5IF6A

Structure of a computationally designed 17-ohp binder
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OHP9_1c
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 32
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5if6A00
1JKGB 3K0ZA 3SOYA 3MKIA 1DMNA 1Z1SA 2W2CA 5DRVA 4LMIA 3STDA 1SJWA 1NU3A 3OX9A 3NHXA 3GZXB 4XBTA 3VGNA 5IG5A 5IEPA 2F86B 3MG2A 3OWYA 3IPTA 5IEOA 1O7WB 3OV4A 2XSHB 3EBYA 1A2KA 5CK6A 2BMQB 4HM0B 5CF1A 4L7KA 3MHEA 2Z76A 4XM4A 1OF5A 2HMJB 2HMLB 3EHCA 2RCDA 5JPUA 1OF5B 2QIYA 4HM4B 4WWUC 3S5CA 2K54A 3FLJA 3LZAA 3MG3A 5AIIA 4HJLB 3DUKA 2GBXB 3B4OA 3EF8A 1VZZA 1UUWB 3EJVA 3JUPA 1W00A 2HMKB 3HX8A 5G2GA 2IMJA 3KE7A 2R4IA 1ULIB 2GXFA 3B8LA 3FF2A 5DREA 2HMOB 1O7NB 3ER7A 4MJDA 3ROBA 2INXA 5TGNA 3F9SA 3I0YA 5AI1A 2BMRB 4X2OA 4XDVA 5STDA 8CHOA 3SEDA 2HMNB 5AIFA 1OHSA 3EN8A 4U13A 5AEUB 4LGQA 3JUMA 1OHPA 3CPOA 3BB9A 1HKXA 4RZMA 3F40A 3FF0A 4L8PA 4WP5A 5AEWB 5IG4A 5KP1A 3MYTA 3B7CA 1UUVB 4KVHA 5AIHA 4GB5A 5AIGA 3DM8A 3GZBA 1OCVA 3KKGA 3GZRA 4WYKA 4J9AA 3GRDA 1O7HB 2B24B 4WYKB 4J8TA 4HM7B 1QMAA 5CLKA 4HM6B 4R9LA 3F7XA 3RGRA 1DMQA 3E99A 1E3VA 1IDPA 1DMMA 1GY7A 1OHOA 2BNGA 4CDLA 2JQ5A 4HM1B 5KP3A 1BUQA 3CNMA 4R1KA 1QJGA 3HZPA 1NWWA 6STDA 1GY5A 5D81A 1TUHA 3EBTA 2GBWB 4IIAA 3G0KA 5CXOA 1GYBA 2F99A 1ZX2A 4HZBB 2XR8B 3EX9A 5HGRA 1JN5A 3FGYA 3G8ZA 1E97A 3K7CA 1W02A 1AR0A 3LYGA 4X2HA 4HM2B 3NV0A 3KZTA 1C7HA 3OXAA 3WMDA 4Q53A 3NV0B 2F98A 3KSPA 3MSOA 3MG1A 5IENA 1ULJB 3NM2A 3B4PA 3CNXA 2GEYA 1OH0A 7STDA 4K1VA 3JUOA 2B1XB 4HKVB 3G16A 4STDA 1EA2A 2RGQA 5IG0A 1GS3A 5BVBA 3F14A 1GY6A 2A15A 5IG3A 3OWSA 1Q40A 3BLZA 2QGUA 2XSOB 3Q90A 3VSYA 2I9WA 1Q40B 3F8HA 1JKGA 3A76A 3DZLA 3DXOA 3NUVA 5KP4A 3EQQB 2OWPA 1CQSA 4K1UA 2PZVA 3EN1B 5IF6A 3JUQA 4H3UA 3H51A 1W6YA 1STDA 5BXQA 3ECFA 1K41A 3SOAA 2YFLB 1W01A 3EC9A 4HZ9B 1JB2A 1O7MB 4FCJA 3RGAA 5FW5A 3H3HA 3FH1A 3F7SA 3NXJA 1ZO2A 1O7GB 2GEXA 4OUQA 4HVNA 3FZWA 4N3VA 2CKFB 2Z7AA 4LEHA 4ORLA 1EG9B 3FKAA 1ISKA 4HM3B 4XBXA 3UJMA 1OUNA 3OWUA 1JB4A 4XDWA 3D9RA 1JN5B 1NDOB 2RFRA 1WQLB 1TP6A 2HMMB 4R9KA 5CF2A 4HM5B 2YFIB 1JB5A 3GWRA 4I4KA 5D82A 3UNLA 3T8NA 2CHCA 1ASKA 5IERA 2XRXB 3JUNA 3HK4A 5JPPA 1O7PB 4L8OA 3FSDA 1OGXA 1OPYA 1Q42A 2Z77A 2BMOB 5EVHA 1S5AA 4OVMA 1OGZA 4XBYA 4PEJA 3M8CA 3NBRA 2UX0A 1U5OA 2STDA 3F8XA 3T8UA 3DMCA 4FCMA 4HM8B 3CU3A 5D83A 2YFJB 3GZYB 4XB5A 1E3RA
chains in the Genus database with same CATH superfamily
2F4YA 1LQGC 1JKGB 2KRTA 1IVWA 1FGQA 1GOYA 2MF7A 1DMNA 3K0ZA 3LTDA 3MKIA 3SOYA 3KFQC 1JBSA 1MWUA 3I563 3CCS3 2CFDA 1BRKA 1W6GA 2Y74A 1MWTA 3K63A 1Z1SA 2W2CA 5DRVA 5LC6A 1IVUA 3CCQ3 4LMIA 3STDA 1SJWA 1PY3A 1NU3A 1RGKA 3OX9A 2H0HA 1WMOA 3NHXA 1N5HA 3GZXB 4XBTA 1YJW3 2IY2A 3VGNA 2WGOA 5IG5A 5IEPA 1UGIA 1I2GA 4RNZA 2F86B 1BNGA 4MMZB 1MGWA 3PCRA 3MG2A 2E2TA 2F5MA 3OWYA 3QRDA 8RNTA 3PS8A 2ZHXB 3IPTA 4EW5A 5IEOA 4BL2A 1O7WB 3OV4A 1B2MA 2Z6BA 1RN7A 2XSHB 3EBYA 5G1KA 1A2KA 1W7CA 2KF6A 2BMQB 4HM0B 5CK6A 5CF1A 1BIRA 1W2B2 4L7KA 3MHEA 2Z76A 4WHAA 2UGIA 3BNBA 2OTL3 3DH2A 4XM4A 1OF5A 2HMJB 1WNHA 1TRPA 1BRNL 4ILFA 3CCM3 1JBTA 2W56A 3AHWA 4CCVA 1VQ63 3HIGA 1FGTA 1GOVA 1M1K4 1KD14 1X1UA 3DGLA 1V57A 2HMLB 3EHCA 3OW22 2RCDA 5JPUA 1ROVA 1OF5B 1V74A 1Q824 2BO9B 1I3IA 3BU4A 1UCIA 4MMYB 1CYVA 1STFI 1UGHI 4OK0A 2QIYA 3PCSA 4O02B 4HM4B 1FUWA 1B2SA 4WWUC 1AV4A 1MOLA 3S5CA 2K54A 3FLJA 4R80A 1YHQ3 1Q864 3LZAA 3SYUA 1B27A 1T2HA 1A2VA 3D4AA 3MG3A 4IPBA 5AIIA 4HJLB 4ZM8A 3DUKA 1VQ53 2GBXB 1BAOA 2L4VA 2LQVA 3B4OA 2OTJ3 3EF8A 1RNTA 2BU4A 1MGRA 1B3SA 1VZZA 2OQEA 1UUWB 1VQK3 1A67A 2C4BA 2UUGC 3EJVA 5AYSC 3CCR3 4AEQA 3JUPA 1W00A 1IT7A 3QK9A 2HMKB 3HX8A 4HYZA 5ELUA 1UDII 1W4NA 2AADA 1CYUA 2W6JH 5G2GA 4EYCA 2OCTA 3SX1A 2IMJA 2RNTA 2H0GA 1AVKA 3KE7A 3S27A 3Q3FA 1IU7A 1YIJ3 2FGTA 2R41A 1ULIB 2R4IA 1BSCA 3N8BA 2GXFA 2L1SA 3B8LA 1YJ93 3CD63 3FF2A 5DREA 1R4CA 7GSPA 1GSPA 4FMBA 4BU4A 2E2UA 2ZDJA 1WTHA 4O8SA 2GSPA 3U1WA 1L5GB 3BNDA 2HMOB 1O7NB 3ER7A 4MJDA 3ROBA 3NM7A 2INXA 1VQM3 3WOEB 5TGNA 3F9SA 3I0YA 5AI1A 2BMRB 4X2OA 5HOHA 4LYLB 4XDVA 1VQ73 4N6OB 3Q1CA 5STDA 1FUSA 8CHOA 3CCU3 3I553 3SEDA 2HMNB 3X41A 4EV2A 1T3BA 1X1WA 4I5QA 1RJOA 5AIFA 1OHSA 1GMPA 3X3YA 3EN8A 4U13A 5RNTA 5AEUB 4LGQA 4J5KA 4WFOA 1QVG2 4LSOA 3JUMA 4NPBA 1OHPA 3DY5A 5EEOA 3CPOA 1B21A 1RSNA 1I8VA 4AKYA 4TX4A 3BB9A 3WODG 1HKXA 2AAEA 1JRQA 4RZMA 3ZG0A 3F40A 2QA43 3FF0A 4L8PA 4WP5A 1LNIA 2XGNA 5AEWB 1AVLA 4HAAA 1YNVX 4K61A 5IG4A 4FMAA 5KP1A 3HOHA 1YIT3 3MYTA 3CC43 3B7CA 1UUVB 4KVHA 4BIRA 1Q7Y4 5AIHA 2H0IA 4GB5A 2RBIA 4FCZA 5AIGA 1GOUA 1RNBA 3DM8A 3GZBA 1OCVA 1GD4A 3KKGA 1MWRA 1BOXA 4IT7A 1RGGA 2IYJA 1N9EA 1FGRA 3GZRA 1UCKA 4WYKA 4J9AA 3J7Yd 4QWTA 5M19A 2IUKA 3GRDA 4R4KA 1IT8A 3G6E3 1B2XA 4MMXB 4BTYA 1FZUA 3WHOA 1O7HB 1QAFA 2CK3H 3EB8A 2B24B 1C54A 1LXEA 1N9JA 3AGNA 3NQZA 2Q07A 4WYKB 2FXTA 4J8TA 1I2EA 4HM7B 1QMAA 4KFEA 5CLKA 1BSBA 4HM6B 4R9LA 9RNTA 2O9UX 1D6UA 1D6YA 2WOHA 3F7XA 3SLUA 1WMNA 1N8R4 3RGRA 1I0VA 1DMQA 2F5WA 1BANA 3FCSB 1BSAA 5AYRB 3D5IA 3E99A 1E3VA 3PZWA 1YGEA 2M7OA 1IDPA 2P05A 1DMMA 1GY7A 1I0XA 1OHOA 3ZG5A 1AQZA 1GMRA 1KSIA 3NBJA 2BNGA 4CDLA 2JQ5A 3BIRA 2XFTA 3RNTA 3N54B 4HM1B 1EEJA 3DGYA 5G1LA 5KP3A 3CNMA 3V92A 1HZ1A 4BTXA 1BUQA 4N6NB 1FUTA 2CWUA 1LOVA 4R1KA 1QJGA 3FG4A 3HZPA 1NWWA 3L0RA 1RKYA 4G1MB 1KQS2 6STDA 1B20A 1GY5A 4N6LA 4HBRA 2WO0A 3LXUX 2W56B 3UB1A 2CWVA 3AMOA 1Q7HA 1UI7A 1SIIA 1W2ZA 4RNTA 3Q2PA 1SARA 1I70A 1BRJA 1UUGB 5D81A 5JBSA 1PU4A 1JZDA 3O8YA 1TUHA 3WA3A 3KN4A 1K9M4 1EQKA 1RLSA 3AMOB 3LTAA 3EBTA 2W04A 2GBWB 2K3DA 4IIAA 2CW9A 3G0KA 5CXOA 2CC3A 1GYBA 1ROAA 1ZX2A 2F99A 4HZBB 1U8CB 4N6V0 1IVVA 3LTCA 2XR8B 3FG1A 3EX9A 1W5ZA 1VQQA 1T2IA 5HGRA 4FMCA 1JN5A 2GU3A 1FGOA 4H61A 3FGYA 1RGEA 3G8ZA 1E97A 3K7CA 3V99A 2ML5A 2OOVA 2CFGA 4LZIA 1VQL3 3AHSA 1BUJA 1W02A 1SPUA 1AR0A 2CIUA 3LYGA 1BGSA 4X2HA 4HM2B 3NV0A 5IW9A 3KZTA 1C7HA 2P09A 3OXAA 1TU5A 1EKMA 2WOFA 4N6TA 2MC8A 1TIJA 3WMDA 1EUIC 4AKZA 1UI8A 2WGQA 4GSPA 1N5PA 3N9HA 1W6CA 1K28A 1FGMA 2XGLA 4Q53A 3CMA3 3NV0B 2ZL8A 2E2VA 4EXRA 4KZ1A 2CFLA 2W9PA 2F98A 1IQXA 1IV7A 5BIRA 6GSPA 3CCJ3 3KSPA 1LQMB 3HI7A 3MSOA 3MG1A 5A0OB 2W9QA 2CX0A 2W03A 5IENA 1ULJB 1TJDA 4JF8A 3NM2A 3B4PA 5M18A 1BNFA 1M1XB 1YVSA 3CNXA 1RN1A 1TFOA 2GEYA 3X42A 1OH0A 2IA7A 2QEX3 7STDA 3AGOA 1WMPA 1JJ22 4K1VA 1B2ZA 3JUOA 2KF5A 2B1XB 1QAKA 1IQ8A 1AY7A 1BSDA 1BNIA 1D6ZA 4HKVB 3CCE3 3MPHA 3G16A 2ML6A 4STDA 1EA2A 2RGQA 5IG0A 1GS3A 3SVAA 5BVBA 3U97A 3F14A 3CPW2 1BRGA 1GY6A 3CC73 1OACA 2A15A 1I3FA 1KC84 5IG3A 3OWSA 3S29A 1BSEA 3CCV3 1Q40A 2CG1A 1QVF2 2ZA4A 1PFPA 4FR9A 1J2BA 1DVDA 1RTUA 3BLZA 1KWIA 1V58A 2CFKA 3LT8A 2QGUA 3PGBA 2XSOB 3Q90A 2CH9A 1DYUA 1X1XA 2RSXA 1BRSA 1BRIA 1N8QA 1UW1A 3KCHA 2I9WA 3SXXA 3VSYA 1VQN3 1Q40B 1G0TA 3F8HA 1JKGA 3A76A 3IJEB 3DZLA 3X3XA 3DXOA 3WR2A 1YGWA 1Q9EA 4KFDA 3NUVA 5KP4A 4EC6A 2P0MA 3EQQB 2OWPA 1CQSA 3ALAA 4K1UA 3CXC2 1A90A 2JDIH 2PZVA 2Y73A 5FGOA 3LTBA 1BNRA 3EN1B 1NO3A 3KIIA 2XH9A 5IF6A 1GD3A 2V1LA 1Y4KA 3JUQA 4GL6A 1RN4A 4H3UA 1MNLA 1LOYA 1A2PA 1TFKA 3TDGA 4NREA 2J8XB 3LH4A 4JRFA 3PYJA 3H51A 3G4S3 1IQYA 3S28A 1VQO3 1BVIA 2PNCA 3CC23 1DE3A 1W6YA 1STDA 3WA2X 5BXQA 3ECFA 3D3LA 1K41A 2XF3A 1RGLA 3SOAA 1NJI4 1TRQA 2YFLB 3WDGB 3X3ZA 1W01A 3EC9A 3HIIA 4HZ9B 1UCJA 4BTWA 3NQYA 3LMLA 3RDEA 1JB2A 1O7MB 1K734 4BL3A 3G713 4FCJA 1UCLA 3X40A 4CPKA 1BU4A 1TTOA 3LT9A 1LOWA 4N6MA 1LRAA 3RGAA 4O2HA 5FW5A 1HU9A 2XEPA 3H3HA 4GHOA 1RGFA 1VQ93 4K90B 3FH1A 3F7SA 3NXJA 3NX0A 1RGHA 4RNYA 1GMQA 1ZO2A 1IK3A 1O7GB 2GEXA 2KAAA 2GU1A 4OUQA 4HVNA 3FZWA 3JVCA 4N3VA 3BNCA 2CKFB 2KXGA 2CFWA 1NNVA 2Z7AA 1T5YA 3PXMA 4LEHA 3ZFZA 6RNTA 4ORLA 1SIHA 1X1YA 1G96A 2O3OA 4NHFA 1EG9B 2LYXA 2D1WA 3FKAA 1ISKA 1RCLA 1YJN3 2BHMA 5BU4A 3LOYA 1RCKA 1RHLA 2CG0A 2KCDA 4HM3B 4XBXA 3S67A 7RNTA 1S723 4EV5A 2IUJA 3UJMA 1OUNA 1M9GA 1VQ83 1JBRA 3OWUA 1JB4A 3VF1A 4XDWA 1MWSA 3D9RA 3CCL3 1CH0A 2KF4A 3UL5A 1RGCA 1IV9A 4MEIA 1JN5B 1NDOB 1LVNA 2YX9A 3V98A 2BT3A 4N6UA 2CX1A 1RGAA 3A5EA 2HOHA 2RFRA 2C10A 1M904 1WQLB 1TP6A 3KSED 2HMMB 1ZS7A 2SARA 1VQ43 3GAXA 1K8A4 2FNQA 4RBNA 4R9KA 4FMDA 5CF2A 1ZGXA 3IMAB 1B2UA 3D5GA 4HM5B 1I2FA 1JB5A 1QALA 2P38A 2YFIB 3GWRA 1VQP3 4I4KA 5D82A 3UNLA 1US1A 3DGMA 2XFSA 3T8NA 4DKIA 1Q814 1NB5I 2CHCA 1ASKA 1BRHA 5IERA 2XRXB 2W0QA 5GSPA 2OQEC 3FG3A 3JUNA 5ELJA 1BNEA 1DETA 3HK4A 3K5TA 1G02A 5LC7A 5JPPA 1O7PB 2BIRA 4EBGA 4L8OA 3FSDA 3D79A 1OGXA 3URPA 1F8NA 1OPYA 1Q42A 2Z77A 4KFFA 2BMOB 1IYYA 4O3VA 4KT3B 5EVHA 1YVBI 3GSPA 1S5AA 2OOVC 2D42A 4OVMA 3UL6A 1OGZA 4XBYA 1BNSA 5M1AA 4CJNA 4PEJA 1LNHA 3M8CA 3NBRA 2UX0A 3DGOA 2P0XA 1U5OA 1DVCA 3CME3 1IVXA 4J5GA 1FYSA 1NB3I 1R4YA 1LOXA 2STDA 3F8XA 2CWTA 3WOFB 1JNQA 1BNJA 3T8UA 3DMCA 1RDSA 4FCMA 1SQWA 1JV2B 2KF3A 4HM8B 3T0UA 3CU3A 1RMSA 1RRHA 5I97A 3K9MC 5D83A 1FW7A 1CEWI 2YFJB 4HOHA 1RRLA 5EQLA 1HYFA 2K0MA 1PYLA 3DGNA 3GZYB 4XB5A 2C11A 2SBLA 3NBBA 1E3RA 1FA3A 2F56A 3EE1A 1JZOA 3MWZA 3BNEA 1YI23
chains in the Genus database with same CATH topology
2KRTA 1JKGB 1IVWA 1FGQA 2MF7A 3K0ZA 1DMNA 3LTDA 3MKIA 3SOYA 3KFQC 3I563 3CCS3 2CFDA 1W6GA 2Y74A 3K63A 1Z1SA 2W2CA 5DRVA 5LC6A 1IVUA 3CCQ3 4LMIA 3STDA 1SJWA 1NU3A 3OX9A 1WMOA 3NHXA 1N5HA 3GZXB 4XBTA 1YJW3 3VGNA 2WGOA 5IG5A 5IEPA 4RNZA 2F86B 4MMZB 3PCRA 3MG2A 2E2TA 3OWYA 3QRDA 3PS8A 3IPTA 5IEOA 1O7WB 3OV4A 2Z6BA 1RN7A 2XSHB 3EBYA 1A2KA 1W7CA 5CK6A 2BMQB 4HM0B 5CF1A 1W2B2 4L7KA 3MHEA 2Z76A 4WHAA 3BNBA 2OTL3 4XM4A 1OF5A 2HMJB 1WNHA 3CCM3 2W56A 4CCVA 1VQ63 3HIGA 1FGTA 1M1K4 1KD14 3DGLA 2HMLB 3EHCA 3OW22 2RCDA 5JPUA 1ROVA 1OF5B 1V74A 1Q824 2BO9B 4MMYB 1CYVA 1STFI 4OK0A 2QIYA 3PCSA 4O02B 4HM4B 1FUWA 4WWUC 1AV4A 1MOLA 3S5CA 2K54A 3FLJA 4R80A 1YHQ3 1Q864 3LZAA 1A2VA 3MG3A 4IPBA 5AIIA 4HJLB 4ZM8A 3DUKA 1VQ53 2GBXB 2L4VA 2LQVA 3B4OA 2OTJ3 3EF8A 1VZZA 2OQEA 1UUWB 1VQK3 1A67A 5AYSC 3EJVA 3CCR3 4AEQA 3JUPA 1W00A 1IT7A 3QK9A 2HMKB 3HX8A 4HYZA 5ELUA 1W4NA 1CYUA 2W6JH 5G2GA 4EYCA 2OCTA 3SX1A 2IMJA 1AVKA 3KE7A 3S27A 1IU7A 1YIJ3 2FGTA 2R4IA 1ULIB 3N8BA 2GXFA 3B8LA 3CD63 1YJ93 3FF2A 5DREA 1R4CA 4FMBA 2E2UA 2ZDJA 1WTHA 4O8SA 3U1WA 1L5GB 3BNDA 2HMOB 1O7NB 3ER7A 4MJDA 3ROBA 3NM7A 2INXA 1VQM3 3WOEB 5TGNA 3F9SA 3I0YA 5AI1A 2BMRB 4X2OA 4XDVA 1VQ73 4N6OB 3Q1CA 5STDA 8CHOA 3CCU3 3I553 3SEDA 2HMNB 3X41A 4EV2A 5AIFA 1RJOA 1OHSA 3X3YA 3EN8A 4U13A 5AEUB 4LGQA 4WFOA 1QVG2 4LSOA 3JUMA 1OHPA 3DY5A 5EEOA 3CPOA 4AKYA 4TX4A 3BB9A 3WODG 1HKXA 1JRQA 4RZMA 2QA43 3F40A 3FF0A 4L8PA 4WP5A 2XGNA 5AEWB 1AVLA 4K61A 5IG4A 4FMAA 5KP1A 1YIT3 3MYTA 3CC43 3B7CA 1UUVB 4KVHA 1Q7Y4 5AIHA 4GB5A 4FCZA 5AIGA 3DM8A 3GZBA 1OCVA 1GD4A 3KKGA 4IT7A 1N9EA 1FGRA 3GZRA 4WYKA 4J9AA 3J7Yd 4QWTA 2IUKA 3GRDA 4R4KA 1IT8A 3G6E3 4MMXB 4BTYA 1O7HB 1QAFA 2CK3H 3EB8A 2B24B 1LXEA 1N9JA 3NQZA 2Q07A 4WYKB 2FXTA 4J8TA 4HM7B 1QMAA 4KFEA 5CLKA 4HM6B 4R9LA 2O9UX 1D6UA 1D6YA 2WOHA 3F7XA 3SLUA 1WMNA 1N8R4 3RGRA 1DMQA 3FCSB 5AYRB 3E99A 1E3VA 3PZWA 1YGEA 2M7OA 1IDPA 2P05A 1DMMA 1GY7A 1OHOA 1KSIA 3NBJA 2BNGA 4CDLA 2JQ5A 2XFTA 3N54B 4HM1B 5KP3A 1BUQA 3V92A 3CNMA 4BTXA 4N6NB 2CWUA 4R1KA 1QJGA 3FG4A 3HZPA 1NWWA 3L0RA 1RKYA 4G1MB 1KQS2 6STDA 1GY5A 4N6LA 4HBRA 2WO0A 3LXUX 2W56B 3UB1A 2CWVA 3AMOA 1UI7A 1SIIA 1W2ZA 3Q2PA 5D81A 5JBSA 1PU4A 3O8YA 1TUHA 3WA3A 3KN4A 1K9M4 1EQKA 3AMOB 3LTAA 3EBTA 2W04A 2GBWB 4IIAA 2CW9A 3G0KA 5CXOA 2CC3A 1GYBA 1ROAA 1ZX2A 2F99A 4HZBB 1U8CB 4N6V0 1IVVA 3LTCA 2XR8B 3FG1A 3EX9A 1W5ZA 5HGRA 4FMCA 1JN5A 2GU3A 1FGOA 4H61A 3FGYA 3G8ZA 1E97A 3K7CA 3V99A 2ML5A 2OOVA 2CFGA 4LZIA 1VQL3 1W02A 1SPUA 1AR0A 2CIUA 3LYGA 4X2HA 4HM2B 3NV0A 5IW9A 3KZTA 1C7HA 2P09A 3OXAA 1TU5A 1EKMA 2WOFA 4N6TA 2MC8A 1TIJA 3WMDA 4AKZA 1UI8A 2WGQA 1N5PA 3N9HA 1W6CA 1K28A 1FGMA 2XGLA 4Q53A 3CMA3 3NV0B 2ZL8A 2E2VA 4EXRA 4KZ1A 2CFLA 2W9PA 2F98A 1IQXA 1IV7A 3CCJ3 3KSPA 3HI7A 3MSOA 3MG1A 5A0OB 2W9QA 2W03A 5IENA 1ULJB 4JF8A 3NM2A 3B4PA 1M1XB 3CNXA 1TFOA 2GEYA 3X42A 1OH0A 2IA7A 2QEX3 7STDA 1WMPA 1JJ22 4K1VA 3JUOA 1QAKA 1IQ8A 2B1XB 3CCE3 1D6ZA 4HKVB 3MPHA 3G16A 2ML6A 4STDA 1EA2A 2RGQA 5IG0A 1GS3A 3SVAA 5BVBA 3U97A 3F14A 3CPW2 1GY6A 3CC73 1OACA 2A15A 1KC84 5IG3A 3OWSA 3S29A 3CCV3 1Q40A 2CG1A 1QVF2 1PFPA 4FR9A 1J2BA 1DVDA 3BLZA 1KWIA 2CFKA 3LT8A 2QGUA 3PGBA 2XSOB 3Q90A 2CH9A 1DYUA 2RSXA 3SXXA 1UW1A 1N8QA 3VSYA 2I9WA 1VQN3 1Q40B 3F8HA 1JKGA 3A76A 3IJEB 3DZLA 3X3XA 3DXOA 4KFDA 3NUVA 5KP4A 4EC6A 2P0MA 3EQQB 2OWPA 1CQSA 3ALAA 4K1UA 3CXC2 1A90A 2JDIH 2PZVA 2Y73A 3LTBA 3EN1B 1NO3A 3KIIA 2XH9A 5IF6A 1GD3A 2V1LA 1Y4KA 3JUQA 4GL6A 4H3UA 5FGOA 1MNLA 1TFKA 3TDGA 4NREA 3LH4A 4JRFA 3PYJA 3H51A 3G4S3 1IQYA 3S28A 1VQO3 2PNCA 3CC23 1W6YA 1STDA 3WA2X 5BXQA 3ECFA 3D3LA 1K41A 2XF3A 3SOAA 1NJI4 2YFLB 3WDGB 3X3ZA 1W01A 3EC9A 3HIIA 4HZ9B 4BTWA 3NQYA 3LMLA 3RDEA 1JB2A 1O7MB 1K734 3G713 4FCJA 3X40A 4N6MA 3LT9A 3RGAA 4O2HA 5FW5A 1HU9A 2XEPA 3H3HA 1VQ93 4K90B 3FH1A 3F7SA 3NXJA 3NX0A 1IK3A 4RNYA 1ZO2A 1O7GB 2GEXA 2GU1A 4OUQA 4HVNA 3FZWA 3JVCA 4N3VA 3BNCA 2CKFB 2KXGA 2CFWA 2Z7AA 3PXMA 1T5YA 4LEHA 4ORLA 1SIHA 1G96A 2O3OA 4NHFA 1EG9B 2LYXA 2D1WA 3FKAA 1ISKA 1YJN3 2BHMA 3LOYA 2CG0A 3S67A 2KCDA 4HM3B 4XBXA 1S723 4EV5A 2IUJA 3UJMA 1OUNA 1M9GA 1VQ83 3OWUA 1JB4A 3VF1A 4XDWA 3D9RA 3CCL3 3UL5A 1IV9A 4MEIA 1JN5B 1NDOB 1LVNA 2YX9A 3V98A 2BT3A 4N6UA 2RFRA 2C10A 1M904 1WQLB 1TP6A 3KSED 2HMMB 1VQ43 3GAXA 1K8A4 2FNQA 4RBNA 4R9KA 4FMDA 5CF2A 3IMAB 4HM5B 2YFIB 1JB5A 1QALA 2P38A 3GWRA 1VQP3 4I4KA 5D82A 3UNLA 1US1A 3DGMA 2XFSA 3T8NA 1Q814 1NB5I 2CHCA 1ASKA 5IERA 2XRXB 2W0QA 2OQEC 3FG3A 3JUNA 5ELJA 3HK4A 3K5TA 5LC7A 5JPPA 1O7PB 4EBGA 4L8OA 3FSDA 1OGXA 1F8NA 1OPYA 1Q42A 2Z77A 4KFFA 2BMOB 4O3VA 5EVHA 1YVBI 1S5AA 2OOVC 2D42A 4OVMA 3UL6A 1OGZA 4XBYA 4PEJA 1LNHA 3M8CA 3NBRA 2UX0A 3DGOA 2P0XA 1U5OA 1DVCA 3CME3 1IVXA 1NB3I 3WOFB 1LOXA 2STDA 3F8XA 2CWTA 1JNQA 3T8UA 3DMCA 4FCMA 1SQWA 1JV2B 4HM8B 3T0UA 3CU3A 1RRHA 5I97A 3K9MC 5D83A 1CEWI 2YFJB 5EQLA 1RRLA 2K0MA 3DGNA 3GZYB 4XB5A 2C11A 2SBLA 3NBBA 1E3RA 1FA3A 3EE1A 3MWZA 3BNEA 1YI23
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKG B;  3K0Z A;  3SOY A;  3MKI A;  1DMN A;  1Z1S A;  2W2C A;  5DRV A;  4LMI A;  3STD A;  1SJW A;  1NU3 A;  3OX9 A;  3NHX A;  3GZX B;  4XBT A;  3VGN A;  5IG5 A;  5IEP A;  2F86 B;  3MG2 A;  3OWY A;  3IPT A;  5IEO A;  1O7W B;  3OV4 A;  2XSH B;  3EBY A;  1A2K A;  5CK6 A;  2BMQ B;  4HM0 B;  5CF1 A;  4L7K A;  3MHE A;  2Z76 A;  4XM4 A;  1OF5 A;  2HMJ B;  2HML B;  3EHC A;  2RCD A;  5JPU A;  1OF5 B;  2QIY A;  4HM4 B;  4WWU C;  3S5C A;  2K54 A;  3FLJ A;  3LZA A;  3MG3 A;  5AII A;  4HJL B;  3DUK A;  2GBX B;  3B4O A;  3EF8 A;  1VZZ A;  1UUW B;  3EJV A;  3JUP A;  1W00 A;  2HMK B;  3HX8 A;  5G2G A;  2IMJ A;  3KE7 A;  2R4I A;  1ULI B;  2GXF A;  3B8L A;  3FF2 A;  5DRE A;  2HMO B;  1O7N B;  3ER7 A;  4MJD A;  3ROB A;  2INX A;  5TGN A;  3F9S A;  3I0Y A;  5AI1 A;  2BMR B;  4X2O A;  4XDV A;  5STD A;  8CHO A;  3SED A;  2HMN B;  5AIF A;  1OHS A;  3EN8 A;  4U13 A;  5AEU B;  4LGQ A;  3JUM A;  1OHP A;  3CPO A;  3BB9 A;  1HKX A;  4RZM A;  3F40 A;  3FF0 A;  4L8P A;  4WP5 A;  5AEW B;  5IG4 A;  5KP1 A;  3MYT A;  3B7C A;  1UUV B;  4KVH A;  5AIH A;  4GB5 A;  5AIG A;  3DM8 A;  3GZB A;  1OCV A;  3KKG A;  3GZR A;  4WYK A;  4J9A A;  3GRD A;  1O7H B;  2B24 B;  4WYK B;  4J8T A;  4HM7 B;  1QMA A;  5CLK A;  4HM6 B;  4R9L A;  3F7X A;  3RGR A;  1DMQ A;  3E99 A;  1E3V A;  1IDP A;  1DMM A;  1GY7 A;  1OHO A;  2BNG A;  4CDL A;  2JQ5 A;  4HM1 B;  5KP3 A;  1BUQ A;  3CNM A;  4R1K A;  1QJG A;  3HZP A;  1NWW A;  6STD A;  1GY5 A;  5D81 A;  1TUH A;  3EBT A;  2GBW B;  4IIA A;  3G0K A;  5CXO A;  1GYB A;  2F99 A;  1ZX2 A;  4HZB B;  2XR8 B;  3EX9 A;  5HGR A;  1JN5 A;  3FGY A;  3G8Z A;  1E97 A;  3K7C A;  1W02 A;  1AR0 A;  3LYG A;  4X2H A;  4HM2 B;  3NV0 A;  3KZT A;  1C7H A;  3OXA A;  3WMD A;  4Q53 A;  3NV0 B;  2F98 A;  3KSP A;  3MSO A;  3MG1 A;  5IEN A;  1ULJ B;  3NM2 A;  3B4P A;  3CNX A;  2GEY A;  1OH0 A;  7STD A;  4K1V A;  3JUO A;  2B1X B;  4HKV B;  3G16 A;  4STD A;  1EA2 A;  2RGQ A;  5IG0 A;  1GS3 A;  5BVB A;  3F14 A;  1GY6 A;  2A15 A;  5IG3 A;  3OWS A;  1Q40 A;  3BLZ A;  2QGU A;  2XSO B;  3Q90 A;  3VSY A;  2I9W A;  1Q40 B;  3F8H A;  1JKG A;  3A76 A;  3DZL A;  3DXO A;  3NUV A;  5KP4 A;  3EQQ B;  2OWP A;  1CQS A;  4K1U A;  2PZV A;  3EN1 B;  5IF6 A;  3JUQ A;  4H3U A;  3H51 A;  1W6Y A;  1STD A;  5BXQ A;  3ECF A;  1K41 A;  3SOA A;  2YFL B;  1W01 A;  3EC9 A;  4HZ9 B;  1JB2 A;  1O7M B;  4FCJ A;  3RGA A;  5FW5 A;  3H3H A;  3FH1 A;  3F7S A;  3NXJ A;  1ZO2 A;  1O7G B;  2GEX A;  4OUQ A;  4HVN A;  3FZW A;  4N3V A;  2CKF B;  2Z7A A;  4LEH A;  4ORL A;  1EG9 B;  3FKA A;  1ISK A;  4HM3 B;  4XBX A;  3UJM A;  1OUN A;  3OWU A;  1JB4 A;  4XDW A;  3D9R A;  1JN5 B;  1NDO B;  2RFR A;  1WQL B;  1TP6 A;  2HMM B;  4R9K A;  5CF2 A;  4HM5 B;  2YFI B;  1JB5 A;  3GWR A;  4I4K A;  5D82 A;  3UNL A;  3T8N A;  2CHC A;  1ASK A;  5IER A;  2XRX B;  3JUN A;  3HK4 A;  5JPP A;  1O7P B;  4L8O A;  3FSD A;  1OGX A;  1OPY A;  1Q42 A;  2Z77 A;  2BMO B;  5EVH A;  1S5A A;  4OVM A;  1OGZ A;  4XBY A;  4PEJ A;  3M8C A;  3NBR A;  2UX0 A;  1U5O A;  2STD A;  3F8X A;  3T8U A;  3DMC A;  4FCM A;  4HM8 B;  3CU3 A;  5D83 A;  2YFJ B;  3GZY B;  4XB5 A;  1E3R A; 
#chains in the Genus database with same CATH topology
 2F4Y A;  1LQG C;  1JKG B;  2KRT A;  1IVW A;  1FGQ A;  1GOY A;  2MF7 A;  1DMN A;  3K0Z A;  3LTD A;  3MKI A;  3SOY A;  3KFQ C;  1JBS A;  1MWU A;  3I56 3;  3CCS 3;  2CFD A;  1BRK A;  1W6G A;  2Y74 A;  1MWT A;  3K63 A;  1Z1S A;  2W2C A;  5DRV A;  5LC6 A;  1IVU A;  3CCQ 3;  4LMI A;  3STD A;  1SJW A;  1PY3 A;  1NU3 A;  1RGK A;  3OX9 A;  2H0H A;  1WMO A;  3NHX A;  1N5H A;  3GZX B;  4XBT A;  1YJW 3;  2IY2 A;  3VGN A;  2WGO A;  5IG5 A;  5IEP A;  1UGI A;  1I2G A;  4RNZ A;  2F86 B;  1BNG A;  4MMZ B;  1MGW A;  3PCR A;  3MG2 A;  2E2T A;  2F5M A;  3OWY A;  3QRD A;  8RNT A;  3PS8 A;  2ZHX B;  3IPT A;  4EW5 A;  5IEO A;  4BL2 A;  1O7W B;  3OV4 A;  1B2M A;  2Z6B A;  1RN7 A;  2XSH B;  3EBY A;  5G1K A;  1A2K A;  1W7C A;  2KF6 A;  2BMQ B;  4HM0 B;  5CK6 A;  5CF1 A;  1BIR A;  1W2B 2;  4L7K A;  3MHE A;  2Z76 A;  4WHA A;  2UGI A;  3BNB A;  2OTL 3;  3DH2 A;  4XM4 A;  1OF5 A;  2HMJ B;  1WNH A;  1TRP A;  1BRN L;  4ILF A;  3CCM 3;  1JBT A;  2W56 A;  3AHW A;  4CCV A;  1VQ6 3;  3HIG A;  1FGT A;  1GOV A;  1M1K 4;  1KD1 4;  1X1U A;  3DGL A;  1V57 A;  2HML B;  3EHC A;  3OW2 2;  2RCD A;  5JPU A;  1ROV A;  1OF5 B;  1V74 A;  1Q82 4;  2BO9 B;  1I3I A;  3BU4 A;  1UCI A;  4MMY B;  1CYV A;  1STF I;  1UGH I;  4OK0 A;  2QIY A;  3PCS A;  4O02 B;  4HM4 B;  1FUW A;  1B2S A;  4WWU C;  1AV4 A;  1MOL A;  3S5C A;  2K54 A;  3FLJ A;  4R80 A;  1YHQ 3;  1Q86 4;  3LZA A;  3SYU A;  1B27 A;  1T2H A;  1A2V A;  3D4A A;  3MG3 A;  4IPB A;  5AII A;  4HJL B;  4ZM8 A;  3DUK A;  1VQ5 3;  2GBX B;  1BAO A;  2L4V A;  2LQV A;  3B4O A;  2OTJ 3;  3EF8 A;  1RNT A;  2BU4 A;  1MGR A;  1B3S A;  1VZZ A;  2OQE A;  1UUW B;  1VQK 3;  1A67 A;  2C4B A;  2UUG C;  3EJV A;  5AYS C;  3CCR 3;  4AEQ A;  3JUP A;  1W00 A;  1IT7 A;  3QK9 A;  2HMK B;  3HX8 A;  4HYZ A;  5ELU A;  1UDI I;  1W4N A;  2AAD A;  1CYU A;  2W6J H;  5G2G A;  4EYC A;  2OCT A;  3SX1 A;  2IMJ A;  2RNT A;  2H0G A;  1AVK A;  3KE7 A;  3S27 A;  3Q3F A;  1IU7 A;  1YIJ 3;  2FGT A;  2R41 A;  1ULI B;  2R4I A;  1BSC A;  3N8B A;  2GXF A;  2L1S A;  3B8L A;  1YJ9 3;  3CD6 3;  3FF2 A;  5DRE A;  1R4C A;  7GSP A;  1GSP A;  4FMB A;  4BU4 A;  2E2U A;  2ZDJ A;  1WTH A;  4O8S A;  2GSP A;  3U1W A;  1L5G B;  3BND A;  2HMO B;  1O7N B;  3ER7 A;  4MJD A;  3ROB A;  3NM7 A;  2INX A;  1VQM 3;  3WOE B;  5TGN A;  3F9S A;  3I0Y A;  5AI1 A;  2BMR B;  4X2O A;  5HOH A;  4LYL B;  4XDV A;  1VQ7 3;  4N6O B;  3Q1C A;  5STD A;  1FUS A;  8CHO A;  3CCU 3;  3I55 3;  3SED A;  2HMN B;  3X41 A;  4EV2 A;  1T3B A;  1X1W A;  4I5Q A;  1RJO A;  5AIF A;  1OHS A;  1GMP A;  3X3Y A;  3EN8 A;  4U13 A;  5RNT A;  5AEU B;  4LGQ A;  4J5K A;  4WFO A;  1QVG 2;  4LSO A;  3JUM A;  4NPB A;  1OHP A;  3DY5 A;  5EEO A;  3CPO A;  1B21 A;  1RSN A;  1I8V A;  4AKY A;  4TX4 A;  3BB9 A;  3WOD G;  1HKX A;  2AAE A;  1JRQ A;  4RZM A;  3ZG0 A;  3F40 A;  2QA4 3;  3FF0 A;  4L8P A;  4WP5 A;  1LNI A;  2XGN A;  5AEW B;  1AVL A;  4HAA A;  1YNV X;  4K61 A;  5IG4 A;  4FMA A;  5KP1 A;  3HOH A;  1YIT 3;  3MYT A;  3CC4 3;  3B7C A;  1UUV B;  4KVH A;  4BIR A;  1Q7Y 4;  5AIH A;  2H0I A;  4GB5 A;  2RBI A;  4FCZ A;  5AIG A;  1GOU A;  1RNB A;  3DM8 A;  3GZB A;  1OCV A;  1GD4 A;  3KKG A;  1MWR A;  1BOX A;  4IT7 A;  1RGG A;  2IYJ A;  1N9E A;  1FGR A;  3GZR A;  1UCK A;  4WYK A;  4J9A A;  3J7Y d;  4QWT A;  5M19 A;  2IUK A;  3GRD A;  4R4K A;  1IT8 A;  3G6E 3;  1B2X A;  4MMX B;  4BTY A;  1FZU A;  3WHO A;  1O7H B;  1QAF A;  2CK3 H;  3EB8 A;  2B24 B;  1C54 A;  1LXE A;  1N9J A;  3AGN A;  3NQZ A;  2Q07 A;  4WYK B;  2FXT A;  4J8T A;  1I2E A;  4HM7 B;  1QMA A;  4KFE A;  5CLK A;  1BSB A;  4HM6 B;  4R9L A;  9RNT A;  2O9U X;  1D6U A;  1D6Y A;  2WOH A;  3F7X A;  3SLU A;  1WMN A;  1N8R 4;  3RGR A;  1I0V A;  1DMQ A;  2F5W A;  1BAN A;  3FCS B;  1BSA A;  5AYR B;  3D5I A;  3E99 A;  1E3V A;  3PZW A;  1YGE A;  2M7O A;  1IDP A;  2P05 A;  1DMM A;  1GY7 A;  1I0X A;  1OHO A;  3ZG5 A;  1AQZ A;  1GMR A;  1KSI A;  3NBJ A;  2BNG A;  4CDL A;  2JQ5 A;  3BIR A;  2XFT A;  3RNT A;  3N54 B;  4HM1 B;  1EEJ A;  3DGY A;  5G1L A;  5KP3 A;  3CNM A;  3V92 A;  1HZ1 A;  4BTX A;  1BUQ A;  4N6N B;  1FUT A;  2CWU A;  1LOV A;  4R1K A;  1QJG A;  3FG4 A;  3HZP A;  1NWW A;  3L0R A;  1RKY A;  4G1M B;  1KQS 2;  6STD A;  1B20 A;  1GY5 A;  4N6L A;  4HBR A;  2WO0 A;  3LXU X;  2W56 B;  3UB1 A;  2CWV A;  3AMO A;  1Q7H A;  1UI7 A;  1SII A;  1W2Z A;  4RNT A;  3Q2P A;  1SAR A;  1I70 A;  1BRJ A;  1UUG B;  5D81 A;  5JBS A;  1PU4 A;  1JZD A;  3O8Y A;  1TUH A;  3WA3 A;  3KN4 A;  1K9M 4;  1EQK A;  1RLS A;  3AMO B;  3LTA A;  3EBT A;  2W04 A;  2GBW B;  2K3D A;  4IIA A;  2CW9 A;  3G0K A;  5CXO A;  2CC3 A;  1GYB A;  1ROA A;  1ZX2 A;  2F99 A;  4HZB B;  1U8C B;  4N6V 0;  1IVV A;  3LTC A;  2XR8 B;  3FG1 A;  3EX9 A;  1W5Z A;  1VQQ A;  1T2I A;  5HGR A;  4FMC A;  1JN5 A;  2GU3 A;  1FGO A;  4H61 A;  3FGY A;  1RGE A;  3G8Z A;  1E97 A;  3K7C A;  3V99 A;  2ML5 A;  2OOV A;  2CFG A;  4LZI A;  1VQL 3;  3AHS A;  1BUJ A;  1W02 A;  1SPU A;  1AR0 A;  2CIU A;  3LYG A;  1BGS A;  4X2H A;  4HM2 B;  3NV0 A;  5IW9 A;  3KZT A;  1C7H A;  2P09 A;  3OXA A;  1TU5 A;  1EKM A;  2WOF A;  4N6T A;  2MC8 A;  1TIJ A;  3WMD A;  1EUI C;  4AKZ A;  1UI8 A;  2WGQ A;  4GSP A;  1N5P A;  3N9H A;  1W6C A;  1K28 A;  1FGM A;  2XGL A;  4Q53 A;  3CMA 3;  3NV0 B;  2ZL8 A;  2E2V A;  4EXR A;  4KZ1 A;  2CFL A;  2W9P A;  2F98 A;  1IQX A;  1IV7 A;  5BIR A;  6GSP A;  3CCJ 3;  3KSP A;  1LQM B;  3HI7 A;  3MSO A;  3MG1 A;  5A0O B;  2W9Q A;  2CX0 A;  2W03 A;  5IEN A;  1ULJ B;  1TJD A;  4JF8 A;  3NM2 A;  3B4P A;  5M18 A;  1BNF A;  1M1X B;  1YVS A;  3CNX A;  1RN1 A;  1TFO A;  2GEY A;  3X42 A;  1OH0 A;  2IA7 A;  2QEX 3;  7STD A;  3AGO A;  1WMP A;  1JJ2 2;  4K1V A;  1B2Z A;  3JUO A;  2KF5 A;  2B1X B;  1QAK A;  1IQ8 A;  1AY7 A;  1BSD A;  1BNI A;  1D6Z A;  4HKV B;  3CCE 3;  3MPH A;  3G16 A;  2ML6 A;  4STD A;  1EA2 A;  2RGQ A;  5IG0 A;  1GS3 A;  3SVA A;  5BVB A;  3U97 A;  3F14 A;  3CPW 2;  1BRG A;  1GY6 A;  3CC7 3;  1OAC A;  2A15 A;  1I3F A;  1KC8 4;  5IG3 A;  3OWS A;  3S29 A;  1BSE A;  3CCV 3;  1Q40 A;  2CG1 A;  1QVF 2;  2ZA4 A;  1PFP A;  4FR9 A;  1J2B A;  1DVD A;  1RTU A;  3BLZ A;  1KWI A;  1V58 A;  2CFK A;  3LT8 A;  2QGU A;  3PGB A;  2XSO B;  3Q90 A;  2CH9 A;  1DYU A;  1X1X A;  2RSX A;  1BRS A;  1BRI A;  1N8Q A;  1UW1 A;  3KCH A;  2I9W A;  3SXX A;  3VSY A;  1VQN 3;  1Q40 B;  1G0T A;  3F8H A;  1JKG A;  3A76 A;  3IJE B;  3DZL A;  3X3X A;  3DXO A;  3WR2 A;  1YGW A;  1Q9E A;  4KFD A;  3NUV A;  5KP4 A;  4EC6 A;  2P0M A;  3EQQ B;  2OWP A;  1CQS A;  3ALA A;  4K1U A;  3CXC 2;  1A90 A;  2JDI H;  2PZV A;  2Y73 A;  5FGO A;  3LTB A;  1BNR A;  3EN1 B;  1NO3 A;  3KII A;  2XH9 A;  5IF6 A;  1GD3 A;  2V1L A;  1Y4K A;  3JUQ A;  4GL6 A;  1RN4 A;  4H3U A;  1MNL A;  1LOY A;  1A2P A;  1TFK A;  3TDG A;  4NRE A;  2J8X B;  3LH4 A;  4JRF A;  3PYJ A;  3H51 A;  3G4S 3;  1IQY A;  3S28 A;  1VQO 3;  1BVI A;  2PNC A;  3CC2 3;  1DE3 A;  1W6Y A;  1STD A;  3WA2 X;  5BXQ A;  3ECF A;  3D3L A;  1K41 A;  2XF3 A;  1RGL A;  3SOA A;  1NJI 4;  1TRQ A;  2YFL B;  3WDG B;  3X3Z A;  1W01 A;  3EC9 A;  3HII A;  4HZ9 B;  1UCJ A;  4BTW A;  3NQY A;  3LML A;  3RDE A;  1JB2 A;  1O7M B;  1K73 4;  4BL3 A;  3G71 3;  4FCJ A;  1UCL A;  3X40 A;  4CPK A;  1BU4 A;  1TTO A;  3LT9 A;  1LOW A;  4N6M A;  1LRA A;  3RGA A;  4O2H A;  5FW5 A;  1HU9 A;  2XEP A;  3H3H A;  4GHO A;  1RGF A;  1VQ9 3;  4K90 B;  3FH1 A;  3F7S A;  3NXJ A;  3NX0 A;  1RGH A;  4RNY A;  1GMQ A;  1ZO2 A;  1IK3 A;  1O7G B;  2GEX A;  2KAA A;  2GU1 A;  4OUQ A;  4HVN A;  3FZW A;  3JVC A;  4N3V A;  3BNC A;  2CKF B;  2KXG A;  2CFW A;  1NNV A;  2Z7A A;  1T5Y A;  3PXM A;  4LEH A;  3ZFZ A;  6RNT A;  4ORL A;  1SIH A;  1X1Y A;  1G96 A;  2O3O A;  4NHF A;  1EG9 B;  2LYX A;  2D1W A;  3FKA A;  1ISK A;  1RCL A;  1YJN 3;  2BHM A;  5BU4 A;  3LOY A;  1RCK A;  1RHL A;  2CG0 A;  2KCD A;  4HM3 B;  4XBX A;  3S67 A;  7RNT A;  1S72 3;  4EV5 A;  2IUJ A;  3UJM A;  1OUN A;  1M9G A;  1VQ8 3;  1JBR A;  3OWU A;  1JB4 A;  3VF1 A;  4XDW A;  1MWS A;  3D9R A;  3CCL 3;  1CH0 A;  2KF4 A;  3UL5 A;  1RGC A;  1IV9 A;  4MEI A;  1JN5 B;  1NDO B;  1LVN A;  2YX9 A;  3V98 A;  2BT3 A;  4N6U A;  2CX1 A;  1RGA A;  3A5E A;  2HOH A;  2RFR A;  2C10 A;  1M90 4;  1WQL B;  1TP6 A;  3KSE D;  2HMM B;  1ZS7 A;  2SAR A;  1VQ4 3;  3GAX A;  1K8A 4;  2FNQ A;  4RBN A;  4R9K A;  4FMD A;  5CF2 A;  1ZGX A;  3IMA B;  1B2U A;  3D5G A;  4HM5 B;  1I2F A;  1JB5 A;  1QAL A;  2P38 A;  2YFI B;  3GWR A;  1VQP 3;  4I4K A;  5D82 A;  3UNL A;  1US1 A;  3DGM A;  2XFS A;  3T8N A;  4DKI A;  1Q81 4;  1NB5 I;  2CHC A;  1ASK A;  1BRH A;  5IER A;  2XRX B;  2W0Q A;  5GSP A;  2OQE C;  3FG3 A;  3JUN A;  5ELJ A;  1BNE A;  1DET A;  3HK4 A;  3K5T A;  1G02 A;  5LC7 A;  5JPP A;  1O7P B;  2BIR A;  4EBG A;  4L8O A;  3FSD A;  3D79 A;  1OGX A;  3URP A;  1F8N A;  1OPY A;  1Q42 A;  2Z77 A;  4KFF A;  2BMO B;  1IYY A;  4O3V A;  4KT3 B;  5EVH A;  1YVB I;  3GSP A;  1S5A A;  2OOV C;  2D42 A;  4OVM A;  3UL6 A;  1OGZ A;  4XBY A;  1BNS A;  5M1A A;  4CJN A;  4PEJ A;  1LNH A;  3M8C A;  3NBR A;  2UX0 A;  3DGO A;  2P0X A;  1U5O A;  1DVC A;  3CME 3;  1IVX A;  4J5G A;  1FYS A;  1NB3 I;  1R4Y A;  1LOX A;  2STD A;  3F8X A;  2CWT A;  3WOF B;  1JNQ A;  1BNJ A;  3T8U A;  3DMC A;  1RDS A;  4FCM A;  1SQW A;  1JV2 B;  2KF3 A;  4HM8 B;  3T0U A;  3CU3 A;  1RMS A;  1RRH A;  5I97 A;  3K9M C;  5D83 A;  1FW7 A;  1CEW I;  2YFJ B;  4HOH A;  1RRL A;  5EQL A;  1HYF A;  2K0M A;  1PYL A;  3DGN A;  3GZY B;  4XB5 A;  2C11 A;  2SBL A;  3NBB A;  1E3R A;  1FA3 A;  2F56 A;  3EE1 A;  1JZO A;  3MWZ A;  3BNE A;  1YI2 3; 
#chains in the Genus database with same CATH homology
 2KRT A;  1JKG B;  1IVW A;  1FGQ A;  2MF7 A;  3K0Z A;  1DMN A;  3LTD A;  3MKI A;  3SOY A;  3KFQ C;  3I56 3;  3CCS 3;  2CFD A;  1W6G A;  2Y74 A;  3K63 A;  1Z1S A;  2W2C A;  5DRV A;  5LC6 A;  1IVU A;  3CCQ 3;  4LMI A;  3STD A;  1SJW A;  1NU3 A;  3OX9 A;  1WMO A;  3NHX A;  1N5H A;  3GZX B;  4XBT A;  1YJW 3;  3VGN A;  2WGO A;  5IG5 A;  5IEP A;  4RNZ A;  2F86 B;  4MMZ B;  3PCR A;  3MG2 A;  2E2T A;  3OWY A;  3QRD A;  3PS8 A;  3IPT A;  5IEO A;  1O7W B;  3OV4 A;  2Z6B A;  1RN7 A;  2XSH B;  3EBY A;  1A2K A;  1W7C A;  5CK6 A;  2BMQ B;  4HM0 B;  5CF1 A;  1W2B 2;  4L7K A;  3MHE A;  2Z76 A;  4WHA A;  3BNB A;  2OTL 3;  4XM4 A;  1OF5 A;  2HMJ B;  1WNH A;  3CCM 3;  2W56 A;  4CCV A;  1VQ6 3;  3HIG A;  1FGT A;  1M1K 4;  1KD1 4;  3DGL A;  2HML B;  3EHC A;  3OW2 2;  2RCD A;  5JPU A;  1ROV A;  1OF5 B;  1V74 A;  1Q82 4;  2BO9 B;  4MMY B;  1CYV A;  1STF I;  4OK0 A;  2QIY A;  3PCS A;  4O02 B;  4HM4 B;  1FUW A;  4WWU C;  1AV4 A;  1MOL A;  3S5C A;  2K54 A;  3FLJ A;  4R80 A;  1YHQ 3;  1Q86 4;  3LZA A;  1A2V A;  3MG3 A;  4IPB A;  5AII A;  4HJL B;  4ZM8 A;  3DUK A;  1VQ5 3;  2GBX B;  2L4V A;  2LQV A;  3B4O A;  2OTJ 3;  3EF8 A;  1VZZ A;  2OQE A;  1UUW B;  1VQK 3;  1A67 A;  5AYS C;  3EJV A;  3CCR 3;  4AEQ A;  3JUP A;  1W00 A;  1IT7 A;  3QK9 A;  2HMK B;  3HX8 A;  4HYZ A;  5ELU A;  1W4N A;  1CYU A;  2W6J H;  5G2G A;  4EYC A;  2OCT A;  3SX1 A;  2IMJ A;  1AVK A;  3KE7 A;  3S27 A;  1IU7 A;  1YIJ 3;  2FGT A;  2R4I A;  1ULI B;  3N8B A;  2GXF A;  3B8L A;  3CD6 3;  1YJ9 3;  3FF2 A;  5DRE A;  1R4C A;  4FMB A;  2E2U A;  2ZDJ A;  1WTH A;  4O8S A;  3U1W A;  1L5G B;  3BND A;  2HMO B;  1O7N B;  3ER7 A;  4MJD A;  3ROB A;  3NM7 A;  2INX A;  1VQM 3;  3WOE B;  5TGN A;  3F9S A;  3I0Y A;  5AI1 A;  2BMR B;  4X2O A;  4XDV A;  1VQ7 3;  4N6O B;  3Q1C A;  5STD A;  8CHO A;  3CCU 3;  3I55 3;  3SED A;  2HMN B;  3X41 A;  4EV2 A;  5AIF A;  1RJO A;  1OHS A;  3X3Y A;  3EN8 A;  4U13 A;  5AEU B;  4LGQ A;  4WFO A;  1QVG 2;  4LSO A;  3JUM A;  1OHP A;  3DY5 A;  5EEO A;  3CPO A;  4AKY A;  4TX4 A;  3BB9 A;  3WOD G;  1HKX A;  1JRQ A;  4RZM A;  2QA4 3;  3F40 A;  3FF0 A;  4L8P A;  4WP5 A;  2XGN A;  5AEW B;  1AVL A;  4K61 A;  5IG4 A;  4FMA A;  5KP1 A;  1YIT 3;  3MYT A;  3CC4 3;  3B7C A;  1UUV B;  4KVH A;  1Q7Y 4;  5AIH A;  4GB5 A;  4FCZ A;  5AIG A;  3DM8 A;  3GZB A;  1OCV A;  1GD4 A;  3KKG A;  4IT7 A;  1N9E A;  1FGR A;  3GZR A;  4WYK A;  4J9A A;  3J7Y d;  4QWT A;  2IUK A;  3GRD A;  4R4K A;  1IT8 A;  3G6E 3;  4MMX B;  4BTY A;  1O7H B;  1QAF A;  2CK3 H;  3EB8 A;  2B24 B;  1LXE A;  1N9J A;  3NQZ A;  2Q07 A;  4WYK B;  2FXT A;  4J8T A;  4HM7 B;  1QMA A;  4KFE A;  5CLK A;  4HM6 B;  4R9L A;  2O9U X;  1D6U A;  1D6Y A;  2WOH A;  3F7X A;  3SLU A;  1WMN A;  1N8R 4;  3RGR A;  1DMQ A;  3FCS B;  5AYR B;  3E99 A;  1E3V A;  3PZW A;  1YGE A;  2M7O A;  1IDP A;  2P05 A;  1DMM A;  1GY7 A;  1OHO A;  1KSI A;  3NBJ A;  2BNG A;  4CDL A;  2JQ5 A;  2XFT A;  3N54 B;  4HM1 B;  5KP3 A;  1BUQ A;  3V92 A;  3CNM A;  4BTX A;  4N6N B;  2CWU A;  4R1K A;  1QJG A;  3FG4 A;  3HZP A;  1NWW A;  3L0R A;  1RKY A;  4G1M B;  1KQS 2;  6STD A;  1GY5 A;  4N6L A;  4HBR A;  2WO0 A;  3LXU X;  2W56 B;  3UB1 A;  2CWV A;  3AMO A;  1UI7 A;  1SII A;  1W2Z A;  3Q2P A;  5D81 A;  5JBS A;  1PU4 A;  3O8Y A;  1TUH A;  3WA3 A;  3KN4 A;  1K9M 4;  1EQK A;  3AMO B;  3LTA A;  3EBT A;  2W04 A;  2GBW B;  4IIA A;  2CW9 A;  3G0K A;  5CXO A;  2CC3 A;  1GYB A;  1ROA A;  1ZX2 A;  2F99 A;  4HZB B;  1U8C B;  4N6V 0;  1IVV A;  3LTC A;  2XR8 B;  3FG1 A;  3EX9 A;  1W5Z A;  5HGR A;  4FMC A;  1JN5 A;  2GU3 A;  1FGO A;  4H61 A;  3FGY A;  3G8Z A;  1E97 A;  3K7C A;  3V99 A;  2ML5 A;  2OOV A;  2CFG A;  4LZI A;  1VQL 3;  1W02 A;  1SPU A;  1AR0 A;  2CIU A;  3LYG A;  4X2H A;  4HM2 B;  3NV0 A;  5IW9 A;  3KZT A;  1C7H A;  2P09 A;  3OXA A;  1TU5 A;  1EKM A;  2WOF A;  4N6T A;  2MC8 A;  1TIJ A;  3WMD A;  4AKZ A;  1UI8 A;  2WGQ A;  1N5P A;  3N9H A;  1W6C A;  1K28 A;  1FGM A;  2XGL A;  4Q53 A;  3CMA 3;  3NV0 B;  2ZL8 A;  2E2V A;  4EXR A;  4KZ1 A;  2CFL A;  2W9P A;  2F98 A;  1IQX A;  1IV7 A;  3CCJ 3;  3KSP A;  3HI7 A;  3MSO A;  3MG1 A;  5A0O B;  2W9Q A;  2W03 A;  5IEN A;  1ULJ B;  4JF8 A;  3NM2 A;  3B4P A;  1M1X B;  3CNX A;  1TFO A;  2GEY A;  3X42 A;  1OH0 A;  2IA7 A;  2QEX 3;  7STD A;  1WMP A;  1JJ2 2;  4K1V A;  3JUO A;  1QAK A;  1IQ8 A;  2B1X B;  3CCE 3;  1D6Z A;  4HKV B;  3MPH A;  3G16 A;  2ML6 A;  4STD A;  1EA2 A;  2RGQ A;  5IG0 A;  1GS3 A;  3SVA A;  5BVB A;  3U97 A;  3F14 A;  3CPW 2;  1GY6 A;  3CC7 3;  1OAC A;  2A15 A;  1KC8 4;  5IG3 A;  3OWS A;  3S29 A;  3CCV 3;  1Q40 A;  2CG1 A;  1QVF 2;  1PFP A;  4FR9 A;  1J2B A;  1DVD A;  3BLZ A;  1KWI A;  2CFK A;  3LT8 A;  2QGU A;  3PGB A;  2XSO B;  3Q90 A;  2CH9 A;  1DYU A;  2RSX A;  3SXX A;  1UW1 A;  1N8Q A;  3VSY A;  2I9W A;  1VQN 3;  1Q40 B;  3F8H A;  1JKG A;  3A76 A;  3IJE B;  3DZL A;  3X3X A;  3DXO A;  4KFD A;  3NUV A;  5KP4 A;  4EC6 A;  2P0M A;  3EQQ B;  2OWP A;  1CQS A;  3ALA A;  4K1U A;  3CXC 2;  1A90 A;  2JDI H;  2PZV A;  2Y73 A;  3LTB A;  3EN1 B;  1NO3 A;  3KII A;  2XH9 A;  5IF6 A;  1GD3 A;  2V1L A;  1Y4K A;  3JUQ A;  4GL6 A;  4H3U A;  5FGO A;  1MNL A;  1TFK A;  3TDG A;  4NRE A;  3LH4 A;  4JRF A;  3PYJ A;  3H51 A;  3G4S 3;  1IQY A;  3S28 A;  1VQO 3;  2PNC A;  3CC2 3;  1W6Y A;  1STD A;  3WA2 X;  5BXQ A;  3ECF A;  3D3L A;  1K41 A;  2XF3 A;  3SOA A;  1NJI 4;  2YFL B;  3WDG B;  3X3Z A;  1W01 A;  3EC9 A;  3HII A;  4HZ9 B;  4BTW A;  3NQY A;  3LML A;  3RDE A;  1JB2 A;  1O7M B;  1K73 4;  3G71 3;  4FCJ A;  3X40 A;  4N6M A;  3LT9 A;  3RGA A;  4O2H A;  5FW5 A;  1HU9 A;  2XEP A;  3H3H A;  1VQ9 3;  4K90 B;  3FH1 A;  3F7S A;  3NXJ A;  3NX0 A;  1IK3 A;  4RNY A;  1ZO2 A;  1O7G B;  2GEX A;  2GU1 A;  4OUQ A;  4HVN A;  3FZW A;  3JVC A;  4N3V A;  3BNC A;  2CKF B;  2KXG A;  2CFW A;  2Z7A A;  3PXM A;  1T5Y A;  4LEH A;  4ORL A;  1SIH A;  1G96 A;  2O3O A;  4NHF A;  1EG9 B;  2LYX A;  2D1W A;  3FKA A;  1ISK A;  1YJN 3;  2BHM A;  3LOY A;  2CG0 A;  3S67 A;  2KCD A;  4HM3 B;  4XBX A;  1S72 3;  4EV5 A;  2IUJ A;  3UJM A;  1OUN A;  1M9G A;  1VQ8 3;  3OWU A;  1JB4 A;  3VF1 A;  4XDW A;  3D9R A;  3CCL 3;  3UL5 A;  1IV9 A;  4MEI A;  1JN5 B;  1NDO B;  1LVN A;  2YX9 A;  3V98 A;  2BT3 A;  4N6U A;  2RFR A;  2C10 A;  1M90 4;  1WQL B;  1TP6 A;  3KSE D;  2HMM B;  1VQ4 3;  3GAX A;  1K8A 4;  2FNQ A;  4RBN A;  4R9K A;  4FMD A;  5CF2 A;  3IMA B;  4HM5 B;  2YFI B;  1JB5 A;  1QAL A;  2P38 A;  3GWR A;  1VQP 3;  4I4K A;  5D82 A;  3UNL A;  1US1 A;  3DGM A;  2XFS A;  3T8N A;  1Q81 4;  1NB5 I;  2CHC A;  1ASK A;  5IER A;  2XRX B;  2W0Q A;  2OQE C;  3FG3 A;  3JUN A;  5ELJ A;  3HK4 A;  3K5T A;  5LC7 A;  5JPP A;  1O7P B;  4EBG A;  4L8O A;  3FSD A;  1OGX A;  1F8N A;  1OPY A;  1Q42 A;  2Z77 A;  4KFF A;  2BMO B;  4O3V A;  5EVH A;  1YVB I;  1S5A A;  2OOV C;  2D42 A;  4OVM A;  3UL6 A;  1OGZ A;  4XBY A;  4PEJ A;  1LNH A;  3M8C A;  3NBR A;  2UX0 A;  3DGO A;  2P0X A;  1U5O A;  1DVC A;  3CME 3;  1IVX A;  1NB3 I;  3WOF B;  1LOX A;  2STD A;  3F8X A;  2CWT A;  1JNQ A;  3T8U A;  3DMC A;  4FCM A;  1SQW A;  1JV2 B;  4HM8 B;  3T0U A;  3CU3 A;  1RRH A;  5I97 A;  3K9M C;  5D83 A;  1CEW I;  2YFJ B;  5EQL A;  1RRL A;  2K0M A;  3DGN A;  3GZY B;  4XB5 A;  2C11 A;  2SBL A;  3NBB A;  1E3R A;  1FA3 A;  3EE1 A;  3MWZ A;  3BNE A;  1YI2 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...