1NJI4

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nji400
1VQK3 3CD63 1Q814 1VQ93 1N8R4 3CCM3 1VQ63 1VQL3 3CCU3 3CCR3 3CPW2 1VQ73 3CXC2 1YJW3 1S723 1QVG2 1VQO3 1VQP3 1KC84 1M1K4 1VQ53 3CCV3 1VQM3 2OTL3 3CC73 1Q864 3CC43 3I553 2OTJ3 3G4S3 1VQ83 1YIT3 1K734 1YJ93 1VQN3 3I563 1Q824 1YJN3 1QVF2 2QA43 1JJ22 3CMA3 3CCE3 1YIJ3 3G6E3 1YI23 1W2B2 1YHQ3 3CC23 3CME3 1K8A4 1M904 3CCS3 2QEX3 3CCQ3 3OW22 1Q7Y4 1KQS2 1VQ43 1KD14 3G713 3CCJ3 1NJI4 3CCL3 1K9M4
chains in the Genus database with same CATH superfamily
1VQK3 1RMSA 3B4OA 4CPKA 1DVDA 1X1UA 3VF1A 1TU5A 1LXEA 2D42A 2ZL8A 2C4BA 5HOHA 2Y73A 2OQEC 2CFLA 3F40A 4FCZA 5ELJA 2P38A 5FW5A 1LQMB 1HZ1A 2INXA 1WMPA 3V99A 1Q40B 2I9WA 3O8YA 3MKIA 1AVKA 2K0MA 3DGNA 2Z77A 3MYTA 2HMLB 1IVVA 4BU4A 4CCVA 1PU4A 3GRDA 4MMZB 5EQLA 3WHOA 1C54A 4CJNA 4BTXA 4L7KA 3ECFA 1QJGA 1OPYA 2XSHB 5I97A 1A2PA 4XBYA 1FGOA 2RFRA 3LTCA 3NM7A 1W4NA 3FG3A 4ORLA 1S5AA 3CU3A 1ZS7A 1QVG2 6GSPA 5JBSA 2XH9A 4J5GA 4FMAA 3T0UA 1B2SA 1RJOA 4J9AA 3CC73 1LQGC 1Q864 4PEJA 3I553 3G4S3 1ROVA 4IT7A 2CH9A 1K734 3FH1A 1EQKA 1TP6A 1LOYA 2YFLB 5IW9A 4HM1B 1KWIA 1NNVA 2CFDA 4MJDA 5G1LA 1E97A 3IJEB 3NX0A 4GHOA 2GEYA 3DXOA 1TFKA 1YNVX 2BHMA 3FG1A 3X3YA 1Q9EA 3OW22 1Q7Y4 4HM4B 1BRHA 1BVIA 2SBLA 3CNXA 4AEQA 2O3OA 5IEOA 3UB1A 4K1VA 3LYGA 1Q814 1VQ93 3DY5A 2QIYA 3G16A 1JBTA 2WGQA 3FLJA 2Z76A 3HK4A 4GB5A 4XBTA 5M1AA 1RLSA 1RN4A 1YVBI 3KKGA 1JB5A 2HMOB 4WYKA 2BMOB 2F98A 1FGQA 2GSPA 1YJ93 1G02A 2KF5A 3LTBA 4H3UA 1MWRA 1W2B2 3CMA3 1C7HA 1UUVB 3HIIA 2FXTA 1V57A 5D83A 3EBTA 1IQ8A 1UI7A 4N3VA 1E3RA 1PFPA 3CCS3 3QRDA 1CYVA 4JF8A 4RNZA 3ZG0A 1VQ43 3T8UA 1A2KA 1B2ZA 1RTUA 3D5IA 5D82A 3CD63 1HYFA 2MF7A 1W00A 3OX9A 5AYRB 2K3DA 1BIRA 3B4PA 4CDLA 1U8CB 1I0XA 1EUIC 1BOXA 1RGKA 1KC84 3MG2A 3B7CA 2CFKA 3DUKA 1I3IA 4GL6A 2YFIB 1BNGA 5HGRA 2Z7AA 1B2MA 1Q7HA 4OVMA 1ULJB 1X1YA 3I563 4K90B 4EBGA 1Q824 1D6UA 3F8HA 1JNQA 1UDII 1IT8A 2XRXB 4G1MB 1Q42A 1B21A 4XDWA 2KF6A 2E2VA 2A15A 1GYBA 2Y74A 1VZZA 4KFFA 1KQS2 4NREA 3BNBA 3MG1A 4H61A 5BIRA 3K5TA 4I4KA 2P0MA 2GEXA 3CPW2 1OGZA 1UGHI 1GD4A 1Z1SA 1JV2B 1E3VA 3LH4A 2ZHXB 3NUVA 4OK0A 4WWUC 2F5WA 5IENA 1BRNL 3EB8A 1J2BA 4O2HA 3F7SA 4EW5A 3GWRA 1L5GB 1BRGA 5LC7A 5FGOA 5AIGA 3H51A 1YIT3 1GMQA 2LYXA 4K61A 1OH0A 1A90A 1JRQA 1TTOA 5AIHA 4O02B 2L1SA 2UUGC 4WYKB 1JN5B 5AEWB 4XB5A 4R9KA 4X2HA 1UI8A 1W6GA 2BMQB 2UGIA 1LNIA 1IK3A 1GMPA 3S29A 2HOHA 4U13A 3N9HA 2CX1A 3CNMA 3JVCA 1SIIA 1DMNA 4BTWA 1ROAA 3MPHA 2HMKB 2IUJA 8CHOA 5M19A 3AMOA 1QALA 3FF0A 4QWTA 3S27A 2L4VA 3NQYA 3NHXA 3RGAA 2Q07A 1NDOB 3FSDA 3MWZA 1DVCA 2WGOA 1RGEA 1CH0A 1VQP3 1VQ53 2RSXA 3J7Yd 1RDSA 1BRKA 4JRFA 3S28A 2W9PA 1PY3A 2BU4A 4L8OA 2RNTA 3NBRA 1BSAA 1RCKA 2CFWA 3KE7A 1RN7A 1RN1A 2IY2A 1TRQA 1B27A 1PYLA 3GZYB 3FGYA 1NWWA 2CWTA 5CLKA 1W5ZA 3LT8A 1BGSA 1UUGB 2XF3A 3LT9A 4KVHA 3CC23 2W6JH 5ELUA 1B2UA 1T3BA 2OWPA 3FG4A 3QK9A 1D6YA 2GBXB 2XFSA 1NJI4 2CW9A 1SIHA 3UL6A 7RNTA 3CCM3 2OCTA 3LTDA 3M8CA 3OWUA 1BSBA 1JBSA 1W02A 4KFEA 1CEWI 1QAKA 3EX9A 3G8ZA 1GD3A 5DREA 2CKFB 2IYJA 2XGLA 1N8QA 3CC43 2XSOB 3SYUA 4WHAA 4HM7B 1QAFA 1OUNA 4R4KA 5IG5A 1FGRA 2CX0A 1VQ83 2CWVA 2HMJB 1RSNA 2P05A 1W6YA 1FW7A 1QVF2 3HX8A 1WMNA 4RNYA 3KIIA 3X3ZA 3WDGB 1UCIA 1I70A 4FCJA 2LQVA 3SOYA 3CME3 1TUHA 4J8TA 1LRAA 2CK3H 3WA2X 1QMAA 4BL2A 1TFOA 1N5PA 3UNLA 2JQ5A 3AHSA 5IG0A 1FUSA 1OHOA 1BRJA 3CCJ3 3SXXA 4J5KA 1GY7A 3FZWA 4N6V0 1UCJA 2CC3A 2AADA 1UGIA 1T2HA 1NU3A 2PNCA 3OWSA 7STDA 3CCR3 2BMRB 1I2FA 4FMBA 1KSIA 1M1K4 3N8BA 4KFDA 4IIAA 4HOHA 3EE1A 3S5CA 1DMMA 3AMOB 1BUJA 3BNEA 4L8PA 1ULIB 3DGOA 3NV0A 5IG4A 2W0QA 1JN5A 1RGGA 1WTHA 2MC8A 4NHFA 3WOEB 4N6NB 3PGBA 2YX9A 6RNTA 4Q53A 8RNTA 3G6E3 3AHWA 1IV7A 3WR2A 4KT3B 3BIRA 2XR8B 3SLUA 1STFI 1GMRA 1I0VA 1LOVA 1KD14 1WMOA 3WOFB 1RNBA 3GZBA 4HVNA 1VQ63 4HKVB 1BNIA 3HIGA 2CWUA 5M18A 1GY5A 2BO9B 2R41A 3G0KA 3GZXB 2OTL3 1AVLA 1G96A 5IEPA 5IF6A 2W56B 1YGEA 1RGFA 3A5EA 2BIRA 3SEDA 3GZRA 3ZFZA 4EV5A 1SJWA 1BUQA 1AY7A 4BL3A 3D79A 1YJN3 1OHSA 3DGYA 3VGNA 1US1A 1YIJ3 3UJMA 1OF5A 2B24B 3A76A 4WFOA 1BNFA 2H0GA 3GSPA 1AR0A 3NXJA 1O7PB 1M1XB 1FUTA 2RBIA 4I5QA 4ILFA 1RNTA 1DE3A 1B20A 1BSCA 1CYUA 1OCVA 3FF2A 4HZBB 2OQEA 2ZA4A 3DGLA 2W9QA 1X1WA 3PCSA 3BLZA 3F8XA 3IPTA 5IERA 1YGWA 4XDVA 5TGNA 1B3SA 1SQWA 2FGTA 3K63A 3N54B 4FR9A 2OTJ3 1IV9A 1N9JA 3KSED 4XM4A 3TDGA 3WODG 4EC6A 3KN4A 2CIUA 1YI23 1LOWA 3NV0B 3DH2A 3WA3A 1RGCA 1ZX2A 4DKIA 4N6OB 4N6TA 4R1KA 3OWYA 1HKXA 1FGTA 1JKGA 2KAAA 1GOYA 2IMJA 3KSPA 1RKYA 1VQN3 3CCL3 1GOVA 2RCDA 1BNRA 1V58A 3LTAA 1VQL3 1I8VA 3CPOA 1GSPA 2FNQA 3MHEA 1SARA 3X41A 3PYJA 3CXC2 1YJW3 5EVHA 1T5YA 3CCV3 5BVBA 5KP3A 1ZO2A 2CFGA 1Y4KA 3Q1CA 5A0OB 3T8NA 7GSPA 1CQSA 2HMMB 1BAOA 4MEIA 1O7NB 3Q90A 4HM8B 3KFQC 1RHLA 2F56A 3Q2PA 4HZ9B 1FA3A 2E2TA 4O8SA 1D6ZA 4HYZA 4R9LA 2CHCA 2KCDA 1BRSA 3OXAA 4BTYA 2F5MA 2H0HA 4O3VA 1DMQA 1M904 1STDA 3OV4A 3RGRA 3VSYA 1OGXA 3EC9A 1NO3A 2CG1A 1BNEA 4HM6B 3BB9A 1OF5B 2F86B 3ALAA 4LGQA 2IA7A 2XGNA 5JPPA 1K41A 2W56A 1IQXA 3K0ZA 1GOUA 3JUMA 1W01A 2M7OA 4RBNA 3LXUX 2AAEA 3AGOA 1WQLB 1OACA 5IG3A 3NBJA 3NM2A 3DGMA 3UL5A 3FKAA 3X3XA 2OOVA 1W2ZA 2KXGA 3EF8A 4FCMA 4AKYA 5DRVA 2R4IA 1EA2A 2QA43 3LZAA 3DZLA 1LOXA 4HJLB 1EKMA 4FMDA 3MG3A 5GSPA 3BU4A 1K28A 3X42A 3I0YA 5CXOA 3ROBA 5CF1A 2K54A 1A67A 3FCSB 1W7CA 2QEX3 1MWSA 5LC6A 4LEHA 3G713 1BRIA 4HM0B 2F4YA 2O9UX 4LYLB 2D1WA 2GU1A 2GU3A 1G0TA 4HM3B 2B1XB 1AV4A 1UW1A 3RNTA 1JKGB 2KF3A 3D3LA 1UCKA 2C10A 3D4AA 1RGHA 3S67A 1N5HA 1MGWA 3F7XA 4LZIA 2YFJB 1RRLA 1BSEA 2H0IA 2HMNB 5D81A 5BXQA 4EXRA 5STDA 3K9MC 4RNTA 1O7MB 2ML6A 4HM5B 2BT3A 3JUPA 1JZDA 3JUQA 1IVUA 1JZOA 2P0XA 3URPA 3NQZA 3L0RA 4HM2B 3K7CA 1NB5I 1TJDA 5AYSC 3JUOA 3CCE3 3WMDA 1YHQ3 1UCLA 4EYCA 4HBRA 1UUWB 1MGRA 1BNSA 3H3HA 1IDPA 2BNGA 3JUNA 4AKZA 4WP5A 1I3FA 1RGLA 3EN1B 4STDA 4ZM8A 1JBRA 3F9SA 3PZWA 1ISKA 1N9EA 3ZG5A 1EEJA 2J8XB 3CCU3 2XEPA 1S723 5AIIA 1VQO3 5AEUB 1IYYA 1FYSA 1IQYA 1BSDA 3LOYA 4EV2A 3BNCA 2SARA 1JB2A 2W04A 2WOHA 1B2XA 1NB3I 1WNHA 1O7HB 5KP4A 3BNDA 1HU9A 4TX4A 4MMXB 2OOVC 2W2CA 2KRTA 3D9RA 6STDA 1IU7A 1IT7A 3PS8A 4HAAA 5RNTA 1YVSA 2WO0A 1LNHA 1MWUA 1R4CA 1BANA 1K8A4 3IMAB 3KZTA 4K1UA 3D5GA 1RCLA 1DETA 1F8NA 3RDEA 3CCQ3 3DM8A 3HOHA 1IVWA 3DMCA 3PXMA 4LSOA 3EQQB 4KZ1A 5EEOA 1DYUA 3EHCA 1SPUA 1N8R4 2PZVA 2RGQA 2KF4A 3STDA 2GXFA 1Q40A 2WOFA 2W03A 1OHPA 1VQM3 3E99A 4IPBA 4OUQA 1BNJA 1GS3A 2QGUA 5G2GA 1RRHA 5CF2A 5AI1A 1I2EA 1ZGXA 4NPBA 2IUKA 1I2GA 3AGNA 5JPUA 1EG9B 1X1XA 3Q3FA 5BU4A 3EJVA 2F99A 1JJ22 1M9GA 1MWTA 2XFTA 1FUWA 3EBYA 5AIFA 4N6UA 5KP1A 2CG0A 1ASKA 3HZPA 2UX0A 3SVAA 1GY6A 1FZUA 1R4YA 1O7GB 3X40A 2V1LA 1LVNA 2P09A 4BIRA 1K9M4 4X2OA 3NBBA 5CK6A 3U97A 1A2VA 1AQZA 3SOAA 2E2UA 1VQQA 2JDIH 3PCRA 1VQ73 2STDA 3F14A 3LMLA 3V92A 1RGAA 3EN8A 3HI7A 3KCHA 1IVXA 3ER7A 1BU4A 3MSOA 1U5OA 9RNTA 3SX1A 1V74A 4MMYB 4R80A 1T2IA 1TIJA 2C11A 2ZDJA 1MNLA 1MOLA 1TRPA 2ML5A 3B8LA 4RZMA 1JB4A 1O7WB 4FMCA 4GSPA 3U1WA 1W6CA 1FGMA 3GAXA 5G1KA 3V98A 2GBWB 4XBXA 4N6MA 4N6LA 4LMIA 2Z6BA
chains in the Genus database with same CATH topology
1VQK3 3B4OA 1DVDA 3VF1A 1TU5A 1LXEA 2D42A 2ZL8A 2Y73A 2OQEC 2CFLA 3F40A 4FCZA 5ELJA 2P38A 5FW5A 2INXA 1WMPA 3V99A 1Q40B 2I9WA 3O8YA 3MKIA 1AVKA 2K0MA 3DGNA 2Z77A 3MYTA 2HMLB 1IVVA 4CCVA 1PU4A 3GRDA 4MMZB 5EQLA 4BTXA 4L7KA 3ECFA 1QJGA 1OPYA 2XSHB 5I97A 4XBYA 1FGOA 2RFRA 3LTCA 3NM7A 1W4NA 3FG3A 4ORLA 1S5AA 3CU3A 1QVG2 5JBSA 2XH9A 4FMAA 3T0UA 1RJOA 4J9AA 3CC73 1Q864 4PEJA 3I553 3G4S3 1ROVA 4IT7A 2CH9A 1K734 3FH1A 1EQKA 1TP6A 2YFLB 5IW9A 4HM1B 1KWIA 4MJDA 2CFDA 1E97A 3IJEB 3NX0A 2GEYA 3DXOA 1TFKA 2BHMA 3FG1A 1Q7Y4 3OW22 4HM4B 2SBLA 3CNXA 4AEQA 2O3OA 5IEOA 3UB1A 4K1VA 3LYGA 1Q814 1VQ93 3DY5A 2QIYA 3G16A 2WGQA 3FLJA 2Z76A 3HK4A 4GB5A 4XBTA 4WYKA 3KKGA 1YVBI 1JB5A 2HMOB 2BMOB 2F98A 1FGQA 1YJ93 3LTBA 4H3UA 3CMA3 1W2B2 1C7HA 1UUVB 3HIIA 2FXTA 5D83A 3EBTA 1IQ8A 1UI7A 4N3VA 1E3RA 1PFPA 3CCS3 3QRDA 1CYVA 4JF8A 4RNZA 1VQ43 3T8UA 1A2KA 5D82A 3CD63 2MF7A 1W00A 3OX9A 5AYRB 3B4PA 4CDLA 1U8CB 1KC84 3MG2A 3B7CA 2CFKA 3DUKA 4GL6A 2YFIB 5HGRA 2Z7AA 4OVMA 1ULJB 3I563 4K90B 4EBGA 1Q824 1D6UA 3F8HA 1JNQA 1IT8A 2XRXB 4G1MB 1Q42A 4XDWA 2E2VA 2A15A 1GYBA 2Y74A 1VZZA 4KFFA 1KQS2 4NREA 3BNBA 3MG1A 4H61A 3K5TA 4I4KA 2P0MA 2GEXA 3CPW2 1OGZA 1Z1SA 1GD4A 3LH4A 1JV2B 1E3VA 3NUVA 4OK0A 4WWUC 1J2BA 5IENA 3EB8A 4O2HA 3F7SA 3GWRA 1L5GB 5LC7A 5FGOA 5AIGA 3H51A 1YIT3 2LYXA 4K61A 1OH0A 1A90A 1JRQA 5AIHA 4O02B 4WYKB 1JN5B 5AEWB 4XB5A 4R9KA 4X2HA 1UI8A 1W6GA 2BMQB 1IK3A 3S29A 4U13A 3N9HA 3CNMA 3JVCA 1SIIA 1DMNA 4BTWA 1ROAA 3MPHA 2HMKB 2IUJA 8CHOA 3AMOA 1QALA 3FF0A 4QWTA 3S27A 2L4VA 3NQYA 3NHXA 3RGAA 2Q07A 1NDOB 3FSDA 3MWZA 1DVCA 2WGOA 1VQP3 1VQ53 2RSXA 3J7Yd 4JRFA 3S28A 2W9PA 4L8OA 3NBRA 2CFWA 3KE7A 1RN7A 3GZYB 3FGYA 1NWWA 2CWTA 5CLKA 1W5ZA 3LT8A 2XF3A 3LT9A 4KVHA 3CC23 2W6JH 5ELUA 2OWPA 3FG4A 3QK9A 1D6YA 2GBXB 2XFSA 1NJI4 2CW9A 1SIHA 3UL6A 3CCM3 2OCTA 3LTDA 3M8CA 3OWUA 1W02A 4KFEA 1CEWI 1QAKA 3EX9A 3G8ZA 1GD3A 5DREA 2CKFB 2XGLA 1N8QA 3CC43 2XSOB 4WHAA 4HM7B 1QAFA 1OUNA 4R4KA 5IG5A 1FGRA 1VQ83 2CWVA 2HMJB 2P05A 1W6YA 1QVF2 3HX8A 1WMNA 4RNYA 3KIIA 3X3ZA 3WDGB 4FCJA 2LQVA 3SOYA 3CME3 1TUHA 4J8TA 3WA2X 2CK3H 1QMAA 1TFOA 1N5PA 3UNLA 2JQ5A 5IG0A 1OHOA 3CCJ3 3SXXA 1GY7A 3FZWA 4N6V0 2CC3A 1NU3A 2PNCA 3OWSA 7STDA 3CCR3 2BMRB 4FMBA 1KSIA 1M1K4 3N8BA 4KFDA 4IIAA 3EE1A 3S5CA 1DMMA 3AMOB 3BNEA 4L8PA 1ULIB 3DGOA 3NV0A 5IG4A 2W0QA 1JN5A 1WTHA 2MC8A 4NHFA 3WOEB 4N6NB 3PGBA 2YX9A 4Q53A 3G6E3 1IV7A 2XR8B 3SLUA 1STFI 1KD14 1WMOA 3WOFB 3GZBA 4HVNA 1VQ63 4HKVB 3HIGA 2CWUA 1GY5A 2BO9B 3G0KA 3GZXB 2OTL3 1AVLA 1G96A 5IEPA 5IF6A 2W56B 1YGEA 3SEDA 3GZRA 4EV5A 1SJWA 1BUQA 1YJN3 1OHSA 3VGNA 1YIJ3 1US1A 3UJMA 1OF5A 2B24B 3A76A 4WFOA 1AR0A 3NXJA 1O7PB 1M1XB 1CYUA 1OCVA 3FF2A 4HZBB 2OQEA 3DGLA 2W9QA 3PCSA 3BLZA 3F8XA 3IPTA 5IERA 4XDVA 5TGNA 1SQWA 2FGTA 3N54B 3K63A 4FR9A 2OTJ3 1IV9A 1N9JA 3KSED 4XM4A 3TDGA 3WODG 4EC6A 3KN4A 2CIUA 1YI23 3NV0B 3WA3A 1ZX2A 4N6OB 4N6TA 4R1KA 3OWYA 1HKXA 1FGTA 1JKGA 2IMJA 3KSPA 1RKYA 1VQN3 3CCL3 2RCDA 3LTAA 1VQL3 3CPOA 3MHEA 2FNQA 3X41A 3CXC2 1YJW3 3PYJA 5EVHA 1T5YA 3CCV3 5BVBA 5KP3A 1ZO2A 2CFGA 1Y4KA 3Q1CA 5A0OB 3T8NA 1CQSA 2HMMB 4MEIA 1O7NB 3Q90A 4HM8B 3KFQC 4HZ9B 3Q2PA 1FA3A 2E2TA 4O8SA 1D6ZA 4HYZA 4R9LA 2CHCA 2KCDA 3OXAA 4BTYA 4O3VA 1DMQA 1M904 1STDA 3OV4A 3RGRA 3VSYA 1OGXA 3EC9A 1NO3A 2CG1A 4HM6B 3BB9A 1OF5B 2F86B 3ALAA 4LGQA 2IA7A 2XGNA 5JPPA 1K41A 2W56A 1IQXA 3K0ZA 3JUMA 1W01A 2M7OA 4RBNA 3LXUX 1WQLB 1OACA 5IG3A 3NBJA 3NM2A 3DGMA 3UL5A 3FKAA 3X3XA 2OOVA 1W2ZA 2KXGA 3EF8A 4FCMA 4AKYA 5DRVA 2R4IA 1EA2A 2QA43 3LZAA 3DZLA 1LOXA 4HJLB 1EKMA 4FMDA 3MG3A 1K28A 3X42A 3I0YA 5CXOA 3ROBA 5CF1A 2K54A 1A67A 3FCSB 1W7CA 2QEX3 5LC6A 4LEHA 3G713 4HM0B 2O9UX 2GU1A 2D1WA 2GU3A 4HM3B 2B1XB 1AV4A 1UW1A 1JKGB 3D3LA 2C10A 3S67A 1N5HA 3X3YA 3F7XA 4LZIA 2YFJB 1RRLA 5BXQA 2HMNB 5D81A 4EXRA 5STDA 3K9MC 1O7MB 2ML6A 4HM5B 2BT3A 3JUPA 3JUQA 1IVUA 2P0XA 3NQZA 3L0RA 4HM2B 3K7CA 1NB5I 5AYSC 3JUOA 3CCE3 3WMDA 1YHQ3 4EYCA 4HBRA 1UUWB 3H3HA 1IDPA 2BNGA 3JUNA 4AKZA 4WP5A 4STDA 3EN1B 4ZM8A 3F9SA 3PZWA 1ISKA 1N9EA 3CCU3 2XEPA 1S723 5AIIA 1VQO3 5AEUB 1IQYA 3LOYA 4EV2A 3BNCA 2W04A 1JB2A 2WOHA 1NB3I 1WNHA 1O7HB 5KP4A 3BNDA 1HU9A 4TX4A 4MMXB 2OOVC 2W2CA 2KRTA 3D9RA 6STDA 1IU7A 1IT7A 3PS8A 2WO0A 1LNHA 1R4CA 1K8A4 3IMAB 3KZTA 4K1UA 3CCQ3 1F8NA 3RDEA 3DM8A 1IVWA 3DMCA 3PXMA 4LSOA 3EQQB 4KZ1A 5EEOA 1DYUA 3EHCA 1SPUA 1N8R4 2PZVA 2RGQA 3STDA 2GXFA 1Q40A 2WOFA 2W03A 1OHPA 1VQM3 3E99A 4IPBA 4OUQA 1GS3A 2QGUA 5G2GA 1RRHA 5CF2A 5AI1A 2IUKA 5JPUA 1EG9B 3EJVA 2F99A 1JJ22 1M9GA 2XFTA 1FUWA 3EBYA 5AIFA 4N6UA 5KP1A 2CG0A 1ASKA 3HZPA 2UX0A 3SVAA 1GY6A 1O7GB 3X40A 2V1LA 1LVNA 2P09A 1K9M4 4X2OA 3NBBA 5CK6A 3U97A 1A2VA 3SOAA 2E2UA 2JDIH 3PCRA 1VQ73 2STDA 3F14A 3LMLA 3V92A 3EN8A 3HI7A 1IVXA 3ER7A 3MSOA 1U5OA 3SX1A 1V74A 4MMYB 4R80A 1TIJA 2C11A 2ZDJA 1MNLA 1MOLA 2ML5A 3B8LA 4RZMA 1JB4A 1O7WB 4FMCA 3U1WA 1W6CA 1FGMA 3GAXA 3V98A 2GBWB 4XBXA 4N6MA 4N6LA 4LMIA 2Z6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK 3;  3CD6 3;  1Q81 4;  1VQ9 3;  1N8R 4;  3CCM 3;  1VQ6 3;  1VQL 3;  3CCU 3;  3CCR 3;  3CPW 2;  1VQ7 3;  3CXC 2;  1YJW 3;  1S72 3;  1QVG 2;  1VQO 3;  1VQP 3;  1KC8 4;  1M1K 4;  1VQ5 3;  3CCV 3;  1VQM 3;  2OTL 3;  3CC7 3;  1Q86 4;  3CC4 3;  3I55 3;  2OTJ 3;  3G4S 3;  1VQ8 3;  1YIT 3;  1K73 4;  1YJ9 3;  1VQN 3;  3I56 3;  1Q82 4;  1YJN 3;  1QVF 2;  2QA4 3;  1JJ2 2;  3CMA 3;  3CCE 3;  1YIJ 3;  3G6E 3;  1YI2 3;  1W2B 2;  1YHQ 3;  3CC2 3;  3CME 3;  1K8A 4;  1M90 4;  3CCS 3;  2QEX 3;  3CCQ 3;  3OW2 2;  1Q7Y 4;  1KQS 2;  1VQ4 3;  1KD1 4;  3G71 3;  3CCJ 3;  1NJI 4;  3CCL 3;  1K9M 4; 
#chains in the Genus database with same CATH topology
 1VQK 3;  1RMS A;  3B4O A;  4CPK A;  1DVD A;  1X1U A;  3VF1 A;  1TU5 A;  1LXE A;  2D42 A;  2ZL8 A;  2C4B A;  5HOH A;  2Y73 A;  2OQE C;  2CFL A;  3F40 A;  4FCZ A;  5ELJ A;  2P38 A;  5FW5 A;  1LQM B;  1HZ1 A;  2INX A;  1WMP A;  3V99 A;  1Q40 B;  2I9W A;  3O8Y A;  3MKI A;  1AVK A;  2K0M A;  3DGN A;  2Z77 A;  3MYT A;  2HML B;  1IVV A;  4BU4 A;  4CCV A;  1PU4 A;  3GRD A;  4MMZ B;  5EQL A;  3WHO A;  1C54 A;  4CJN A;  4BTX A;  4L7K A;  3ECF A;  1QJG A;  1OPY A;  2XSH B;  5I97 A;  1A2P A;  4XBY A;  1FGO A;  2RFR A;  3LTC A;  3NM7 A;  1W4N A;  3FG3 A;  4ORL A;  1S5A A;  3CU3 A;  1ZS7 A;  1QVG 2;  6GSP A;  5JBS A;  2XH9 A;  4J5G A;  4FMA A;  3T0U A;  1B2S A;  1RJO A;  4J9A A;  3CC7 3;  1LQG C;  1Q86 4;  4PEJ A;  3I55 3;  3G4S 3;  1ROV A;  4IT7 A;  2CH9 A;  1K73 4;  3FH1 A;  1EQK A;  1TP6 A;  1LOY A;  2YFL B;  5IW9 A;  4HM1 B;  1KWI A;  1NNV A;  2CFD A;  4MJD A;  5G1L A;  1E97 A;  3IJE B;  3NX0 A;  4GHO A;  2GEY A;  3DXO A;  1TFK A;  1YNV X;  2BHM A;  3FG1 A;  3X3Y A;  1Q9E A;  3OW2 2;  1Q7Y 4;  4HM4 B;  1BRH A;  1BVI A;  2SBL A;  3CNX A;  4AEQ A;  2O3O A;  5IEO A;  3UB1 A;  4K1V A;  3LYG A;  1Q81 4;  1VQ9 3;  3DY5 A;  2QIY A;  3G16 A;  1JBT A;  2WGQ A;  3FLJ A;  2Z76 A;  3HK4 A;  4GB5 A;  4XBT A;  5M1A A;  1RLS A;  1RN4 A;  1YVB I;  3KKG A;  1JB5 A;  2HMO B;  4WYK A;  2BMO B;  2F98 A;  1FGQ A;  2GSP A;  1YJ9 3;  1G02 A;  2KF5 A;  3LTB A;  4H3U A;  1MWR A;  1W2B 2;  3CMA 3;  1C7H A;  1UUV B;  3HII A;  2FXT A;  1V57 A;  5D83 A;  3EBT A;  1IQ8 A;  1UI7 A;  4N3V A;  1E3R A;  1PFP A;  3CCS 3;  3QRD A;  1CYV A;  4JF8 A;  4RNZ A;  3ZG0 A;  1VQ4 3;  3T8U A;  1A2K A;  1B2Z A;  1RTU A;  3D5I A;  5D82 A;  3CD6 3;  1HYF A;  2MF7 A;  1W00 A;  3OX9 A;  5AYR B;  2K3D A;  1BIR A;  3B4P A;  4CDL A;  1U8C B;  1I0X A;  1EUI C;  1BOX A;  1RGK A;  1KC8 4;  3MG2 A;  3B7C A;  2CFK A;  3DUK A;  1I3I A;  4GL6 A;  2YFI B;  1BNG A;  5HGR A;  2Z7A A;  1B2M A;  1Q7H A;  4OVM A;  1ULJ B;  1X1Y A;  3I56 3;  4K90 B;  4EBG A;  1Q82 4;  1D6U A;  3F8H A;  1JNQ A;  1UDI I;  1IT8 A;  2XRX B;  4G1M B;  1Q42 A;  1B21 A;  4XDW A;  2KF6 A;  2E2V A;  2A15 A;  1GYB A;  2Y74 A;  1VZZ A;  4KFF A;  1KQS 2;  4NRE A;  3BNB A;  3MG1 A;  4H61 A;  5BIR A;  3K5T A;  4I4K A;  2P0M A;  2GEX A;  3CPW 2;  1OGZ A;  1UGH I;  1GD4 A;  1Z1S A;  1JV2 B;  1E3V A;  3LH4 A;  2ZHX B;  3NUV A;  4OK0 A;  4WWU C;  2F5W A;  5IEN A;  1BRN L;  3EB8 A;  1J2B A;  4O2H A;  3F7S A;  4EW5 A;  3GWR A;  1L5G B;  1BRG A;  5LC7 A;  5FGO A;  5AIG A;  3H51 A;  1YIT 3;  1GMQ A;  2LYX A;  4K61 A;  1OH0 A;  1A90 A;  1JRQ A;  1TTO A;  5AIH A;  4O02 B;  2L1S A;  2UUG C;  4WYK B;  1JN5 B;  5AEW B;  4XB5 A;  4R9K A;  4X2H A;  1UI8 A;  1W6G A;  2BMQ B;  2UGI A;  1LNI A;  1IK3 A;  1GMP A;  3S29 A;  2HOH A;  4U13 A;  3N9H A;  2CX1 A;  3CNM A;  3JVC A;  1SII A;  1DMN A;  4BTW A;  1ROA A;  3MPH A;  2HMK B;  2IUJ A;  8CHO A;  5M19 A;  3AMO A;  1QAL A;  3FF0 A;  4QWT A;  3S27 A;  2L4V A;  3NQY A;  3NHX A;  3RGA A;  2Q07 A;  1NDO B;  3FSD A;  3MWZ A;  1DVC A;  2WGO A;  1RGE A;  1CH0 A;  1VQP 3;  1VQ5 3;  2RSX A;  3J7Y d;  1RDS A;  1BRK A;  4JRF A;  3S28 A;  2W9P A;  1PY3 A;  2BU4 A;  4L8O A;  2RNT A;  3NBR A;  1BSA A;  1RCK A;  2CFW A;  3KE7 A;  1RN7 A;  1RN1 A;  2IY2 A;  1TRQ A;  1B27 A;  1PYL A;  3GZY B;  3FGY A;  1NWW A;  2CWT A;  5CLK A;  1W5Z A;  3LT8 A;  1BGS A;  1UUG B;  2XF3 A;  3LT9 A;  4KVH A;  3CC2 3;  2W6J H;  5ELU A;  1B2U A;  1T3B A;  2OWP A;  3FG4 A;  3QK9 A;  1D6Y A;  2GBX B;  2XFS A;  1NJI 4;  2CW9 A;  1SIH A;  3UL6 A;  7RNT A;  3CCM 3;  2OCT A;  3LTD A;  3M8C A;  3OWU A;  1BSB A;  1JBS A;  1W02 A;  4KFE A;  1CEW I;  1QAK A;  3EX9 A;  3G8Z A;  1GD3 A;  5DRE A;  2CKF B;  2IYJ A;  2XGL A;  1N8Q A;  3CC4 3;  2XSO B;  3SYU A;  4WHA A;  4HM7 B;  1QAF A;  1OUN A;  4R4K A;  5IG5 A;  1FGR A;  2CX0 A;  1VQ8 3;  2CWV A;  2HMJ B;  1RSN A;  2P05 A;  1W6Y A;  1FW7 A;  1QVF 2;  3HX8 A;  1WMN A;  4RNY A;  3KII A;  3X3Z A;  3WDG B;  1UCI A;  1I70 A;  4FCJ A;  2LQV A;  3SOY A;  3CME 3;  1TUH A;  4J8T A;  1LRA A;  2CK3 H;  3WA2 X;  1QMA A;  4BL2 A;  1TFO A;  1N5P A;  3UNL A;  2JQ5 A;  3AHS A;  5IG0 A;  1FUS A;  1OHO A;  1BRJ A;  3CCJ 3;  3SXX A;  4J5K A;  1GY7 A;  3FZW A;  4N6V 0;  1UCJ A;  2CC3 A;  2AAD A;  1UGI A;  1T2H A;  1NU3 A;  2PNC A;  3OWS A;  7STD A;  3CCR 3;  2BMR B;  1I2F A;  4FMB A;  1KSI A;  1M1K 4;  3N8B A;  4KFD A;  4IIA A;  4HOH A;  3EE1 A;  3S5C A;  1DMM A;  3AMO B;  1BUJ A;  3BNE A;  4L8P A;  1ULI B;  3DGO A;  3NV0 A;  5IG4 A;  2W0Q A;  1JN5 A;  1RGG A;  1WTH A;  2MC8 A;  4NHF A;  3WOE B;  4N6N B;  3PGB A;  2YX9 A;  6RNT A;  4Q53 A;  8RNT A;  3G6E 3;  3AHW A;  1IV7 A;  3WR2 A;  4KT3 B;  3BIR A;  2XR8 B;  3SLU A;  1STF I;  1GMR A;  1I0V A;  1LOV A;  1KD1 4;  1WMO A;  3WOF B;  1RNB A;  3GZB A;  4HVN A;  1VQ6 3;  4HKV B;  1BNI A;  3HIG A;  2CWU A;  5M18 A;  1GY5 A;  2BO9 B;  2R41 A;  3G0K A;  3GZX B;  2OTL 3;  1AVL A;  1G96 A;  5IEP A;  5IF6 A;  2W56 B;  1YGE A;  1RGF A;  3A5E A;  2BIR A;  3SED A;  3GZR A;  3ZFZ A;  4EV5 A;  1SJW A;  1BUQ A;  1AY7 A;  4BL3 A;  3D79 A;  1YJN 3;  1OHS A;  3DGY A;  3VGN A;  1US1 A;  1YIJ 3;  3UJM A;  1OF5 A;  2B24 B;  3A76 A;  4WFO A;  1BNF A;  2H0G A;  3GSP A;  1AR0 A;  3NXJ A;  1O7P B;  1M1X B;  1FUT A;  2RBI A;  4I5Q A;  4ILF A;  1RNT A;  1DE3 A;  1B20 A;  1BSC A;  1CYU A;  1OCV A;  3FF2 A;  4HZB B;  2OQE A;  2ZA4 A;  3DGL A;  2W9Q A;  1X1W A;  3PCS A;  3BLZ A;  3F8X A;  3IPT A;  5IER A;  1YGW A;  4XDV A;  5TGN A;  1B3S A;  1SQW A;  2FGT A;  3K63 A;  3N54 B;  4FR9 A;  2OTJ 3;  1IV9 A;  1N9J A;  3KSE D;  4XM4 A;  3TDG A;  3WOD G;  4EC6 A;  3KN4 A;  2CIU A;  1YI2 3;  1LOW A;  3NV0 B;  3DH2 A;  3WA3 A;  1RGC A;  1ZX2 A;  4DKI A;  4N6O B;  4N6T A;  4R1K A;  3OWY A;  1HKX A;  1FGT A;  1JKG A;  2KAA A;  1GOY A;  2IMJ A;  3KSP A;  1RKY A;  1VQN 3;  3CCL 3;  1GOV A;  2RCD A;  1BNR A;  1V58 A;  3LTA A;  1VQL 3;  1I8V A;  3CPO A;  1GSP A;  2FNQ A;  3MHE A;  1SAR A;  3X41 A;  3PYJ A;  3CXC 2;  1YJW 3;  5EVH A;  1T5Y A;  3CCV 3;  5BVB A;  5KP3 A;  1ZO2 A;  2CFG A;  1Y4K A;  3Q1C A;  5A0O B;  3T8N A;  7GSP A;  1CQS A;  2HMM B;  1BAO A;  4MEI A;  1O7N B;  3Q90 A;  4HM8 B;  3KFQ C;  1RHL A;  2F56 A;  3Q2P A;  4HZ9 B;  1FA3 A;  2E2T A;  4O8S A;  1D6Z A;  4HYZ A;  4R9L A;  2CHC A;  2KCD A;  1BRS A;  3OXA A;  4BTY A;  2F5M A;  2H0H A;  4O3V A;  1DMQ A;  1M90 4;  1STD A;  3OV4 A;  3RGR A;  3VSY A;  1OGX A;  3EC9 A;  1NO3 A;  2CG1 A;  1BNE A;  4HM6 B;  3BB9 A;  1OF5 B;  2F86 B;  3ALA A;  4LGQ A;  2IA7 A;  2XGN A;  5JPP A;  1K41 A;  2W56 A;  1IQX A;  3K0Z A;  1GOU A;  3JUM A;  1W01 A;  2M7O A;  4RBN A;  3LXU X;  2AAE A;  3AGO A;  1WQL B;  1OAC A;  5IG3 A;  3NBJ A;  3NM2 A;  3DGM A;  3UL5 A;  3FKA A;  3X3X A;  2OOV A;  1W2Z A;  2KXG A;  3EF8 A;  4FCM A;  4AKY A;  5DRV A;  2R4I A;  1EA2 A;  2QA4 3;  3LZA A;  3DZL A;  1LOX A;  4HJL B;  1EKM A;  4FMD A;  3MG3 A;  5GSP A;  3BU4 A;  1K28 A;  3X42 A;  3I0Y A;  5CXO A;  3ROB A;  5CF1 A;  2K54 A;  1A67 A;  3FCS B;  1W7C A;  2QEX 3;  1MWS A;  5LC6 A;  4LEH A;  3G71 3;  1BRI A;  4HM0 B;  2F4Y A;  2O9U X;  4LYL B;  2D1W A;  2GU1 A;  2GU3 A;  1G0T A;  4HM3 B;  2B1X B;  1AV4 A;  1UW1 A;  3RNT A;  1JKG B;  2KF3 A;  3D3L A;  1UCK A;  2C10 A;  3D4A A;  1RGH A;  3S67 A;  1N5H A;  1MGW A;  3F7X A;  4LZI A;  2YFJ B;  1RRL A;  1BSE A;  2H0I A;  2HMN B;  5D81 A;  5BXQ A;  4EXR A;  5STD A;  3K9M C;  4RNT A;  1O7M B;  2ML6 A;  4HM5 B;  2BT3 A;  3JUP A;  1JZD A;  3JUQ A;  1IVU A;  1JZO A;  2P0X A;  3URP A;  3NQZ A;  3L0R A;  4HM2 B;  3K7C A;  1NB5 I;  1TJD A;  5AYS C;  3JUO A;  3CCE 3;  3WMD A;  1YHQ 3;  1UCL A;  4EYC A;  4HBR A;  1UUW B;  1MGR A;  1BNS A;  3H3H A;  1IDP A;  2BNG A;  3JUN A;  4AKZ A;  4WP5 A;  1I3F A;  1RGL A;  3EN1 B;  4STD A;  4ZM8 A;  1JBR A;  3F9S A;  3PZW A;  1ISK A;  1N9E A;  3ZG5 A;  1EEJ A;  2J8X B;  3CCU 3;  2XEP A;  1S72 3;  5AII A;  1VQO 3;  5AEU B;  1IYY A;  1FYS A;  1IQY A;  1BSD A;  3LOY A;  4EV2 A;  3BNC A;  2SAR A;  1JB2 A;  2W04 A;  2WOH A;  1B2X A;  1NB3 I;  1WNH A;  1O7H B;  5KP4 A;  3BND A;  1HU9 A;  4TX4 A;  4MMX B;  2OOV C;  2W2C A;  2KRT A;  3D9R A;  6STD A;  1IU7 A;  1IT7 A;  3PS8 A;  4HAA A;  5RNT A;  1YVS A;  2WO0 A;  1LNH A;  1MWU A;  1R4C A;  1BAN A;  1K8A 4;  3IMA B;  3KZT A;  4K1U A;  3D5G A;  1RCL A;  1DET A;  1F8N A;  3RDE A;  3CCQ 3;  3DM8 A;  3HOH A;  1IVW A;  3DMC A;  3PXM A;  4LSO A;  3EQQ B;  4KZ1 A;  5EEO A;  1DYU A;  3EHC A;  1SPU A;  1N8R 4;  2PZV A;  2RGQ A;  2KF4 A;  3STD A;  2GXF A;  1Q40 A;  2WOF A;  2W03 A;  1OHP A;  1VQM 3;  3E99 A;  4IPB A;  4OUQ A;  1BNJ A;  1GS3 A;  2QGU A;  5G2G A;  1RRH A;  5CF2 A;  5AI1 A;  1I2E A;  1ZGX A;  4NPB A;  2IUK A;  1I2G A;  3AGN A;  5JPU A;  1EG9 B;  1X1X A;  3Q3F A;  5BU4 A;  3EJV A;  2F99 A;  1JJ2 2;  1M9G A;  1MWT A;  2XFT A;  1FUW A;  3EBY A;  5AIF A;  4N6U A;  5KP1 A;  2CG0 A;  1ASK A;  3HZP A;  2UX0 A;  3SVA A;  1GY6 A;  1FZU A;  1R4Y A;  1O7G B;  3X40 A;  2V1L A;  1LVN A;  2P09 A;  4BIR A;  1K9M 4;  4X2O A;  3NBB A;  5CK6 A;  3U97 A;  1A2V A;  1AQZ A;  3SOA A;  2E2U A;  1VQQ A;  2JDI H;  3PCR A;  1VQ7 3;  2STD A;  3F14 A;  3LML A;  3V92 A;  1RGA A;  3EN8 A;  3HI7 A;  3KCH A;  1IVX A;  3ER7 A;  1BU4 A;  3MSO A;  1U5O A;  9RNT A;  3SX1 A;  1V74 A;  4MMY B;  4R80 A;  1T2I A;  1TIJ A;  2C11 A;  2ZDJ A;  1MNL A;  1MOL A;  1TRP A;  2ML5 A;  3B8L A;  4RZM A;  1JB4 A;  1O7W B;  4FMC A;  4GSP A;  3U1W A;  1W6C A;  1FGM A;  3GAX A;  5G1K A;  3V98 A;  2GBW B;  4XBX A;  4N6M A;  4N6L A;  4LMI A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 1VQK 3;  3B4O A;  1DVD A;  3VF1 A;  1TU5 A;  1LXE A;  2D42 A;  2ZL8 A;  2Y73 A;  2OQE C;  2CFL A;  3F40 A;  4FCZ A;  5ELJ A;  2P38 A;  5FW5 A;  2INX A;  1WMP A;  3V99 A;  1Q40 B;  2I9W A;  3O8Y A;  3MKI A;  1AVK A;  2K0M A;  3DGN A;  2Z77 A;  3MYT A;  2HML B;  1IVV A;  4CCV A;  1PU4 A;  3GRD A;  4MMZ B;  5EQL A;  4BTX A;  4L7K A;  3ECF A;  1QJG A;  1OPY A;  2XSH B;  5I97 A;  4XBY A;  1FGO A;  2RFR A;  3LTC A;  3NM7 A;  1W4N A;  3FG3 A;  4ORL A;  1S5A A;  3CU3 A;  1QVG 2;  5JBS A;  2XH9 A;  4FMA A;  3T0U A;  1RJO A;  4J9A A;  3CC7 3;  1Q86 4;  4PEJ A;  3I55 3;  3G4S 3;  1ROV A;  4IT7 A;  2CH9 A;  1K73 4;  3FH1 A;  1EQK A;  1TP6 A;  2YFL B;  5IW9 A;  4HM1 B;  1KWI A;  4MJD A;  2CFD A;  1E97 A;  3IJE B;  3NX0 A;  2GEY A;  3DXO A;  1TFK A;  2BHM A;  3FG1 A;  1Q7Y 4;  3OW2 2;  4HM4 B;  2SBL A;  3CNX A;  4AEQ A;  2O3O A;  5IEO A;  3UB1 A;  4K1V A;  3LYG A;  1Q81 4;  1VQ9 3;  3DY5 A;  2QIY A;  3G16 A;  2WGQ A;  3FLJ A;  2Z76 A;  3HK4 A;  4GB5 A;  4XBT A;  4WYK A;  3KKG A;  1YVB I;  1JB5 A;  2HMO B;  2BMO B;  2F98 A;  1FGQ A;  1YJ9 3;  3LTB A;  4H3U A;  3CMA 3;  1W2B 2;  1C7H A;  1UUV B;  3HII A;  2FXT A;  5D83 A;  3EBT A;  1IQ8 A;  1UI7 A;  4N3V A;  1E3R A;  1PFP A;  3CCS 3;  3QRD A;  1CYV A;  4JF8 A;  4RNZ A;  1VQ4 3;  3T8U A;  1A2K A;  5D82 A;  3CD6 3;  2MF7 A;  1W00 A;  3OX9 A;  5AYR B;  3B4P A;  4CDL A;  1U8C B;  1KC8 4;  3MG2 A;  3B7C A;  2CFK A;  3DUK A;  4GL6 A;  2YFI B;  5HGR A;  2Z7A A;  4OVM A;  1ULJ B;  3I56 3;  4K90 B;  4EBG A;  1Q82 4;  1D6U A;  3F8H A;  1JNQ A;  1IT8 A;  2XRX B;  4G1M B;  1Q42 A;  4XDW A;  2E2V A;  2A15 A;  1GYB A;  2Y74 A;  1VZZ A;  4KFF A;  1KQS 2;  4NRE A;  3BNB A;  3MG1 A;  4H61 A;  3K5T A;  4I4K A;  2P0M A;  2GEX A;  3CPW 2;  1OGZ A;  1Z1S A;  1GD4 A;  3LH4 A;  1JV2 B;  1E3V A;  3NUV A;  4OK0 A;  4WWU C;  1J2B A;  5IEN A;  3EB8 A;  4O2H A;  3F7S A;  3GWR A;  1L5G B;  5LC7 A;  5FGO A;  5AIG A;  3H51 A;  1YIT 3;  2LYX A;  4K61 A;  1OH0 A;  1A90 A;  1JRQ A;  5AIH A;  4O02 B;  4WYK B;  1JN5 B;  5AEW B;  4XB5 A;  4R9K A;  4X2H A;  1UI8 A;  1W6G A;  2BMQ B;  1IK3 A;  3S29 A;  4U13 A;  3N9H A;  3CNM A;  3JVC A;  1SII A;  1DMN A;  4BTW A;  1ROA A;  3MPH A;  2HMK B;  2IUJ A;  8CHO A;  3AMO A;  1QAL A;  3FF0 A;  4QWT A;  3S27 A;  2L4V A;  3NQY A;  3NHX A;  3RGA A;  2Q07 A;  1NDO B;  3FSD A;  3MWZ A;  1DVC A;  2WGO A;  1VQP 3;  1VQ5 3;  2RSX A;  3J7Y d;  4JRF A;  3S28 A;  2W9P A;  4L8O A;  3NBR A;  2CFW A;  3KE7 A;  1RN7 A;  3GZY B;  3FGY A;  1NWW A;  2CWT A;  5CLK A;  1W5Z A;  3LT8 A;  2XF3 A;  3LT9 A;  4KVH A;  3CC2 3;  2W6J H;  5ELU A;  2OWP A;  3FG4 A;  3QK9 A;  1D6Y A;  2GBX B;  2XFS A;  1NJI 4;  2CW9 A;  1SIH A;  3UL6 A;  3CCM 3;  2OCT A;  3LTD A;  3M8C A;  3OWU A;  1W02 A;  4KFE A;  1CEW I;  1QAK A;  3EX9 A;  3G8Z A;  1GD3 A;  5DRE A;  2CKF B;  2XGL A;  1N8Q A;  3CC4 3;  2XSO B;  4WHA A;  4HM7 B;  1QAF A;  1OUN A;  4R4K A;  5IG5 A;  1FGR A;  1VQ8 3;  2CWV A;  2HMJ B;  2P05 A;  1W6Y A;  1QVF 2;  3HX8 A;  1WMN A;  4RNY A;  3KII A;  3X3Z A;  3WDG B;  4FCJ A;  2LQV A;  3SOY A;  3CME 3;  1TUH A;  4J8T A;  3WA2 X;  2CK3 H;  1QMA A;  1TFO A;  1N5P A;  3UNL A;  2JQ5 A;  5IG0 A;  1OHO A;  3CCJ 3;  3SXX A;  1GY7 A;  3FZW A;  4N6V 0;  2CC3 A;  1NU3 A;  2PNC A;  3OWS A;  7STD A;  3CCR 3;  2BMR B;  4FMB A;  1KSI A;  1M1K 4;  3N8B A;  4KFD A;  4IIA A;  3EE1 A;  3S5C A;  1DMM A;  3AMO B;  3BNE A;  4L8P A;  1ULI B;  3DGO A;  3NV0 A;  5IG4 A;  2W0Q A;  1JN5 A;  1WTH A;  2MC8 A;  4NHF A;  3WOE B;  4N6N B;  3PGB A;  2YX9 A;  4Q53 A;  3G6E 3;  1IV7 A;  2XR8 B;  3SLU A;  1STF I;  1KD1 4;  1WMO A;  3WOF B;  3GZB A;  4HVN A;  1VQ6 3;  4HKV B;  3HIG A;  2CWU A;  1GY5 A;  2BO9 B;  3G0K A;  3GZX B;  2OTL 3;  1AVL A;  1G96 A;  5IEP A;  5IF6 A;  2W56 B;  1YGE A;  3SED A;  3GZR A;  4EV5 A;  1SJW A;  1BUQ A;  1YJN 3;  1OHS A;  3VGN A;  1YIJ 3;  1US1 A;  3UJM A;  1OF5 A;  2B24 B;  3A76 A;  4WFO A;  1AR0 A;  3NXJ A;  1O7P B;  1M1X B;  1CYU A;  1OCV A;  3FF2 A;  4HZB B;  2OQE A;  3DGL A;  2W9Q A;  3PCS A;  3BLZ A;  3F8X A;  3IPT A;  5IER A;  4XDV A;  5TGN A;  1SQW A;  2FGT A;  3N54 B;  3K63 A;  4FR9 A;  2OTJ 3;  1IV9 A;  1N9J A;  3KSE D;  4XM4 A;  3TDG A;  3WOD G;  4EC6 A;  3KN4 A;  2CIU A;  1YI2 3;  3NV0 B;  3WA3 A;  1ZX2 A;  4N6O B;  4N6T A;  4R1K A;  3OWY A;  1HKX A;  1FGT A;  1JKG A;  2IMJ A;  3KSP A;  1RKY A;  1VQN 3;  3CCL 3;  2RCD A;  3LTA A;  1VQL 3;  3CPO A;  3MHE A;  2FNQ A;  3X41 A;  3CXC 2;  1YJW 3;  3PYJ A;  5EVH A;  1T5Y A;  3CCV 3;  5BVB A;  5KP3 A;  1ZO2 A;  2CFG A;  1Y4K A;  3Q1C A;  5A0O B;  3T8N A;  1CQS A;  2HMM B;  4MEI A;  1O7N B;  3Q90 A;  4HM8 B;  3KFQ C;  4HZ9 B;  3Q2P A;  1FA3 A;  2E2T A;  4O8S A;  1D6Z A;  4HYZ A;  4R9L A;  2CHC A;  2KCD A;  3OXA A;  4BTY A;  4O3V A;  1DMQ A;  1M90 4;  1STD A;  3OV4 A;  3RGR A;  3VSY A;  1OGX A;  3EC9 A;  1NO3 A;  2CG1 A;  4HM6 B;  3BB9 A;  1OF5 B;  2F86 B;  3ALA A;  4LGQ A;  2IA7 A;  2XGN A;  5JPP A;  1K41 A;  2W56 A;  1IQX A;  3K0Z A;  3JUM A;  1W01 A;  2M7O A;  4RBN A;  3LXU X;  1WQL B;  1OAC A;  5IG3 A;  3NBJ A;  3NM2 A;  3DGM A;  3UL5 A;  3FKA A;  3X3X A;  2OOV A;  1W2Z A;  2KXG A;  3EF8 A;  4FCM A;  4AKY A;  5DRV A;  2R4I A;  1EA2 A;  2QA4 3;  3LZA A;  3DZL A;  1LOX A;  4HJL B;  1EKM A;  4FMD A;  3MG3 A;  1K28 A;  3X42 A;  3I0Y A;  5CXO A;  3ROB A;  5CF1 A;  2K54 A;  1A67 A;  3FCS B;  1W7C A;  2QEX 3;  5LC6 A;  4LEH A;  3G71 3;  4HM0 B;  2O9U X;  2GU1 A;  2D1W A;  2GU3 A;  4HM3 B;  2B1X B;  1AV4 A;  1UW1 A;  1JKG B;  3D3L A;  2C10 A;  3S67 A;  1N5H A;  3X3Y A;  3F7X A;  4LZI A;  2YFJ B;  1RRL A;  5BXQ A;  2HMN B;  5D81 A;  4EXR A;  5STD A;  3K9M C;  1O7M B;  2ML6 A;  4HM5 B;  2BT3 A;  3JUP A;  3JUQ A;  1IVU A;  2P0X A;  3NQZ A;  3L0R A;  4HM2 B;  3K7C A;  1NB5 I;  5AYS C;  3JUO A;  3CCE 3;  3WMD A;  1YHQ 3;  4EYC A;  4HBR A;  1UUW B;  3H3H A;  1IDP A;  2BNG A;  3JUN A;  4AKZ A;  4WP5 A;  4STD A;  3EN1 B;  4ZM8 A;  3F9S A;  3PZW A;  1ISK A;  1N9E A;  3CCU 3;  2XEP A;  1S72 3;  5AII A;  1VQO 3;  5AEU B;  1IQY A;  3LOY A;  4EV2 A;  3BNC A;  2W04 A;  1JB2 A;  2WOH A;  1NB3 I;  1WNH A;  1O7H B;  5KP4 A;  3BND A;  1HU9 A;  4TX4 A;  4MMX B;  2OOV C;  2W2C A;  2KRT A;  3D9R A;  6STD A;  1IU7 A;  1IT7 A;  3PS8 A;  2WO0 A;  1LNH A;  1R4C A;  1K8A 4;  3IMA B;  3KZT A;  4K1U A;  3CCQ 3;  1F8N A;  3RDE A;  3DM8 A;  1IVW A;  3DMC A;  3PXM A;  4LSO A;  3EQQ B;  4KZ1 A;  5EEO A;  1DYU A;  3EHC A;  1SPU A;  1N8R 4;  2PZV A;  2RGQ A;  3STD A;  2GXF A;  1Q40 A;  2WOF A;  2W03 A;  1OHP A;  1VQM 3;  3E99 A;  4IPB A;  4OUQ A;  1GS3 A;  2QGU A;  5G2G A;  1RRH A;  5CF2 A;  5AI1 A;  2IUK A;  5JPU A;  1EG9 B;  3EJV A;  2F99 A;  1JJ2 2;  1M9G A;  2XFT A;  1FUW A;  3EBY A;  5AIF A;  4N6U A;  5KP1 A;  2CG0 A;  1ASK A;  3HZP A;  2UX0 A;  3SVA A;  1GY6 A;  1O7G B;  3X40 A;  2V1L A;  1LVN A;  2P09 A;  1K9M 4;  4X2O A;  3NBB A;  5CK6 A;  3U97 A;  1A2V A;  3SOA A;  2E2U A;  2JDI H;  3PCR A;  1VQ7 3;  2STD A;  3F14 A;  3LML A;  3V92 A;  3EN8 A;  3HI7 A;  1IVX A;  3ER7 A;  3MSO A;  1U5O A;  3SX1 A;  1V74 A;  4MMY B;  4R80 A;  1TIJ A;  2C11 A;  2ZDJ A;  1MNL A;  1MOL A;  2ML5 A;  3B8L A;  4RZM A;  1JB4 A;  1O7W B;  4FMC A;  3U1W A;  1W6C A;  1FGM A;  3GAX A;  3V98 A;  2GBW B;  4XBX A;  4N6M A;  4N6L A;  4LMI A;  2Z6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...