG B;  3CU3 A;  2RCD A;  4HZ9 B;  3JUO A;  1JB4 A;  3FF0 A;  3IPT A;  3CNX A;  1SJW A;  4R9K A;  2GEY A;  3HX8 A;  5TGN A;  7STD A;  1E3V A;  3DXO A;  3GZR A;  1AR0 A;  1ZX2 A;  2YFL B;  3GZX B;  4HM8 B;  4HM0 B;  5IG0 A;  5AEW B;  1QMA A;  4LMI A;  4CDL A;  2XR8 B;  1W6Y A;  4ORL A;  3EJV A;  4OVM A;  2HMJ B;  1E97 A;  1E3R A;  2QIY A;  3K0Z A;  4IIA A;  2BMO B;  5AEU B;  5D82 A;  2HMK B;  4KVH A;  3JUQ A;  4I4K A;  1W02 A;  1GS3 A;  4HKV B;  1W01 A;  5AI1 A;  5FW5 A;  4MJD A;  3OWY A;  3Q90 A;  1JKG A;  3OX9 A;  5IER A;  2UX0 A;  2Z7A A;  5IEP A;  3NUV A;  3EN8 A;  4WYK B;  5IF6 A;  1TUH A;  1VZZ A;  3BB9 A;  3LYG A;  3K7C A;  2RGQ A;  4RZM A;  2RFR A;  3EHC A;  1O7P B;  2CKF B;  5DRV A;  2GEX A;  3MYT A;  3NHX A;  3BLZ A;  4R1K A;  5KP3 A;  5G2G A;  4X2H A;  3KE7 A;  3F14 A;  5IG3 A;  5JPU A;  3LZA A;  3MG1 A;  5IG4 A;  1OF5 A;  3NXJ A;  5CF2 A;  3ECF A;  3H51 A;  3DM8 A;  2HMN B;  4FCM A;  3EBY A;  3SOA A;  3G8Z A;  1OCV A;  2GBX B;  3JUP A;  3GWR A;  2HML B;  3I0Y A;  2QGU A;  3ER7 A;  5EVH A;  4WYK A;  1NDO B;  3FZW A;  3NBR A;  3NM2 A;  1NU3 A;  3E99 A;  5IEO A;  4XBX A;  3OWS A;  3T8U A;  1DMN A;  2CHC A;  5AIH A;  4WWU C;  4XBT A;  5CF1 A;  4K1V A;  1Q40 B;  2B24 B;  4STD A;  4K1U A;  2W2C A;  4XB5 A;  3GZY B;  1U5O A;  3S5C A;  4LEH A;  1A2K A;  1OPY A;  1K41 A;  2GBW B;  4U13 A;  3ROB A;  4HZB B;  5CXO A;  4L8O A;  1HKX A;  4X2O A;  3CNM A;  1TP6 A;  5KP1 A;  1UUW B;  3EC9 A;  3KKG A;  4OUQ A;  3MKI A;  1CQS A;  1W00 A;  1OUN A;  1GY6 A;  4PEJ A;  3F7X A;  3EQQ B;  5AII A;  2XSH B;  3DUK A;  1Q40 A;  3EF8 A;  3FH1 A;  4J8T A;  5AIG A;  3G0K A;  1ZO2 A;  4HM2 B;  4HVN A;  5BXQ A;  4HJL B;  3H3H A;  2YFI B;  2Z76 A;  1ULJ B;  3FKA A;  2JQ5 A;  1ASK A;  3OWU A;  3F40 A;  1EG9 B;  6STD A;  3UNL A;  1Q42 A;  3KSP A;  8CHO A;  1OHP A;  3F8H A;  3T8N A;  3B7C A;  3F7S A;  3RGA A;  1DMQ A;  2XRX B;  3NV0 B;  1OHS A;  3MG3 A;  4FCJ A;  5D83 A;  1EA2 A;  3A76 A;  2GXF A;  3FLJ A;  5KP4 A;  3JUN A;  1BUQ A;  2INX A;  2BNG A;  3GRD A;  1JN5 B;  2F86 B;  3SOY A;  1O7G B;  3FSD A;  1QJG A;  3F9S A;  4H3U A;  2IMJ A;  4R9L A;  1DMM A;  3UJM A;  1C7H A;  1IDP A;  1OGZ A;  2OWP A;  3FF2 A;  1OHO A;  3M8C A;  5JPP A;  5DRE A;  1O7H B;  3MHE A;  3HZP A;  4J9A A;  2R4I A;  3DZL A;  3NV0 A;  2Z77 A;  3FGY A;  5BVB A;  5HGR A;  4Q53 A;  3KZT A;  3MG2 A;  1ULI B;  3VSY A;  1OF5 B;  3DMC A;  3EX9 A;  4N3V A;  2PZV A;  2F98 A;  1JN5 A;  2A15 A;  4XBY A;  4L7K A;  1O7W B;  3B8L A;  1WQL B;  4HM1 B; 
#chains in the Genus database with same CATH topology
 1YJ9 3;  1D6U A;  4XM4 A;  1O7N B;  1GY7 A;  1O7M B;  4XDW A;  2SBL A;  2AAE A;  2CW9 A;  3KN4 A;  1VQ7 3;  1N8R 4;  3QRD A;  3S29 A;  4N6N B;  4FMA A;  3VGN A;  3Q3F A;  2HMM B;  3LTD A;  4NRE A;  1JB2 A;  2BO9 B;  5I97 A;  2W56 A;  4N6L A;  5STD A;  2CH9 A;  2K54 A;  1X1W A;  3N8B A;  2KCD A;  3OXA A;  1YJW 3;  3LXU X;  1PY3 A;  1VQO 3;  3VF1 A;  2W03 A;  3DGM A;  4JF8 A;  2W9Q A;  2WO0 A;  1STD A;  1IVV A;  1UUV B;  1EQK A;  1I2E A;  3PS8 A;  3CCU 3;  2ZL8 A;  2XSO B;  2K0M A;  3FG1 A;  5AIF A;  4GB5 A;  1FYS A;  1S72 3;  2P05 A;  2YFJ B;  1BRS A;  1BSB A;  1W7C A;  1NWW A;  2V1L A;  3LTB A;  5LC7 A;  1I0V A;  2B1X B;  2Y74 A;  1OH0 A;  2HMO B;  2I9W A;  1S5A A;  1WMP A;  4EV5 A;  3CC2 3;  3RGR A;  3CME 3;  1LQM B;  4EYC A;  3DGO A;  1RSN A;  3B4O A;  1N8Q A;  1J2B A;  1OGX A;  4LYL B;  3D9R A;  1G0T A;  1RTU A;  2STD A;  3OV4 A;  1BSA A;  5D81 A;  3UL6 A;  4EBG A;  3EN1 B;  4WHA A;  3SYU A;  3B4P A;  1RGC A;  3F8X A;  2W04 A;  3MSO A;  1VQP 3;  1JB5 A;  4XDV A;  1ROA A;  4LGQ A;  4L8P A;  1GOY A;  2CG1 A;  4JRF A;  1Z1S A;  3AHS A;  3HK4 A;  1AQZ A;  3WMD A;  1JNQ A;  1RGA A;  4HM4 B;  1B2Z A;  3GZB A;  3SED A;  1YNV X;  3CCS 3;  3Q1C A;  1B2X A;  3G16 A;  3U97 A;  1GY5 A;  4HM3 B;  3WOF B;  1BRN L;  4HM6 B;  1MWU A;  3D4A A;  2IYJ A;  2BMR B;  3JUM A;  3AMO A;  4J5G A;  1NJI 4;  1ISK A;  2IUK A;  4HM7 B;  4WP5 A;  3STD A;  1IVU A;  1EUI C;  5CK6 A;  1K73 4;  1BNS A;  1GMQ A;  3CPO A;  4N6M A;  1GYB A;  2OOV A;  5IG5 A;  3CD6 3;  1VQ5 3;  2CFD A;  1B21 A;  2CK3 H;  4HOH A;  2ZDJ A;  3K5T A;  5CLK A;  1SPU A;  2MF7 A;  1M90 4;  5HOH A;  2BMQ B;  3EBT A;  1IQ8 A;  2RBI A;  2OCT A;  5IEN A;  1BRK A;  2F99 A;  4HM5 B;  1JKG B;  1WMO A;  4WFO A;  3CU3 A;  1TRP A;  1BRJ A;  1YIT 3;  2RCD A;  3ZG0 A;  4HZ9 B;  2AAD A;  3JUO A;  1TFO A;  1JB4 A;  2KF4 A;  3FF0 A;  1MGW A;  1JRQ A;  3IPT A;  3PZW A;  5AYR B;  3CNX A;  4BU4 A;  3LTA A;  3CCR 3;  4J5K A;  1SJW A;  1VQN 3;  4R9K A;  4KFF A;  1MWS A;  2GEY A;  1C54 A;  3HX8 A;  3IMA B;  4GHO A;  5TGN A;  1ROV A;  1DVD A;  1BOX A;  1UGI A;  3ZG5 A;  3NQY A;  2ZHX B;  7STD A;  1E3V A;  1LOY A;  3LML A;  1I2G A;  1TIJ A;  1BNF A;  1BNI A;  6RNT A;  3DXO A;  3GZR A;  1AR0 A;  1ZX2 A;  2YFL B;  3LOY A;  3GZX B;  3CCV 3;  1I3I A;  4HM8 B;  1BNR A;  2UGI A;  4HM0 B;  1SIH A;  5IG0 A;  3I56 3;  5AEW B;  1QMA A;  4LMI A;  1T3B A;  2XGL A;  1CYU A;  4AKZ A;  4CDL A;  2XR8 B;  4ZM8 A;  2FGT A;  4KFE A;  1F8N A;  4FR9 A;  1W6Y A;  4ORL A;  3V98 A;  3SVA A;  1T2I A;  1GOU A;  2PNC A;  1TFK A;  3EJV A;  1UCK A;  4AKY A;  4OVM A;  2HMJ B;  1E97 A;  1RN4 A;  1CYV A;  3BU4 A;  1U8C B;  3RNT A;  4BTY A;  1N5H A;  4BTW A;  3WA3 A;  1E3R A;  2QIY A;  3K63 A;  6GSP A;  1UDI I;  7GSP A;  3CCM 3;  3KSE D;  3K0Z A;  1BSC A;  4IIA A;  2WOH A;  2BMO B;  4AEQ A;  1CH0 A;  5AEU B;  1FGQ A;  2IY2 A;  3NBB A;  5D82 A;  1W6G A;  2HMK B;  4KVH A;  3JUQ A;  3L0R A;  5EEO A;  3AGN A;  1HU9 A;  4I4K A;  1A90 A;  1W02 A;  1GS3 A;  4O3V A;  1B2U A;  1QAF A;  2Q07 A;  3X3Y A;  1KC8 4;  4HKV B;  1W01 A;  5AI1 A;  1RGE A;  1IV7 A;  1DET A;  4MJD A;  3MPH A;  5FW5 A;  1IU7 A;  4CJN A;  1VQ4 3;  2KXG A;  3OWY A;  2CFW A;  3Q90 A;  1JKG A;  1KWI A;  1RN7 A;  3OX9 A;  5IER A;  2UX0 A;  2D42 A;  2Z7A A;  1AY7 A;  3WR2 A;  1RGL A;  1R4Y A;  2FXT A;  3NUV A;  5IEP A;  3FCS B;  1JBT A;  3EN8 A;  3HI7 A;  1A2P A;  1I70 A;  1X1X A;  4WYK B;  5IF6 A;  1TUH A;  1VZZ A;  3BB9 A;  3LYG A;  1EKM A;  1YJN 3;  3K7C A;  3D3L A;  4HYZ A;  1RCL A;  1DVC A;  1W5Z A;  2RGQ A;  1Q7H A;  4MMY B;  2M7O A;  4QWT A;  1W4N A;  1GD4 A;  4RZM A;  2RFR A;  1JZD A;  3G71 3;  4N6U A;  1LQG C;  1O7P B;  2CKF B;  3EHC A;  1YGE A;  4FCZ A;  2OQE A;  5JBS A;  1IT7 A;  3NQZ A;  5DRV A;  2GEX A;  3MYT A;  1HZ1 A;  3NHX A;  3BLZ A;  4N6T A;  4R1K A;  3CC7 3;  5KP3 A;  5G2G A;  1SII A;  1LRA A;  1EEJ A;  1PYL A;  1US1 A;  3KE7 A;  4X2H A;  1I0X A;  4FMD A;  3F14 A;  5IG3 A;  2CWT A;  5JPU A;  1YVB I;  3LZA A;  2E2V A;  3QK9 A;  4BL2 A;  1WTH A;  3MG1 A;  1RLS A;  5IG4 A;  1GD3 A;  3CPW 2;  1OF5 A;  1JV2 B;  1NB5 I;  4O2H A;  4BTX A;  7RNT A;  4IPB A;  1BNJ A;  3NXJ A;  3N54 B;  2RNT A;  2L4V A;  5M19 A;  3SLU A;  2F5W A;  5CF2 A;  3D5G A;  3NM7 A;  4GSP A;  2GU3 A;  1LOX A;  1MNL A;  3ECF A;  3ZFZ A;  3H51 A;  1IVW A;  1VQK 3;  1MOL A;  4R80 A;  1BRG A;  3DM8 A;  3T0U A;  2HMN B;  3FG4 A;  1K28 A;  1W6C A;  4EW5 A;  1MWR A;  2W6J H;  3DY5 A;  5ELJ A;  5A0O B;  1SAR A;  2BU4 A;  4FCM A;  2UUG C;  3EBY A;  2YX9 A;  3SXX A;  1Q82 4;  3HOH A;  2R41 A;  3SOA A;  3G8Z A;  1RNB A;  1OCV A;  1FW7 A;  2GBX B;  1BSE A;  1BAN A;  3JUP A;  1RRL A;  1I2F A;  2D1W A;  3GWR A;  3V92 A;  2HML B;  3URP A;  4I5Q A;  9RNT A;  3I0Y A;  2QGU A;  3UB1 A;  3CCQ 3;  2XH9 A;  3ER7 A;  5EVH A;  4WYK A;  1NDO B;  1MGR A;  1D6Y A;  2WGO A;  1RHL A;  3FZW A;  3PCS A;  5M1A A;  3NBR A;  3NM2 A;  1B2S A;  4KFD A;  3S67 A;  1NU3 A;  3E99 A;  5IEO A;  2L1S A;  1DYU A;  1YVS A;  4XBX A;  1VQ9 3;  1FGM A;  1A2V A;  3OWS A;  1W2Z A;  1VQQ A;  1DMN A;  3SX1 A;  3T8U A;  1G96 A;  1AVL A;  1RN1 A;  2CHC A;  2E2U A;  5AIH A;  1M1X B;  2H0G A;  2WGQ A;  4WWU C;  4XBT A;  5CF1 A;  4K1V A;  3D5I A;  2CC3 A;  1RMS A;  1Q40 B;  2BT3 A;  2LQV A;  4O8S A;  3DGY A;  1IYY A;  1HYF A;  2B24 B;  2LYX A;  1B27 A;  2CX1 A;  4K1U A;  2W2C A;  4STD A;  2J8X B;  1QAL A;  1UCL A;  4XB5 A;  3UL5 A;  1KSI A;  4CCV A;  5AYS C;  3X41 A;  1LXE A;  3GZY B;  4KZ1 A;  1AVK A;  3JVC A;  4BL3 A;  1RGG A;  2BIR A;  2F4Y A;  1U5O A;  2H0I A;  3IJE B;  4FMC A;  3S5C A;  3ALA A;  3V99 A;  1IK3 A;  1QVG 2;  4LEH A;  1YGW A;  1A2K A;  1WNH A;  5RNT A;  2Y73 A;  1OPY A;  1K41 A;  1RGH A;  3S27 A;  2GBW B;  4U13 A;  3ROB A;  3WOD G;  1VQL 3;  2BHM A;  1FGO A;  3PGB A;  1V58 A;  4RNT A;  1FUT A;  4HZB B;  1IVX A;  3PXM A;  5CXO A;  4EXR A;  4L8O A;  1HKX A;  4X2O A;  5BU4 A;  1RDS A;  2F56 A;  3CNM A;  3RDE A;  1PU4 A;  1GOV A;  2XFT A;  2P38 A;  3BNE A;  3DH2 A;  8RNT A;  1TP6 A;  1VQ8 3;  2OOV C;  1UI7 A;  5KP1 A;  1UUW B;  3EC9 A;  3KKG A;  4OUQ A;  1FGR A;  3DGN A;  4N6O B;  1N9J A;  5LC6 A;  2OTL 3;  3BNB A;  3EE1 A;  3PCR A;  3MKI A;  1IV9 A;  4G1M B;  3O8Y A;  1N9E A;  4FMB A;  2W9P A;  1CQS A;  1R4C A;  4HBR A;  2XEP A;  1W00 A;  2O3O A;  1OUN A;  2CFL A;  4RNZ A;  1FUW A;  1GY6 A;  3KCH A;  1TU5 A;  1QAK A;  4PEJ A;  1BVI A;  3F7X A;  3EQQ B;  5AII A;  1NO3 A;  4IT7 A;  1Q7Y 4;  1Q86 4;  1B2M A;  4ILF A;  4LZI A;  4BIR A;  1M9G A;  1NB3 I;  2HOH A;  2XSH B;  4KT3 B;  1D6Z A;  3DUK A;  1JBR A;  1RGF A;  3AHW A;  1Q40 A;  1GMR A;  2E2T A;  3U1W A;  3DGL A;  3EF8 A;  3FH1 A;  4J8T A;  1RCK A;  3PYJ A;  5AIG A;  1JBS A;  3AMO B;  1B3S A;  2P09 A;  3BND A;  2W0Q A;  3G0K A;  3KII A;  1UCJ A;  1ZO2 A;  1BNG A;  3BNC A;  4HM2 B;  4HVN A;  1YI2 3;  5BXQ A;  4HJL B;  1V57 A;  2CWU A;  3H3H A;  2FNQ A;  4RBN A;  1JZO A;  2CG0 A;  2YFI B;  3AGO A;  3HIG A;  2Z76 A;  1N5P A;  2ZA4 A;  4LSO A;  5GSP A;  3TDG A;  1LOW A;  1BRH A;  1ULJ B;  2IUJ A;  3FKA A;  5EQL A;  3CCL 3;  3OW2 2;  1L5G B;  3X40 A;  3LH4 A;  1CEW I;  2IA7 A;  2JQ5 A;  1BUJ A;  1ASK A;  4OK0 A;  4O02 B;  3X3Z A;  3OWU A;  3F40 A;  1EG9 B;  6STD A;  2CWV A;  3WA2 X;  1UI8 A;  3GSP A;  4NPB A;  3UNL A;  1Q42 A;  1LNI A;  1KQS 2;  1LOV A;  3KSP A;  1X1Y A;  3BIR A;  4EC6 A;  2KF5 A;  8CHO A;  5BIR A;  4K90 B;  3EB8 A;  1OHP A;  1K8A 4;  1LVN A;  3F8H A;  3NX0 A;  3T8N A;  3B7C A;  2RSX A;  1A67 A;  1IQY A;  1TTO A;  1UW1 A;  3GAX A;  2QA4 3;  3F7S A;  1WMN A;  1Q81 4;  2O9U X;  3RGA A;  1K9M 4;  1DMQ A;  2XFS A;  2F5M A;  1AV4 A;  2XRX B;  4R4K A;  5ELU A;  3NV0 B;  2QEX 3;  2K3D A;  1OHS A;  3K9M C;  1BSD A;  1PFP A;  1ZGX A;  1T2H A;  3CC4 3;  1X1U A;  3MG3 A;  4FCJ A;  3I55 3;  1I8V A;  5D83 A;  3CCJ 3;  1EA2 A;  1IQX A;  3A76 A;  2GXF A;  3FLJ A;  3KFQ C;  5KP4 A;  1BRI A;  3JUN A;  3LT8 A;  1BUQ A;  2Z6B A;  1BAO A;  2INX A;  2BNG A;  1M1K 4;  1RKY A;  3GRD A;  2OQE C;  1LNH A;  1RGK A;  3WOE B;  1JN5 B;  3S28 A;  2F86 B;  1BIR A;  1FUS A;  1RNT A;  2CFK A;  3CCE 3;  2KAA A;  3G4S 3;  2H0H A;  1BGS A;  3SOY A;  1YHQ 3;  1O7G B;  3FSD A;  1BU4 A;  1QJG A;  4NHF A;  2XF3 A;  2SAR A;  1JJ2 2;  3LTC A;  5G1L A;  3WDG B;  1KD1 4;  4RNY A;  3X3X A;  2CFG A;  1NNV A;  3F9S A;  4GL6 A;  4H3U A;  4CPK A;  1STF I;  1B20 A;  2C4B A;  1GMP A;  3MWZ A;  2OTJ 3;  2IMJ A;  4MMX B;  4R9L A;  2GU1 A;  1DMM A;  1Q9E A;  3G6E 3;  1ZS7 A;  2C10 A;  1UUG B;  3LT9 A;  3UJM A;  2W56 B;  3FG3 A;  1C7H A;  1IDP A;  3CMA 3;  2ML6 A;  1OGZ A;  1SQW A;  2OWP A;  2WOF A;  4DKI A;  1MWT A;  3CXC 2;  4EV2 A;  3FF2 A;  1OHO A;  4N6V 0;  5G1K A;  3NBJ A;  2XGN A;  1OAC A;  3J7Y d;  1I3F A;  1YIJ 3;  1DE3 A;  3M8C A;  4MEI A;  2P0M A;  4HAA A;  5JPP A;  1RRH A;  5DRE A;  3WHO A;  1O7H B;  3MHE A;  3HZP A;  4J9A A;  1VQ6 3;  2KF3 A;  2ML5 A;  2GSP A;  5FGO A;  2R4I A;  1GSP A;  4TX4 A;  1FA3 A;  1W2B 2;  1G02 A;  3N9H A;  3DZL A;  3NV0 A;  1TJD A;  2Z77 A;  1IT8 A;  3X42 A;  1Y4K A;  1RJO A;  1TRQ A;  5IW9 A;  3FGY A;  5BVB A;  2C11 A;  5HGR A;  2KRT A;  3KZT A;  4Q53 A;  3MG2 A;  1ULI B;  4K61 A;  1BNE A;  3VSY A;  3A5E A;  2P0X A;  1OF5 B;  3DMC A;  3EX9 A;  1T5Y A;  3D79 A;  4N3V A;  2KF6 A;  2F98 A;  2PZV A;  3Q2P A;  1QVF 2;  2CIU A;  1FGT A;  1FZU A;  1UGH I;  1JN5 A;  2A15 A;  4XBY A;  4L7K A;  5M18 A;  1UCI A;  1O7W B;  4H61 A;  4MMZ B;  1V74 A;  3B8L A;  1VQM 3;  1WQL B;  3HII A;  4HM1 B;  2MC8 A;  2CX0 A;  2JDI H; 
#chains in the Genus database with same CATH homology
 1YJ9 3;  1D6U A;  4XM4 A;  1O7N B;  1GY7 A;  1O7M B;  4XDW A;  2SBL A;  2CW9 A;  3KN4 A;  1VQ7 3;  1N8R 4;  3QRD A;  3S29 A;  4N6N B;  4FMA A;  3VGN A;  2HMM B;  3LTD A;  4NRE A;  2BO9 B;  1JB2 A;  5I97 A;  2W56 A;  4N6L A;  5STD A;  2CH9 A;  2K54 A;  3N8B A;  3OXA A;  2KCD A;  1YJW 3;  3LXU X;  1VQO 3;  3VF1 A;  2W03 A;  3DGM A;  4JF8 A;  2W9Q A;  2WO0 A;  1STD A;  1IVV A;  1UUV B;  1EQK A;  3PS8 A;  3CCU 3;  2ZL8 A;  2XSO B;  2K0M A;  3FG1 A;  5AIF A;  4GB5 A;  1S72 3;  2P05 A;  2YFJ B;  1W7C A;  3LTB A;  2V1L A;  1NWW A;  5LC7 A;  2B1X B;  2Y74 A;  1OH0 A;  2HMO B;  2I9W A;  1S5A A;  1WMP A;  4EV5 A;  3CC2 3;  3RGR A;  3CME 3;  4EYC A;  3DGO A;  3B4O A;  1N8Q A;  1J2B A;  1OGX A;  3D9R A;  2STD A;  3OV4 A;  5D81 A;  3UL6 A;  4EBG A;  3EN1 B;  4WHA A;  3B4P A;  3F8X A;  2W04 A;  3MSO A;  1VQP 3;  1JB5 A;  4XDV A;  1ROA A;  4LGQ A;  4L8P A;  2CG1 A;  3WMD A;  4JRF A;  1Z1S A;  3HK4 A;  1JNQ A;  4HM4 B;  3GZB A;  3SED A;  3CCS 3;  3Q1C A;  3G16 A;  3U97 A;  1GY5 A;  4HM3 B;  3WOF B;  4HM6 B;  2BMR B;  3JUM A;  3AMO A;  1ISK A;  1NJI 4;  2IUK A;  4HM7 B;  4WP5 A;  3STD A;  1IVU A;  1K73 4;  5CK6 A;  3CPO A;  4N6M A;  1GYB A;  2OOV A;  5IG5 A;  3CD6 3;  1VQ5 3;  2CFD A;  2CK3 H;  2ZDJ A;  3K5T A;  5CLK A;  1SPU A;  2MF7 A;  1M90 4;  2BMQ B;  3EBT A;  1IQ8 A;  2OCT A;  5IEN A;  4HM5 B;  2F99 A;  1JKG B;  1WMO A;  4WFO A;  3CU3 A;  1YIT 3;  2RCD A;  4HZ9 B;  3JUO A;  1TFO A;  1JB4 A;  3FF0 A;  3PZW A;  3IPT A;  1JRQ A;  5AYR B;  3CCR 3;  1VQN 3;  3CNX A;  3LTA A;  1SJW A;  4R9K A;  4KFF A;  2GEY A;  3HX8 A;  3IMA B;  5TGN A;  1ROV A;  1DVD A;  3NQY A;  7STD A;  1E3V A;  3LML A;  1TIJ A;  3DXO A;  3GZR A;  1AR0 A;  1ZX2 A;  2YFL B;  3LOY A;  3GZX B;  3CCV 3;  4HM8 B;  4HM0 B;  1SIH A;  5IG0 A;  3I56 3;  5AEW B;  1QMA A;  4LMI A;  2XGL A;  1CYU A;  4AKZ A;  4CDL A;  2XR8 B;  4ZM8 A;  2FGT A;  4KFE A;  1F8N A;  4FR9 A;  1W6Y A;  4ORL A;  3V98 A;  3SVA A;  2PNC A;  1TFK A;  3EJV A;  4AKY A;  4OVM A;  2HMJ B;  1E97 A;  1CYV A;  1U8C B;  4BTY A;  1N5H A;  4BTW A;  3WA3 A;  1E3R A;  2QIY A;  3K63 A;  3CCM 3;  3KSE D;  3K0Z A;  4IIA A;  2WOH A;  2BMO B;  4AEQ A;  5AEU B;  1FGQ A;  3NBB A;  5D82 A;  1W6G A;  2HMK B;  4KVH A;  3JUQ A;  3L0R A;  5EEO A;  1A90 A;  1HU9 A;  4I4K A;  1W02 A;  1GS3 A;  4O3V A;  1QAF A;  2Q07 A;  3X3Y A;  1KC8 4;  4HKV B;  1W01 A;  5AI1 A;  5FW5 A;  1IV7 A;  4MJD A;  3MPH A;  1VQ4 3;  1IU7 A;  2KXG A;  3OWY A;  2CFW A;  3Q90 A;  1JKG A;  1KWI A;  1RN7 A;  3OX9 A;  5IER A;  2UX0 A;  2D42 A;  2Z7A A;  2FXT A;  3NUV A;  5IEP A;  3FCS B;  3EN8 A;  3HI7 A;  4WYK B;  5IF6 A;  1TUH A;  1VZZ A;  3BB9 A;  3LYG A;  1EKM A;  1YJN 3;  3K7C A;  3D3L A;  4HYZ A;  1DVC A;  1W5Z A;  2RGQ A;  4MMY B;  2M7O A;  4QWT A;  1W4N A;  1GD4 A;  4RZM A;  2RFR A;  3G71 3;  4N6U A;  3EHC A;  1O7P B;  2CKF B;  1YGE A;  4FCZ A;  2OQE A;  5JBS A;  1IT7 A;  3NQZ A;  5DRV A;  2GEX A;  3MYT A;  3NHX A;  4N6T A;  3BLZ A;  4R1K A;  3CC7 3;  5KP3 A;  5G2G A;  1SII A;  1US1 A;  4X2H A;  3KE7 A;  4FMD A;  3F14 A;  5IG3 A;  2CWT A;  5JPU A;  1YVB I;  3LZA A;  2E2V A;  3QK9 A;  1WTH A;  3MG1 A;  5IG4 A;  1GD3 A;  3CPW 2;  1OF5 A;  1JV2 B;  1NB5 I;  4O2H A;  4BTX A;  4IPB A;  3NXJ A;  3N54 B;  2L4V A;  3SLU A;  5CF2 A;  3NM7 A;  2GU3 A;  1LOX A;  1MNL A;  3ECF A;  3H51 A;  1IVW A;  1VQK 3;  1MOL A;  4R80 A;  3DM8 A;  3T0U A;  2HMN B;  3FG4 A;  1K28 A;  1W6C A;  2W6J H;  3DY5 A;  5ELJ A;  5A0O B;  4FCM A;  3EBY A;  2YX9 A;  3SXX A;  1Q82 4;  3SOA A;  3G8Z A;  1OCV A;  2GBX B;  3JUP A;  1RRL A;  2D1W A;  3GWR A;  3V92 A;  2HML B;  3CCQ 3;  3I0Y A;  2QGU A;  3UB1 A;  2XH9 A;  3ER7 A;  5EVH A;  4WYK A;  1NDO B;  1D6Y A;  2WGO A;  3FZW A;  3PCS A;  3NBR A;  3NM2 A;  4KFD A;  3S67 A;  1NU3 A;  3E99 A;  5IEO A;  1DYU A;  4XBX A;  1FGM A;  1A2V A;  3OWS A;  1W2Z A;  3T8U A;  1DMN A;  3SX1 A;  1G96 A;  1AVL A;  2CHC A;  2E2U A;  5AIH A;  1M1X B;  4WWU C;  2WGQ A;  4XBT A;  5CF1 A;  4K1V A;  2CC3 A;  1Q40 B;  2BT3 A;  2LQV A;  4O8S A;  2B24 B;  2LYX A;  4K1U A;  4STD A;  2W2C A;  4CCV A;  1QAL A;  4XB5 A;  3UL5 A;  1KSI A;  5AYS C;  3X41 A;  1LXE A;  3GZY B;  4KZ1 A;  1AVK A;  3JVC A;  1U5O A;  4FMC A;  3IJE B;  3V99 A;  3S5C A;  3ALA A;  1IK3 A;  1QVG 2;  4LEH A;  1A2K A;  1WNH A;  2Y73 A;  1OPY A;  1K41 A;  3S27 A;  2GBW B;  4U13 A;  3ROB A;  3WOD G;  1VQL 3;  2BHM A;  1FGO A;  3PGB A;  4HZB B;  1IVX A;  3PXM A;  5CXO A;  4EXR A;  4L8O A;  1HKX A;  4X2O A;  3CNM A;  3RDE A;  1PU4 A;  2XFT A;  2P38 A;  3BNE A;  1TP6 A;  1VQ8 3;  2OOV C;  1UI7 A;  5KP1 A;  1UUW B;  3EC9 A;  3KKG A;  4OUQ A;  1FGR A;  3DGN A;  4N6O B;  1N9J A;  5LC6 A;  2OTL 3;  3BNB A;  3EE1 A;  3PCR A;  3MKI A;  1IV9 A;  4G1M B;  3O8Y A;  1N9E A;  4FMB A;  2W9P A;  1CQS A;  1R4C A;  4HBR A;  2XEP A;  1W00 A;  2O3O A;  1OUN A;  2CFL A;  4RNZ A;  1FUW A;  1GY6 A;  1TU5 A;  1QAK A;  4PEJ A;  3F7X A;  3EQQ B;  5AII A;  1NO3 A;  4IT7 A;  1Q7Y 4;  1Q86 4;  4LZI A;  1M9G A;  1NB3 I;  2XSH B;  1D6Z A;  3DUK A;  1Q40 A;  2E2T A;  3U1W A;  3DGL A;  3EF8 A;  3FH1 A;  4J8T A;  3PYJ A;  5AIG A;  3AMO B;  2P09 A;  3BND A;  2W0Q A;  3G0K A;  3KII A;  1ZO2 A;  3BNC A;  4HM2 B;  4HVN A;  1YI2 3;  5BXQ A;  4HJL B;  2CWU A;  3H3H A;  2FNQ A;  4RBN A;  2YFI B;  2CG0 A;  3HIG A;  2Z76 A;  1N5P A;  4LSO A;  3TDG A;  2IUJ A;  3CCL 3;  1ULJ B;  3FKA A;  5EQL A;  3OW2 2;  1L5G B;  3X40 A;  3LH4 A;  1CEW I;  2IA7 A;  2JQ5 A;  1ASK A;  4OK0 A;  4O02 B;  3X3Z A;  3OWU A;  3F40 A;  1EG9 B;  6STD A;  2CWV A;  3WA2 X;  1UI8 A;  3UNL A;  1Q42 A;  1KQS 2;  3KSP A;  4EC6 A;  8CHO A;  4K90 B;  3EB8 A;  1OHP A;  1K8A 4;  1LVN A;  3F8H A;  3NX0 A;  3T8N A;  3B7C A;  2RSX A;  1A67 A;  1IQY A;  1UW1 A;  3GAX A;  2QA4 3;  3F7S A;  1WMN A;  1Q81 4;  2O9U X;  3RGA A;  1K9M 4;  1DMQ A;  2XFS A;  2XRX B;  1AV4 A;  4R4K A;  5ELU A;  3NV0 B;  2QEX 3;  1OHS A;  3K9M C;  1PFP A;  3CC4 3;  3MG3 A;  4FCJ A;  3I55 3;  5D83 A;  3CCJ 3;  1EA2 A;  1IQX A;  3A76 A;  2GXF A;  3FLJ A;  3KFQ C;  5KP4 A;  3JUN A;  3LT8 A;  1BUQ A;  2Z6B A;  2INX A;  2BNG A;  1M1K 4;  1RKY A;  3GRD A;  2OQE C;  1LNH A;  3WOE B;  1JN5 B;  3S28 A;  2F86 B;  2CFK A;  3CCE 3;  3G4S 3;  3SOY A;  1YHQ 3;  1O7G B;  3FSD A;  1QJG A;  4NHF A;  2XF3 A;  1JJ2 2;  3LTC A;  3WDG B;  1KD1 4;  4RNY A;  3X3X A;  2CFG A;  3F9S A;  4GL6 A;  4H3U A;  1STF I;  3MWZ A;  2OTJ 3;  2IMJ A;  4MMX B;  4R9L A;  2GU1 A;  1DMM A;  3G6E 3;  2C10 A;  3UJM A;  3LT9 A;  2W56 B;  3FG3 A;  1C7H A;  1IDP A;  3CMA 3;  2ML6 A;  1OGZ A;  1SQW A;  2OWP A;  2WOF A;  3CXC 2;  1VQ9 3;  4EV2 A;  3FF2 A;  1OHO A;  4N6V 0;  3NBJ A;  2XGN A;  1OAC A;  3J7Y d;  1YIJ 3;  3M8C A;  4MEI A;  2P0M A;  5JPP A;  1RRH A;  5DRE A;  1O7H B;  3MHE A;  3HZP A;  4J9A A;  1VQ6 3;  2ML5 A;  5FGO A;  2R4I A;  4TX4 A;  1FA3 A;  1W2B 2;  3N9H A;  3DZL A;  3NV0 A;  2Z77 A;  1IT8 A;  3X42 A;  1Y4K A;  1RJO A;  5IW9 A;  3FGY A;  5BVB A;  2C11 A;  5HGR A;  2KRT A;  3KZT A;  4Q53 A;  3MG2 A;  1ULI B;  4K61 A;  3VSY A;  2P0X A;  1OF5 B;  3DMC A;  3EX9 A;  1T5Y A;  4N3V A;  2PZV A;  2F98 A;  1QVF 2;  3Q2P A;  2CIU A;  1FGT A;  1JN5 A;  2A15 A;  4XBY A;  4L7K A;  1O7W B;  4H61 A;  4MMZ B;  1V74 A;  3B8L A;  1VQM 3;  1WQL B;  3HII A;  4HM1 B;  2MC8 A;  2JDI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...