5IF6A

Structure of a computationally designed 17-ohp binder
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords OHP9_1c
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
total genus 32
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5if6A00
3GWRA 2BMOB 1Z1SA 2RFRA 2GEXA 4L8OA 3E99A 1WQLB 1EA2A 4HM6B 8CHOA 1EG9B 2HMMB 3LYGA 3LZAA 4L8PA 3CNXA 3F40A 1E3VA 1O7HB 5D81A 2R4IA 3MHEA 5AIIA 1DMNA 3EJVA 2JQ5A 4LEHA 1Q40B 2YFIB 2HMKB 1ULJB 2Z7AA 4HKVB 4Q53A 5DREA 3JUQA 3OX9A 1W00A 3OWUA 3G8ZA 3FLJA 3GRDA 2HMNB 3ROBA 5CF2A 2HMJB 3DUKA 3DXOA 1CQSA 2XSOB 5IG5A 3DMCA 4HM3B 3KE7A 4WYKB 1A2KA 3F7XA 1JN5A 3EN8A 1OF5A 1W01A 2INXA 3T8NA 2W2CA 3VGNA 5IEOA 3KZTA 2BNGA 2YFJB 3K0ZA 4RZMA 3B7CA 1JKGA 5AIGA 5IF6A 1UUVB 4R1KA 3SOYA 2GEYA 3EC9A 5KP3A 5DRVA 3G16A 2XSHB 3HK4A 4K1VA 1JN5B 1OF5B 2BMRB 3I0YA 4FCMA 3ECFA 2B1XB 2CKFB 2CHCA 1DMQA 3OXAA 4WWUC 2BMQB 1OHPA 4XBXA 4K1UA 1IDPA 3UNLA 5BXQA 1JKGB 4KVHA 3MKIA 1NU3A 1O7MB 5G2GA 3F14A 4STDA 1JB4A 5STDA 1OH0A 1E3RA 4XM4A 4WYKA 5IEPA 4HZBB 4LGQA 1STDA 1NDOB 4XBYA 3RGAA 1U5OA 2UX0A 5CXOA 5HGRA 3WMDA 3D9RA 1AR0A 4CDLA 3NHXA 1ULIB 4HZ9B 2F98A 4R9LA 3NXJA 1K41A 1O7WB 5IG3A 3B8LA 2RCDA 1TUHA 3K7CA 2XR8B 3DM8A 4GB5A 3F7SA 3HX8A 3VSYA 1OUNA 3B4OA 3EQQB 1SJWA 3OV4A 3MG3A 5IENA 5BVBA 2A15A 1OHOA 4I4KA 3T8UA 1VZZA 5AEUB 4ORLA 3OWYA 1E97A 1OGXA 3NUVA 3EBTA 3KSPA 3FKAA 4HM0B 5IG4A 6STDA 2I9WA 4J9AA 1O7GB 4IIAA 1HKXA 5TGNA 4XDVA 3JUOA 5AIHA 3MG1A 3FGYA 3JUMA 1Q42A 5KP4A 2IMJA 1BUQA 1O7PB 3EX9A 1W6YA 2GBXB 4HM5B 3HZPA 4HM7B 3GZXB 2GXFA 3GZRA 5D82A 1OHSA 1OPYA 3CU3A 4X2HA 1ASKA 1NWWA 3SOAA 3OWSA 3NV0A 4XB5A 1DMMA 4L7KA 3FH1A 4OUQA 3NM2A 4HM1B 5JPUA 3FF2A 7STDA 1TP6A 3H51A 3GZYB 5D83A 3GZBA 3STDA 4HM4B 5JPPA 1GY5A 3FF0A 2OWPA 3EBYA 1GY6A 1OCVA 4XBTA 2HMOB 1OGZA 3F8XA 4LMIA 3A76A 5KP1A 4X2OA 4U13A 2YFLB 4J8TA 3NV0B 3NBRA 4N3VA 3FZWA 4R9KA 3EF8A 3ER7A 2XRXB 3G0KA 3CPOA 3B4PA 5IERA 1W02A 3EN1B 1ISKA 3MSOA 4H3UA 3M8CA 2Z77A 5CLKA 3MG2A 2B24B 3S5CA 2K54A 4HVNA 1QJGA 1GY7A 4WP5A 1ZX2A 3JUNA 1QMAA 2STDA 3H3HA 2F99A 4HJLB 3F8HA 2PZVA 2F86B 3RGRA 4PEJA 5FW5A 2Z76A 4HM8B 2HMLB 3KKGA 1JB5A 3Q90A 3DZLA 1O7NB 3SEDA 1JB2A 3EHCA 2QGUA 5AIFA 3MYTA 3CNMA 3IPTA 4XDWA 3JUPA 2QIYA 5AI1A 1S5AA 5CK6A 3BB9A 2GBWB 3UJMA 5AEWB 1GS3A 4HM2B 1ZO2A 1C7HA 1UUWB 1GYBA 3FSDA 3F9SA 5IG0A 1Q40A 4OVMA 2RGQA 4MJDA 3BLZA 5CF1A 4FCJA 5EVHA
chains in the Genus database with same CATH superfamily
2IA7A 2W6JH 1FGRA 2BMOB 3GWRA 4RNZA 2OOVC 3LTBA 1D6UA 1I70A 1Q7HA 1BUJA 1Z1SA 2RFRA 3LTCA 1N9EA 2WOFA 2GEXA 3CCL3 4GSPA 3CC23 4L8OA 1YI23 3OW22 2CFLA 3A5EA 3E99A 2RNTA 1AVLA 2F5WA 1TRQA 1IYYA 1WQLB 2H0HA 1KWIA 3KN4A 4EV2A 2WOHA 1EA2A 2IYJA 4HM6B 1SPUA 8CHOA 1EG9B 4ZM8A 3PCSA 1GOYA 2HMMB 1VQK3 3LYGA 1RJOA 3LZAA 4L8PA 3CNXA 3WOFB 3F40A 4AEQA 1BRGA 1E3VA 3K9MC 1O7HB 1UW1A 5D81A 3S27A 2R4IA 1NB3I 4EBGA 1FGTA 1D6YA 1FUSA 3MHEA 2CH9A 2C4BA 1VQL3 5AIIA 1B2XA 1BGSA 1MWTA 1LVNA 1R4YA 1IVVA 2KCDA 1DMNA 2E2TA 3NBJA 2F4YA 4J5KA 1I3FA 3EJVA 2JQ5A 4LEHA 2ZDJA 3KFQC 4JRFA 1WMPA 1Q40B 4KZ1A 3N54B 2BT3A 2YFIB 1Q9EA 2HMKB 1ULJB 1WTHA 2Z7AA 4HKVB 3AGOA 4N6LA 4Q53A 3LH4A 5DREA 2ZL8A 1W4NA 1MGRA 1BSBA 5HOHA 2CWTA 3SLUA 3JUQA 1LOXA 2PNCA 3OX9A 1RGFA 2CIUA 1W00A 3OWUA 3G8ZA 1HZ1A 3FLJA 3GRDA 4FCZA 2HMNB 3ROBA 1CYUA 5CF2A 1GD3A 2HMJB 1CEWI 1RMSA 3DUKA 1BNIA 3DXOA 1CQSA 3SXXA 2IUKA 1SIHA 2XSOB 4JF8A 4I5QA 3DMCA 4HM3B 4DKIA 1ROVA 4IPBA 5IG5A 1FGOA 1DE3A 1BSEA 1RGCA 3KE7A 4WYKB 1A2KA 2KF3A 3ZG5A 1BANA 3UL6A 1BNGA 2F56A 1WMNA 3F7XA 1K734 4FMAA 1JN5A 1RNTA 3EN8A 1BIRA 1OF5A 3AHWA 2CC3A 1M1XB 4N6NB 1W01A 2INXA 1JZDA 1NNVA 1SIIA 1YGEA 8RNTA 3CCV3 3D5GA 3T8NA 1B2SA 2JDIH 3G713 2W2CA 1BU4A 3I563 1RHLA 3VGNA 2LQVA 1RTUA 2O3OA 5IEOA 3KZTA 2BNGA 1BOXA 5BIRA 1VQP3 3KIIA 2YFJB 1UUGB 1YNVX 1K28A 3S67A 1NO3A 1RN7A 5M1AA 1B2MA 3K0ZA 4EW5A 2WGQA 1B3SA 4RZMA 3B7CA 3CCU3 1LNHA 1JKGA 2CG0A 2UGIA 4HYZA 2CG1A 4O8SA 5AIGA 3K63A 1IQYA 4RNYA 2XGLA 2W04A 4NREA 1YJW3 4O3VA 1JNQA 3BIRA 3PYJA 5IF6A 1UUVB 1RGHA 2GSPA 5I97A 1A90A 1VQ83 1IVUA 1UCLA 4R1KA 1W7CA 1A2PA 4FMBA 3D3LA 4LSOA 4N6V0 2GEYA 3SOYA 4HAAA 4J5GA 3CMA3 3EC9A 5KP3A 5RNTA 5DRVA 1YVBI 3G16A 2XSHB 1N5HA 1RGAA 2W0QA 3LT9A 4IT7A 1AQZA 3HK4A 4K1VA 1MWRA 1X1UA 1HYFA 1JN5B 1DYUA 3LXUX 4AKYA 1OF5B 1RSNA 1EKMA 2XF3A 1RDSA 2BMRB 3D5IA 3I0YA 4FCMA 1IT7A 3ECFA 2B1XB 2CKFB 3CD63 2W03A 2CHCA 1RNBA 2H0GA 1DMQA 3PXMA 3OXAA 3VF1A 4WWUC 2GU1A 3CCR3 1LRAA 2BMQB 4CCVA 3X3XA 1OHPA 3DGOA 2C11A 2XFSA 4XBXA 4K1UA 2FXTA 3CME3 1AVKA 1IDPA 1RGLA 1YGWA 1EUIC 3UNLA 5EVHA 2OQEA 3X40A 5BXQA 1DVCA 1JKGB 3DGLA 4K90B 4KVHA 1FA3A 1V57A 2P09A 1B2ZA 1MOLA 1NU3A 1O7MB 3MKIA 3BNCA 2KF4A 5G2GA 1STFI 1TFKA 3K5TA 3G4S3 4GL6A 3F14A 3IMAB 1JB4A 2K0MA 1SQWA 4FR9A 1HU9A 4STDA 1DETA 1ROAA 1W6GA 5G1KA 1IVXA 2L1SA 1LQMB 5STDA 1OH0A 4BU4A 1Q864 1M1K4 4KT3B 1E3RA 4XM4A 2R41A 4MMYB 4OK0A 3SYUA 4WYKA 4MEIA 1I0XA 4MMXB 1BRKA 3CC43 1FZUA 5IEPA 3L0RA 4HZBB 4LGQA 1STDA 1U8CB 1FGQA 4N6MA 5IW9A 2OTL3 2CWVA 1OACA 1IT8A 4H61A 4TX4A 3ZFZA 1BRSA 3HIGA 2BO9B 3CCJ3 4KFDA 3J7Yd 3LT8A 1NDOB 4N6TA 4XBYA 3FG4A 4ILFA 2RBIA 3RGAA 4FMCA 1U5OA 3BU4A 2UX0A 2L4VA 2P05A 5CXOA 5ELUA 5HGRA 3WMDA 3D9RA 3CXC2 1AR0A 3S29A 4BTWA 3LMLA 1J2BA 1BSCA 1X1YA 3U97A 2W56A 4CDLA 1YIJ3 3NHXA 4LZIA 1BVIA 2C10A 1ULIB 4HZ9B 3V92A 1Q7Y4 3NM7A 1N8R4 1JRQA 1TFOA 2OOVA 2F98A 4R9LA 3CCM3 5LC7A 1T2IA 4N6UA 2HOHA 2CX0A 5GSPA 1PY3A 3LTDA 3NXJA 1BRIA 1K41A 1VQ93 1M904 1O7WB 3Q2PA 2W9PA 1G0TA 2P0MA 3B8LA 4BL2A 5IG3A 4HBRA 1G96A 4BTXA 2SBLA 2ML5A 2RCDA 1DVDA 1TUHA 3K7CA 1C54A 3EE1A 2XR8B 3DM8A 4GB5A 4FMDA 4RNTA 3F7SA 3HX8A 4EYCA 2GU3A 3VSYA 3RNTA 1BSAA 2YX9A 1NJI4 1OUNA 1YJN3 3B4OA 3WDGB 3EQQB 1SJWA 2Q07A 3HOHA 3GSPA 2SARA 3OV4A 3CC73 2OTJ3 7RNTA 3D4AA 1I2EA 2OCTA 2CX1A 3MG3A 5IENA 1T2HA 3X41A 4CJNA 5A0OB 5BVBA 4RBNA 2A15A 1OHOA 1YHQ3 1FW7A 9RNTA 4I4KA 3T8UA 1G02A 1VZZA 1X1WA 3AMOA 3IJEB 2UUGC 3ZG0A 5AEUB 1GOUA 1LXEA 4N6OB 4ORLA 1TJDA 2W56B 2CWUA 3GAXA 3SVAA 3WOEB 3OWYA 3V99A 1FUWA 2WGOA 1VQ73 2WO0A 1E97A 3O8YA 1RRHA 1T3BA 3WHOA 1OGXA 3NUVA 3N8BA 3EBTA 3KSPA 3U1WA 3FKAA 4HM0B 1PYLA 5IG4A 6STDA 1IV7A 2I9WA 3ALAA 1BSDA 4J9AA 3DH2A 2D1WA 1O7GB 4BIRA 1MWUA 2QEX3 1W2B2 4IIAA 1HKXA 1BNEA 5TGNA 1I2FA 4XDVA 1BRJA 1MNLA 3JUOA 1RGKA 5AIHA 1BNFA 1IK3A 3MG1A 3MWZA 3NQYA 3FGYA 3BNBA 1I0VA 1Q42A 3JUMA 5KP4A 1TU5A 1MGWA 3WA3A 1N8QA 2IMJA 2ZHXB 1O7PB 3EX9A 1BUQA 1AV4A 1W6YA 3WA2X 4BTYA 2GBXB 2CK3H 1BNRA 4HM5B 5AYRB 1LOYA 3HZPA 1QAFA 4EC6A 1BRHA 1UGIA 4HM7B 1IQ8A 3DGMA 4NPBA 4O2HA 3I553 5M18A 3AMOB 1YJ93 3GZXB 2GXFA 3GZRA 2RSXA 2Y73A 5D82A 1Q824 1IU7A 1OHSA 1OPYA 2E2UA 2KF6A 3X3ZA 1TTOA 3PGBA 3N9HA 3CU3A 1KD14 1BNSA 2BIRA 4X2HA 1ASKA 1CH0A 3MPHA 1NWWA 3SOAA 3NQZA 3OWSA 3NV0A 4XB5A 1DMMA 1BRNL 3S28A 4EXRA 1PU4A 4L7KA 3LOYA 1AY7A 3FH1A 4OUQA 3NM2A 2IUJA 2AADA 4HM1B 5JPUA 3QK9A 1MWSA 1QAKA 1RLSA 3FF2A 7STDA 3FCSB 3WR2A 1TP6A 3H51A 3GZYB 3LTAA 1K8A4 2CW9A 3KCHA 3AHSA 2XGNA 1IV9A 5D83A 1KSIA 2MF7A 1RGEA 3KSED 3GZBA 4G1MB 3STDA 3UB1A 3CPW2 1A67A 2W9QA 4HM4B 5JPPA 1GY5A 1VQ43 3D79A 3FF0A 1JJ22 1JBTA 2OWPA 1B21A 1GMRA 3EBYA 5BU4A 1GY6A 1OCVA 1K9M4 3DGYA 3X3YA 1Y4KA 4XBTA 2HMOB 1OGZA 3F8XA 1VQO3 4LMIA 1GMQA 1RGGA 1I2GA 3A76A 5JBSA 1X1XA 4GHOA 5KP1A 2CFDA 6GSPA 1UGHI 4R4KA 2LYXA 1RCLA 1ZS7A 1B20A 4X2OA 5G1LA 4U13A 1VQ63 2P38A 2YFLB 4J8TA 3NV0B 3NBRA 4WHAA 4N3VA 4EV5A 1VQN3 3FZWA 1W2ZA 1T5YA 3G6E3 4R9KA 3EF8A 2KRTA 3ER7A 2XRXB 1US1A 2IY2A 1I8VA 2XEPA 1N5PA 1UI7A 3G0KA 3CPOA 2E2VA 3PS8A 1WMOA 3AGNA 3B4PA 1WNHA 3WODG 1L5GB 5IERA 1W02A 3CCE3 2QA43 3EN1B 2V1LA 3V98A 1ISKA 1FUTA 3MSOA 3URPA 4H3UA 1ZGXA 3M8CA 1YVSA 1UDII 3HI7A 1JV2B 4AKZA 4QWTA 1KC84 2Z77A 2K3DA 5CLKA 6RNTA 3MG2A 2B24B 2XH9A 4HOHA 3S5CA 2K54A 1S723 2BU4A 4LYLB 2CFKA 4HVNA 1QJGA 1EEJA 1V58A 1GMPA 1GY7A 4WP5A 3TDGA 1TIJA 1ZX2A 2CFWA 3JUNA 3QRDA 1B2UA 1LQGC 1QMAA 2STDA 1SARA 2KAAA 1VQQA 3H3HA 3SX1A 2F99A 1M9GA 4HJLB 3PCRA 2Y74A 3F8HA 2M7OA 7GSPA 1GOVA 1VQ53 1A2VA 2PZVA 2F86B 3RGRA 3X42A 2KF5A 4CPKA 2MC8A 1KQS2 1IVWA 1RN1A 4PEJA 5FW5A 1RRLA 2H0IA 1BAOA 3NBBA 2Z76A 4R80A 4HM8B 3FG1A 2HMLB 1BNJA 1IQXA 3KKGA 5EQLA 1V74A 4O02B 5EEOA 1FYSA 1JB5A 3Q90A 3DZLA 1R4CA 1GSPA 5AYSC 1UCJA 1O7NB 1LOVA 1I3IA 1QALA 1UCIA 1JB2A 3SEDA 1TRPA 3EHCA 2QGUA 2FNQA 1RN4A 3DGNA 3HIIA 1QVF2 2OQEC 5AIFA 5FGOA 3RDEA 4KFEA 3MYTA 3PZWA 3CNMA 3NX0A 1PFPA 2J8XB 1D6ZA 3IPTA 1JZOA 3CCS3 1RKYA 2KXGA 2ZA4A 1VQM3 1W5ZA 4XDWA 3UL5A 3JUPA 1RCKA 2QIYA 2FGTA 2P0XA 5AI1A 4BL3A 3DY5A 1S5AA 1UCKA 4K61A 1W6CA 4KFFA 3EB8A 5CK6A 3BB9A 3CCQ3 2GBWB 1Q814 2CFGA 3UJMA 2D42A 1LOWA 4NHFA 1UI8A 2XFTA 1JBSA 1YIT3 5AEWB 1FGMA 1GS3A 3Q1CA 3Q3FA 3T0UA 1F8NA 1QVG2 4HM2B 1B27A 5ELJA 3BNDA 1ZO2A 1NB5I 2BHMA 2O9UX 1C7HA 1UUWB 1EQKA 1GYBA 3FSDA 3JVCA 1N9JA 2AAEA 3F9SA 2ML6A 3FG3A 5IG0A 1GD4A 1Q40A 2F5MA 4OVMA 5LC6A 4WFOA 1LNIA 2Z6BA 1JBRA 2RGQA 4MJDA 3BLZA 5CF1A 3BNEA 4FCJA 1CYVA 5M19A 4MMZB
chains in the Genus database with same CATH topology
2IA7A 2W6JH 1FGRA 2BMOB 3GWRA 4RNZA 2OOVC 3LTBA 1D6UA 1Z1SA 2RFRA 3LTCA 1N9EA 2WOFA 2GEXA 3CCL3 3CC23 4L8OA 1YI23 3OW22 2CFLA 3E99A 1AVLA 1WQLB 1KWIA 3KN4A 4EV2A 2WOHA 1EA2A 4HM6B 1SPUA 8CHOA 1EG9B 4ZM8A 3PCSA 2HMMB 1VQK3 3LYGA 1RJOA 3LZAA 4L8PA 3CNXA 3WOFB 3F40A 4AEQA 1E3VA 3K9MC 1O7HB 1UW1A 5D81A 3S27A 2R4IA 1NB3I 4EBGA 1FGTA 1D6YA 3MHEA 2CH9A 1VQL3 5AIIA 1LVNA 1IVVA 2KCDA 1DMNA 2E2TA 3NBJA 3EJVA 2JQ5A 4LEHA 2ZDJA 3KFQC 4JRFA 1WMPA 1Q40B 4KZ1A 3N54B 2BT3A 2YFIB 2HMKB 1ULJB 1WTHA 2Z7AA 4HKVB 4N6LA 4Q53A 3LH4A 5DREA 2ZL8A 1W4NA 2CWTA 3SLUA 3JUQA 1LOXA 2PNCA 3OX9A 2CIUA 1W00A 3OWUA 3G8ZA 3FLJA 3GRDA 4FCZA 2HMNB 3ROBA 1CYUA 5CF2A 1GD3A 2HMJB 1CEWI 3DUKA 3DXOA 1CQSA 3SXXA 2IUKA 1SIHA 2XSOB 4JF8A 5IG5A 3DMCA 4HM3B 1ROVA 4IPBA 1FGOA 3KE7A 4WYKB 1A2KA 3UL6A 1WMNA 3F7XA 1K734 4FMAA 1JN5A 3EN8A 1OF5A 2CC3A 1M1XB 4N6NB 1W01A 2INXA 3CCV3 1YGEA 1SIIA 3T8NA 2JDIH 3G713 2W2CA 3I563 3VGNA 2LQVA 2O3OA 5IEOA 3KZTA 2BNGA 1VQP3 3KIIA 2YFJB 1K28A 3S67A 1NO3A 1RN7A 3K0ZA 2WGQA 4RZMA 3B7CA 3CCU3 1LNHA 1JKGA 2CG0A 4HYZA 2CG1A 4O8SA 5AIGA 3K63A 1IQYA 4RNYA 2XGLA 2W04A 4NREA 1YJW3 4O3VA 1JNQA 3PYJA 5IF6A 1UUVB 5I97A 1A90A 1VQ83 1IVUA 4R1KA 1W7CA 4FMBA 4LSOA 3D3LA 4N6V0 3SOYA 2GEYA 3CMA3 3EC9A 5KP3A 5DRVA 1YVBI 3G16A 2XSHB 1N5HA 2W0QA 3LT9A 4IT7A 3HK4A 4K1VA 1JN5B 1DYUA 3LXUX 4AKYA 1OF5B 1EKMA 2XF3A 2BMRB 3I0YA 4FCMA 1IT7A 3ECFA 2B1XB 2CKFB 3CD63 2W03A 2CHCA 3PXMA 1DMQA 3OXAA 3VF1A 4WWUC 2GU1A 3CCR3 2BMQB 4CCVA 3X3XA 1OHPA 3DGOA 2C11A 2XFSA 4XBXA 4K1UA 2FXTA 3CME3 1AVKA 1IDPA 3UNLA 5EVHA 2OQEA 3X40A 5BXQA 1DVCA 1JKGB 3DGLA 4K90B 4KVHA 1FA3A 2P09A 3MKIA 1MOLA 1NU3A 1O7MB 3BNCA 5G2GA 1STFI 1TFKA 3K5TA 3G4S3 4GL6A 3F14A 3IMAB 1JB4A 2K0MA 1SQWA 4FR9A 1HU9A 4STDA 1W6GA 1ROAA 4EV5A 1IVXA 5STDA 1OH0A 1Q864 1M1K4 1E3RA 4XM4A 4MMYB 4OK0A 4WYKA 4MEIA 4MMXB 3CC43 5IEPA 3L0RA 4HZBB 4LGQA 1STDA 1U8CB 1FGQA 4N6MA 5IW9A 2OTL3 2CWVA 1OACA 1IT8A 4H61A 4TX4A 3HIGA 2BO9B 3CCJ3 4KFDA 3J7Yd 3LT8A 1NDOB 4N6TA 4XBYA 3FG4A 3RGAA 4FMCA 1U5OA 2UX0A 2L4VA 2P05A 5CXOA 5ELUA 5HGRA 3WMDA 3D9RA 3CXC2 1AR0A 3S29A 4BTWA 3LMLA 1J2BA 3U97A 2W56A 4CDLA 1YIJ3 3NHXA 4LZIA 2C10A 3V92A 1ULIB 4HZ9B 1Q7Y4 3NM7A 1N8R4 1JRQA 1TFOA 2OOVA 2F98A 4R9LA 3CCM3 5LC7A 4N6UA 3LTDA 3NXJA 1VQ93 1K41A 1M904 1O7WB 3Q2PA 2W9PA 5IG3A 2P0MA 3B8LA 4HBRA 1G96A 4BTXA 2SBLA 2ML5A 2RCDA 1DVDA 1TUHA 3K7CA 3EE1A 2XR8B 3DM8A 4GB5A 4FMDA 3F7SA 3HX8A 4EYCA 2GU3A 3VSYA 2YX9A 1NJI4 1OUNA 1YJN3 3B4OA 3WDGB 3EQQB 1SJWA 2Q07A 3OV4A 3CC73 2OTJ3 2OCTA 3MG3A 5IENA 3X41A 5A0OB 5BVBA 4RBNA 2A15A 1OHOA 1YHQ3 4I4KA 3T8UA 1VZZA 3AMOA 3IJEB 5AEUB 4ORLA 1LXEA 4N6OB 2W56B 2CWUA 3GAXA 3SVAA 3WOEB 3OWYA 3V99A 1FUWA 2WGOA 1VQ73 2WO0A 1E97A 3O8YA 1RRHA 1OGXA 3NUVA 3N8BA 3EBTA 3KSPA 3U1WA 3FKAA 4HM0B 5IG4A 6STDA 1IV7A 2I9WA 3ALAA 4J9AA 2D1WA 1O7GB 2QEX3 1W2B2 4IIAA 1HKXA 5TGNA 4XDVA 1MNLA 3JUOA 5AIHA 1IK3A 3MG1A 3MWZA 3NQYA 3FGYA 3BNBA 3JUMA 1Q42A 5KP4A 1TU5A 3WA3A 1N8QA 2IMJA 1BUQA 1O7PB 3EX9A 1AV4A 1W6YA 3WA2X 4BTYA 2GBXB 2CK3H 4HM5B 5AYRB 3HZPA 1QAFA 4EC6A 4HM7B 1IQ8A 3DGMA 4O2HA 1YJ93 3I553 3AMOB 3GZXB 2GXFA 3GZRA 2RSXA 2Y73A 5D82A 1Q824 1IU7A 1OHSA 1OPYA 2E2UA 3X3ZA 3PGBA 3N9HA 3CU3A 1KD14 4X2HA 1ASKA 3MPHA 1NWWA 3SOAA 3NQZA 3OWSA 3NV0A 4XB5A 1DMMA 3S28A 4EXRA 1PU4A 4L7KA 3LOYA 3FH1A 4OUQA 3NM2A 2IUJA 4HM1B 5JPUA 3QK9A 3FF2A 1QAKA 7STDA 3FCSB 1TP6A 3H51A 3GZYB 3LTAA 1K8A4 2CW9A 2XGNA 1IV9A 5D83A 1KSIA 2MF7A 4G1MB 3KSED 3GZBA 3STDA 3UB1A 3CPW2 1A67A 2W9QA 4HM4B 5JPPA 1GY5A 1VQ43 3FF0A 1JJ22 2OWPA 3EBYA 1GY6A 1OCVA 1K9M4 3X3YA 1Y4KA 4XBTA 2HMOB 1OGZA 3F8XA 1VQO3 4LMIA 3A76A 5JBSA 5KP1A 2CFDA 4R4KA 2LYXA 4X2OA 4U13A 1VQ63 2YFLB 2P38A 4J8TA 3NV0B 3NBRA 4WHAA 4N3VA 1VQN3 3FZWA 1W2ZA 1T5YA 3G6E3 4R9KA 3EF8A 2KRTA 3ER7A 2XRXB 1US1A 2XEPA 1N5PA 1UI7A 3G0KA 3CPOA 2E2VA 3PS8A 1WMOA 3B4PA 1WNHA 3WODG 1L5GB 5IERA 1W02A 3CCE3 2QA43 3EN1B 2V1LA 3V98A 1ISKA 3MSOA 4H3UA 3M8CA 3HI7A 1JV2B 4AKZA 4QWTA 1KC84 2Z77A 5CLKA 3MG2A 2B24B 2XH9A 3S5CA 2K54A 1S723 2CFKA 4HVNA 1QJGA 1GY7A 4WP5A 3TDGA 1TIJA 1ZX2A 2CFWA 3JUNA 3QRDA 1QMAA 2STDA 3H3HA 3SX1A 2F99A 1M9GA 4HJLB 3PCRA 2Y74A 3F8HA 2M7OA 1VQ53 1A2VA 2PZVA 2F86B 3RGRA 3X42A 2MC8A 1KQS2 1IVWA 4PEJA 5FW5A 1RRLA 3NBBA 2Z76A 4R80A 4HM8B 3FG1A 2HMLB 1IQXA 3KKGA 5EQLA 1V74A 4O02B 5EEOA 1JB5A 3Q90A 3DZLA 1R4CA 5AYSC 1O7NB 1QALA 3SEDA 1JB2A 3EHCA 2QGUA 2FNQA 3DGNA 3HIIA 1QVF2 2OQEC 5AIFA 5FGOA 3RDEA 4KFEA 3MYTA 3PZWA 3CNMA 3NX0A 1PFPA 1D6ZA 3IPTA 3CCS3 1RKYA 2KXGA 1VQM3 1W5ZA 4XDWA 3UL5A 3JUPA 2QIYA 2FGTA 2P0XA 5AI1A 3DY5A 1S5AA 4K61A 4KFFA 1W6CA 5CK6A 3EB8A 3BB9A 3CCQ3 2GBWB 1Q814 2CFGA 3UJMA 2D42A 4NHFA 1UI8A 2XFTA 1YIT3 5AEWB 1FGMA 1GS3A 3Q1CA 3T0UA 1F8NA 1QVG2 4HM2B 5ELJA 3BNDA 1ZO2A 1NB5I 2BHMA 2O9UX 1C7HA 1UUWB 1EQKA 1GYBA 3FSDA 3JVCA 1N9JA 3F9SA 2ML6A 3FG3A 5IG0A 1GD4A 1Q40A 4OVMA 5LC6A 4WFOA 2Z6BA 2RGQA 4MJDA 3BLZA 5CF1A 3BNEA 4FCJA 1CYVA 4MMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWR A;  2BMO B;  1Z1S A;  2RFR A;  2GEX A;  4L8O A;  3E99 A;  1WQL B;  1EA2 A;  4HM6 B;  8CHO A;  1EG9 B;  2HMM B;  3LYG A;  3LZA A;  4L8P A;  3CNX A;  3F40 A;  1E3V A;  1O7H B;  5D81 A;  2R4I A;  3MHE A;  5AII A;  1DMN A;  3EJV A;  2JQ5 A;  4LEH A;  1Q40 B;  2YFI B;  2HMK B;  1ULJ B;  2Z7A A;  4HKV B;  4Q53 A;  5DRE A;  3JUQ A;  3OX9 A;  1W00 A;  3OWU A;  3G8Z A;  3FLJ A;  3GRD A;  2HMN B;  3ROB A;  5CF2 A;  2HMJ B;  3DUK A;  3DXO A;  1CQS A;  2XSO B;  5IG5 A;  3DMC A;  4HM3 B;  3KE7 A;  4WYK B;  1A2K A;  3F7X A;  1JN5 A;  3EN8 A;  1OF5 A;  1W01 A;  2INX A;  3T8N A;  2W2C A;  3VGN A;  5IEO A;  3KZT A;  2BNG A;  2YFJ B;  3K0Z A;  4RZM A;  3B7C A;  1JKG A;  5AIG A;  5IF6 A;  1UUV B;  4R1K A;  3SOY A;  2GEY A;  3EC9 A;  5KP3 A;  5DRV A;  3G16 A;  2XSH B;  3HK4 A;  4K1V A;  1JN5 B;  1OF5 B;  2BMR B;  3I0Y A;  4FCM A;  3ECF A;  2B1X B;  2CKF B;  2CHC A;  1DMQ A;  3OXA A;  4WWU C;  2BMQ B;  1OHP A;  4XBX A;  4K1U A;  1IDP A;  3UNL A;  5BXQ A;  1JKG B;  4KVH A;  3MKI A;  1NU3 A;  1O7M B;  5G2G A;  3F14 A;  4STD A;  1JB4 A;  5STD A;  1OH0 A;  1E3R A;  4XM4 A;  4WYK A;  5IEP A;  4HZB B;  4LGQ A;  1STD A;  1NDO B;  4XBY A;  3RGA A;  1U5O A;  2UX0 A;  5CXO A;  5HGR A;  3WMD A;  3D9R A;  1AR0 A;  4CDL A;  3NHX A;  1ULI B;  4HZ9 B;  2F98 A;  4R9L A;  3NXJ A;  1K41 A;  1O7W B;  5IG3 A;  3B8L A;  2RCD A;  1TUH A;  3K7C A;  2XR8 B;  3DM8 A;  4GB5 A;  3F7S A;  3HX8 A;  3VSY A;  1OUN A;  3B4O A;  3EQQ B;  1SJW A;  3OV4 A;  3MG3 A;  5IEN A;  5BVB A;  2A15 A;  1OHO A;  4I4K A;  3T8U A;  1VZZ A;  5AEU B;  4ORL A;  3OWY A;  1E97 A;  1OGX A;  3NUV A;  3EBT A;  3KSP A;  3FKA A;  4HM0 B;  5IG4 A;  6STD A;  2I9W A;  4J9A A;  1O7G B;  4IIA A;  1HKX A;  5TGN A;  4XDV A;  3JUO A;  5AIH A;  3MG1 A;  3FGY A;  3JUM A;  1Q42 A;  5KP4 A;  2IMJ A;  1BUQ A;  1O7P B;  3EX9 A;  1W6Y A;  2GBX B;  4HM5 B;  3HZP A;  4HM7 B;  3GZX B;  2GXF A;  3GZR A;  5D82 A;  1OHS A;  1OPY A;  3CU3 A;  4X2H A;  1ASK A;  1NWW A;  3SOA A;  3OWS A;  3NV0 A;  4XB5 A;  1DMM A;  4L7K A;  3FH1 A;  4OUQ A;  3NM2 A;  4HM1 B;  5JPU A;  3FF2 A;  7STD A;  1TP6 A;  3H51 A;  3GZY B;  5D83 A;  3GZB A;  3STD A;  4HM4 B;  5JPP A;  1GY5 A;  3FF0 A;  2OWP A;  3EBY A;  1GY6 A;  1OCV A;  4XBT A;  2HMO B;  1OGZ A;  3F8X A;  4LMI A;  3A76 A;  5KP1 A;  4X2O A;  4U13 A;  2YFL B;  4J8T A;  3NV0 B;  3NBR A;  4N3V A;  3FZW A;  4R9K A;  3EF8 A;  3ER7 A;  2XRX B;  3G0K A;  3CPO A;  3B4P A;  5IER A;  1W02 A;  3EN1 B;  1ISK A;  3MSO A;  4H3U A;  3M8C A;  2Z77 A;  5CLK A;  3MG2 A;  2B24 B;  3S5C A;  2K54 A;  4HVN A;  1QJG A;  1GY7 A;  4WP5 A;  1ZX2 A;  3JUN A;  1QMA A;  2STD A;  3H3H A;  2F99 A;  4HJL B;  3F8H A;  2PZV A;  2F86 B;  3RGR A;  4PEJ A;  5FW5 A;  2Z76 A;  4HM8 B;  2HML B;  3KKG A;  1JB5 A;  3Q90 A;  3DZL A;  1O7N B;  3SED A;  1JB2 A;  3EHC A;  2QGU A;  5AIF A;  3MYT A;  3CNM A;  3IPT A;  4XDW A;  3JUP A;  2QIY A;  5AI1 A;  1S5A A;  5CK6 A;  3BB9 A;  2GBW B;  3UJM A;  5AEW B;  1GS3 A;  4HM2 B;  1ZO2 A;  1C7H A;  1UUW B;  1GYB A;  3FSD A;  3F9S A;  5IG0 A;  1Q40 A;  4OVM A;  2RGQ A;  4MJD A;  3BLZ A;  5CF1 A;  4FCJ A;  5EVH A; 
#chains in the Genus database with same CATH topology
 2IA7 A;  2W6J H;  1FGR A;  2BMO B;  3GWR A;  4RNZ A;  2OOV C;  3LTB A;  1D6U A;  1I70 A;  1Q7H A;  1BUJ A;  1Z1S A;  2RFR A;  3LTC A;  1N9E A;  2WOF A;  2GEX A;  3CCL 3;  4GSP A;  3CC2 3;  4L8O A;  1YI2 3;  3OW2 2;  2CFL A;  3A5E A;  3E99 A;  2RNT A;  1AVL A;  2F5W A;  1TRQ A;  1IYY A;  1WQL B;  2H0H A;  1KWI A;  3KN4 A;  4EV2 A;  2WOH A;  1EA2 A;  2IYJ A;  4HM6 B;  1SPU A;  8CHO A;  1EG9 B;  4ZM8 A;  3PCS A;  1GOY A;  2HMM B;  1VQK 3;  3LYG A;  1RJO A;  3LZA A;  4L8P A;  3CNX A;  3WOF B;  3F40 A;  4AEQ A;  1BRG A;  1E3V A;  3K9M C;  1O7H B;  1UW1 A;  5D81 A;  3S27 A;  2R4I A;  1NB3 I;  4EBG A;  1FGT A;  1D6Y A;  1FUS A;  3MHE A;  2CH9 A;  2C4B A;  1VQL 3;  5AII A;  1B2X A;  1BGS A;  1MWT A;  1LVN A;  1R4Y A;  1IVV A;  2KCD A;  1DMN A;  2E2T A;  3NBJ A;  2F4Y A;  4J5K A;  1I3F A;  3EJV A;  2JQ5 A;  4LEH A;  2ZDJ A;  3KFQ C;  4JRF A;  1WMP A;  1Q40 B;  4KZ1 A;  3N54 B;  2BT3 A;  2YFI B;  1Q9E A;  2HMK B;  1ULJ B;  1WTH A;  2Z7A A;  4HKV B;  3AGO A;  4N6L A;  4Q53 A;  3LH4 A;  5DRE A;  2ZL8 A;  1W4N A;  1MGR A;  1BSB A;  5HOH A;  2CWT A;  3SLU A;  3JUQ A;  1LOX A;  2PNC A;  3OX9 A;  1RGF A;  2CIU A;  1W00 A;  3OWU A;  3G8Z A;  1HZ1 A;  3FLJ A;  3GRD A;  4FCZ A;  2HMN B;  3ROB A;  1CYU A;  5CF2 A;  1GD3 A;  2HMJ B;  1CEW I;  1RMS A;  3DUK A;  1BNI A;  3DXO A;  1CQS A;  3SXX A;  2IUK A;  1SIH A;  2XSO B;  4JF8 A;  4I5Q A;  3DMC A;  4HM3 B;  4DKI A;  1ROV A;  4IPB A;  5IG5 A;  1FGO A;  1DE3 A;  1BSE A;  1RGC A;  3KE7 A;  4WYK B;  1A2K A;  2KF3 A;  3ZG5 A;  1BAN A;  3UL6 A;  1BNG A;  2F56 A;  1WMN A;  3F7X A;  1K73 4;  4FMA A;  1JN5 A;  1RNT A;  3EN8 A;  1BIR A;  1OF5 A;  3AHW A;  2CC3 A;  1M1X B;  4N6N B;  1W01 A;  2INX A;  1JZD A;  1NNV A;  1SII A;  1YGE A;  8RNT A;  3CCV 3;  3D5G A;  3T8N A;  1B2S A;  2JDI H;  3G71 3;  2W2C A;  1BU4 A;  3I56 3;  1RHL A;  3VGN A;  2LQV A;  1RTU A;  2O3O A;  5IEO A;  3KZT A;  2BNG A;  1BOX A;  5BIR A;  1VQP 3;  3KII A;  2YFJ B;  1UUG B;  1YNV X;  1K28 A;  3S67 A;  1NO3 A;  1RN7 A;  5M1A A;  1B2M A;  3K0Z A;  4EW5 A;  2WGQ A;  1B3S A;  4RZM A;  3B7C A;  3CCU 3;  1LNH A;  1JKG A;  2CG0 A;  2UGI A;  4HYZ A;  2CG1 A;  4O8S A;  5AIG A;  3K63 A;  1IQY A;  4RNY A;  2XGL A;  2W04 A;  4NRE A;  1YJW 3;  4O3V A;  1JNQ A;  3BIR A;  3PYJ A;  5IF6 A;  1UUV B;  1RGH A;  2GSP A;  5I97 A;  1A90 A;  1VQ8 3;  1IVU A;  1UCL A;  4R1K A;  1W7C A;  1A2P A;  4FMB A;  3D3L A;  4LSO A;  4N6V 0;  2GEY A;  3SOY A;  4HAA A;  4J5G A;  3CMA 3;  3EC9 A;  5KP3 A;  5RNT A;  5DRV A;  1YVB I;  3G16 A;  2XSH B;  1N5H A;  1RGA A;  2W0Q A;  3LT9 A;  4IT7 A;  1AQZ A;  3HK4 A;  4K1V A;  1MWR A;  1X1U A;  1HYF A;  1JN5 B;  1DYU A;  3LXU X;  4AKY A;  1OF5 B;  1RSN A;  1EKM A;  2XF3 A;  1RDS A;  2BMR B;  3D5I A;  3I0Y A;  4FCM A;  1IT7 A;  3ECF A;  2B1X B;  2CKF B;  3CD6 3;  2W03 A;  2CHC A;  1RNB A;  2H0G A;  1DMQ A;  3PXM A;  3OXA A;  3VF1 A;  4WWU C;  2GU1 A;  3CCR 3;  1LRA A;  2BMQ B;  4CCV A;  3X3X A;  1OHP A;  3DGO A;  2C11 A;  2XFS A;  4XBX A;  4K1U A;  2FXT A;  3CME 3;  1AVK A;  1IDP A;  1RGL A;  1YGW A;  1EUI C;  3UNL A;  5EVH A;  2OQE A;  3X40 A;  5BXQ A;  1DVC A;  1JKG B;  3DGL A;  4K90 B;  4KVH A;  1FA3 A;  1V57 A;  2P09 A;  1B2Z A;  1MOL A;  1NU3 A;  1O7M B;  3MKI A;  3BNC A;  2KF4 A;  5G2G A;  1STF I;  1TFK A;  3K5T A;  3G4S 3;  4GL6 A;  3F14 A;  3IMA B;  1JB4 A;  2K0M A;  1SQW A;  4FR9 A;  1HU9 A;  4STD A;  1DET A;  1ROA A;  1W6G A;  5G1K A;  1IVX A;  2L1S A;  1LQM B;  5STD A;  1OH0 A;  4BU4 A;  1Q86 4;  1M1K 4;  4KT3 B;  1E3R A;  4XM4 A;  2R41 A;  4MMY B;  4OK0 A;  3SYU A;  4WYK A;  4MEI A;  1I0X A;  4MMX B;  1BRK A;  3CC4 3;  1FZU A;  5IEP A;  3L0R A;  4HZB B;  4LGQ A;  1STD A;  1U8C B;  1FGQ A;  4N6M A;  5IW9 A;  2OTL 3;  2CWV A;  1OAC A;  1IT8 A;  4H61 A;  4TX4 A;  3ZFZ A;  1BRS A;  3HIG A;  2BO9 B;  3CCJ 3;  4KFD A;  3J7Y d;  3LT8 A;  1NDO B;  4N6T A;  4XBY A;  3FG4 A;  4ILF A;  2RBI A;  3RGA A;  4FMC A;  1U5O A;  3BU4 A;  2UX0 A;  2L4V A;  2P05 A;  5CXO A;  5ELU A;  5HGR A;  3WMD A;  3D9R A;  3CXC 2;  1AR0 A;  3S29 A;  4BTW A;  3LML A;  1J2B A;  1BSC A;  1X1Y A;  3U97 A;  2W56 A;  4CDL A;  1YIJ 3;  3NHX A;  4LZI A;  1BVI A;  2C10 A;  1ULI B;  4HZ9 B;  3V92 A;  1Q7Y 4;  3NM7 A;  1N8R 4;  1JRQ A;  1TFO A;  2OOV A;  2F98 A;  4R9L A;  3CCM 3;  5LC7 A;  1T2I A;  4N6U A;  2HOH A;  2CX0 A;  5GSP A;  1PY3 A;  3LTD A;  3NXJ A;  1BRI A;  1K41 A;  1VQ9 3;  1M90 4;  1O7W B;  3Q2P A;  2W9P A;  1G0T A;  2P0M A;  3B8L A;  4BL2 A;  5IG3 A;  4HBR A;  1G96 A;  4BTX A;  2SBL A;  2ML5 A;  2RCD A;  1DVD A;  1TUH A;  3K7C A;  1C54 A;  3EE1 A;  2XR8 B;  3DM8 A;  4GB5 A;  4FMD A;  4RNT A;  3F7S A;  3HX8 A;  4EYC A;  2GU3 A;  3VSY A;  3RNT A;  1BSA A;  2YX9 A;  1NJI 4;  1OUN A;  1YJN 3;  3B4O A;  3WDG B;  3EQQ B;  1SJW A;  2Q07 A;  3HOH A;  3GSP A;  2SAR A;  3OV4 A;  3CC7 3;  2OTJ 3;  7RNT A;  3D4A A;  1I2E A;  2OCT A;  2CX1 A;  3MG3 A;  5IEN A;  1T2H A;  3X41 A;  4CJN A;  5A0O B;  5BVB A;  4RBN A;  2A15 A;  1OHO A;  1YHQ 3;  1FW7 A;  9RNT A;  4I4K A;  3T8U A;  1G02 A;  1VZZ A;  1X1W A;  3AMO A;  3IJE B;  2UUG C;  3ZG0 A;  5AEU B;  1GOU A;  1LXE A;  4N6O B;  4ORL A;  1TJD A;  2W56 B;  2CWU A;  3GAX A;  3SVA A;  3WOE B;  3OWY A;  3V99 A;  1FUW A;  2WGO A;  1VQ7 3;  2WO0 A;  1E97 A;  3O8Y A;  1RRH A;  1T3B A;  3WHO A;  1OGX A;  3NUV A;  3N8B A;  3EBT A;  3KSP A;  3U1W A;  3FKA A;  4HM0 B;  1PYL A;  5IG4 A;  6STD A;  1IV7 A;  2I9W A;  3ALA A;  1BSD A;  4J9A A;  3DH2 A;  2D1W A;  1O7G B;  4BIR A;  1MWU A;  2QEX 3;  1W2B 2;  4IIA A;  1HKX A;  1BNE A;  5TGN A;  1I2F A;  4XDV A;  1BRJ A;  1MNL A;  3JUO A;  1RGK A;  5AIH A;  1BNF A;  1IK3 A;  3MG1 A;  3MWZ A;  3NQY A;  3FGY A;  3BNB A;  1I0V A;  1Q42 A;  3JUM A;  5KP4 A;  1TU5 A;  1MGW A;  3WA3 A;  1N8Q A;  2IMJ A;  2ZHX B;  1O7P B;  3EX9 A;  1BUQ A;  1AV4 A;  1W6Y A;  3WA2 X;  4BTY A;  2GBX B;  2CK3 H;  1BNR A;  4HM5 B;  5AYR B;  1LOY A;  3HZP A;  1QAF A;  4EC6 A;  1BRH A;  1UGI A;  4HM7 B;  1IQ8 A;  3DGM A;  4NPB A;  4O2H A;  3I55 3;  5M18 A;  3AMO B;  1YJ9 3;  3GZX B;  2GXF A;  3GZR A;  2RSX A;  2Y73 A;  5D82 A;  1Q82 4;  1IU7 A;  1OHS A;  1OPY A;  2E2U A;  2KF6 A;  3X3Z A;  1TTO A;  3PGB A;  3N9H A;  3CU3 A;  1KD1 4;  1BNS A;  2BIR A;  4X2H A;  1ASK A;  1CH0 A;  3MPH A;  1NWW A;  3SOA A;  3NQZ A;  3OWS A;  3NV0 A;  4XB5 A;  1DMM A;  1BRN L;  3S28 A;  4EXR A;  1PU4 A;  4L7K A;  3LOY A;  1AY7 A;  3FH1 A;  4OUQ A;  3NM2 A;  2IUJ A;  2AAD A;  4HM1 B;  5JPU A;  3QK9 A;  1MWS A;  1QAK A;  1RLS A;  3FF2 A;  7STD A;  3FCS B;  3WR2 A;  1TP6 A;  3H51 A;  3GZY B;  3LTA A;  1K8A 4;  2CW9 A;  3KCH A;  3AHS A;  2XGN A;  1IV9 A;  5D83 A;  1KSI A;  2MF7 A;  1RGE A;  3KSE D;  3GZB A;  4G1M B;  3STD A;  3UB1 A;  3CPW 2;  1A67 A;  2W9Q A;  4HM4 B;  5JPP A;  1GY5 A;  1VQ4 3;  3D79 A;  3FF0 A;  1JJ2 2;  1JBT A;  2OWP A;  1B21 A;  1GMR A;  3EBY A;  5BU4 A;  1GY6 A;  1OCV A;  1K9M 4;  3DGY A;  3X3Y A;  1Y4K A;  4XBT A;  2HMO B;  1OGZ A;  3F8X A;  1VQO 3;  4LMI A;  1GMQ A;  1RGG A;  1I2G A;  3A76 A;  5JBS A;  1X1X A;  4GHO A;  5KP1 A;  2CFD A;  6GSP A;  1UGH I;  4R4K A;  2LYX A;  1RCL A;  1ZS7 A;  1B20 A;  4X2O A;  5G1L A;  4U13 A;  1VQ6 3;  2P38 A;  2YFL B;  4J8T A;  3NV0 B;  3NBR A;  4WHA A;  4N3V A;  4EV5 A;  1VQN 3;  3FZW A;  1W2Z A;  1T5Y A;  3G6E 3;  4R9K A;  3EF8 A;  2KRT A;  3ER7 A;  2XRX B;  1US1 A;  2IY2 A;  1I8V A;  2XEP A;  1N5P A;  1UI7 A;  3G0K A;  3CPO A;  2E2V A;  3PS8 A;  1WMO A;  3AGN A;  3B4P A;  1WNH A;  3WOD G;  1L5G B;  5IER A;  1W02 A;  3CCE 3;  2QA4 3;  3EN1 B;  2V1L A;  3V98 A;  1ISK A;  1FUT A;  3MSO A;  3URP A;  4H3U A;  1ZGX A;  3M8C A;  1YVS A;  1UDI I;  3HI7 A;  1JV2 B;  4AKZ A;  4QWT A;  1KC8 4;  2Z77 A;  2K3D A;  5CLK A;  6RNT A;  3MG2 A;  2B24 B;  2XH9 A;  4HOH A;  3S5C A;  2K54 A;  1S72 3;  2BU4 A;  4LYL B;  2CFK A;  4HVN A;  1QJG A;  1EEJ A;  1V58 A;  1GMP A;  1GY7 A;  4WP5 A;  3TDG A;  1TIJ A;  1ZX2 A;  2CFW A;  3JUN A;  3QRD A;  1B2U A;  1LQG C;  1QMA A;  2STD A;  1SAR A;  2KAA A;  1VQQ A;  3H3H A;  3SX1 A;  2F99 A;  1M9G A;  4HJL B;  3PCR A;  2Y74 A;  3F8H A;  2M7O A;  7GSP A;  1GOV A;  1VQ5 3;  1A2V A;  2PZV A;  2F86 B;  3RGR A;  3X42 A;  2KF5 A;  4CPK A;  2MC8 A;  1KQS 2;  1IVW A;  1RN1 A;  4PEJ A;  5FW5 A;  1RRL A;  2H0I A;  1BAO A;  3NBB A;  2Z76 A;  4R80 A;  4HM8 B;  3FG1 A;  2HML B;  1BNJ A;  1IQX A;  3KKG A;  5EQL A;  1V74 A;  4O02 B;  5EEO A;  1FYS A;  1JB5 A;  3Q90 A;  3DZL A;  1R4C A;  1GSP A;  5AYS C;  1UCJ A;  1O7N B;  1LOV A;  1I3I A;  1QAL A;  1UCI A;  1JB2 A;  3SED A;  1TRP A;  3EHC A;  2QGU A;  2FNQ A;  1RN4 A;  3DGN A;  3HII A;  1QVF 2;  2OQE C;  5AIF A;  5FGO A;  3RDE A;  4KFE A;  3MYT A;  3PZW A;  3CNM A;  3NX0 A;  1PFP A;  2J8X B;  1D6Z A;  3IPT A;  1JZO A;  3CCS 3;  1RKY A;  2KXG A;  2ZA4 A;  1VQM 3;  1W5Z A;  4XDW A;  3UL5 A;  3JUP A;  1RCK A;  2QIY A;  2FGT A;  2P0X A;  5AI1 A;  4BL3 A;  3DY5 A;  1S5A A;  1UCK A;  4K61 A;  1W6C A;  4KFF A;  3EB8 A;  5CK6 A;  3BB9 A;  3CCQ 3;  2GBW B;  1Q81 4;  2CFG A;  3UJM A;  2D42 A;  1LOW A;  4NHF A;  1UI8 A;  2XFT A;  1JBS A;  1YIT 3;  5AEW B;  1FGM A;  1GS3 A;  3Q1C A;  3Q3F A;  3T0U A;  1F8N A;  1QVG 2;  4HM2 B;  1B27 A;  5ELJ A;  3BND A;  1ZO2 A;  1NB5 I;  2BHM A;  2O9U X;  1C7H A;  1UUW B;  1EQK A;  1GYB A;  3FSD A;  3JVC A;  1N9J A;  2AAE A;  3F9S A;  2ML6 A;  3FG3 A;  5IG0 A;  1GD4 A;  1Q40 A;  2F5M A;  4OVM A;  5LC6 A;  4WFO A;  1LNI A;  2Z6B A;  1JBR A;  2RGQ A;  4MJD A;  3BLZ A;  5CF1 A;  3BNE A;  4FCJ A;  1CYV A;  5M19 A;  4MMZ B; 
#chains in the Genus database with same CATH homology
 2IA7 A;  2W6J H;  1FGR A;  2BMO B;  3GWR A;  4RNZ A;  2OOV C;  3LTB A;  1D6U A;  1Z1S A;  2RFR A;  3LTC A;  1N9E A;  2WOF A;  2GEX A;  3CCL 3;  3CC2 3;  4L8O A;  1YI2 3;  3OW2 2;  2CFL A;  3E99 A;  1AVL A;  1WQL B;  1KWI A;  3KN4 A;  4EV2 A;  2WOH A;  1EA2 A;  4HM6 B;  1SPU A;  8CHO A;  1EG9 B;  4ZM8 A;  3PCS A;  2HMM B;  1VQK 3;  3LYG A;  1RJO A;  3LZA A;  4L8P A;  3CNX A;  3WOF B;  3F40 A;  4AEQ A;  1E3V A;  3K9M C;  1O7H B;  1UW1 A;  5D81 A;  3S27 A;  2R4I A;  1NB3 I;  4EBG A;  1FGT A;  1D6Y A;  3MHE A;  2CH9 A;  1VQL 3;  5AII A;  1LVN A;  1IVV A;  2KCD A;  1DMN A;  2E2T A;  3NBJ A;  3EJV A;  2JQ5 A;  4LEH A;  2ZDJ A;  3KFQ C;  4JRF A;  1WMP A;  1Q40 B;  4KZ1 A;  3N54 B;  2BT3 A;  2YFI B;  2HMK B;  1ULJ B;  1WTH A;  2Z7A A;  4HKV B;  4N6L A;  4Q53 A;  3LH4 A;  5DRE A;  2ZL8 A;  1W4N A;  2CWT A;  3SLU A;  3JUQ A;  1LOX A;  2PNC A;  3OX9 A;  2CIU A;  1W00 A;  3OWU A;  3G8Z A;  3FLJ A;  3GRD A;  4FCZ A;  2HMN B;  3ROB A;  1CYU A;  5CF2 A;  1GD3 A;  2HMJ B;  1CEW I;  3DUK A;  3DXO A;  1CQS A;  3SXX A;  2IUK A;  1SIH A;  2XSO B;  4JF8 A;  5IG5 A;  3DMC A;  4HM3 B;  1ROV A;  4IPB A;  1FGO A;  3KE7 A;  4WYK B;  1A2K A;  3UL6 A;  1WMN A;  3F7X A;  1K73 4;  4FMA A;  1JN5 A;  3EN8 A;  1OF5 A;  2CC3 A;  1M1X B;  4N6N B;  1W01 A;  2INX A;  3CCV 3;  1YGE A;  1SII A;  3T8N A;  2JDI H;  3G71 3;  2W2C A;  3I56 3;  3VGN A;  2LQV A;  2O3O A;  5IEO A;  3KZT A;  2BNG A;  1VQP 3;  3KII A;  2YFJ B;  1K28 A;  3S67 A;  1NO3 A;  1RN7 A;  3K0Z A;  2WGQ A;  4RZM A;  3B7C A;  3CCU 3;  1LNH A;  1JKG A;  2CG0 A;  4HYZ A;  2CG1 A;  4O8S A;  5AIG A;  3K63 A;  1IQY A;  4RNY A;  2XGL A;  2W04 A;  4NRE A;  1YJW 3;  4O3V A;  1JNQ A;  3PYJ A;  5IF6 A;  1UUV B;  5I97 A;  1A90 A;  1VQ8 3;  1IVU A;  4R1K A;  1W7C A;  4FMB A;  4LSO A;  3D3L A;  4N6V 0;  3SOY A;  2GEY A;  3CMA 3;  3EC9 A;  5KP3 A;  5DRV A;  1YVB I;  3G16 A;  2XSH B;  1N5H A;  2W0Q A;  3LT9 A;  4IT7 A;  3HK4 A;  4K1V A;  1JN5 B;  1DYU A;  3LXU X;  4AKY A;  1OF5 B;  1EKM A;  2XF3 A;  2BMR B;  3I0Y A;  4FCM A;  1IT7 A;  3ECF A;  2B1X B;  2CKF B;  3CD6 3;  2W03 A;  2CHC A;  3PXM A;  1DMQ A;  3OXA A;  3VF1 A;  4WWU C;  2GU1 A;  3CCR 3;  2BMQ B;  4CCV A;  3X3X A;  1OHP A;  3DGO A;  2C11 A;  2XFS A;  4XBX A;  4K1U A;  2FXT A;  3CME 3;  1AVK A;  1IDP A;  3UNL A;  5EVH A;  2OQE A;  3X40 A;  5BXQ A;  1DVC A;  1JKG B;  3DGL A;  4K90 B;  4KVH A;  1FA3 A;  2P09 A;  3MKI A;  1MOL A;  1NU3 A;  1O7M B;  3BNC A;  5G2G A;  1STF I;  1TFK A;  3K5T A;  3G4S 3;  4GL6 A;  3F14 A;  3IMA B;  1JB4 A;  2K0M A;  1SQW A;  4FR9 A;  1HU9 A;  4STD A;  1W6G A;  1ROA A;  4EV5 A;  1IVX A;  5STD A;  1OH0 A;  1Q86 4;  1M1K 4;  1E3R A;  4XM4 A;  4MMY B;  4OK0 A;  4WYK A;  4MEI A;  4MMX B;  3CC4 3;  5IEP A;  3L0R A;  4HZB B;  4LGQ A;  1STD A;  1U8C B;  1FGQ A;  4N6M A;  5IW9 A;  2OTL 3;  2CWV A;  1OAC A;  1IT8 A;  4H61 A;  4TX4 A;  3HIG A;  2BO9 B;  3CCJ 3;  4KFD A;  3J7Y d;  3LT8 A;  1NDO B;  4N6T A;  4XBY A;  3FG4 A;  3RGA A;  4FMC A;  1U5O A;  2UX0 A;  2L4V A;  2P05 A;  5CXO A;  5ELU A;  5HGR A;  3WMD A;  3D9R A;  3CXC 2;  1AR0 A;  3S29 A;  4BTW A;  3LML A;  1J2B A;  3U97 A;  2W56 A;  4CDL A;  1YIJ 3;  3NHX A;  4LZI A;  2C10 A;  3V92 A;  1ULI B;  4HZ9 B;  1Q7Y 4;  3NM7 A;  1N8R 4;  1JRQ A;  1TFO A;  2OOV A;  2F98 A;  4R9L A;  3CCM 3;  5LC7 A;  4N6U A;  3LTD A;  3NXJ A;  1VQ9 3;  1K41 A;  1M90 4;  1O7W B;  3Q2P A;  2W9P A;  5IG3 A;  2P0M A;  3B8L A;  4HBR A;  1G96 A;  4BTX A;  2SBL A;  2ML5 A;  2RCD A;  1DVD A;  1TUH A;  3K7C A;  3EE1 A;  2XR8 B;  3DM8 A;  4GB5 A;  4FMD A;  3F7S A;  3HX8 A;  4EYC A;  2GU3 A;  3VSY A;  2YX9 A;  1NJI 4;  1OUN A;  1YJN 3;  3B4O A;  3WDG B;  3EQQ B;  1SJW A;  2Q07 A;  3OV4 A;  3CC7 3;  2OTJ 3;  2OCT A;  3MG3 A;  5IEN A;  3X41 A;  5A0O B;  5BVB A;  4RBN A;  2A15 A;  1OHO A;  1YHQ 3;  4I4K A;  3T8U A;  1VZZ A;  3AMO A;  3IJE B;  5AEU B;  4ORL A;  1LXE A;  4N6O B;  2W56 B;  2CWU A;  3GAX A;  3SVA A;  3WOE B;  3OWY A;  3V99 A;  1FUW A;  2WGO A;  1VQ7 3;  2WO0 A;  1E97 A;  3O8Y A;  1RRH A;  1OGX A;  3NUV A;  3N8B A;  3EBT A;  3KSP A;  3U1W A;  3FKA A;  4HM0 B;  5IG4 A;  6STD A;  1IV7 A;  2I9W A;  3ALA A;  4J9A A;  2D1W A;  1O7G B;  2QEX 3;  1W2B 2;  4IIA A;  1HKX A;  5TGN A;  4XDV A;  1MNL A;  3JUO A;  5AIH A;  1IK3 A;  3MG1 A;  3MWZ A;  3NQY A;  3FGY A;  3BNB A;  3JUM A;  1Q42 A;  5KP4 A;  1TU5 A;  3WA3 A;  1N8Q A;  2IMJ A;  1BUQ A;  1O7P B;  3EX9 A;  1AV4 A;  1W6Y A;  3WA2 X;  4BTY A;  2GBX B;  2CK3 H;  4HM5 B;  5AYR B;  3HZP A;  1QAF A;  4EC6 A;  4HM7 B;  1IQ8 A;  3DGM A;  4O2H A;  1YJ9 3;  3I55 3;  3AMO B;  3GZX B;  2GXF A;  3GZR A;  2RSX A;  2Y73 A;  5D82 A;  1Q82 4;  1IU7 A;  1OHS A;  1OPY A;  2E2U A;  3X3Z A;  3PGB A;  3N9H A;  3CU3 A;  1KD1 4;  4X2H A;  1ASK A;  3MPH A;  1NWW A;  3SOA A;  3NQZ A;  3OWS A;  3NV0 A;  4XB5 A;  1DMM A;  3S28 A;  4EXR A;  1PU4 A;  4L7K A;  3LOY A;  3FH1 A;  4OUQ A;  3NM2 A;  2IUJ A;  4HM1 B;  5JPU A;  3QK9 A;  3FF2 A;  1QAK A;  7STD A;  3FCS B;  1TP6 A;  3H51 A;  3GZY B;  3LTA A;  1K8A 4;  2CW9 A;  2XGN A;  1IV9 A;  5D83 A;  1KSI A;  2MF7 A;  4G1M B;  3KSE D;  3GZB A;  3STD A;  3UB1 A;  3CPW 2;  1A67 A;  2W9Q A;  4HM4 B;  5JPP A;  1GY5 A;  1VQ4 3;  3FF0 A;  1JJ2 2;  2OWP A;  3EBY A;  1GY6 A;  1OCV A;  1K9M 4;  3X3Y A;  1Y4K A;  4XBT A;  2HMO B;  1OGZ A;  3F8X A;  1VQO 3;  4LMI A;  3A76 A;  5JBS A;  5KP1 A;  2CFD A;  4R4K A;  2LYX A;  4X2O A;  4U13 A;  1VQ6 3;  2YFL B;  2P38 A;  4J8T A;  3NV0 B;  3NBR A;  4WHA A;  4N3V A;  1VQN 3;  3FZW A;  1W2Z A;  1T5Y A;  3G6E 3;  4R9K A;  3EF8 A;  2KRT A;  3ER7 A;  2XRX B;  1US1 A;  2XEP A;  1N5P A;  1UI7 A;  3G0K A;  3CPO A;  2E2V A;  3PS8 A;  1WMO A;  3B4P A;  1WNH A;  3WOD G;  1L5G B;  5IER A;  1W02 A;  3CCE 3;  2QA4 3;  3EN1 B;  2V1L A;  3V98 A;  1ISK A;  3MSO A;  4H3U A;  3M8C A;  3HI7 A;  1JV2 B;  4AKZ A;  4QWT A;  1KC8 4;  2Z77 A;  5CLK A;  3MG2 A;  2B24 B;  2XH9 A;  3S5C A;  2K54 A;  1S72 3;  2CFK A;  4HVN A;  1QJG A;  1GY7 A;  4WP5 A;  3TDG A;  1TIJ A;  1ZX2 A;  2CFW A;  3JUN A;  3QRD A;  1QMA A;  2STD A;  3H3H A;  3SX1 A;  2F99 A;  1M9G A;  4HJL B;  3PCR A;  2Y74 A;  3F8H A;  2M7O A;  1VQ5 3;  1A2V A;  2PZV A;  2F86 B;  3RGR A;  3X42 A;  2MC8 A;  1KQS 2;  1IVW A;  4PEJ A;  5FW5 A;  1RRL A;  3NBB A;  2Z76 A;  4R80 A;  4HM8 B;  3FG1 A;  2HML B;  1IQX A;  3KKG A;  5EQL A;  1V74 A;  4O02 B;  5EEO A;  1JB5 A;  3Q90 A;  3DZL A;  1R4C A;  5AYS C;  1O7N B;  1QAL A;  3SED A;  1JB2 A;  3EHC A;  2QGU A;  2FNQ A;  3DGN A;  3HII A;  1QVF 2;  2OQE C;  5AIF A;  5FGO A;  3RDE A;  4KFE A;  3MYT A;  3PZW A;  3CNM A;  3NX0 A;  1PFP A;  1D6Z A;  3IPT A;  3CCS 3;  1RKY A;  2KXG A;  1VQM 3;  1W5Z A;  4XDW A;  3UL5 A;  3JUP A;  2QIY A;  2FGT A;  2P0X A;  5AI1 A;  3DY5 A;  1S5A A;  4K61 A;  4KFF A;  1W6C A;  5CK6 A;  3EB8 A;  3BB9 A;  3CCQ 3;  2GBW B;  1Q81 4;  2CFG A;  3UJM A;  2D42 A;  4NHF A;  1UI8 A;  2XFT A;  1YIT 3;  5AEW B;  1FGM A;  1GS3 A;  3Q1C A;  3T0U A;  1F8N A;  1QVG 2;  4HM2 B;  5ELJ A;  3BND A;  1ZO2 A;  1NB5 I;  2BHM A;  2O9U X;  1C7H A;  1UUW B;  1EQK A;  1GYB A;  3FSD A;  3JVC A;  1N9J A;  3F9S A;  2ML6 A;  3FG3 A;  5IG0 A;  1GD4 A;  1Q40 A;  4OVM A;  5LC6 A;  4WFO A;  2Z6B A;  2RGQ A;  4MJD A;  3BLZ A;  5CF1 A;  3BNE A;  4FCJ A;  1CYV A;  4MMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...