5IF6A

Structure of a computationally designed 17-ohp binder
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords OHP9_1c
total genus 32
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5if6A00
4R9KA 5DRVA 1W02A 3EHCA 5AIIA 2BMRB 5IG4A 1GY6A 4L7KA 3NV0B 1W01A 2YFJB 3HK4A 3OWSA 3EF8A 3GZBA 4XM4A 3F9SA 1EA2A 1O7HB 3I0YA 2IMJA 4WWUC 3DUKA 1A2KA 4R9LA 1UUVB 5KP3A 5STDA 3ER7A 3MG3A 2GBWB 2RFRA 3B4OA 3GRDA 2CKFB 3F8XA 3FH1A 2BMOB 5IG0A 1JN5A 3EN8A 2A15A 3F40A 2YFLB 5D82A 2HMOB 4J8TA 1EG9B 1GY5A 3JUQA 1NWWA 4XBTA 1Q40B 1OHOA 4PEJA 4LEHA 4OVMA 5AI1A 1JB5A 1OUNA 1UUWB 1OHPA 3G0KA 3UNLA 1AR0A 1O7GB 5IEPA 1JKGB 5FW5A 5D81A 5KP1A 4FCJA 3FKAA 4K1VA 4HZBB 5DREA 1GY7A 2QIYA 2I9WA 4HM6B 3GZRA 3CNMA 1QJGA 3H51A 3CPOA 1NU3A 2XR8B 4XBYA 1OPYA 4L8OA 2Z76A 3Q90A 4LMIA 4LGQA 1OGZA 4XBXA 3RGAA 4IIAA 3ROBA 2Z7AA 3JUPA 4HM8B 4WYKA 3MG2A 3JUNA 4K1UA 1SJWA 3EJVA 3IPTA 1Z1SA 3NBRA 3WMDA 3JUMA 2PZVA 3KE7A 4HZ9B 2QGUA 4XB5A 3EQQB 1JKGA 4HM1B 7STDA 5AIGA 1K41A 3KKGA 4MJDA 2F99A 1ASKA 1O7NB 1Q40A 3D9RA 3NUVA 1E97A 2W2CA 2XRXB 1C7HA 1OCVA 4HM0B 4KVHA 3SEDA 6STDA 4WYKB 1JB2A 1VZZA 2K54A 3GZXB 5CF1A 5JPPA 1NDOB 2HMMB 3BLZA 5IG5A 3BB9A 3HZPA 3KZTA 2GBXB 3T8UA 2OWPA 3CU3A 3NXJA 1Q42A 2GEXA 5IEOA 2UX0A 4CDLA 5IERA 2BMQB 3F7XA 5CLKA 3EC9A 3FLJA 1CQSA 3NV0A 5D83A 1HKXA 3NM2A 1OH0A 1W6YA 2B1XB 3OX9A 3MKIA 5CF2A 1DMNA 1ISKA 3A76A 1GYBA 2HMLB 3E99A 1STDA 4FCMA 4ORLA 4X2OA 1TP6A 3RGRA 3K7CA 3DMCA 1O7MB 1QMAA 3B4PA 5BXQA 2B24B 1ZO2A 1ZX2A 4XDWA 1JN5B 2GEYA 3B8LA 3MG1A 5BVBA 3FF2A 3FSDA 3H3HA 4R1KA 3EX9A 5HGRA 1OGXA 3VSYA 3NHXA 5AEWB 3OV4A 3DZLA 4RZMA 4HM4B 5EVHA 1E3VA 5G2GA 5TGNA 3UJMA 5IG3A 1WQLB 2HMJB 1S5AA 2R4IA 3F14A 5IF6A 3GWRA 4H3UA 3ECFA 4WP5A 3VGNA 1DMMA 3LZAA 1IDPA 1O7PB 3JUOA 1JB4A 2F98A 3CNXA 3S5CA 2Z77A 2STDA 3SOAA 3K0ZA 2GXFA 2HMKB 4U13A 4X2HA 1ULJB 2YFIB 3OWUA 3FF0A 3LYGA 3EBYA 2JQ5A 1OF5A 3F7SA 1OF5B 3MYTA 3MHEA 3F8HA 4HJLB 2F86B 1ULIB 4HM3B 3EN1B 4J9AA 3SOYA 3OXAA 1TUHA 1E3RA 5CXOA 4N3VA 3M8CA 5IENA 3MSOA 1OHSA 3DXOA 2XSOB 2HMNB 4OUQA 4XDVA 3EBTA 3HX8A 3B7CA 3GZYB 2CHCA 4L8PA 4HVNA 3FGYA 5JPUA 3G8ZA 5KP4A 1U5OA 5AIFA 1O7WB 8CHOA 2RCDA 3FZWA 5CK6A 3STDA 3DM8A 4I4KA 4STDA 1BUQA 1W00A 4Q53A 3OWYA 2BNGA 5AIHA 1GS3A 2INXA 4HKVB 3G16A 5AEUB 3T8NA 4HM5B 2RGQA 3KSPA 4HM2B 2XSHB 4HM7B 4GB5A 1DMQA
chains in the Genus database with same CATH superfamily
3PGBA 3EHCA 3SX1A 1JZDA 1RCLA 1F8NA 2C4BA 4FMCA 2YFJB 3HK4A 3EF8A 3GZBA 4J5GA 3BIRA 1X1XA 1IYYA 5STDA 1UUVB 1IQ8A 2F56A 1YJW3 2RFRA 3SVAA 2WOHA 3FH1A 5IG0A 3EN8A 3QK9A 3V92A 3F40A 1UUGB 5AYSC 3J7Yd 1GY5A 1I2FA 1TFOA 5GSPA 1LRAA 3JUQA 1M1K4 1OHOA 2YX9A 1JB5A 2O3OA 2Y73A 3UNLA 2P0XA 4BTYA 4FCJA 4K1VA 3U97A 1JJ22 2QIYA 2IUJA 3CNMA 1QJGA 1WMPA 3CCQ3 2OCTA 5IW9A 1ROAA 1NU3A 2WO0A 2XR8B 1Y4KA 4N6NB 4XBYA 5BIRA 3Q90A 1OGZA 4XBXA 4FMAA 1IU7A 3MG2A 1N5HA 1MWSA 2PNCA 1SARA 3JUMA 3KE7A 4RNTA 1CYUA 1VQM3 4OK0A 1JKGA 2E2UA 5AIGA 3KKGA 1UDII 1RN4A 1O7NB 4LSOA 3NUVA 1MOLA 2O9UX 4WHAA 3CCV3 2XRXB 1C7HA 2KCDA 2OQEC 8RNTA 3S67A 1IT8A 2K54A 2W0QA 3UB1A 2HMMB 1RRHA 1W2B2 2RSXA 1VQ83 1MGWA 1ZGXA 4FR9A 3D79A 4G1MB 3T8UA 4AKZA 3WA2X 2UX0A 4KFEA 3Q2PA 1ROVA 3F7XA 4O3VA 5CLKA 1GMRA 1HKXA 3PCSA 3CCU3 2B1XB 3O8YA 2HMLB 3AGNA 1IQYA 3CCJ3 1BRGA 1QMAA 1ZX2A 1M1XB 4XDWA 1B2SA 1U8CB 3WHOA 1GMPA 3D3LA 5AEWB 2FXTA 1FUWA 1OGXA 3L0RA 1MNLA 1STFI 2W9PA 3DH2A 5EVHA 3CC73 1VQK3 5G2GA 1UCLA 1RMSA 1S5AA 4JRFA 3CC43 4ILFA 3GWRA 5RNTA 3CCE3 4WP5A 1BRJA 3HI7A 3JUOA 1LQMB 5ELUA 2KXGA 3BNDA 4BL2A 4MEIA 1TRPA 3LTCA 3I563 1JNQA 1HYFA 1YHQ3 2Y74A 1K9M4 2W6JH 3LYGA 4CPKA 1GSPA 4HJLB 1OF5A 4HM4B 1Q824 4HM3B 2UUGC 1ULIB 2CWTA 2AAEA 3OXAA 2UGIA 3DGOA 2GU3A 1RCKA 2XSOB 4O2HA 1B27A 4XDVA 4K61A 3HX8A 1FGQA 4HAAA 4CCVA 1I0XA 1R4YA 1BNSA 1N8QA 3LOYA 4RNZA 1O7WB 2RCDA 1Q814 3MPHA 1N8R4 3DGNA 2BNGA 1B2ZA 2INXA 2MF7A 1JBTA 3ZG0A 2QA43 1Q9EA 3KSPA 4JF8A 4HM7B 1PFPA 4R1KA 1I2GA 4R9KA 5DRVA 4AEQA 4BIRA 1B2MA 4GSPA 3CMA3 3N8BA 1FA3A 1AV4A 3FG4A 1W01A 2MC8A 2C10A 4XM4A 1GOVA 3NQZA 1KSIA 3I0YA 3RGRA 3NM7A 1DYUA 4N6MA 1RGGA 3CME3 1RRLA 2KF6A 1LVNA 2XEPA 2CKFB 3F8XA 3GRDA 1JN5A 3Q1CA 2CFDA 1VQP3 2HMOB 3LXUX 1US1A 1BUJA 1AY7A 2QEX3 1WNHA 3KFQC 3CC23 1NWWA 4XBTA 4PEJA 4LEHA 2AADA 3Q3FA 3S28A 1NO3A 1O7GB 5IEPA 5M18A 4HOHA 1FGMA 3S29A 3FKAA 3NBJA 1TRQA 1QVF2 1GY7A 1IQXA 3X3XA 1UCIA 1RLSA 1T3BA 3H51A 1EEJA 4J5KA 1PY3A 2CWUA 1BSEA 4L8OA 4LYLB 5ELJA 1VQQA 2Z76A 2P38A 4IIAA 2Z7AA 2BO9B 4KT3B 4K1UA 1A2VA 1BRKA 1SJWA 3EJVA 1YNVX 4KZ1A 4HZ9B 3EQQB 7STDA 3I553 1I8VA 2ML5A 1WTHA 3ALAA 1PU4A 2L1SA 3D9RA 1GOYA 1Q40A 4IPBA 2K0MA 1EQKA 4KVHA 4ZM8A 1FYSA 4WYKB 1X1UA 1VZZA 4IT7A 1N9EA 1B3SA 1NDOB 2XGNA 1DE3A 1PYLA 2V1LA 4WFOA 3HZPA 1C54A 2GBXB 3PYJA 2H0GA 3HOHA 4CDLA 5IERA 1B21A 3LH4A 2BMQB 1BSCA 2KF5A 1CQSA 1FZUA 2CC3A 3NV0A 5D83A 3PCRA 3NM2A 1YJ93 1OH0A 2OTL3 1VQN3 1NJI4 2R41A 1TU5A 3MKIA 2XFSA 5HOHA 2CG1A 5LC6A 4FMDA 3DMCA 1O7MB 1BNGA 3JVCA 3B4PA 1QAFA 1FGRA 2B24B 1B2UA 1CYVA 1RNTA 4R80A 4EXRA 1JN5B 2GEYA 2GSPA 1NB5I 3IMAB 3H3HA 3FSDA 3PXMA 5HGRA 5A0OB 1BRIA 4GL6A 3NHXA 4NPBA 1K28A 3DZLA 4RZMA 5IG3A 1FGOA 1V74A 5JPUA 1KD14 4EC6A 3WR2A 2CWVA 5IF6A 3LTDA 1LOVA 1LNIA 3V98A 1IV9A 1RGEA 3CNXA 3S5CA 1RKYA 2STDA 1RGAA 1WMNA 2GXFA 4NREA 3FG1A 3G6E3 1QALA 1T2HA 1RNBA 4CJNA 3CXC2 3MYTA 3MHEA 1L5GB 3AGOA 3EN1B 1G96A 1W4NA 3X41A 1E3RA 1YVBI 4N3VA 3CCR3 5IENA 1BGSA 1FUSA 1OHSA 1M904 3UL5A 6RNTA 3EBTA 1JV2B 1LOXA 1SIIA 3FGYA 1YGWA 2SBLA 5KP4A 1U5OA 1SPUA 4TX4A 5AIFA 1RGFA 1BU4A 5CK6A 1Q7HA 4I4KA 1BUQA 3LTBA 1W00A 1S723 3G16A 5G1KA 2IUKA 1YJN3 4HM5B 2RGQA 1BNJA 3LZAA 5I97A 4GB5A 3LT8A 4O8SA 1W02A 3RDEA 3CCL3 5AIIA 1KC84 1GY6A 3D5IA 3KN4A 3NV0B 3D5GA 3F9SA 3AMOA 1O7HB 2W56A 4H61A 3ZG5A 9RNTA 2IMJA 4WWUC 3WODG 1A2KA 1Q7Y4 1RN1A 2XFTA 1YI23 2GBWB 3B4OA 3GSPA 1W2ZA 2RNTA 1TIJA 1R4CA 2WGOA 1RGKA 2E2VA 4J8TA 1JZOA 2CK3H 1D6YA 5D82A 3CCM3 2IYJA 3QRDA 1MWTA 2CIUA 1Q40B 4EV5A 1GMQA 1GD4A 2KRTA 2KAAA 4OVMA 3X3YA 3G4S3 2SARA 5M1AA 1AR0A 4MMZB 5FW5A 2OQEA 2K3DA 3BU4A 4HZBB 1RTUA 5DREA 2ZL8A 3T0UA 2CX0A 3CPOA 3FCSB 3SYUA 1AQZA 1RDSA 4BTXA 1OPYA 1QAKA 4N6V0 4LMIA 4EBGA 2D1WA 3OW22 3RGAA 2W56B 3ROBA 4BU4A 2BU4A 3JUPA 4HM8B 4WYKA 3N9HA 3CD63 1I3FA 4FCZA 2ML6A 3IPTA 3NBRA 1Z1SA 1DETA 1N9JA 2WGQA 4I5QA 2PZVA 4XB5A 1FW7A 4HM1B 3KSED 1J2BA 1K41A 4MJDA 1GOUA 2F99A 4KFFA 2RBIA 1EKMA 1ASKA 1Q864 4O02B 1E97A 3BNCA 1OCVA 1I2EA 1RHLA 1BSBA 1IT7A 1BRHA 1JB2A 3FG3A 5CF1A 1DVDA 1LNHA 1KQS2 2HOHA 2BHMA 5IG5A 1WMOA 3KZTA 1BSAA 2OWPA 3RNTA 2L4VA 3CU3A 5FGOA 3NXJA 1Q42A 2GEXA 5IEOA 4EYCA 1I70A 4BL3A 3FLJA 1LXEA 3KIIA 2W9QA 1OACA 3OX9A 1BSDA 1FUTA 1YVSA 2IY2A 1G02A 1IVXA 1TTOA 4MMYB 5EQLA 4FCMA 5CF2A 1STDA 7GSPA 1BRNL 1BNFA 3K63A 1YGEA 1VQ93 5JBSA 5BXQA 2CFLA 1BNEA 1ZO2A 3KCHA 3PS8A 4MMXB 1B20A 4LZIA 1UCKA 3B8LA 5BVBA 4NHFA 3VSYA 3EX9A 4R4KA 4AKYA 3OV4A 1IVVA 1MGRA 3UJMA 1E3VA 2HMJB 2R4IA 3F14A 1X1WA 4KFDA 2CFKA 4QWTA 2CW9A 4RNYA 4HYZA 3ECFA 3VGNA 3DY5A 1DMMA 3GAXA 1JBRA 1O7PB 1JB4A 4N6TA 2Z77A 3K0ZA 1BNIA 2HMKB 5BU4A 3UL6A 1G0TA 2YFIB 1BANA 3F7SA 1OF5B 1N5PA 3EE1A 2F86B 5AYRB 1T2IA 5M19A 1TUHA 2J8XB 3U1WA 1VQL3 2CX1A 2W04A 3M8CA 3URPA 1RGLA 3DXOA 4OUQA 2P0MA 2XGLA 2H0IA 1D6UA 4N6LA 1A67A 3GZYB 2CHCA 4HVNA 1RGHA 8CHOA 3DM8A 4STDA 4Q53A 4K90B 3SLUA 5AIHA 3T8NA 1VQ73 1IVUA 2F4YA 1GS3A 1DMQA 1LQGC 3BNBA 3V99A 5IG4A 2BMRB 2F5MA 2LQVA 4L7KA 3OWSA 3X40A 4GHOA 1EA2A 1V58A 1BRSA 3DUKA 5KP3A 4R9LA 1VQO3 1A90A 3ER7A 1MWUA 3MG3A 3WA3A 3NX0A 3CCS3 1FGTA 1IVWA 2BMOB 2ZHXB 2A15A 2YFLB 1BOXA 1EG9B 1BAOA 1HZ1A 3AMOB 3AHSA 1DVCA 2CFGA 5AI1A 2OOVA 1IK3A 1K734 1OUNA 1UUWB 1OHPA 2P05A 3G0KA 5G1LA 1JKGB 5D81A 5KP1A 1CH0A 1I3IA 1NNVA 1GD3A 4HM6B 2I9WA 3GZRA 3EB8A 4N6UA 1BIRA 2OTJ3 2F5WA 3WDGB 5EEOA 3X42A 3DGYA 3HIIA 2W03A 4LGQA 1YIT3 3LT9A 7RNTA 3JUNA 2C11A 1SIHA 2Z6BA 1W6GA 3WMDA 1VQ53 1BNRA 1UW1A 2QGUA 4EV2A 1I0VA 2FNQA 1TFKA 2FGTA 3LMLA 3CPW2 2W2CA 1K8A4 4HM0B 4DKIA 3SEDA 5LC7A 6STDA 1MWRA 1CEWI 3GZXB 2P09A 5JPPA 1SQWA 3BLZA 2CG0A 3BB9A 3ZFZA 4X2OA 1UI7A 3WOFB 3PZWA 1EUIC 1IV7A 3S27A 1UGIA 3EC9A 1V57A 3IJEB 1W6YA 4EW5A 1JBSA 1ISKA 1DMNA 2WOFA 3A76A 1GYBA 1RSNA 1W5ZA 1RGCA 1X1YA 1UGHI 3E99A 1TP6A 4ORLA 2E2TA 1M9GA 3DGLA 3K7CA 2KF3A 1UI8A 3MG1A 3NBBA 1YIJ3 2D42A 3MWZA 3FF2A 2CFWA 1JRQA 3K9MC 2H0HA 3K5TA 2XF3A 3BNEA 5TGNA 1D6ZA 1TJDA 1WQLB 2JDIH 3TDGA 1VQ43 1BVIA 4H3UA 6GSPA 1KWIA 3WOEB 1IDPA 1LOYA 2GU1A 2CH9A 3SXXA 2F98A 1HU9A 3SOAA 3NQYA 3HIGA 4U13A 2KF4A 1UCJA 4X2HA 1ULJB 2LYXA 3OWUA 2ZDJA 3FF0A 3G713 3EBYA 2JQ5A 1QVG2 3N54B 4J9AA 3SOYA 3F8HA 3VF1A 3X3ZA 2OOVC 1B2XA 4BTWA 1RN7A 2ZA4A 3A5EA 5CXOA 1A2PA 1VQ63 2BT3A 3MSOA 1LOWA 2IA7A 2HMNB 2M7OA 4HBRA 4L8PA 3AHWA 3B7CA 2BIRA 3LTAA 3G8ZA 1W7CA 4RBNA 2XH9A 4N6OB 3FZWA 4FMBA 3STDA 3D4AA 3OWYA 4HKVB 2Q07A 5AEUB 3DGMA 1W6CA 1T5YA 1AVLA 1ZS7A 2XSHB 4HM2B 1NB3I 1AVKA 1RJOA
chains in the Genus database with same CATH topology
3PGBA 3EHCA 3SX1A 1F8NA 4FMCA 2YFJB 3HK4A 3EF8A 3GZBA 5STDA 1UUVB 1IQ8A 1YJW3 2RFRA 3SVAA 2WOHA 3FH1A 5IG0A 3EN8A 3QK9A 3V92A 3F40A 5AYSC 3J7Yd 1GY5A 1TFOA 3JUQA 1M1K4 1OHOA 2YX9A 1JB5A 2O3OA 2Y73A 3UNLA 2P0XA 4BTYA 4FCJA 4K1VA 3U97A 1JJ22 2QIYA 2IUJA 3CNMA 1QJGA 1WMPA 3CCQ3 2OCTA 5IW9A 1ROAA 1NU3A 2WO0A 2XR8B 1Y4KA 4N6NB 4XBYA 3Q90A 1OGZA 4XBXA 4FMAA 1IU7A 3MG2A 1N5HA 2PNCA 3JUMA 3KE7A 1CYUA 1VQM3 4OK0A 1JKGA 2E2UA 5AIGA 3KKGA 1O7NB 4LSOA 3NUVA 1MOLA 2O9UX 4WHAA 3CCV3 2XRXB 1C7HA 2KCDA 2OQEC 3S67A 1IT8A 2K54A 2W0QA 3UB1A 2HMMB 1RRHA 1W2B2 2RSXA 1VQ83 4G1MB 4FR9A 4AKZA 3T8UA 3WA2X 2UX0A 4KFEA 3Q2PA 1ROVA 3F7XA 4O3VA 5CLKA 1HKXA 3PCSA 3CCU3 2B1XB 3O8YA 2HMLB 1IQYA 3CCJ3 1QMAA 1M1XB 1ZX2A 4XDWA 1U8CB 3D3LA 5AEWB 2FXTA 1FUWA 1OGXA 3L0RA 1MNLA 1STFI 2W9PA 5EVHA 3CC73 1VQK3 5G2GA 3CC43 1S5AA 4JRFA 3GWRA 3CCE3 4WP5A 3HI7A 3JUOA 5ELUA 2KXGA 3BNDA 4MEIA 3LTCA 3I563 1JNQA 1YHQ3 2Y74A 1K9M4 2W6JH 3LYGA 4HJLB 1OF5A 4HM4B 1Q824 4HM3B 1ULIB 2CWTA 3OXAA 3DGOA 2GU3A 2XSOB 4O2HA 4XDVA 4K61A 3HX8A 1FGQA 4CCVA 3LOYA 1N8QA 4RNZA 1O7WB 2RCDA 1Q814 3MPHA 1N8R4 3DGNA 2BNGA 2INXA 2MF7A 2QA43 3KSPA 4JF8A 4HM7B 1PFPA 4R1KA 4R9KA 5DRVA 4AEQA 1FA3A 3CMA3 3N8BA 1AV4A 3FG4A 1W01A 2MC8A 2C10A 4XM4A 3NQZA 1KSIA 3I0YA 3NM7A 1DYUA 4N6MA 3CME3 1RRLA 2XEPA 1LVNA 3GRDA 2CKFB 3F8XA 1JN5A 3Q1CA 2CFDA 1VQP3 2HMOB 3LXUX 1US1A 2QEX3 1WNHA 3KFQC 3CC23 1NWWA 4XBTA 4PEJA 4LEHA 3S28A 1NO3A 1O7GB 5IEPA 1FGMA 3S29A 3FKAA 3NBJA 1QVF2 1GY7A 1IQXA 3H51A 2CWUA 4L8OA 5ELJA 2Z76A 2P38A 4IIAA 2Z7AA 2BO9B 4K1UA 1A2VA 1SJWA 3EJVA 4KZ1A 4HZ9B 3EQQB 7STDA 3I553 2ML5A 1WTHA 3ALAA 1PU4A 3D9RA 1Q40A 4IPBA 2K0MA 1EQKA 4KVHA 4ZM8A 4WYKB 1VZZA 4IT7A 1N9EA 1NDOB 2XGNA 4WFOA 2V1LA 3HZPA 2GBXB 3PYJA 4CDLA 5IERA 3LH4A 2BMQB 1CQSA 3NV0A 2CC3A 5D83A 1YJ93 3PCRA 3NM2A 2OTL3 1OH0A 1VQN3 1NJI4 1TU5A 3MKIA 2XFSA 2CG1A 5LC6A 4FMDA 3DMCA 1O7MB 3X3XA 3JVCA 3B4PA 1QAFA 1FGRA 1CYVA 2B24B 4R80A 4EXRA 1JN5B 2GEYA 1NB5I 3IMAB 3H3HA 3FSDA 3PXMA 5HGRA 5A0OB 4GL6A 3NHXA 1KD14 1K28A 3DZLA 4RZMA 5IG3A 1FGOA 1V74A 5JPUA 4EC6A 2CWVA 5IF6A 3LTDA 3V98A 1IV9A 3CNXA 3S5CA 1RKYA 2STDA 1WMNA 2GXFA 4NREA 3FG1A 3G6E3 1QALA 3CXC2 3MYTA 3MHEA 1L5GB 3EN1B 1G96A 1W4NA 3X41A 1E3RA 1YVBI 4N3VA 3CCR3 5IENA 1OHSA 1M904 3UL5A 3EBTA 1JV2B 1LOXA 1SIIA 3FGYA 5KP4A 2SBLA 1U5OA 1SPUA 4TX4A 5AIFA 5CK6A 1BUQA 4I4KA 3LTBA 1W00A 1S723 3G16A 2IUKA 1YJN3 4HM5B 2RGQA 3LZAA 5I97A 4GB5A 3LT8A 4O8SA 1W02A 3RDEA 3CCL3 5AIIA 1KC84 1GY6A 3KN4A 3NV0B 3F9SA 3AMOA 1O7HB 2W56A 4H61A 1Q7Y4 2IMJA 4WWUC 3WODG 1A2KA 2XFTA 1YI23 2GBWB 3B4OA 1W2ZA 1TIJA 1R4CA 2WGOA 5D82A 2E2VA 4J8TA 1D6YA 2CK3H 3CCM3 3QRDA 2CIUA 1Q40B 4EV5A 1GD4A 2KRTA 4OVMA 3X3YA 3G4S3 1AR0A 4MMZB 5FW5A 2OQEA 4HZBB 5DREA 2ZL8A 3T0UA 3CPOA 3FCSB 4BTXA 1OPYA 1QAKA 4N6V0 4LMIA 4EBGA 2D1WA 3OW22 3RGAA 2W56B 3ROBA 3CD63 3JUPA 4HM8B 4WYKA 3N9HA 4FCZA 2ML6A 3IPTA 3NBRA 1Z1SA 1N9JA 2WGQA 2PZVA 4XB5A 4HM1B 3KSED 1J2BA 1K41A 4MJDA 4KFFA 2F99A 1EKMA 1ASKA 1Q864 4O02B 1E97A 3BNCA 1OCVA 1IT7A 3FG3A 1JB2A 1DVDA 5CF1A 1LNHA 1KQS2 2BHMA 5IG5A 1WMOA 3KZTA 2OWPA 2L4VA 3CU3A 5FGOA 3NXJA 1Q42A 2GEXA 5IEOA 4EYCA 3FLJA 1LXEA 3KIIA 2W9QA 1OACA 3OX9A 5CF2A 4MMYB 1IVXA 5EQLA 4FCMA 1STDA 1VQ93 3K63A 1YGEA 5JBSA 5BXQA 2CFLA 1ZO2A 3PS8A 4MMXB 4LZIA 3B8LA 5BVBA 4NHFA 3VSYA 3EX9A 4R4KA 4AKYA 3OV4A 1IVVA 3UJMA 1E3VA 2HMJB 2R4IA 3F14A 4KFDA 2CFKA 4QWTA 2CW9A 4RNYA 4HYZA 3ECFA 3VGNA 3DY5A 1DMMA 3GAXA 1O7PB 1JB4A 4N6TA 2Z77A 3K0ZA 2HMKB 3UL6A 2YFIB 3F7SA 1OF5B 1N5PA 3EE1A 2F86B 5AYRB 1TUHA 3U1WA 1VQL3 2W04A 3M8CA 3DXOA 4OUQA 2P0MA 2XGLA 4N6LA 1D6UA 1A67A 3GZYB 2CHCA 4HVNA 8CHOA 3DM8A 4STDA 4Q53A 4K90B 3SLUA 5AIHA 3T8NA 1VQ73 1IVUA 1GS3A 1DMQA 3V99A 3BNBA 5IG4A 2BMRB 2LQVA 4L7KA 3OWSA 3X40A 1EA2A 3DUKA 5KP3A 4R9LA 1VQO3 1A90A 3ER7A 3MG3A 3WA3A 3NX0A 3CCS3 1FGTA 1IVWA 2BMOB 2A15A 2YFLB 1EG9B 3AMOB 5AI1A 1DVCA 2CFGA 2OOVA 1IK3A 1K734 1OUNA 1UUWB 1OHPA 2P05A 3G0KA 1JKGB 5D81A 5KP1A 1GD3A 4HM6B 2I9WA 3GZRA 3EB8A 4N6UA 2OTJ3 3WDGB 5EEOA 3X42A 3HIIA 2W03A 4LGQA 1YIT3 3LT9A 3JUNA 2C11A 1SIHA 2Z6BA 1W6GA 3WMDA 1VQ53 1UW1A 2QGUA 4EV2A 2FNQA 1TFKA 2FGTA 3LMLA 3CPW2 2W2CA 1K8A4 4HM0B 3SEDA 5LC7A 6STDA 3GZXB 1CEWI 2P09A 5JPPA 1SQWA 3BLZA 2CG0A 3BB9A 1UI7A 3WOFB 3PZWA 1IV7A 3S27A 3EC9A 3IJEB 1W6YA 1ISKA 1DMNA 2WOFA 3A76A 1GYBA 1W5ZA 3E99A 4ORLA 4X2OA 3RGRA 1TP6A 2E2TA 1M9GA 3DGLA 3K7CA 1UI8A 3MG1A 3NBBA 1YIJ3 2D42A 3MWZA 3FF2A 2CFWA 1JRQA 3K9MC 3K5TA 2XF3A 3BNEA 5TGNA 1D6ZA 1WQLB 2JDIH 3TDGA 1VQ43 4H3UA 1KWIA 3WOEB 1IDPA 2GU1A 2CH9A 3SXXA 2F98A 1HU9A 3SOAA 3NQYA 3HIGA 4U13A 4X2HA 1ULJB 2LYXA 3OWUA 2ZDJA 3FF0A 3G713 3EBYA 2JQ5A 1QVG2 3N54B 4J9AA 3SOYA 3F8HA 3VF1A 3X3ZA 2OOVC 4BTWA 1RN7A 5CXOA 1VQ63 2BT3A 3MSOA 2IA7A 2HMNB 2M7OA 4HBRA 4L8PA 3B7CA 3LTAA 3G8ZA 1W7CA 4RBNA 2XH9A 4N6OB 3FZWA 4FMBA 3STDA 3OWYA 4HKVB 2Q07A 5AEUB 3DGMA 1W6CA 1T5YA 1AVLA 4HM2B 2XSHB 1NB3I 1AVKA 1RJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9K A;  5DRV A;  1W02 A;  3EHC A;  5AII A;  2BMR B;  5IG4 A;  1GY6 A;  4L7K A;  3NV0 B;  1W01 A;  2YFJ B;  3HK4 A;  3OWS A;  3EF8 A;  3GZB A;  4XM4 A;  3F9S A;  1EA2 A;  1O7H B;  3I0Y A;  2IMJ A;  4WWU C;  3DUK A;  1A2K A;  4R9L A;  1UUV B;  5KP3 A;  5STD A;  3ER7 A;  3MG3 A;  2GBW B;  2RFR A;  3B4O A;  3GRD A;  2CKF B;  3F8X A;  3FH1 A;  2BMO B;  5IG0 A;  1JN5 A;  3EN8 A;  2A15 A;  3F40 A;  2YFL B;  5D82 A;  2HMO B;  4J8T A;  1EG9 B;  1GY5 A;  3JUQ A;  1NWW A;  4XBT A;  1Q40 B;  1OHO A;  4PEJ A;  4LEH A;  4OVM A;  5AI1 A;  1JB5 A;  1OUN A;  1UUW B;  1OHP A;  3G0K A;  3UNL A;  1AR0 A;  1O7G B;  5IEP A;  1JKG B;  5FW5 A;  5D81 A;  5KP1 A;  4FCJ A;  3FKA A;  4K1V A;  4HZB B;  5DRE A;  1GY7 A;  2QIY A;  2I9W A;  4HM6 B;  3GZR A;  3CNM A;  1QJG A;  3H51 A;  3CPO A;  1NU3 A;  2XR8 B;  4XBY A;  1OPY A;  4L8O A;  2Z76 A;  3Q90 A;  4LMI A;  4LGQ A;  1OGZ A;  4XBX A;  3RGA A;  4IIA A;  3ROB A;  2Z7A A;  3JUP A;  4HM8 B;  4WYK A;  3MG2 A;  3JUN A;  4K1U A;  1SJW A;  3EJV A;  3IPT A;  1Z1S A;  3NBR A;  3WMD A;  3JUM A;  2PZV A;  3KE7 A;  4HZ9 B;  2QGU A;  4XB5 A;  3EQQ B;  1JKG A;  4HM1 B;  7STD A;  5AIG A;  1K41 A;  3KKG A;  4MJD A;  2F99 A;  1ASK A;  1O7N B;  1Q40 A;  3D9R A;  3NUV A;  1E97 A;  2W2C A;  2XRX B;  1C7H A;  1OCV A;  4HM0 B;  4KVH A;  3SED A;  6STD A;  4WYK B;  1JB2 A;  1VZZ A;  2K54 A;  3GZX B;  5CF1 A;  5JPP A;  1NDO B;  2HMM B;  3BLZ A;  5IG5 A;  3BB9 A;  3HZP A;  3KZT A;  2GBX B;  3T8U A;  2OWP A;  3CU3 A;  3NXJ A;  1Q42 A;  2GEX A;  5IEO A;  2UX0 A;  4CDL A;  5IER A;  2BMQ B;  3F7X A;  5CLK A;  3EC9 A;  3FLJ A;  1CQS A;  3NV0 A;  5D83 A;  1HKX A;  3NM2 A;  1OH0 A;  1W6Y A;  2B1X B;  3OX9 A;  3MKI A;  5CF2 A;  1DMN A;  1ISK A;  3A76 A;  1GYB A;  2HML B;  3E99 A;  1STD A;  4FCM A;  4ORL A;  4X2O A;  1TP6 A;  3RGR A;  3K7C A;  3DMC A;  1O7M B;  1QMA A;  3B4P A;  5BXQ A;  2B24 B;  1ZO2 A;  1ZX2 A;  4XDW A;  1JN5 B;  2GEY A;  3B8L A;  3MG1 A;  5BVB A;  3FF2 A;  3FSD A;  3H3H A;  4R1K A;  3EX9 A;  5HGR A;  1OGX A;  3VSY A;  3NHX A;  5AEW B;  3OV4 A;  3DZL A;  4RZM A;  4HM4 B;  5EVH A;  1E3V A;  5G2G A;  5TGN A;  3UJM A;  5IG3 A;  1WQL B;  2HMJ B;  1S5A A;  2R4I A;  3F14 A;  5IF6 A;  3GWR A;  4H3U A;  3ECF A;  4WP5 A;  3VGN A;  1DMM A;  3LZA A;  1IDP A;  1O7P B;  3JUO A;  1JB4 A;  2F98 A;  3CNX A;  3S5C A;  2Z77 A;  2STD A;  3SOA A;  3K0Z A;  2GXF A;  2HMK B;  4U13 A;  4X2H A;  1ULJ B;  2YFI B;  3OWU A;  3FF0 A;  3LYG A;  3EBY A;  2JQ5 A;  1OF5 A;  3F7S A;  1OF5 B;  3MYT A;  3MHE A;  3F8H A;  4HJL B;  2F86 B;  1ULI B;  4HM3 B;  3EN1 B;  4J9A A;  3SOY A;  3OXA A;  1TUH A;  1E3R A;  5CXO A;  4N3V A;  3M8C A;  5IEN A;  3MSO A;  1OHS A;  3DXO A;  2XSO B;  2HMN B;  4OUQ A;  4XDV A;  3EBT A;  3HX8 A;  3B7C A;  3GZY B;  2CHC A;  4L8P A;  4HVN A;  3FGY A;  5JPU A;  3G8Z A;  5KP4 A;  1U5O A;  5AIF A;  1O7W B;  8CHO A;  2RCD A;  3FZW A;  5CK6 A;  3STD A;  3DM8 A;  4I4K A;  4STD A;  1BUQ A;  1W00 A;  4Q53 A;  3OWY A;  2BNG A;  5AIH A;  1GS3 A;  2INX A;  4HKV B;  3G16 A;  5AEU B;  3T8N A;  4HM5 B;  2RGQ A;  3KSP A;  4HM2 B;  2XSH B;  4HM7 B;  4GB5 A;  1DMQ A; 
#chains in the Genus database with same CATH topology
 3PGB A;  3EHC A;  3SX1 A;  1JZD A;  1RCL A;  1F8N A;  2C4B A;  4FMC A;  2YFJ B;  3HK4 A;  3EF8 A;  3GZB A;  4J5G A;  3BIR A;  1X1X A;  1IYY A;  5STD A;  1UUV B;  1IQ8 A;  2F56 A;  1YJW 3;  2RFR A;  3SVA A;  2WOH A;  3FH1 A;  5IG0 A;  3EN8 A;  3QK9 A;  3V92 A;  3F40 A;  1UUG B;  5AYS C;  3J7Y d;  1GY5 A;  1I2F A;  1TFO A;  5GSP A;  1LRA A;  3JUQ A;  1M1K 4;  1OHO A;  2YX9 A;  1JB5 A;  2O3O A;  2Y73 A;  3UNL A;  2P0X A;  4BTY A;  4FCJ A;  4K1V A;  3U97 A;  1JJ2 2;  2QIY A;  2IUJ A;  3CNM A;  1QJG A;  1WMP A;  3CCQ 3;  2OCT A;  5IW9 A;  1ROA A;  1NU3 A;  2WO0 A;  2XR8 B;  1Y4K A;  4N6N B;  4XBY A;  5BIR A;  3Q90 A;  1OGZ A;  4XBX A;  4FMA A;  1IU7 A;  3MG2 A;  1N5H A;  1MWS A;  2PNC A;  1SAR A;  3JUM A;  3KE7 A;  4RNT A;  1CYU A;  1VQM 3;  4OK0 A;  1JKG A;  2E2U A;  5AIG A;  3KKG A;  1UDI I;  1RN4 A;  1O7N B;  4LSO A;  3NUV A;  1MOL A;  2O9U X;  4WHA A;  3CCV 3;  2XRX B;  1C7H A;  2KCD A;  2OQE C;  8RNT A;  3S67 A;  1IT8 A;  2K54 A;  2W0Q A;  3UB1 A;  2HMM B;  1RRH A;  1W2B 2;  2RSX A;  1VQ8 3;  1MGW A;  1ZGX A;  4FR9 A;  3D79 A;  4G1M B;  3T8U A;  4AKZ A;  3WA2 X;  2UX0 A;  4KFE A;  3Q2P A;  1ROV A;  3F7X A;  4O3V A;  5CLK A;  1GMR A;  1HKX A;  3PCS A;  3CCU 3;  2B1X B;  3O8Y A;  2HML B;  3AGN A;  1IQY A;  3CCJ 3;  1BRG A;  1QMA A;  1ZX2 A;  1M1X B;  4XDW A;  1B2S A;  1U8C B;  3WHO A;  1GMP A;  3D3L A;  5AEW B;  2FXT A;  1FUW A;  1OGX A;  3L0R A;  1MNL A;  1STF I;  2W9P A;  3DH2 A;  5EVH A;  3CC7 3;  1VQK 3;  5G2G A;  1UCL A;  1RMS A;  1S5A A;  4JRF A;  3CC4 3;  4ILF A;  3GWR A;  5RNT A;  3CCE 3;  4WP5 A;  1BRJ A;  3HI7 A;  3JUO A;  1LQM B;  5ELU A;  2KXG A;  3BND A;  4BL2 A;  4MEI A;  1TRP A;  3LTC A;  3I56 3;  1JNQ A;  1HYF A;  1YHQ 3;  2Y74 A;  1K9M 4;  2W6J H;  3LYG A;  4CPK A;  1GSP A;  4HJL B;  1OF5 A;  4HM4 B;  1Q82 4;  4HM3 B;  2UUG C;  1ULI B;  2CWT A;  2AAE A;  3OXA A;  2UGI A;  3DGO A;  2GU3 A;  1RCK A;  2XSO B;  4O2H A;  1B27 A;  4XDV A;  4K61 A;  3HX8 A;  1FGQ A;  4HAA A;  4CCV A;  1I0X A;  1R4Y A;  1BNS A;  1N8Q A;  3LOY A;  4RNZ A;  1O7W B;  2RCD A;  1Q81 4;  3MPH A;  1N8R 4;  3DGN A;  2BNG A;  1B2Z A;  2INX A;  2MF7 A;  1JBT A;  3ZG0 A;  2QA4 3;  1Q9E A;  3KSP A;  4JF8 A;  4HM7 B;  1PFP A;  4R1K A;  1I2G A;  4R9K A;  5DRV A;  4AEQ A;  4BIR A;  1B2M A;  4GSP A;  3CMA 3;  3N8B A;  1FA3 A;  1AV4 A;  3FG4 A;  1W01 A;  2MC8 A;  2C10 A;  4XM4 A;  1GOV A;  3NQZ A;  1KSI A;  3I0Y A;  3RGR A;  3NM7 A;  1DYU A;  4N6M A;  1RGG A;  3CME 3;  1RRL A;  2KF6 A;  1LVN A;  2XEP A;  2CKF B;  3F8X A;  3GRD A;  1JN5 A;  3Q1C A;  2CFD A;  1VQP 3;  2HMO B;  3LXU X;  1US1 A;  1BUJ A;  1AY7 A;  2QEX 3;  1WNH A;  3KFQ C;  3CC2 3;  1NWW A;  4XBT A;  4PEJ A;  4LEH A;  2AAD A;  3Q3F A;  3S28 A;  1NO3 A;  1O7G B;  5IEP A;  5M18 A;  4HOH A;  1FGM A;  3S29 A;  3FKA A;  3NBJ A;  1TRQ A;  1QVF 2;  1GY7 A;  1IQX A;  3X3X A;  1UCI A;  1RLS A;  1T3B A;  3H51 A;  1EEJ A;  4J5K A;  1PY3 A;  2CWU A;  1BSE A;  4L8O A;  4LYL B;  5ELJ A;  1VQQ A;  2Z76 A;  2P38 A;  4IIA A;  2Z7A A;  2BO9 B;  4KT3 B;  4K1U A;  1A2V A;  1BRK A;  1SJW A;  3EJV A;  1YNV X;  4KZ1 A;  4HZ9 B;  3EQQ B;  7STD A;  3I55 3;  1I8V A;  2ML5 A;  1WTH A;  3ALA A;  1PU4 A;  2L1S A;  3D9R A;  1GOY A;  1Q40 A;  4IPB A;  2K0M A;  1EQK A;  4KVH A;  4ZM8 A;  1FYS A;  4WYK B;  1X1U A;  1VZZ A;  4IT7 A;  1N9E A;  1B3S A;  1NDO B;  2XGN A;  1DE3 A;  1PYL A;  2V1L A;  4WFO A;  3HZP A;  1C54 A;  2GBX B;  3PYJ A;  2H0G A;  3HOH A;  4CDL A;  5IER A;  1B21 A;  3LH4 A;  2BMQ B;  1BSC A;  2KF5 A;  1CQS A;  1FZU A;  2CC3 A;  3NV0 A;  5D83 A;  3PCR A;  3NM2 A;  1YJ9 3;  1OH0 A;  2OTL 3;  1VQN 3;  1NJI 4;  2R41 A;  1TU5 A;  3MKI A;  2XFS A;  5HOH A;  2CG1 A;  5LC6 A;  4FMD A;  3DMC A;  1O7M B;  1BNG A;  3JVC A;  3B4P A;  1QAF A;  1FGR A;  2B24 B;  1B2U A;  1CYV A;  1RNT A;  4R80 A;  4EXR A;  1JN5 B;  2GEY A;  2GSP A;  1NB5 I;  3IMA B;  3H3H A;  3FSD A;  3PXM A;  5HGR A;  5A0O B;  1BRI A;  4GL6 A;  3NHX A;  4NPB A;  1K28 A;  3DZL A;  4RZM A;  5IG3 A;  1FGO A;  1V74 A;  5JPU A;  1KD1 4;  4EC6 A;  3WR2 A;  2CWV A;  5IF6 A;  3LTD A;  1LOV A;  1LNI A;  3V98 A;  1IV9 A;  1RGE A;  3CNX A;  3S5C A;  1RKY A;  2STD A;  1RGA A;  1WMN A;  2GXF A;  4NRE A;  3FG1 A;  3G6E 3;  1QAL A;  1T2H A;  1RNB A;  4CJN A;  3CXC 2;  3MYT A;  3MHE A;  1L5G B;  3AGO A;  3EN1 B;  1G96 A;  1W4N A;  3X41 A;  1E3R A;  1YVB I;  4N3V A;  3CCR 3;  5IEN A;  1BGS A;  1FUS A;  1OHS A;  1M90 4;  3UL5 A;  6RNT A;  3EBT A;  1JV2 B;  1LOX A;  1SII A;  3FGY A;  1YGW A;  2SBL A;  5KP4 A;  1U5O A;  1SPU A;  4TX4 A;  5AIF A;  1RGF A;  1BU4 A;  5CK6 A;  1Q7H A;  4I4K A;  1BUQ A;  3LTB A;  1W00 A;  1S72 3;  3G16 A;  5G1K A;  2IUK A;  1YJN 3;  4HM5 B;  2RGQ A;  1BNJ A;  3LZA A;  5I97 A;  4GB5 A;  3LT8 A;  4O8S A;  1W02 A;  3RDE A;  3CCL 3;  5AII A;  1KC8 4;  1GY6 A;  3D5I A;  3KN4 A;  3NV0 B;  3D5G A;  3F9S A;  3AMO A;  1O7H B;  2W56 A;  4H61 A;  3ZG5 A;  9RNT A;  2IMJ A;  4WWU C;  3WOD G;  1A2K A;  1Q7Y 4;  1RN1 A;  2XFT A;  1YI2 3;  2GBW B;  3B4O A;  3GSP A;  1W2Z A;  2RNT A;  1TIJ A;  1R4C A;  2WGO A;  1RGK A;  2E2V A;  4J8T A;  1JZO A;  2CK3 H;  1D6Y A;  5D82 A;  3CCM 3;  2IYJ A;  3QRD A;  1MWT A;  2CIU A;  1Q40 B;  4EV5 A;  1GMQ A;  1GD4 A;  2KRT A;  2KAA A;  4OVM A;  3X3Y A;  3G4S 3;  2SAR A;  5M1A A;  1AR0 A;  4MMZ B;  5FW5 A;  2OQE A;  2K3D A;  3BU4 A;  4HZB B;  1RTU A;  5DRE A;  2ZL8 A;  3T0U A;  2CX0 A;  3CPO A;  3FCS B;  3SYU A;  1AQZ A;  1RDS A;  4BTX A;  1OPY A;  1QAK A;  4N6V 0;  4LMI A;  4EBG A;  2D1W A;  3OW2 2;  3RGA A;  2W56 B;  3ROB A;  4BU4 A;  2BU4 A;  3JUP A;  4HM8 B;  4WYK A;  3N9H A;  3CD6 3;  1I3F A;  4FCZ A;  2ML6 A;  3IPT A;  3NBR A;  1Z1S A;  1DET A;  1N9J A;  2WGQ A;  4I5Q A;  2PZV A;  4XB5 A;  1FW7 A;  4HM1 B;  3KSE D;  1J2B A;  1K41 A;  4MJD A;  1GOU A;  2F99 A;  4KFF A;  2RBI A;  1EKM A;  1ASK A;  1Q86 4;  4O02 B;  1E97 A;  3BNC A;  1OCV A;  1I2E A;  1RHL A;  1BSB A;  1IT7 A;  1BRH A;  1JB2 A;  3FG3 A;  5CF1 A;  1DVD A;  1LNH A;  1KQS 2;  2HOH A;  2BHM A;  5IG5 A;  1WMO A;  3KZT A;  1BSA A;  2OWP A;  3RNT A;  2L4V A;  3CU3 A;  5FGO A;  3NXJ A;  1Q42 A;  2GEX A;  5IEO A;  4EYC A;  1I70 A;  4BL3 A;  3FLJ A;  1LXE A;  3KII A;  2W9Q A;  1OAC A;  3OX9 A;  1BSD A;  1FUT A;  1YVS A;  2IY2 A;  1G02 A;  1IVX A;  1TTO A;  4MMY B;  5EQL A;  4FCM A;  5CF2 A;  1STD A;  7GSP A;  1BRN L;  1BNF A;  3K63 A;  1YGE A;  1VQ9 3;  5JBS A;  5BXQ A;  2CFL A;  1BNE A;  1ZO2 A;  3KCH A;  3PS8 A;  4MMX B;  1B20 A;  4LZI A;  1UCK A;  3B8L A;  5BVB A;  4NHF A;  3VSY A;  3EX9 A;  4R4K A;  4AKY A;  3OV4 A;  1IVV A;  1MGR A;  3UJM A;  1E3V A;  2HMJ B;  2R4I A;  3F14 A;  1X1W A;  4KFD A;  2CFK A;  4QWT A;  2CW9 A;  4RNY A;  4HYZ A;  3ECF A;  3VGN A;  3DY5 A;  1DMM A;  3GAX A;  1JBR A;  1O7P B;  1JB4 A;  4N6T A;  2Z77 A;  3K0Z A;  1BNI A;  2HMK B;  5BU4 A;  3UL6 A;  1G0T A;  2YFI B;  1BAN A;  3F7S A;  1OF5 B;  1N5P A;  3EE1 A;  2F86 B;  5AYR B;  1T2I A;  5M19 A;  1TUH A;  2J8X B;  3U1W A;  1VQL 3;  2CX1 A;  2W04 A;  3M8C A;  3URP A;  1RGL A;  3DXO A;  4OUQ A;  2P0M A;  2XGL A;  2H0I A;  1D6U A;  4N6L A;  1A67 A;  3GZY B;  2CHC A;  4HVN A;  1RGH A;  8CHO A;  3DM8 A;  4STD A;  4Q53 A;  4K90 B;  3SLU A;  5AIH A;  3T8N A;  1VQ7 3;  1IVU A;  2F4Y A;  1GS3 A;  1DMQ A;  1LQG C;  3BNB A;  3V99 A;  5IG4 A;  2BMR B;  2F5M A;  2LQV A;  4L7K A;  3OWS A;  3X40 A;  4GHO A;  1EA2 A;  1V58 A;  1BRS A;  3DUK A;  5KP3 A;  4R9L A;  1VQO 3;  1A90 A;  3ER7 A;  1MWU A;  3MG3 A;  3WA3 A;  3NX0 A;  3CCS 3;  1FGT A;  1IVW A;  2BMO B;  2ZHX B;  2A15 A;  2YFL B;  1BOX A;  1EG9 B;  1BAO A;  1HZ1 A;  3AMO B;  3AHS A;  1DVC A;  2CFG A;  5AI1 A;  2OOV A;  1IK3 A;  1K73 4;  1OUN A;  1UUW B;  1OHP A;  2P05 A;  3G0K A;  5G1L A;  1JKG B;  5D81 A;  5KP1 A;  1CH0 A;  1I3I A;  1NNV A;  1GD3 A;  4HM6 B;  2I9W A;  3GZR A;  3EB8 A;  4N6U A;  1BIR A;  2OTJ 3;  2F5W A;  3WDG B;  5EEO A;  3X42 A;  3DGY A;  3HII A;  2W03 A;  4LGQ A;  1YIT 3;  3LT9 A;  7RNT A;  3JUN A;  2C11 A;  1SIH A;  2Z6B A;  1W6G A;  3WMD A;  1VQ5 3;  1BNR A;  1UW1 A;  2QGU A;  4EV2 A;  1I0V A;  2FNQ A;  1TFK A;  2FGT A;  3LML A;  3CPW 2;  2W2C A;  1K8A 4;  4HM0 B;  4DKI A;  3SED A;  5LC7 A;  6STD A;  1MWR A;  1CEW I;  3GZX B;  2P09 A;  5JPP A;  1SQW A;  3BLZ A;  2CG0 A;  3BB9 A;  3ZFZ A;  4X2O A;  1UI7 A;  3WOF B;  3PZW A;  1EUI C;  1IV7 A;  3S27 A;  1UGI A;  3EC9 A;  1V57 A;  3IJE B;  1W6Y A;  4EW5 A;  1JBS A;  1ISK A;  1DMN A;  2WOF A;  3A76 A;  1GYB A;  1RSN A;  1W5Z A;  1RGC A;  1X1Y A;  1UGH I;  3E99 A;  1TP6 A;  4ORL A;  2E2T A;  1M9G A;  3DGL A;  3K7C A;  2KF3 A;  1UI8 A;  3MG1 A;  3NBB A;  1YIJ 3;  2D42 A;  3MWZ A;  3FF2 A;  2CFW A;  1JRQ A;  3K9M C;  2H0H A;  3K5T A;  2XF3 A;  3BNE A;  5TGN A;  1D6Z A;  1TJD A;  1WQL B;  2JDI H;  3TDG A;  1VQ4 3;  1BVI A;  4H3U A;  6GSP A;  1KWI A;  3WOE B;  1IDP A;  1LOY A;  2GU1 A;  2CH9 A;  3SXX A;  2F98 A;  1HU9 A;  3SOA A;  3NQY A;  3HIG A;  4U13 A;  2KF4 A;  1UCJ A;  4X2H A;  1ULJ B;  2LYX A;  3OWU A;  2ZDJ A;  3FF0 A;  3G71 3;  3EBY A;  2JQ5 A;  1QVG 2;  3N54 B;  4J9A A;  3SOY A;  3F8H A;  3VF1 A;  3X3Z A;  2OOV C;  1B2X A;  4BTW A;  1RN7 A;  2ZA4 A;  3A5E A;  5CXO A;  1A2P A;  1VQ6 3;  2BT3 A;  3MSO A;  1LOW A;  2IA7 A;  2HMN B;  2M7O A;  4HBR A;  4L8P A;  3AHW A;  3B7C A;  2BIR A;  3LTA A;  3G8Z A;  1W7C A;  4RBN A;  2XH9 A;  4N6O B;  3FZW A;  4FMB A;  3STD A;  3D4A A;  3OWY A;  4HKV B;  2Q07 A;  5AEU B;  3DGM A;  1W6C A;  1T5Y A;  1AVL A;  1ZS7 A;  2XSH B;  4HM2 B;  1NB3 I;  1AVK A;  1RJO A; 
#chains in the Genus database with same CATH homology
 3PGB A;  3EHC A;  3SX1 A;  1F8N A;  4FMC A;  2YFJ B;  3HK4 A;  3EF8 A;  3GZB A;  5STD A;  1UUV B;  1IQ8 A;  1YJW 3;  2RFR A;  3SVA A;  2WOH A;  3FH1 A;  5IG0 A;  3EN8 A;  3QK9 A;  3V92 A;  3F40 A;  5AYS C;  3J7Y d;  1GY5 A;  1TFO A;  3JUQ A;  1M1K 4;  1OHO A;  2YX9 A;  1JB5 A;  2O3O A;  2Y73 A;  3UNL A;  2P0X A;  4BTY A;  4FCJ A;  4K1V A;  3U97 A;  1JJ2 2;  2QIY A;  2IUJ A;  3CNM A;  1QJG A;  1WMP A;  3CCQ 3;  2OCT A;  5IW9 A;  1ROA A;  1NU3 A;  2WO0 A;  2XR8 B;  1Y4K A;  4N6N B;  4XBY A;  3Q90 A;  1OGZ A;  4XBX A;  4FMA A;  1IU7 A;  3MG2 A;  1N5H A;  2PNC A;  3JUM A;  3KE7 A;  1CYU A;  1VQM 3;  4OK0 A;  1JKG A;  2E2U A;  5AIG A;  3KKG A;  1O7N B;  4LSO A;  3NUV A;  1MOL A;  2O9U X;  4WHA A;  3CCV 3;  2XRX B;  1C7H A;  2KCD A;  2OQE C;  3S67 A;  1IT8 A;  2K54 A;  2W0Q A;  3UB1 A;  2HMM B;  1RRH A;  1W2B 2;  2RSX A;  1VQ8 3;  4G1M B;  4FR9 A;  4AKZ A;  3T8U A;  3WA2 X;  2UX0 A;  4KFE A;  3Q2P A;  1ROV A;  3F7X A;  4O3V A;  5CLK A;  1HKX A;  3PCS A;  3CCU 3;  2B1X B;  3O8Y A;  2HML B;  1IQY A;  3CCJ 3;  1QMA A;  1M1X B;  1ZX2 A;  4XDW A;  1U8C B;  3D3L A;  5AEW B;  2FXT A;  1FUW A;  1OGX A;  3L0R A;  1MNL A;  1STF I;  2W9P A;  5EVH A;  3CC7 3;  1VQK 3;  5G2G A;  3CC4 3;  1S5A A;  4JRF A;  3GWR A;  3CCE 3;  4WP5 A;  3HI7 A;  3JUO A;  5ELU A;  2KXG A;  3BND A;  4MEI A;  3LTC A;  3I56 3;  1JNQ A;  1YHQ 3;  2Y74 A;  1K9M 4;  2W6J H;  3LYG A;  4HJL B;  1OF5 A;  4HM4 B;  1Q82 4;  4HM3 B;  1ULI B;  2CWT A;  3OXA A;  3DGO A;  2GU3 A;  2XSO B;  4O2H A;  4XDV A;  4K61 A;  3HX8 A;  1FGQ A;  4CCV A;  3LOY A;  1N8Q A;  4RNZ A;  1O7W B;  2RCD A;  1Q81 4;  3MPH A;  1N8R 4;  3DGN A;  2BNG A;  2INX A;  2MF7 A;  2QA4 3;  3KSP A;  4JF8 A;  4HM7 B;  1PFP A;  4R1K A;  4R9K A;  5DRV A;  4AEQ A;  1FA3 A;  3CMA 3;  3N8B A;  1AV4 A;  3FG4 A;  1W01 A;  2MC8 A;  2C10 A;  4XM4 A;  3NQZ A;  1KSI A;  3I0Y A;  3NM7 A;  1DYU A;  4N6M A;  3CME 3;  1RRL A;  2XEP A;  1LVN A;  3GRD A;  2CKF B;  3F8X A;  1JN5 A;  3Q1C A;  2CFD A;  1VQP 3;  2HMO B;  3LXU X;  1US1 A;  2QEX 3;  1WNH A;  3KFQ C;  3CC2 3;  1NWW A;  4XBT A;  4PEJ A;  4LEH A;  3S28 A;  1NO3 A;  1O7G B;  5IEP A;  1FGM A;  3S29 A;  3FKA A;  3NBJ A;  1QVF 2;  1GY7 A;  1IQX A;  3H51 A;  2CWU A;  4L8O A;  5ELJ A;  2Z76 A;  2P38 A;  4IIA A;  2Z7A A;  2BO9 B;  4K1U A;  1A2V A;  1SJW A;  3EJV A;  4KZ1 A;  4HZ9 B;  3EQQ B;  7STD A;  3I55 3;  2ML5 A;  1WTH A;  3ALA A;  1PU4 A;  3D9R A;  1Q40 A;  4IPB A;  2K0M A;  1EQK A;  4KVH A;  4ZM8 A;  4WYK B;  1VZZ A;  4IT7 A;  1N9E A;  1NDO B;  2XGN A;  4WFO A;  2V1L A;  3HZP A;  2GBX B;  3PYJ A;  4CDL A;  5IER A;  3LH4 A;  2BMQ B;  1CQS A;  3NV0 A;  2CC3 A;  5D83 A;  1YJ9 3;  3PCR A;  3NM2 A;  2OTL 3;  1OH0 A;  1VQN 3;  1NJI 4;  1TU5 A;  3MKI A;  2XFS A;  2CG1 A;  5LC6 A;  4FMD A;  3DMC A;  1O7M B;  3X3X A;  3JVC A;  3B4P A;  1QAF A;  1FGR A;  1CYV A;  2B24 B;  4R80 A;  4EXR A;  1JN5 B;  2GEY A;  1NB5 I;  3IMA B;  3H3H A;  3FSD A;  3PXM A;  5HGR A;  5A0O B;  4GL6 A;  3NHX A;  1KD1 4;  1K28 A;  3DZL A;  4RZM A;  5IG3 A;  1FGO A;  1V74 A;  5JPU A;  4EC6 A;  2CWV A;  5IF6 A;  3LTD A;  3V98 A;  1IV9 A;  3CNX A;  3S5C A;  1RKY A;  2STD A;  1WMN A;  2GXF A;  4NRE A;  3FG1 A;  3G6E 3;  1QAL A;  3CXC 2;  3MYT A;  3MHE A;  1L5G B;  3EN1 B;  1G96 A;  1W4N A;  3X41 A;  1E3R A;  1YVB I;  4N3V A;  3CCR 3;  5IEN A;  1OHS A;  1M90 4;  3UL5 A;  3EBT A;  1JV2 B;  1LOX A;  1SII A;  3FGY A;  5KP4 A;  2SBL A;  1U5O A;  1SPU A;  4TX4 A;  5AIF A;  5CK6 A;  1BUQ A;  4I4K A;  3LTB A;  1W00 A;  1S72 3;  3G16 A;  2IUK A;  1YJN 3;  4HM5 B;  2RGQ A;  3LZA A;  5I97 A;  4GB5 A;  3LT8 A;  4O8S A;  1W02 A;  3RDE A;  3CCL 3;  5AII A;  1KC8 4;  1GY6 A;  3KN4 A;  3NV0 B;  3F9S A;  3AMO A;  1O7H B;  2W56 A;  4H61 A;  1Q7Y 4;  2IMJ A;  4WWU C;  3WOD G;  1A2K A;  2XFT A;  1YI2 3;  2GBW B;  3B4O A;  1W2Z A;  1TIJ A;  1R4C A;  2WGO A;  5D82 A;  2E2V A;  4J8T A;  1D6Y A;  2CK3 H;  3CCM 3;  3QRD A;  2CIU A;  1Q40 B;  4EV5 A;  1GD4 A;  2KRT A;  4OVM A;  3X3Y A;  3G4S 3;  1AR0 A;  4MMZ B;  5FW5 A;  2OQE A;  4HZB B;  5DRE A;  2ZL8 A;  3T0U A;  3CPO A;  3FCS B;  4BTX A;  1OPY A;  1QAK A;  4N6V 0;  4LMI A;  4EBG A;  2D1W A;  3OW2 2;  3RGA A;  2W56 B;  3ROB A;  3CD6 3;  3JUP A;  4HM8 B;  4WYK A;  3N9H A;  4FCZ A;  2ML6 A;  3IPT A;  3NBR A;  1Z1S A;  1N9J A;  2WGQ A;  2PZV A;  4XB5 A;  4HM1 B;  3KSE D;  1J2B A;  1K41 A;  4MJD A;  4KFF A;  2F99 A;  1EKM A;  1ASK A;  1Q86 4;  4O02 B;  1E97 A;  3BNC A;  1OCV A;  1IT7 A;  3FG3 A;  1JB2 A;  1DVD A;  5CF1 A;  1LNH A;  1KQS 2;  2BHM A;  5IG5 A;  1WMO A;  3KZT A;  2OWP A;  2L4V A;  3CU3 A;  5FGO A;  3NXJ A;  1Q42 A;  2GEX A;  5IEO A;  4EYC A;  3FLJ A;  1LXE A;  3KII A;  2W9Q A;  1OAC A;  3OX9 A;  5CF2 A;  4MMY B;  1IVX A;  5EQL A;  4FCM A;  1STD A;  1VQ9 3;  3K63 A;  1YGE A;  5JBS A;  5BXQ A;  2CFL A;  1ZO2 A;  3PS8 A;  4MMX B;  4LZI A;  3B8L A;  5BVB A;  4NHF A;  3VSY A;  3EX9 A;  4R4K A;  4AKY A;  3OV4 A;  1IVV A;  3UJM A;  1E3V A;  2HMJ B;  2R4I A;  3F14 A;  4KFD A;  2CFK A;  4QWT A;  2CW9 A;  4RNY A;  4HYZ A;  3ECF A;  3VGN A;  3DY5 A;  1DMM A;  3GAX A;  1O7P B;  1JB4 A;  4N6T A;  2Z77 A;  3K0Z A;  2HMK B;  3UL6 A;  2YFI B;  3F7S A;  1OF5 B;  1N5P A;  3EE1 A;  2F86 B;  5AYR B;  1TUH A;  3U1W A;  1VQL 3;  2W04 A;  3M8C A;  3DXO A;  4OUQ A;  2P0M A;  2XGL A;  4N6L A;  1D6U A;  1A67 A;  3GZY B;  2CHC A;  4HVN A;  8CHO A;  3DM8 A;  4STD A;  4Q53 A;  4K90 B;  3SLU A;  5AIH A;  3T8N A;  1VQ7 3;  1IVU A;  1GS3 A;  1DMQ A;  3V99 A;  3BNB A;  5IG4 A;  2BMR B;  2LQV A;  4L7K A;  3OWS A;  3X40 A;  1EA2 A;  3DUK A;  5KP3 A;  4R9L A;  1VQO 3;  1A90 A;  3ER7 A;  3MG3 A;  3WA3 A;  3NX0 A;  3CCS 3;  1FGT A;  1IVW A;  2BMO B;  2A15 A;  2YFL B;  1EG9 B;  3AMO B;  5AI1 A;  1DVC A;  2CFG A;  2OOV A;  1IK3 A;  1K73 4;  1OUN A;  1UUW B;  1OHP A;  2P05 A;  3G0K A;  1JKG B;  5D81 A;  5KP1 A;  1GD3 A;  4HM6 B;  2I9W A;  3GZR A;  3EB8 A;  4N6U A;  2OTJ 3;  3WDG B;  5EEO A;  3X42 A;  3HII A;  2W03 A;  4LGQ A;  1YIT 3;  3LT9 A;  3JUN A;  2C11 A;  1SIH A;  2Z6B A;  1W6G A;  3WMD A;  1VQ5 3;  1UW1 A;  2QGU A;  4EV2 A;  2FNQ A;  1TFK A;  2FGT A;  3LML A;  3CPW 2;  2W2C A;  1K8A 4;  4HM0 B;  3SED A;  5LC7 A;  6STD A;  3GZX B;  1CEW I;  2P09 A;  5JPP A;  1SQW A;  3BLZ A;  2CG0 A;  3BB9 A;  1UI7 A;  3WOF B;  3PZW A;  1IV7 A;  3S27 A;  3EC9 A;  3IJE B;  1W6Y A;  1ISK A;  1DMN A;  2WOF A;  3A76 A;  1GYB A;  1W5Z A;  3E99 A;  4ORL A;  4X2O A;  3RGR A;  1TP6 A;  2E2T A;  1M9G A;  3DGL A;  3K7C A;  1UI8 A;  3MG1 A;  3NBB A;  1YIJ 3;  2D42 A;  3MWZ A;  3FF2 A;  2CFW A;  1JRQ A;  3K9M C;  3K5T A;  2XF3 A;  3BNE A;  5TGN A;  1D6Z A;  1WQL B;  2JDI H;  3TDG A;  1VQ4 3;  4H3U A;  1KWI A;  3WOE B;  1IDP A;  2GU1 A;  2CH9 A;  3SXX A;  2F98 A;  1HU9 A;  3SOA A;  3NQY A;  3HIG A;  4U13 A;  4X2H A;  1ULJ B;  2LYX A;  3OWU A;  2ZDJ A;  3FF0 A;  3G71 3;  3EBY A;  2JQ5 A;  1QVG 2;  3N54 B;  4J9A A;  3SOY A;  3F8H A;  3VF1 A;  3X3Z A;  2OOV C;  4BTW A;  1RN7 A;  5CXO A;  1VQ6 3;  2BT3 A;  3MSO A;  2IA7 A;  2HMN B;  2M7O A;  4HBR A;  4L8P A;  3B7C A;  3LTA A;  3G8Z A;  1W7C A;  4RBN A;  2XH9 A;  4N6O B;  3FZW A;  4FMB A;  3STD A;  3OWY A;  4HKV B;  2Q07 A;  5AEU B;  3DGM A;  1W6C A;  1T5Y A;  1AVL A;  4HM2 B;  2XSH B;  1NB3 I;  1AVK A;  1RJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...