5IF6A

Structure of a computationally designed 17-ohp binder
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OHP9_1c
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 32
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5if6A00
3BLZA 3M8CA 5STDA 1JB4A 2Z77A 1GY7A 4RZMA 3EX9A 1ZO2A 4HZBB 3EHCA 5IF6A 3FH1A 5AIFA 1GYBA 3LZAA 5G2GA 1AR0A 2F98A 5IG0A 5IG3A 3EF8A 1QJGA 3MG3A 3H51A 8CHOA 5KP3A 1JKGA 3S5CA 4J8TA 4GB5A 1W01A 1JKGB 2Z76A 4HKVB 5IG4A 2RCDA 4MJDA 4Q53A 5EVHA 4LGQA 5IEPA 5HGRA 3UNLA 1ZX2A 1E3VA 5IENA 4HM8B 2HMJB 5D81A 3VGNA 3FZWA 2UX0A 5CK6A 2RFRA 1O7NB 1OUNA 3F8XA 6STDA 3RGAA 5DRVA 4R9KA 4N3VA 1DMMA 3G16A 1SJWA 2YFLB 3NUVA 3Q90A 3G0KA 3EN1B 2B1XB 3B4OA 4LEHA 4WWUC 3IPTA 5KP4A 1K41A 2A15A 4XDWA 2HMOB 1EA2A 3EJVA 3FGYA 4XB5A 1O7PB 2GXFA 2HMKB 1CQSA 3B4PA 3UJMA 1O7MB 3MG2A 5TGNA 3ECFA 1JB5A 4HM3B 1Q42A 3CNMA 3E99A 1C7HA 3NBRA 4OUQA 1OH0A 1NWWA 1OCVA 4XDVA 3SOYA 3RGRA 1JB2A 3B7CA 3EQQB 4J9AA 2GBWB 4HM2B 3EN8A 5FW5A 2INXA 2RGQA 3SEDA 1Q40A 1IDPA 3B8LA 5AIHA 4X2OA 3MKIA 3K7CA 3G8ZA 1Q40B 5CXOA 5AEUB 2QGUA 5CF2A 1ULJB 1EG9B 2GEYA 4HM6B 3A76A 1TP6A 4L8OA 5CF1A 3FF2A 3F8HA 3NXJA 4FCJA 5AI1A 3HK4A 3JUQA 1A2KA 2B24B 3GRDA 5AIGA 4L7KA 5IERA 3GZRA 2XRXB 2GBXB 4XBYA 3MG1A 3MYTA 3MHEA 3HZPA 2YFJB 3OWUA 1GS3A 5DREA 2W2CA 4K1VA 3OWYA 2Z7AA 3ROBA 2BMRB 2PZVA 1OGXA 4HM5B 3JUOA 3MSOA 4H3UA 2HMLB 2R4IA 1E3RA 1GY6A 5JPUA 4HM1B 1S5AA 3HX8A 4HVNA 3OXAA 5D83A 3NV0A 3DMCA 4K1UA 3NV0B 1UUWB 2IMJA 4ORLA 4WYKA 4U13A 2XR8B 2YFIB 4WYKB 3F9SA 3ER7A 4R1KA 5IEOA 2XSHB 2BMOB 3F7SA 4XBXA 3GZYB 1DMQA 2HMNB 2F99A 3EBYA 1UUVB 4STDA 2CHCA 3H3HA 3VSYA 3T8UA 2BNGA 3CPOA 1GY5A 1NDOB 3GWRA 1QMAA 4HJLB 3KE7A 2HMMB 3SOAA 4FCMA 1JN5A 5AIIA 3GZXB 1JN5B 4CDLA 3I0YA 4X2HA 3D9RA 3KSPA 4HM0B 4XBTA 1BUQA 2JQ5A 5AEWB 3FKAA 3FSDA 4L8PA 2OWPA 3T8NA 3JUNA 1W02A 2GEXA 3NHXA 3DXOA 5BVBA 4HM4B 3FLJA 3BB9A 3CU3A 4R9LA 1OPYA 3DUKA 3JUMA 4PEJA 5CLKA 4LMIA 2QIYA 1OGZA 2K54A 3NM2A 3KZTA 4HM7B 1VZZA 1U5OA 5BXQA 3EC9A 3K0ZA 3WMDA 1HKXA 3F14A 4KVHA 3KKGA 3FF0A 3GZBA 2BMQB 1DMNA 2I9WA 3OX9A 4XM4A 3JUPA 2STDA 3LYGA 5D82A 4I4KA 1W6YA 4WP5A 3DZLA 1E97A 1OHSA 3STDA 1W00A 4HZ9B 5JPPA 2XSOB 3F40A 1Z1SA 3CNXA 1TUHA 3DM8A 5IG5A 1STDA 1O7WB 4OVMA 1OHOA 3EBTA 3OWSA 2F86B 5KP1A 1ASKA 1WQLB 3OV4A 4IIAA 1OHPA 3F7XA 1NU3A 1ULIB 7STDA 1OF5A 1O7GB 2CKFB 1OF5B 1ISKA 1O7HB
chains in the Genus database with same CATH superfamily
3BLZA 3M8CA 1LRAA 3LXUX 5STDA 1JB4A 1YGEA 2Z77A 1IV7A 1GY7A 3X41A 4WHAA 4RZMA 4DKIA 2CWVA 5BU4A 3S67A 4MMYB 1HZ1A 1NB3I 4O3VA 2BIRA 3EX9A 1B2UA 1BRJA 1N9EA 3KCHA 3LH4A 3LTAA 1G0TA 1ZO2A 3DGYA 2CFWA 1TFOA 2CC3A 4HZBB 3EHCA 5IF6A 3FH1A 1BU4A 5AIFA 3D3LA 1GYBA 1UI8A 2W56A 3SLUA 3LZAA 5G2GA 2CH9A 1CYUA 1AR0A 2OTJ3 2F98A 2XFSA 2W56B 3X3XA 5M18A 5IG0A 1UCLA 5IG3A 1B3SA 2K0MA 3EF8A 2P0MA 1BOXA 1QJGA 3MG3A 1WNHA 3PGBA 1RDSA 2OCTA 2V1LA 1B27A 1UI7A 1GD4A 3URPA 1VQ63 4BTYA 2XH9A 1GMRA 1MGRA 1BSCA 3H51A 2L1SA 8CHOA 1A67A 5KP3A 1JKGA 1IVWA 2KXGA 3S5CA 4J8TA 4GB5A 1W01A 2R41A 2KF3A 5RNTA 3KFQC 1JKGB 1QAKA 1BNFA 2H0IA 2Z76A 1HYFA 2JDIH 4HKVB 5IG4A 3X3ZA 4GSPA 2FNQA 4ILFA 3CC23 2RCDA 4RNTA 4MJDA 4Q53A 1STFI 4MMZB 5EVHA 1ROAA 4LGQA 5IEPA 5HGRA 1PYLA 1UW1A 2W03A 3D5IA 3LT9A 3UNLA 3WODG 1ZX2A 1E3VA 1N5HA 3IJEB 5IENA 2IY2A 1GSPA 2UUGC 4EW5A 2P05A 4HM8B 6RNTA 2HMJB 3A5EA 5D81A 3S28A 3VGNA 1RTUA 3FZWA 1DE3A 3CCJ3 3NQZA 3WOEB 2UX0A 3UB1A 5CK6A 1RKYA 1LVNA 3X3YA 1M1K4 1KSIA 4EV2A 2RFRA 3PZWA 3WA3A 2W0QA 1O7NB 2XGNA 2E2UA 3SYUA 3WA2X 2F4YA 1Q824 1OUNA 3F8XA 1MGWA 1RNBA 6STDA 3RGAA 4O8SA 2RSXA 4FR9A 2O9UX 1RRHA 1UCJA 1N9JA 1UCIA 4N3VA 4R9KA 4O2HA 5DRVA 3V92A 2PNCA 1DMMA 1B2SA 1I2EA 1W4NA 4ZM8A 3PCRA 3S27A 1W6GA 3CXC2 1NO3A 3CME3 1RGFA 4J5KA 3G16A 1V57A 1SJWA 2YFLB 1TIJA 3DH2A 3NUVA 3Q90A 3ALAA 2M7OA 3G0KA 3EN1B 2B1XB 1KQS2 3B4OA 3EB8A 4LEHA 4WWUC 3IPTA 3Q1CA 1JBRA 1BUJA 1ROVA 1EEJA 2BO9B 2D1WA 1AQZA 1LOYA 5KP4A 3CCQ3 3CCL3 1K41A 1MWRA 1RN4A 2A15A 2HMOB 4XDWA 1EA2A 4LZIA 1IU7A 3EJVA 3K63A 1JBSA 3FGYA 1FUSA 4XB5A 4NREA 1O7PB 4KZ1A 1I70A 1IQ8A 4J5GA 3CC43 2GXFA 1LXEA 2HMKB 1DVDA 1CQSA 1GOVA 2GSPA 3B4PA 1UGHI 2CFGA 1FGRA 2SARA 3TDGA 1RGHA 1T3BA 3SVAA 3UJMA 4CJNA 1O7MB 1YNVX 1GOYA 1SPUA 1RMSA 1JNQA 3I553 3MG2A 3JVCA 1BSDA 1WMPA 3MPHA 2CFDA 5TGNA 3ECFA 1JB5A 1FA3A 4HM3B 1Q42A 3AHSA 3CNMA 5IW9A 3G4S3 3E99A 2GU1A 1C7HA 2WOHA 2GU3A 3VF1A 4N6MA 3NBRA 1BAOA 1SQWA 4OUQA 2KF5A 1OH0A 1NWWA 3PYJA 1Q7Y4 3BU4A 2RNTA 1OCVA 1WMOA 2CK3H 4XDVA 2Y74A 2KF4A 4MMXB 3OW22 1YJ93 1MWTA 1KD14 3SOYA 1IV9A 3RGRA 2HOHA 1JB2A 1DYUA 3B7CA 3EQQB 1I2GA 4J9AA 2CG0A 2W04A 1BSEA 4GL6A 1W2ZA 3N8BA 2IYJA 2GBWB 2OOVC 4HM2B 1D6ZA 3EN8A 5FW5A 2INXA 2RGQA 3QK9A 3PCSA 2F56A 1K734 3SEDA 4FMAA 1Q40A 1IDPA 3B8LA 5AIHA 1I2FA 4X2OA 5BIRA 2D42A 1IYYA 3D5GA 1FUTA 4BL3A 1GOUA 1V74A 1Y4KA 3MKIA 3K7CA 3G8ZA 3IMAB 4JRFA 1IVUA 5G1KA 1Q40B 5I97A 2OQEC 2FXTA 2FGTA 2CX0A 2KAAA 5CXOA 2ZL8A 1QVG2 3WOFB 5AEUB 1RCKA 4FMBA 2QGUA 5CF2A 1ULJB 3KN4A 5G1LA 5GSPA 4BU4A 3UL6A 1EG9B 3I563 2GEYA 1SARA 4HM6B 3N9HA 2AAEA 3LMLA 1QAFA 5ELUA 1UUGB 3A76A 1TP6A 1B2MA 1JZOA 3ZG5A 2MC8A 4L8OA 1T2HA 3D79A 5CF1A 2SBLA 3FF2A 1RRLA 1AVKA 1M904 4G1MB 3HOHA 3F8HA 1EKMA 3NXJA 1N8QA 4FCJA 5AI1A 3HK4A 3JUQA 1A2KA 4AEQA 5M19A 4HYZA 2B24B 2XFTA 3LT8A 3GRDA 1ZGXA 3J7Yd 1BNSA 5AIGA 5EEOA 3UL5A 1RGKA 4L7KA 3U1WA 4N6NB 4NHFA 5IERA 3GZRA 2XRXB 2GBXB 1BRHA 2ML5A 4N6V0 2OTL3 1VQ73 1LNHA 4XBYA 3MG1A 4N6OB 3MYTA 1BGSA 4H61A 3CD63 3MHEA 3L0RA 3HZPA 4N6UA 6GSPA 1TJDA 2YFJB 3N54B 3OWUA 2F5WA 3LTCA 1PU4A 1DETA 1GS3A 1BNJA 1AVLA 5DREA 1MWSA 4EXRA 2KRTA 2W2CA 1K8A4 3K9MC 4K1VA 2IUKA 3OWYA 3HIGA 1YGWA 2Z7AA 3ROBA 1I0XA 3V99A 4K61A 1LOVA 2XEPA 1PY3A 1G96A 3BNBA 4KT3B 2IUJA 2BMRB 3G713 1W5ZA 2PZVA 4BTXA 1OGXA 1RGEA 3SX1A 1IQYA 4HM5B 1TRPA 3JUOA 1IT8A 4AKZA 1Q7HA 2CWTA 2BHMA 1W2B2 3MSOA 4H3UA 2HMLB 2R4IA 1MNLA 4KFEA 2L4VA 1VQL3 1FW7A 2ZDJA 1MWUA 1I3IA 3AGNA 5AYRB 1YJN3 1RNTA 1E3RA 1GY6A 2P09A 5JPUA 5LC7A 2Z6BA 4HM1B 3CCE3 1S5AA 2W9QA 4N6LA 4RBNA 1HU9A 3HX8A 4HVNA 1GMPA 3OXAA 1GMQA 3FG1A 2F5MA 1VQ83 1VQN3 2RBIA 4IT7A 5D83A 1S723 1US1A 3NV0A 3DMCA 1FZUA 2WGQA 4K1UA 1LNIA 1IQXA 1WTHA 4BTWA 1M1XB 1B21A 1UUWB 2IMJA 3NV0B 3Q2PA 3K5TA 4ORLA 4WYKA 4KFDA 4U13A 1X1UA 2BT3A 2XR8B 4FMCA 3WDGB 2YFIB 4WYKB 3F9SA 3ER7A 2AADA 1LOWA 1BRNL 4R1KA 2OOVA 3T0UA 5IEOA 2XSHB 2BMOB 3F7SA 1RLSA 3O8YA 3RNTA 3WHOA 5A0OB 1YHQ3 4XBXA 1D6UA 1J2BA 3GZYB 3MWZA 3CCR3 1DMQA 2HMNB 2XGLA 2F99A 2KF6A 3EBYA 2YX9A 3CMA3 1UUVB 4STDA 3V98A 5JBSA 3HIIA 2UGIA 1NB5I 1RGCA 4FCZA 1FGTA 1BSBA 3NM7A 2OQEA 2CHCA 1CH0A 1KWIA 1U8CB 1IT7A 3H3HA 3VSYA 1LOXA 1SIHA 1X1WA 1PFPA 3G6E3 1VQM3 1BNEA 1C54A 8RNTA 3BNEA 3T8UA 2BNGA 2W6JH 1D6YA 4HAAA 2ZHXB 3CPOA 1AV4A 1GY5A 1VQ43 1VQ53 1NDOB 3S29A 1IVVA 3GWRA 1QMAA 1UGIA 1TFKA 1YIT3 2MF7A 4HJLB 4BIRA 1YJW3 3FCSB 2BU4A 3KE7A 2HMMB 3U97A 3SOAA 1DVCA 4FCMA 3SXXA 1YI23 1JN5A 1BRSA 4MEIA 5AIIA 1V58A 3LTDA 1T2IA 4HBRA 3GZXB 1JN5B 2LQVA 5HOHA 7RNTA 1YVBI 1VQP3 1K9M4 1OACA 1UCKA 2QEX3 1RGAA 4CDLA 2CFKA 4NPBA 2CG1A 3I0YA 1QVF2 2WO0A 3ZFZA 4X2HA 3D9RA 3KSPA 4HM0B 1RHLA 4XBTA 1R4CA 4FMDA 4R4KA 1BUQA 1G02A 2JQ5A 5AEWB 2Y73A 3FKAA 3FSDA 4L8PA 2OWPA 3T8NA 2ML6A 3JUNA 1W02A 2KCDA 3HI7A 1I8VA 1BNIA 2GEXA 1TTOA 2H0GA 3NHXA 4EBGA 3DGOA 4GHOA 3DXOA 1BRIA 4AKYA 4LSOA 1A2VA 1JV2B 2CFLA 2CWUA 2XF3A 4HM4B 5BVBA 3FLJA 1Q9EA 2Q07A 2P0XA 1YIJ3 1N5PA 3AHWA 3BB9A 1B2XA 3CU3A 3ZG0A 1AY7A 3NQYA 1FGOA 1RCLA 4R9LA 1ZS7A 1OPYA 2WOFA 3DUKA 4K90B 3JUMA 4PEJA 5CLKA 1QALA 1T5YA 4LMIA 1B20A 1TU5A 1VQQA 2QIYA 1OGZA 4HOHA 3X42A 2K54A 3NM2A 9RNTA 1IK3A 1KC84 4I5QA 1A90A 4EV5A 1IVXA 1F8NA 1RN7A 3CCS3 2CX1A 1M9GA 1EUIC 3KZTA 1GD3A 4HM7B 5EQLA 1VZZA 1SIIA 1U5OA 3AGOA 1BANA 5BXQA 3EC9A 3K0ZA 4LYLB 1HKXA 3KSED 3WMDA 3F14A 4KVHA 4EC6A 3NX0A 3AMOA 3KKGA 4CPKA 3RDEA 3FF0A 3GZBA 4IPBA 3DGLA 1BSAA 1CYVA 2BMQB 1DMNA 2I9WA 3AMOB 3EE1A 1RGLA 2P38A 3OX9A 3JUPA 4R80A 4XM4A 1I3FA 2STDA 3DGNA 3GSPA 1FGMA 2K3DA 3DY5A 3CCU3 1X1XA 3LYGA 1Q814 1FYSA 1LQMB 5D82A 4RNZA 4I4KA 3X40A 1W6YA 4WP5A 1JJ22 3DZLA 2LYXA 1E97A 2CW9A 1OHSA 3STDA 4RNYA 1BVIA 1BNRA 1L5GB 1I0VA 3CPW2 1W00A 1B2ZA 1NNVA 4HZ9B 5JPPA 4TX4A 1TRQA 1FGQA 3NBJA 2W9PA 1CEWI 5LC6A 3BNCA 4KFFA 1A2PA 4QWTA 3BIRA 2C11A 2XSOB 3F40A 1Z1SA 3DGMA 1R4YA 1YVSA 3CNXA 1TUHA 3DM8A 3KIIA 3D4AA 5IG5A 1W6CA 1RGGA 1STDA 3GAXA 4EYCA 1UDII 1VQK3 1O7WB 3BNDA 4OVMA 1JZDA 1OHOA 4O02B 2J8XB 1NJI4 3EBTA 3OWSA 4WFOA 5M1AA 1BIRA 1BNGA 5ELJA 1WMNA 5AYSC 1N8R4 2F86B 5KP1A 1RSNA 2C4BA 1ASKA 1RJOA 1WQLB 5FGOA 3OV4A 2CIUA 3LTBA 4IIAA 2IA7A 1LQGC 3CC73 1OHPA 1X1YA 3F7XA 3Q3FA 1Q864 1VQ93 4N6TA 1W7CA 2O3OA 2ZA4A 3FG3A 1JRQA 1K28A 1NU3A 3PS8A 2WGOA 1RN1A 2E2TA 3PXMA 1ULIB 3CCM3 1MOLA 1BRKA 2C10A 3LOYA 4BL2A 7STDA 1OF5A 3CCV3 4OK0A 2QA43 1VQO3 1JBTA 3WR2A 1EQKA 3QRDA 1O7GB 1BRGA 2CKFB 3FG4A 4JF8A 1OF5B 1ISKA 1O7HB 1FUWA 2E2VA 7GSPA 3NBBA 4CCVA 2H0HA
chains in the Genus database with same CATH topology
3BLZA 3M8CA 3LXUX 5STDA 1JB4A 1YGEA 2Z77A 1IV7A 1GY7A 3X41A 4WHAA 4RZMA 2CWVA 3S67A 4MMYB 1NB3I 4O3VA 3EX9A 3LTAA 1N9EA 3LH4A 1ZO2A 2CFWA 1TFOA 2CC3A 4HZBB 3EHCA 5IF6A 3FH1A 5AIFA 3D3LA 1GYBA 1UI8A 2W56A 3SLUA 3LZAA 5G2GA 2CH9A 1CYUA 1AR0A 2OTJ3 2F98A 2XFSA 2W56B 3X3XA 5IG0A 5IG3A 2K0MA 3EF8A 2P0MA 1QJGA 3MG3A 1WNHA 3PGBA 2OCTA 2V1LA 1UI7A 1GD4A 1VQ63 4BTYA 2XH9A 3H51A 8CHOA 1A67A 5KP3A 1JKGA 1IVWA 2KXGA 3S5CA 4J8TA 4GB5A 1W01A 3KFQC 1JKGB 1QAKA 2Z76A 2JDIH 4HKVB 5IG4A 3X3ZA 2FNQA 3CC23 2RCDA 4MJDA 4Q53A 1STFI 4MMZB 5EVHA 1ROAA 4LGQA 5IEPA 5HGRA 1UW1A 2W03A 3UNLA 3LT9A 3WODG 1ZX2A 1E3VA 1N5HA 3IJEB 5IENA 2P05A 4HM8B 2HMJB 5D81A 3S28A 3VGNA 3FZWA 3CCJ3 3NQZA 3WOEB 2UX0A 3UB1A 5CK6A 1RKYA 1LVNA 3X3YA 1M1K4 1KSIA 4EV2A 2RFRA 3PZWA 3WA3A 2W0QA 1O7NB 2XGNA 2E2UA 3WA2X 1Q824 1OUNA 3F8XA 6STDA 3RGAA 4O8SA 2RSXA 4FR9A 2O9UX 1RRHA 4R9KA 1N9JA 5DRVA 4N3VA 4O2HA 3V92A 2PNCA 1DMMA 4ZM8A 1W4NA 3PCRA 3S27A 1W6GA 3CXC2 1NO3A 3CME3 3G16A 1SJWA 2YFLB 1TIJA 3NUVA 3Q90A 3ALAA 2M7OA 3G0KA 3EN1B 2B1XB 1KQS2 3B4OA 3EB8A 4LEHA 4WWUC 3IPTA 3Q1CA 1ROVA 2BO9B 2D1WA 3CCL3 5KP4A 3CCQ3 1K41A 2A15A 4XDWA 2HMOB 1EA2A 4LZIA 1IU7A 3EJVA 3K63A 3FGYA 4XB5A 4NREA 1O7PB 4KZ1A 1IQ8A 3CC43 2GXFA 1LXEA 2HMKB 1DVDA 1CQSA 3B4PA 2CFGA 1FGRA 3TDGA 3SVAA 3UJMA 1O7MB 1SPUA 1JNQA 3I553 3MG2A 3JVCA 1WMPA 3MPHA 2CFDA 5TGNA 3ECFA 1JB5A 1FA3A 4HM3B 1Q42A 3CNMA 5IW9A 3G4S3 3E99A 2GU1A 1C7HA 2WOHA 2GU3A 3VF1A 4N6MA 3NBRA 1SQWA 4OUQA 1OH0A 1NWWA 3PYJA 1Q7Y4 1OCVA 1WMOA 2CK3H 4XDVA 2Y74A 4MMXB 3OW22 1YJ93 1KD14 3SOYA 1IV9A 3RGRA 1JB2A 1DYUA 3B7CA 3EQQB 4J9AA 2CG0A 2W04A 4GL6A 1W2ZA 3N8BA 2GBWB 2OOVC 4HM2B 1D6ZA 3EN8A 5FW5A 2INXA 2RGQA 3QK9A 3PCSA 1K734 3SEDA 4FMAA 1Q40A 1IDPA 3B8LA 5AIHA 4X2OA 2D42A 1V74A 1Y4KA 3MKIA 3K7CA 3G8ZA 3IMAB 4JRFA 1IVUA 1Q40B 5I97A 2OQEC 2FXTA 2FGTA 5CXOA 2ZL8A 1QVG2 3WOFB 5AEUB 4FMBA 2QGUA 5CF2A 1ULJB 3KN4A 3UL6A 1EG9B 3I563 2GEYA 4HM6B 3N9HA 3LMLA 1QAFA 5ELUA 3A76A 1TP6A 2MC8A 4L8OA 5CF1A 2SBLA 3FF2A 1RRLA 1AVKA 1M904 4G1MB 3F8HA 1EKMA 3NXJA 1N8QA 4FCJA 5AI1A 3HK4A 3JUQA 1A2KA 4AEQA 4HYZA 2B24B 2XFTA 3LT8A 3GRDA 3J7Yd 5AIGA 5EEOA 3UL5A 4L7KA 3U1WA 4N6NB 4NHFA 5IERA 3GZRA 2XRXB 2GBXB 2ML5A 4N6V0 2OTL3 1VQ73 1LNHA 4XBYA 3MG1A 4N6OB 3MYTA 3CD63 4H61A 3MHEA 3L0RA 3HZPA 4N6UA 2YFJB 3OWUA 3N54B 3LTCA 1PU4A 1GS3A 5DREA 4EXRA 1AVLA 2KRTA 2W2CA 1K8A4 3K9MC 4K1VA 2IUKA 3OWYA 3HIGA 2Z7AA 3ROBA 3V99A 4K61A 2XEPA 3BNBA 1G96A 2IUJA 2BMRB 3G713 2PZVA 1W5ZA 4BTXA 1OGXA 3SX1A 1IQYA 4HM5B 3JUOA 1IT8A 4AKZA 2CWTA 2BHMA 1W2B2 3MSOA 4H3UA 2HMLB 2R4IA 1MNLA 4KFEA 2L4VA 1VQL3 2ZDJA 5AYRB 1YJN3 1E3RA 1GY6A 2P09A 5JPUA 5LC7A 2Z6BA 4HM1B 3CCE3 1S5AA 2W9QA 4N6LA 4RBNA 1HU9A 3HX8A 4HVNA 3OXAA 3FG1A 1VQ83 1VQN3 5D83A 4IT7A 1S723 1US1A 3NV0A 3DMCA 2WGQA 4K1UA 1IQXA 1WTHA 4BTWA 1M1XB 3NV0B 1UUWB 2IMJA 3Q2PA 4ORLA 3K5TA 4WYKA 4KFDA 4U13A 2XR8B 2BT3A 4FMCA 3WDGB 2YFIB 4WYKB 3F9SA 3ER7A 4R1KA 2OOVA 3T0UA 5IEOA 2XSHB 2BMOB 3F7SA 3O8YA 1YHQ3 5A0OB 4XBXA 1D6UA 1J2BA 3GZYB 3MWZA 3CCR3 1DMQA 2HMNB 2XGLA 2F99A 3EBYA 2YX9A 3CMA3 1UUVB 4STDA 3V98A 5JBSA 3HIIA 1NB5I 4FCZA 1FGTA 3NM7A 2OQEA 2CHCA 1KWIA 1U8CB 1IT7A 3H3HA 3VSYA 1LOXA 1SIHA 1VQM3 1PFPA 3G6E3 3BNEA 3T8UA 2BNGA 2W6JH 1D6YA 3CPOA 1AV4A 1GY5A 1VQ43 1VQ53 1NDOB 3S29A 1IVVA 3GWRA 1QMAA 1TFKA 1YIT3 2MF7A 4HJLB 1YJW3 3FCSB 3KE7A 2HMMB 3U97A 3SOAA 1DVCA 4FCMA 3SXXA 1YI23 1JN5A 4MEIA 5AIIA 3LTDA 4HBRA 3GZXB 1JN5B 2LQVA 1YVBI 1VQP3 1K9M4 1OACA 2QEX3 4CDLA 2CFKA 2CG1A 3I0YA 2WO0A 4X2HA 3D9RA 3KSPA 4HM0B 4XBTA 1R4CA 4FMDA 4R4KA 1BUQA 2JQ5A 5AEWB 2Y73A 3FKAA 3FSDA 4L8PA 2OWPA 3T8NA 2ML6A 3JUNA 1W02A 2KCDA 3HI7A 2GEXA 3NHXA 4EBGA 3DGOA 3DXOA 4AKYA 4LSOA 1A2VA 1JV2B 2XF3A 2CFLA 2CWUA 4HM4B 5BVBA 3FLJA 2Q07A 1YIJ3 2P0XA 1QVF2 1N5PA 3BB9A 3CU3A 3NQYA 1FGOA 4R9LA 1OPYA 2WOFA 3DUKA 4K90B 3JUMA 4PEJA 5CLKA 1QALA 1T5YA 4LMIA 1TU5A 2QIYA 1OGZA 3X42A 1KC84 2K54A 3NM2A 1A90A 1IK3A 4EV5A 1IVXA 1F8NA 1RN7A 3CCS3 1M9GA 3KZTA 1GD3A 4HM7B 5EQLA 1VZZA 1SIIA 1U5OA 5BXQA 3EC9A 3K0ZA 3WMDA 1HKXA 3KSED 4EC6A 3F14A 4KVHA 3NX0A 3AMOA 3KKGA 3RDEA 3FF0A 3GZBA 4IPBA 3DGLA 1CYVA 2BMQB 1DMNA 2I9WA 3AMOB 3EE1A 2P38A 3OX9A 4XM4A 3JUPA 4R80A 2STDA 3DGNA 1FGMA 3DY5A 3CCU3 3LYGA 1Q814 5D82A 4RNZA 4I4KA 3X40A 1W6YA 4WP5A 1JJ22 3DZLA 2LYXA 1E97A 2CW9A 1OHSA 3STDA 4RNYA 1L5GB 3CPW2 1W00A 4HZ9B 5JPPA 4TX4A 1FGQA 3NBJA 2W9PA 1CEWI 5LC6A 3BNCA 4KFFA 4QWTA 2C11A 2XSOB 3F40A 1Z1SA 3DGMA 3CNXA 1TUHA 3DM8A 3KIIA 5IG5A 1W6CA 1STDA 3GAXA 4EYCA 1VQK3 1O7WB 3BNDA 4OVMA 1OHOA 4O02B 1NJI4 3EBTA 3OWSA 4WFOA 5ELJA 1WMNA 5AYSC 1N8R4 2F86B 5KP1A 1ASKA 1RJOA 1WQLB 5FGOA 3OV4A 2CIUA 3LTBA 4IIAA 2IA7A 3CC73 1OHPA 3F7XA 1Q864 1VQ93 4N6TA 1W7CA 2O3OA 3FG3A 1JRQA 1K28A 1NU3A 3PS8A 2WGOA 2E2TA 3PXMA 1ULIB 3CCM3 1MOLA 2C10A 3LOYA 7STDA 3CCV3 1OF5A 2QA43 4OK0A 1VQO3 1EQKA 3QRDA 1O7GB 4JF8A 2CKFB 3FG4A 1OF5B 1ISKA 1O7HB 1FUWA 2E2VA 3NBBA 4CCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLZ A;  3M8C A;  5STD A;  1JB4 A;  2Z77 A;  1GY7 A;  4RZM A;  3EX9 A;  1ZO2 A;  4HZB B;  3EHC A;  5IF6 A;  3FH1 A;  5AIF A;  1GYB A;  3LZA A;  5G2G A;  1AR0 A;  2F98 A;  5IG0 A;  5IG3 A;  3EF8 A;  1QJG A;  3MG3 A;  3H51 A;  8CHO A;  5KP3 A;  1JKG A;  3S5C A;  4J8T A;  4GB5 A;  1W01 A;  1JKG B;  2Z76 A;  4HKV B;  5IG4 A;  2RCD A;  4MJD A;  4Q53 A;  5EVH A;  4LGQ A;  5IEP A;  5HGR A;  3UNL A;  1ZX2 A;  1E3V A;  5IEN A;  4HM8 B;  2HMJ B;  5D81 A;  3VGN A;  3FZW A;  2UX0 A;  5CK6 A;  2RFR A;  1O7N B;  1OUN A;  3F8X A;  6STD A;  3RGA A;  5DRV A;  4R9K A;  4N3V A;  1DMM A;  3G16 A;  1SJW A;  2YFL B;  3NUV A;  3Q90 A;  3G0K A;  3EN1 B;  2B1X B;  3B4O A;  4LEH A;  4WWU C;  3IPT A;  5KP4 A;  1K41 A;  2A15 A;  4XDW A;  2HMO B;  1EA2 A;  3EJV A;  3FGY A;  4XB5 A;  1O7P B;  2GXF A;  2HMK B;  1CQS A;  3B4P A;  3UJM A;  1O7M B;  3MG2 A;  5TGN A;  3ECF A;  1JB5 A;  4HM3 B;  1Q42 A;  3CNM A;  3E99 A;  1C7H A;  3NBR A;  4OUQ A;  1OH0 A;  1NWW A;  1OCV A;  4XDV A;  3SOY A;  3RGR A;  1JB2 A;  3B7C A;  3EQQ B;  4J9A A;  2GBW B;  4HM2 B;  3EN8 A;  5FW5 A;  2INX A;  2RGQ A;  3SED A;  1Q40 A;  1IDP A;  3B8L A;  5AIH A;  4X2O A;  3MKI A;  3K7C A;  3G8Z A;  1Q40 B;  5CXO A;  5AEU B;  2QGU A;  5CF2 A;  1ULJ B;  1EG9 B;  2GEY A;  4HM6 B;  3A76 A;  1TP6 A;  4L8O A;  5CF1 A;  3FF2 A;  3F8H A;  3NXJ A;  4FCJ A;  5AI1 A;  3HK4 A;  3JUQ A;  1A2K A;  2B24 B;  3GRD A;  5AIG A;  4L7K A;  5IER A;  3GZR A;  2XRX B;  2GBX B;  4XBY A;  3MG1 A;  3MYT A;  3MHE A;  3HZP A;  2YFJ B;  3OWU A;  1GS3 A;  5DRE A;  2W2C A;  4K1V A;  3OWY A;  2Z7A A;  3ROB A;  2BMR B;  2PZV A;  1OGX A;  4HM5 B;  3JUO A;  3MSO A;  4H3U A;  2HML B;  2R4I A;  1E3R A;  1GY6 A;  5JPU A;  4HM1 B;  1S5A A;  3HX8 A;  4HVN A;  3OXA A;  5D83 A;  3NV0 A;  3DMC A;  4K1U A;  3NV0 B;  1UUW B;  2IMJ A;  4ORL A;  4WYK A;  4U13 A;  2XR8 B;  2YFI B;  4WYK B;  3F9S A;  3ER7 A;  4R1K A;  5IEO A;  2XSH B;  2BMO B;  3F7S A;  4XBX A;  3GZY B;  1DMQ A;  2HMN B;  2F99 A;  3EBY A;  1UUV B;  4STD A;  2CHC A;  3H3H A;  3VSY A;  3T8U A;  2BNG A;  3CPO A;  1GY5 A;  1NDO B;  3GWR A;  1QMA A;  4HJL B;  3KE7 A;  2HMM B;  3SOA A;  4FCM A;  1JN5 A;  5AII A;  3GZX B;  1JN5 B;  4CDL A;  3I0Y A;  4X2H A;  3D9R A;  3KSP A;  4HM0 B;  4XBT A;  1BUQ A;  2JQ5 A;  5AEW B;  3FKA A;  3FSD A;  4L8P A;  2OWP A;  3T8N A;  3JUN A;  1W02 A;  2GEX A;  3NHX A;  3DXO A;  5BVB A;  4HM4 B;  3FLJ A;  3BB9 A;  3CU3 A;  4R9L A;  1OPY A;  3DUK A;  3JUM A;  4PEJ A;  5CLK A;  4LMI A;  2QIY A;  1OGZ A;  2K54 A;  3NM2 A;  3KZT A;  4HM7 B;  1VZZ A;  1U5O A;  5BXQ A;  3EC9 A;  3K0Z A;  3WMD A;  1HKX A;  3F14 A;  4KVH A;  3KKG A;  3FF0 A;  3GZB A;  2BMQ B;  1DMN A;  2I9W A;  3OX9 A;  4XM4 A;  3JUP A;  2STD A;  3LYG A;  5D82 A;  4I4K A;  1W6Y A;  4WP5 A;  3DZL A;  1E97 A;  1OHS A;  3STD A;  1W00 A;  4HZ9 B;  5JPP A;  2XSO B;  3F40 A;  1Z1S A;  3CNX A;  1TUH A;  3DM8 A;  5IG5 A;  1STD A;  1O7W B;  4OVM A;  1OHO A;  3EBT A;  3OWS A;  2F86 B;  5KP1 A;  1ASK A;  1WQL B;  3OV4 A;  4IIA A;  1OHP A;  3F7X A;  1NU3 A;  1ULI B;  7STD A;  1OF5 A;  1O7G B;  2CKF B;  1OF5 B;  1ISK A;  1O7H B; 
#chains in the Genus database with same CATH topology
 3BLZ A;  3M8C A;  1LRA A;  3LXU X;  5STD A;  1JB4 A;  1YGE A;  2Z77 A;  1IV7 A;  1GY7 A;  3X41 A;  4WHA A;  4RZM A;  4DKI A;  2CWV A;  5BU4 A;  3S67 A;  4MMY B;  1HZ1 A;  1NB3 I;  4O3V A;  2BIR A;  3EX9 A;  1B2U A;  1BRJ A;  1N9E A;  3KCH A;  3LH4 A;  3LTA A;  1G0T A;  1ZO2 A;  3DGY A;  2CFW A;  1TFO A;  2CC3 A;  4HZB B;  3EHC A;  5IF6 A;  3FH1 A;  1BU4 A;  5AIF A;  3D3L A;  1GYB A;  1UI8 A;  2W56 A;  3SLU A;  3LZA A;  5G2G A;  2CH9 A;  1CYU A;  1AR0 A;  2OTJ 3;  2F98 A;  2XFS A;  2W56 B;  3X3X A;  5M18 A;  5IG0 A;  1UCL A;  5IG3 A;  1B3S A;  2K0M A;  3EF8 A;  2P0M A;  1BOX A;  1QJG A;  3MG3 A;  1WNH A;  3PGB A;  1RDS A;  2OCT A;  2V1L A;  1B27 A;  1UI7 A;  1GD4 A;  3URP A;  1VQ6 3;  4BTY A;  2XH9 A;  1GMR A;  1MGR A;  1BSC A;  3H51 A;  2L1S A;  8CHO A;  1A67 A;  5KP3 A;  1JKG A;  1IVW A;  2KXG A;  3S5C A;  4J8T A;  4GB5 A;  1W01 A;  2R41 A;  2KF3 A;  5RNT A;  3KFQ C;  1JKG B;  1QAK A;  1BNF A;  2H0I A;  2Z76 A;  1HYF A;  2JDI H;  4HKV B;  5IG4 A;  3X3Z A;  4GSP A;  2FNQ A;  4ILF A;  3CC2 3;  2RCD A;  4RNT A;  4MJD A;  4Q53 A;  1STF I;  4MMZ B;  5EVH A;  1ROA A;  4LGQ A;  5IEP A;  5HGR A;  1PYL A;  1UW1 A;  2W03 A;  3D5I A;  3LT9 A;  3UNL A;  3WOD G;  1ZX2 A;  1E3V A;  1N5H A;  3IJE B;  5IEN A;  2IY2 A;  1GSP A;  2UUG C;  4EW5 A;  2P05 A;  4HM8 B;  6RNT A;  2HMJ B;  3A5E A;  5D81 A;  3S28 A;  3VGN A;  1RTU A;  3FZW A;  1DE3 A;  3CCJ 3;  3NQZ A;  3WOE B;  2UX0 A;  3UB1 A;  5CK6 A;  1RKY A;  1LVN A;  3X3Y A;  1M1K 4;  1KSI A;  4EV2 A;  2RFR A;  3PZW A;  3WA3 A;  2W0Q A;  1O7N B;  2XGN A;  2E2U A;  3SYU A;  3WA2 X;  2F4Y A;  1Q82 4;  1OUN A;  3F8X A;  1MGW A;  1RNB A;  6STD A;  3RGA A;  4O8S A;  2RSX A;  4FR9 A;  2O9U X;  1RRH A;  1UCJ A;  1N9J A;  1UCI A;  4N3V A;  4R9K A;  4O2H A;  5DRV A;  3V92 A;  2PNC A;  1DMM A;  1B2S A;  1I2E A;  1W4N A;  4ZM8 A;  3PCR A;  3S27 A;  1W6G A;  3CXC 2;  1NO3 A;  3CME 3;  1RGF A;  4J5K A;  3G16 A;  1V57 A;  1SJW A;  2YFL B;  1TIJ A;  3DH2 A;  3NUV A;  3Q90 A;  3ALA A;  2M7O A;  3G0K A;  3EN1 B;  2B1X B;  1KQS 2;  3B4O A;  3EB8 A;  4LEH A;  4WWU C;  3IPT A;  3Q1C A;  1JBR A;  1BUJ A;  1ROV A;  1EEJ A;  2BO9 B;  2D1W A;  1AQZ A;  1LOY A;  5KP4 A;  3CCQ 3;  3CCL 3;  1K41 A;  1MWR A;  1RN4 A;  2A15 A;  2HMO B;  4XDW A;  1EA2 A;  4LZI A;  1IU7 A;  3EJV A;  3K63 A;  1JBS A;  3FGY A;  1FUS A;  4XB5 A;  4NRE A;  1O7P B;  4KZ1 A;  1I70 A;  1IQ8 A;  4J5G A;  3CC4 3;  2GXF A;  1LXE A;  2HMK B;  1DVD A;  1CQS A;  1GOV A;  2GSP A;  3B4P A;  1UGH I;  2CFG A;  1FGR A;  2SAR A;  3TDG A;  1RGH A;  1T3B A;  3SVA A;  3UJM A;  4CJN A;  1O7M B;  1YNV X;  1GOY A;  1SPU A;  1RMS A;  1JNQ A;  3I55 3;  3MG2 A;  3JVC A;  1BSD A;  1WMP A;  3MPH A;  2CFD A;  5TGN A;  3ECF A;  1JB5 A;  1FA3 A;  4HM3 B;  1Q42 A;  3AHS A;  3CNM A;  5IW9 A;  3G4S 3;  3E99 A;  2GU1 A;  1C7H A;  2WOH A;  2GU3 A;  3VF1 A;  4N6M A;  3NBR A;  1BAO A;  1SQW A;  4OUQ A;  2KF5 A;  1OH0 A;  1NWW A;  3PYJ A;  1Q7Y 4;  3BU4 A;  2RNT A;  1OCV A;  1WMO A;  2CK3 H;  4XDV A;  2Y74 A;  2KF4 A;  4MMX B;  3OW2 2;  1YJ9 3;  1MWT A;  1KD1 4;  3SOY A;  1IV9 A;  3RGR A;  2HOH A;  1JB2 A;  1DYU A;  3B7C A;  3EQQ B;  1I2G A;  4J9A A;  2CG0 A;  2W04 A;  1BSE A;  4GL6 A;  1W2Z A;  3N8B A;  2IYJ A;  2GBW B;  2OOV C;  4HM2 B;  1D6Z A;  3EN8 A;  5FW5 A;  2INX A;  2RGQ A;  3QK9 A;  3PCS A;  2F56 A;  1K73 4;  3SED A;  4FMA A;  1Q40 A;  1IDP A;  3B8L A;  5AIH A;  1I2F A;  4X2O A;  5BIR A;  2D42 A;  1IYY A;  3D5G A;  1FUT A;  4BL3 A;  1GOU A;  1V74 A;  1Y4K A;  3MKI A;  3K7C A;  3G8Z A;  3IMA B;  4JRF A;  1IVU A;  5G1K A;  1Q40 B;  5I97 A;  2OQE C;  2FXT A;  2FGT A;  2CX0 A;  2KAA A;  5CXO A;  2ZL8 A;  1QVG 2;  3WOF B;  5AEU B;  1RCK A;  4FMB A;  2QGU A;  5CF2 A;  1ULJ B;  3KN4 A;  5G1L A;  5GSP A;  4BU4 A;  3UL6 A;  1EG9 B;  3I56 3;  2GEY A;  1SAR A;  4HM6 B;  3N9H A;  2AAE A;  3LML A;  1QAF A;  5ELU A;  1UUG B;  3A76 A;  1TP6 A;  1B2M A;  1JZO A;  3ZG5 A;  2MC8 A;  4L8O A;  1T2H A;  3D79 A;  5CF1 A;  2SBL A;  3FF2 A;  1RRL A;  1AVK A;  1M90 4;  4G1M B;  3HOH A;  3F8H A;  1EKM A;  3NXJ A;  1N8Q A;  4FCJ A;  5AI1 A;  3HK4 A;  3JUQ A;  1A2K A;  4AEQ A;  5M19 A;  4HYZ A;  2B24 B;  2XFT A;  3LT8 A;  3GRD A;  1ZGX A;  3J7Y d;  1BNS A;  5AIG A;  5EEO A;  3UL5 A;  1RGK A;  4L7K A;  3U1W A;  4N6N B;  4NHF A;  5IER A;  3GZR A;  2XRX B;  2GBX B;  1BRH A;  2ML5 A;  4N6V 0;  2OTL 3;  1VQ7 3;  1LNH A;  4XBY A;  3MG1 A;  4N6O B;  3MYT A;  1BGS A;  4H61 A;  3CD6 3;  3MHE A;  3L0R A;  3HZP A;  4N6U A;  6GSP A;  1TJD A;  2YFJ B;  3N54 B;  3OWU A;  2F5W A;  3LTC A;  1PU4 A;  1DET A;  1GS3 A;  1BNJ A;  1AVL A;  5DRE A;  1MWS A;  4EXR A;  2KRT A;  2W2C A;  1K8A 4;  3K9M C;  4K1V A;  2IUK A;  3OWY A;  3HIG A;  1YGW A;  2Z7A A;  3ROB A;  1I0X A;  3V99 A;  4K61 A;  1LOV A;  2XEP A;  1PY3 A;  1G96 A;  3BNB A;  4KT3 B;  2IUJ A;  2BMR B;  3G71 3;  1W5Z A;  2PZV A;  4BTX A;  1OGX A;  1RGE A;  3SX1 A;  1IQY A;  4HM5 B;  1TRP A;  3JUO A;  1IT8 A;  4AKZ A;  1Q7H A;  2CWT A;  2BHM A;  1W2B 2;  3MSO A;  4H3U A;  2HML B;  2R4I A;  1MNL A;  4KFE A;  2L4V A;  1VQL 3;  1FW7 A;  2ZDJ A;  1MWU A;  1I3I A;  3AGN A;  5AYR B;  1YJN 3;  1RNT A;  1E3R A;  1GY6 A;  2P09 A;  5JPU A;  5LC7 A;  2Z6B A;  4HM1 B;  3CCE 3;  1S5A A;  2W9Q A;  4N6L A;  4RBN A;  1HU9 A;  3HX8 A;  4HVN A;  1GMP A;  3OXA A;  1GMQ A;  3FG1 A;  2F5M A;  1VQ8 3;  1VQN 3;  2RBI A;  4IT7 A;  5D83 A;  1S72 3;  1US1 A;  3NV0 A;  3DMC A;  1FZU A;  2WGQ A;  4K1U A;  1LNI A;  1IQX A;  1WTH A;  4BTW A;  1M1X B;  1B21 A;  1UUW B;  2IMJ A;  3NV0 B;  3Q2P A;  3K5T A;  4ORL A;  4WYK A;  4KFD A;  4U13 A;  1X1U A;  2BT3 A;  2XR8 B;  4FMC A;  3WDG B;  2YFI B;  4WYK B;  3F9S A;  3ER7 A;  2AAD A;  1LOW A;  1BRN L;  4R1K A;  2OOV A;  3T0U A;  5IEO A;  2XSH B;  2BMO B;  3F7S A;  1RLS A;  3O8Y A;  3RNT A;  3WHO A;  5A0O B;  1YHQ 3;  4XBX A;  1D6U A;  1J2B A;  3GZY B;  3MWZ A;  3CCR 3;  1DMQ A;  2HMN B;  2XGL A;  2F99 A;  2KF6 A;  3EBY A;  2YX9 A;  3CMA 3;  1UUV B;  4STD A;  3V98 A;  5JBS A;  3HII A;  2UGI A;  1NB5 I;  1RGC A;  4FCZ A;  1FGT A;  1BSB A;  3NM7 A;  2OQE A;  2CHC A;  1CH0 A;  1KWI A;  1U8C B;  1IT7 A;  3H3H A;  3VSY A;  1LOX A;  1SIH A;  1X1W A;  1PFP A;  3G6E 3;  1VQM 3;  1BNE A;  1C54 A;  8RNT A;  3BNE A;  3T8U A;  2BNG A;  2W6J H;  1D6Y A;  4HAA A;  2ZHX B;  3CPO A;  1AV4 A;  1GY5 A;  1VQ4 3;  1VQ5 3;  1NDO B;  3S29 A;  1IVV A;  3GWR A;  1QMA A;  1UGI A;  1TFK A;  1YIT 3;  2MF7 A;  4HJL B;  4BIR A;  1YJW 3;  3FCS B;  2BU4 A;  3KE7 A;  2HMM B;  3U97 A;  3SOA A;  1DVC A;  4FCM A;  3SXX A;  1YI2 3;  1JN5 A;  1BRS A;  4MEI A;  5AII A;  1V58 A;  3LTD A;  1T2I A;  4HBR A;  3GZX B;  1JN5 B;  2LQV A;  5HOH A;  7RNT A;  1YVB I;  1VQP 3;  1K9M 4;  1OAC A;  1UCK A;  2QEX 3;  1RGA A;  4CDL A;  2CFK A;  4NPB A;  2CG1 A;  3I0Y A;  1QVF 2;  2WO0 A;  3ZFZ A;  4X2H A;  3D9R A;  3KSP A;  4HM0 B;  1RHL A;  4XBT A;  1R4C A;  4FMD A;  4R4K A;  1BUQ A;  1G02 A;  2JQ5 A;  5AEW B;  2Y73 A;  3FKA A;  3FSD A;  4L8P A;  2OWP A;  3T8N A;  2ML6 A;  3JUN A;  1W02 A;  2KCD A;  3HI7 A;  1I8V A;  1BNI A;  2GEX A;  1TTO A;  2H0G A;  3NHX A;  4EBG A;  3DGO A;  4GHO A;  3DXO A;  1BRI A;  4AKY A;  4LSO A;  1A2V A;  1JV2 B;  2CFL A;  2CWU A;  2XF3 A;  4HM4 B;  5BVB A;  3FLJ A;  1Q9E A;  2Q07 A;  2P0X A;  1YIJ 3;  1N5P A;  3AHW A;  3BB9 A;  1B2X A;  3CU3 A;  3ZG0 A;  1AY7 A;  3NQY A;  1FGO A;  1RCL A;  4R9L A;  1ZS7 A;  1OPY A;  2WOF A;  3DUK A;  4K90 B;  3JUM A;  4PEJ A;  5CLK A;  1QAL A;  1T5Y A;  4LMI A;  1B20 A;  1TU5 A;  1VQQ A;  2QIY A;  1OGZ A;  4HOH A;  3X42 A;  2K54 A;  3NM2 A;  9RNT A;  1IK3 A;  1KC8 4;  4I5Q A;  1A90 A;  4EV5 A;  1IVX A;  1F8N A;  1RN7 A;  3CCS 3;  2CX1 A;  1M9G A;  1EUI C;  3KZT A;  1GD3 A;  4HM7 B;  5EQL A;  1VZZ A;  1SII A;  1U5O A;  3AGO A;  1BAN A;  5BXQ A;  3EC9 A;  3K0Z A;  4LYL B;  1HKX A;  3KSE D;  3WMD A;  3F14 A;  4KVH A;  4EC6 A;  3NX0 A;  3AMO A;  3KKG A;  4CPK A;  3RDE A;  3FF0 A;  3GZB A;  4IPB A;  3DGL A;  1BSA A;  1CYV A;  2BMQ B;  1DMN A;  2I9W A;  3AMO B;  3EE1 A;  1RGL A;  2P38 A;  3OX9 A;  3JUP A;  4R80 A;  4XM4 A;  1I3F A;  2STD A;  3DGN A;  3GSP A;  1FGM A;  2K3D A;  3DY5 A;  3CCU 3;  1X1X A;  3LYG A;  1Q81 4;  1FYS A;  1LQM B;  5D82 A;  4RNZ A;  4I4K A;  3X40 A;  1W6Y A;  4WP5 A;  1JJ2 2;  3DZL A;  2LYX A;  1E97 A;  2CW9 A;  1OHS A;  3STD A;  4RNY A;  1BVI A;  1BNR A;  1L5G B;  1I0V A;  3CPW 2;  1W00 A;  1B2Z A;  1NNV A;  4HZ9 B;  5JPP A;  4TX4 A;  1TRQ A;  1FGQ A;  3NBJ A;  2W9P A;  1CEW I;  5LC6 A;  3BNC A;  4KFF A;  1A2P A;  4QWT A;  3BIR A;  2C11 A;  2XSO B;  3F40 A;  1Z1S A;  3DGM A;  1R4Y A;  1YVS A;  3CNX A;  1TUH A;  3DM8 A;  3KII A;  3D4A A;  5IG5 A;  1W6C A;  1RGG A;  1STD A;  3GAX A;  4EYC A;  1UDI I;  1VQK 3;  1O7W B;  3BND A;  4OVM A;  1JZD A;  1OHO A;  4O02 B;  2J8X B;  1NJI 4;  3EBT A;  3OWS A;  4WFO A;  5M1A A;  1BIR A;  1BNG A;  5ELJ A;  1WMN A;  5AYS C;  1N8R 4;  2F86 B;  5KP1 A;  1RSN A;  2C4B A;  1ASK A;  1RJO A;  1WQL B;  5FGO A;  3OV4 A;  2CIU A;  3LTB A;  4IIA A;  2IA7 A;  1LQG C;  3CC7 3;  1OHP A;  1X1Y A;  3F7X A;  3Q3F A;  1Q86 4;  1VQ9 3;  4N6T A;  1W7C A;  2O3O A;  2ZA4 A;  3FG3 A;  1JRQ A;  1K28 A;  1NU3 A;  3PS8 A;  2WGO A;  1RN1 A;  2E2T A;  3PXM A;  1ULI B;  3CCM 3;  1MOL A;  1BRK A;  2C10 A;  3LOY A;  4BL2 A;  7STD A;  1OF5 A;  3CCV 3;  4OK0 A;  2QA4 3;  1VQO 3;  1JBT A;  3WR2 A;  1EQK A;  3QRD A;  1O7G B;  1BRG A;  2CKF B;  3FG4 A;  4JF8 A;  1OF5 B;  1ISK A;  1O7H B;  1FUW A;  2E2V A;  7GSP A;  3NBB A;  4CCV A;  2H0H A; 
#chains in the Genus database with same CATH homology
 3BLZ A;  3M8C A;  3LXU X;  5STD A;  1JB4 A;  1YGE A;  2Z77 A;  1IV7 A;  1GY7 A;  3X41 A;  4WHA A;  4RZM A;  2CWV A;  3S67 A;  4MMY B;  1NB3 I;  4O3V A;  3EX9 A;  3LTA A;  1N9E A;  3LH4 A;  1ZO2 A;  2CFW A;  1TFO A;  2CC3 A;  4HZB B;  3EHC A;  5IF6 A;  3FH1 A;  5AIF A;  3D3L A;  1GYB A;  1UI8 A;  2W56 A;  3SLU A;  3LZA A;  5G2G A;  2CH9 A;  1CYU A;  1AR0 A;  2OTJ 3;  2F98 A;  2XFS A;  2W56 B;  3X3X A;  5IG0 A;  5IG3 A;  2K0M A;  3EF8 A;  2P0M A;  1QJG A;  3MG3 A;  1WNH A;  3PGB A;  2OCT A;  2V1L A;  1UI7 A;  1GD4 A;  1VQ6 3;  4BTY A;  2XH9 A;  3H51 A;  8CHO A;  1A67 A;  5KP3 A;  1JKG A;  1IVW A;  2KXG A;  3S5C A;  4J8T A;  4GB5 A;  1W01 A;  3KFQ C;  1JKG B;  1QAK A;  2Z76 A;  2JDI H;  4HKV B;  5IG4 A;  3X3Z A;  2FNQ A;  3CC2 3;  2RCD A;  4MJD A;  4Q53 A;  1STF I;  4MMZ B;  5EVH A;  1ROA A;  4LGQ A;  5IEP A;  5HGR A;  1UW1 A;  2W03 A;  3UNL A;  3LT9 A;  3WOD G;  1ZX2 A;  1E3V A;  1N5H A;  3IJE B;  5IEN A;  2P05 A;  4HM8 B;  2HMJ B;  5D81 A;  3S28 A;  3VGN A;  3FZW A;  3CCJ 3;  3NQZ A;  3WOE B;  2UX0 A;  3UB1 A;  5CK6 A;  1RKY A;  1LVN A;  3X3Y A;  1M1K 4;  1KSI A;  4EV2 A;  2RFR A;  3PZW A;  3WA3 A;  2W0Q A;  1O7N B;  2XGN A;  2E2U A;  3WA2 X;  1Q82 4;  1OUN A;  3F8X A;  6STD A;  3RGA A;  4O8S A;  2RSX A;  4FR9 A;  2O9U X;  1RRH A;  4R9K A;  1N9J A;  5DRV A;  4N3V A;  4O2H A;  3V92 A;  2PNC A;  1DMM A;  4ZM8 A;  1W4N A;  3PCR A;  3S27 A;  1W6G A;  3CXC 2;  1NO3 A;  3CME 3;  3G16 A;  1SJW A;  2YFL B;  1TIJ A;  3NUV A;  3Q90 A;  3ALA A;  2M7O A;  3G0K A;  3EN1 B;  2B1X B;  1KQS 2;  3B4O A;  3EB8 A;  4LEH A;  4WWU C;  3IPT A;  3Q1C A;  1ROV A;  2BO9 B;  2D1W A;  3CCL 3;  5KP4 A;  3CCQ 3;  1K41 A;  2A15 A;  4XDW A;  2HMO B;  1EA2 A;  4LZI A;  1IU7 A;  3EJV A;  3K63 A;  3FGY A;  4XB5 A;  4NRE A;  1O7P B;  4KZ1 A;  1IQ8 A;  3CC4 3;  2GXF A;  1LXE A;  2HMK B;  1DVD A;  1CQS A;  3B4P A;  2CFG A;  1FGR A;  3TDG A;  3SVA A;  3UJM A;  1O7M B;  1SPU A;  1JNQ A;  3I55 3;  3MG2 A;  3JVC A;  1WMP A;  3MPH A;  2CFD A;  5TGN A;  3ECF A;  1JB5 A;  1FA3 A;  4HM3 B;  1Q42 A;  3CNM A;  5IW9 A;  3G4S 3;  3E99 A;  2GU1 A;  1C7H A;  2WOH A;  2GU3 A;  3VF1 A;  4N6M A;  3NBR A;  1SQW A;  4OUQ A;  1OH0 A;  1NWW A;  3PYJ A;  1Q7Y 4;  1OCV A;  1WMO A;  2CK3 H;  4XDV A;  2Y74 A;  4MMX B;  3OW2 2;  1YJ9 3;  1KD1 4;  3SOY A;  1IV9 A;  3RGR A;  1JB2 A;  1DYU A;  3B7C A;  3EQQ B;  4J9A A;  2CG0 A;  2W04 A;  4GL6 A;  1W2Z A;  3N8B A;  2GBW B;  2OOV C;  4HM2 B;  1D6Z A;  3EN8 A;  5FW5 A;  2INX A;  2RGQ A;  3QK9 A;  3PCS A;  1K73 4;  3SED A;  4FMA A;  1Q40 A;  1IDP A;  3B8L A;  5AIH A;  4X2O A;  2D42 A;  1V74 A;  1Y4K A;  3MKI A;  3K7C A;  3G8Z A;  3IMA B;  4JRF A;  1IVU A;  1Q40 B;  5I97 A;  2OQE C;  2FXT A;  2FGT A;  5CXO A;  2ZL8 A;  1QVG 2;  3WOF B;  5AEU B;  4FMB A;  2QGU A;  5CF2 A;  1ULJ B;  3KN4 A;  3UL6 A;  1EG9 B;  3I56 3;  2GEY A;  4HM6 B;  3N9H A;  3LML A;  1QAF A;  5ELU A;  3A76 A;  1TP6 A;  2MC8 A;  4L8O A;  5CF1 A;  2SBL A;  3FF2 A;  1RRL A;  1AVK A;  1M90 4;  4G1M B;  3F8H A;  1EKM A;  3NXJ A;  1N8Q A;  4FCJ A;  5AI1 A;  3HK4 A;  3JUQ A;  1A2K A;  4AEQ A;  4HYZ A;  2B24 B;  2XFT A;  3LT8 A;  3GRD A;  3J7Y d;  5AIG A;  5EEO A;  3UL5 A;  4L7K A;  3U1W A;  4N6N B;  4NHF A;  5IER A;  3GZR A;  2XRX B;  2GBX B;  2ML5 A;  4N6V 0;  2OTL 3;  1VQ7 3;  1LNH A;  4XBY A;  3MG1 A;  4N6O B;  3MYT A;  3CD6 3;  4H61 A;  3MHE A;  3L0R A;  3HZP A;  4N6U A;  2YFJ B;  3OWU A;  3N54 B;  3LTC A;  1PU4 A;  1GS3 A;  5DRE A;  4EXR A;  1AVL A;  2KRT A;  2W2C A;  1K8A 4;  3K9M C;  4K1V A;  2IUK A;  3OWY A;  3HIG A;  2Z7A A;  3ROB A;  3V99 A;  4K61 A;  2XEP A;  3BNB A;  1G96 A;  2IUJ A;  2BMR B;  3G71 3;  2PZV A;  1W5Z A;  4BTX A;  1OGX A;  3SX1 A;  1IQY A;  4HM5 B;  3JUO A;  1IT8 A;  4AKZ A;  2CWT A;  2BHM A;  1W2B 2;  3MSO A;  4H3U A;  2HML B;  2R4I A;  1MNL A;  4KFE A;  2L4V A;  1VQL 3;  2ZDJ A;  5AYR B;  1YJN 3;  1E3R A;  1GY6 A;  2P09 A;  5JPU A;  5LC7 A;  2Z6B A;  4HM1 B;  3CCE 3;  1S5A A;  2W9Q A;  4N6L A;  4RBN A;  1HU9 A;  3HX8 A;  4HVN A;  3OXA A;  3FG1 A;  1VQ8 3;  1VQN 3;  5D83 A;  4IT7 A;  1S72 3;  1US1 A;  3NV0 A;  3DMC A;  2WGQ A;  4K1U A;  1IQX A;  1WTH A;  4BTW A;  1M1X B;  3NV0 B;  1UUW B;  2IMJ A;  3Q2P A;  4ORL A;  3K5T A;  4WYK A;  4KFD A;  4U13 A;  2XR8 B;  2BT3 A;  4FMC A;  3WDG B;  2YFI B;  4WYK B;  3F9S A;  3ER7 A;  4R1K A;  2OOV A;  3T0U A;  5IEO A;  2XSH B;  2BMO B;  3F7S A;  3O8Y A;  1YHQ 3;  5A0O B;  4XBX A;  1D6U A;  1J2B A;  3GZY B;  3MWZ A;  3CCR 3;  1DMQ A;  2HMN B;  2XGL A;  2F99 A;  3EBY A;  2YX9 A;  3CMA 3;  1UUV B;  4STD A;  3V98 A;  5JBS A;  3HII A;  1NB5 I;  4FCZ A;  1FGT A;  3NM7 A;  2OQE A;  2CHC A;  1KWI A;  1U8C B;  1IT7 A;  3H3H A;  3VSY A;  1LOX A;  1SIH A;  1VQM 3;  1PFP A;  3G6E 3;  3BNE A;  3T8U A;  2BNG A;  2W6J H;  1D6Y A;  3CPO A;  1AV4 A;  1GY5 A;  1VQ4 3;  1VQ5 3;  1NDO B;  3S29 A;  1IVV A;  3GWR A;  1QMA A;  1TFK A;  1YIT 3;  2MF7 A;  4HJL B;  1YJW 3;  3FCS B;  3KE7 A;  2HMM B;  3U97 A;  3SOA A;  1DVC A;  4FCM A;  3SXX A;  1YI2 3;  1JN5 A;  4MEI A;  5AII A;  3LTD A;  4HBR A;  3GZX B;  1JN5 B;  2LQV A;  1YVB I;  1VQP 3;  1K9M 4;  1OAC A;  2QEX 3;  4CDL A;  2CFK A;  2CG1 A;  3I0Y A;  2WO0 A;  4X2H A;  3D9R A;  3KSP A;  4HM0 B;  4XBT A;  1R4C A;  4FMD A;  4R4K A;  1BUQ A;  2JQ5 A;  5AEW B;  2Y73 A;  3FKA A;  3FSD A;  4L8P A;  2OWP A;  3T8N A;  2ML6 A;  3JUN A;  1W02 A;  2KCD A;  3HI7 A;  2GEX A;  3NHX A;  4EBG A;  3DGO A;  3DXO A;  4AKY A;  4LSO A;  1A2V A;  1JV2 B;  2XF3 A;  2CFL A;  2CWU A;  4HM4 B;  5BVB A;  3FLJ A;  2Q07 A;  1YIJ 3;  2P0X A;  1QVF 2;  1N5P A;  3BB9 A;  3CU3 A;  3NQY A;  1FGO A;  4R9L A;  1OPY A;  2WOF A;  3DUK A;  4K90 B;  3JUM A;  4PEJ A;  5CLK A;  1QAL A;  1T5Y A;  4LMI A;  1TU5 A;  2QIY A;  1OGZ A;  3X42 A;  1KC8 4;  2K54 A;  3NM2 A;  1A90 A;  1IK3 A;  4EV5 A;  1IVX A;  1F8N A;  1RN7 A;  3CCS 3;  1M9G A;  3KZT A;  1GD3 A;  4HM7 B;  5EQL A;  1VZZ A;  1SII A;  1U5O A;  5BXQ A;  3EC9 A;  3K0Z A;  3WMD A;  1HKX A;  3KSE D;  4EC6 A;  3F14 A;  4KVH A;  3NX0 A;  3AMO A;  3KKG A;  3RDE A;  3FF0 A;  3GZB A;  4IPB A;  3DGL A;  1CYV A;  2BMQ B;  1DMN A;  2I9W A;  3AMO B;  3EE1 A;  2P38 A;  3OX9 A;  4XM4 A;  3JUP A;  4R80 A;  2STD A;  3DGN A;  1FGM A;  3DY5 A;  3CCU 3;  3LYG A;  1Q81 4;  5D82 A;  4RNZ A;  4I4K A;  3X40 A;  1W6Y A;  4WP5 A;  1JJ2 2;  3DZL A;  2LYX A;  1E97 A;  2CW9 A;  1OHS A;  3STD A;  4RNY A;  1L5G B;  3CPW 2;  1W00 A;  4HZ9 B;  5JPP A;  4TX4 A;  1FGQ A;  3NBJ A;  2W9P A;  1CEW I;  5LC6 A;  3BNC A;  4KFF A;  4QWT A;  2C11 A;  2XSO B;  3F40 A;  1Z1S A;  3DGM A;  3CNX A;  1TUH A;  3DM8 A;  3KII A;  5IG5 A;  1W6C A;  1STD A;  3GAX A;  4EYC A;  1VQK 3;  1O7W B;  3BND A;  4OVM A;  1OHO A;  4O02 B;  1NJI 4;  3EBT A;  3OWS A;  4WFO A;  5ELJ A;  1WMN A;  5AYS C;  1N8R 4;  2F86 B;  5KP1 A;  1ASK A;  1RJO A;  1WQL B;  5FGO A;  3OV4 A;  2CIU A;  3LTB A;  4IIA A;  2IA7 A;  3CC7 3;  1OHP A;  3F7X A;  1Q86 4;  1VQ9 3;  4N6T A;  1W7C A;  2O3O A;  3FG3 A;  1JRQ A;  1K28 A;  1NU3 A;  3PS8 A;  2WGO A;  2E2T A;  3PXM A;  1ULI B;  3CCM 3;  1MOL A;  2C10 A;  3LOY A;  7STD A;  3CCV 3;  1OF5 A;  2QA4 3;  4OK0 A;  1VQO 3;  1EQK A;  3QRD A;  1O7G B;  4JF8 A;  2CKF B;  3FG4 A;  1OF5 B;  1ISK A;  1O7H B;  1FUW A;  2E2V A;  3NBB A;  4CCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...