1NJI4

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nji400
1VQ73 1Q824 1VQM3 2OTJ3 1VQ83 1M1K4 1YI23 1VQO3 1YIJ3 1M904 3CC43 1JJ22 3CC23 3CXC2 3CMA3 3CCM3 1N8R4 1K8A4 1QVG2 1YHQ3 3CCQ3 1YIT3 1YJN3 1W2B2 1VQP3 1KQS2 1S723 2QA43 1YJ93 3I563 3CCE3 3CCS3 3CCJ3 1K734 3G6E3 3CME3 1Q814 1KD14 1VQK3 1VQ53 1VQ93 1VQN3 1QVF2 2QEX3 3CC73 1Q864 3G713 3G4S3 3CCV3 1YJW3 1Q7Y4 3I553 1VQ63 1NJI4 1KC84 1K9M4 3CPW2 3CCU3 3OW22 3CCR3 2OTL3 3CCL3 1VQ43 3CD63 1VQL3
chains in the Genus database with same CATH superfamily
1VQ73 3B7CA 1JBSA 3FCSB 1T2HA 4LYLB 4EW5A 1B2MA 1BSEA 1UUGB 1STFI 1N9JA 2XGNA 3QRDA 2CHCA 2GEXA 2OWPA 2UGIA 3EJVA 5M19A 5AYRB 5D83A 2HMOB 3AMOA 1YIT3 2Z7AA 4PEJA 3PCSA 4HAAA 3G16A 3IJEB 1YVSA 5BXQA 1BGSA 1K28A 2INXA 1HYFA 2BMOB 2CX0A 2P0MA 3AMOB 2OOVA 2CWUA 1WTHA 4G1MB 2H0IA 2F98A 1W02A 3CC73 2KF6A 3HK4A 1LNHA 1VZZA 2RBIA 3A5EA 4HOHA 4Q53A 3ROBA 3MG2A 3I553 1JBRA 1OCVA 1LOXA 4O8SA 5DRVA 1GMPA 3FGYA 1RGGA 3KKGA 5D81A 1IVWA 1YVBI 3S67A 2K0MA 1D6ZA 1YNVX 1RGLA 1C7HA 3AGOA 3NV0A 1RGHA 3D79A 3GZXB 4EV2A 1JB5A 2JQ5A 1UUVB 2FXTA 4X2OA 2KF4A 1Q9EA 1UI7A 1S723 1QAFA 2F5MA 3IMAB 3MKIA 3NHXA 3G0KA 1UI8A 2V1LA 1KWIA 4N6MA 1JZDA 1O7MB 1JV2B 2RSXA 3OWUA 3J7Yd 1BRIA 1FUTA 1NWWA 1W4NA 1YGEA 4U13A 2BHMA 1IU7A 1OHPA 2F4YA 4R80A 2BU4A 8RNTA 1FUWA 1N9EA 3MYTA 3SVAA 1RMSA 3GRDA 5IEOA 4WFOA 1G96A 1RDSA 5CLKA 3FKAA 1X1WA 4GHOA 2XEPA 4WHAA 3PS8A 4BIRA 3FSDA 4XM4A 2AAEA 3AHWA 2H0HA 1GYBA 3FG4A 1TTOA 2YFLB 1GY5A 3MHEA 1Y4KA 3CMA3 1I0VA 1PY3A 1IT8A 3EF8A 3SOAA 2W9PA 1BNJA 1N8R4 2YX9A 3N9HA 1US1A 1LQMB 4ILFA 4KFEA 4MJDA 3WR2A 2IUJA 4L8OA 2HMLB 2QGUA 3KSED 1BRJA 5AIFA 1B27A 3LOYA 4R1KA 2H0GA 2CW9A 1OUNA 1I2GA 1MWSA 2WGQA 1FUSA 1FGTA 2C11A 2KRTA 1SPUA 3V98A 3V92A 5CXOA 2YFIB 3G6E3 1K734 5ELUA 1BSAA 2KXGA 4GL6A 1C54A 2I9WA 4HYZA 4LZIA 1VQ63 2WOHA 2STDA 3JUQA 4HM8B 2UX0A 4R9LA 1HZ1A 4IPBA 5EVHA 3CCR3 5AIHA 1B3SA 2FGTA 5JPUA 1A2KA 2GXFA 6RNTA 1M1XB 1W6YA 2GBWB 2XH9A 3F8HA 1JB2A 4RZMA 1VQM3 3HIGA 1I2EA 2GEYA 4KT3B 2W0QA 3KIIA 3H3HA 1AVLA 2UUGC 1V57A 2GU1A 2KF5A 4BL2A 3EB8A 1QVG2 4HM7B 2Z76A 4BTXA 4BTYA 3PCRA 3SYUA 4X2HA 8CHOA 4N6LA 1OF5A 2F5WA 3MG1A 2Y73A 4N6V0 2RNTA 1FGMA 2XSOB 3LYGA 1JB4A 1BVIA 1RCLA 2P05A 1AY7A 3HIIA 3NV0B 3OV4A 3FG1A 4HM3B 2QEX3 4H61A 3JUNA 4O02B 1GOVA 3K5TA 1T5YA 1U8CB 3D5IA 4NHFA 3EHCA 7GSPA 1BAOA 1GSPA 2IMJA 1BNEA 2IYJA 4LMIA 3Q2PA 1BNSA 1Q7HA 3X3YA 4CJNA 1Q824 2BMRB 3U1WA 1BRSA 3D3LA 3B8LA 3SX1A 1I70A 1RGFA 3ALAA 3QK9A 1LXEA 2K54A 1JZOA 1B2ZA 3CNMA 4LSOA 1IYYA 3HI7A 3NM7A 2W9QA 3JUOA 2F56A 1BSCA 1LVNA 3T0UA 3CCS3 2M7OA 3DY5A 4EYCA 4HM5B 1RHLA 2CFDA 1OHOA 3D5GA 4FMCA 5M18A 4CDLA 1RN4A 4TX4A 2CG1A 7RNTA 3N54B 1BRNL 1VQ43 1VQ93 3PZWA 2YFJB 3PYJA 4FCMA 1LRAA 3NXJA 1YI23 2E2UA 1X1XA 3K7CA 1BNFA 4EBGA 2XSHB 1LOWA 3X3ZA 1MGRA 2LQVA 1K8A4 1UW1A 1ZS7A 1GMQA 2R4IA 3U97A 3BIRA 1HKXA 5FW5A 2WOFA 2IUKA 2CWTA 3GZYB 3X42A 1V74A 3WODG 3N8BA 4FMDA 4K90B 3MSOA 4MMXB 1Q814 2Z6BA 1BRKA 3F40A 1BNIA 1NNVA 3D9RA 3DGMA 1ZGXA 2HMJB 4STDA 3VSYA 5BVBA 1W6GA 4K1VA 2W56A 4CCVA 1D6UA 3LH4A 3OWSA 1Q40B 1EQKA 1JBTA 3DGLA 4RNTA 4FR9A 1IVXA 1MWRA 1CH0A 5A0OB 1TIJA 2LYXA 1AV4A 1W6CA 2R41A 2CG0A 5G2GA 1I3FA 3ZG0A 4XDVA 1TUHA 4HM1B 1CYVA 3X40A 3BLZA 3WOEB 4KFDA 3T8UA 2F86B 2ML5A 4H3UA 1NB3I 1FYSA 2XF3A 3CCJ3 2PZVA 1SARA 5IG4A 3WA2X 1RRLA 4EC6A 3PGBA 1MGWA 3EX9A 3G713 1BANA 1JRQA 3F7SA 3V99A 3HZPA 3WA3A 3EC9A 1GOUA 1UGIA 5AEWB 3DUKA 5AYSC 1SIHA 2CFWA 2CKFB 1B21A 2W56B 2ZDJA 3EE1A 2BT3A 4RNYA 3BU4A 7STDA 1R4CA 4I5QA 1IV7A 2Y74A 1CYUA 1DMNA 3UNLA 5IG3A 2B1XB 4NREA 1JN5A 5G1LA 3SOYA 1YHQ3 1VQQA 2HMMB 2GSPA 1B2SA 2CFKA 4EV5A 1CQSA 1TFOA 1W5ZA 1UCKA 3HOHA 1O7NB 2O9UX 3I0YA 3MG3A 1EG9B 2WGOA 6STDA 2KAAA 1IK3A 5G1KA 1DMMA 6GSPA 2W6JH 1JKGA 1GY7A 3RGRA 5BIRA 1NJI4 5IF6A 2D1WA 4J9AA 5CK6A 2MF7A 1K41A 1B2UA 3CU3A 3JVCA 5HOHA 2K3DA 4CPKA 1RLSA 2OTJ3 1RGAA 1GMRA 3FF2A 1BRHA 1IT7A 3AGNA 1X1YA 2CC3A 2KCDA 2KF3A 3CXC2 1NB5I 1IQ8A 3B4OA 1YGWA 3CPOA 4N6OB 1ISKA 1RN1A 1IQYA 1A2PA 4MMYB 4HM0B 3ZFZA 3H51A 3CCQ3 1FZUA 1UCLA 1L5GB 1RSNA 1KQS2 5IEPA 1DMQA 3RDEA 1YJ93 3KFQC 3I563 4MMZB 3CCE3 1N5PA 1N5HA 1O7HB 3SEDA 4AKZA 1ROVA 1SQWA 4JRFA 4HKVB 5CF1A 2CH9A 4GSPA 4BTWA 3CCV3 1E3RA 2J8XB 3EN1B 1ULJB 1KC84 2P0XA 1IVUA 4QWTA 1I3IA 3LXUX 2B24B 1O7WB 1PYLA 1S5AA 1VQL3 1WMPA 1W2ZA 1EUIC 5LC6A 1UUWB 2XR8B 2W2CA 3KZTA 1KSIA 1OPYA 9RNTA 4O2HA 1RGEA 3CC43 1GD3A 3BNCA 3S28A 1WNHA 1IVVA 2HOHA 1AVKA 4EXRA 4KZ1A 2BMQB 3KCHA 1VQP3 2Q07A 4K61A 4L8PA 3EQQB 4BU4A 1TJDA 1BRGA 1RGCA 2XRXB 1UDII 1GD4A 1PFPA 1RN7A 1WMOA 5GSPA 1BUQA 1KD14 4WWUC 4FCJA 3BB9A 4HZ9B 3FG3A 1OHSA 4XBTA 5AEUB 1PU4A 1Q864 1QVF2 1YJW3 5M1AA 1ROAA 3OWYA 3O8YA 3K9MC 2RFRA 3UJMA 1QJGA 1X1UA 4FCZA 1MOLA 4KFFA 4N6NB 4N6TA 1GS3A 3URPA 5KP1A 3E99A 3BNDA 1OGXA 1IQXA 3NBBA 3WMDA 2CIUA 3PXMA 4RNZA 4HM2B 1ZO2A 1DVDA 4XB5A 2GU3A 1DYUA 3DZLA 3FF0A 5BU4A 2L1SA 1RKYA 1LNIA 1BIRA 3A76A 1A67A 3OXAA 1U5OA 1IV9A 1CEWI 1JKGB 1IDPA 2SBLA 2XFTA 2C10A 2P38A 2A15A 2PNCA 2OQEC 3UB1A 1VQN3 3LTAA 3T8NA 2BNGA 2XGLA 3EBTA 1TU5A 4HM6B 3LTBA 2CWVA 3NQYA 1SJWA 1TFKA 3CD63 1I8VA 1A90A 3F8XA 4LEHA 4WYKB 3LT8A 2JDIH 5FGOA 1M9GA 1TRPA 4HBRA 1RTUA 3DH2A 1DE3A 1EKMA 3LT9A 4HM4B 2OQEA 3RNTA 3UL6A 4IIAA 1BU4A 1NDOB 1OGZA 1R4YA 3Q90A 4MEIA 1UCIA 4AKYA 1Q42A 3KE7A 1UCJA 2E2TA 4O3VA 3SXXA 3IPTA 3G8ZA 2CFGA 2P09A 3G4S3 3X41A 1MNLA 1UGHI 1DVCA 1WMNA 1FA3A 2BIRA 1G0TA 3M8CA 5I97A 3GZRA 1D6YA 2GBXB 1NO3A 4XBYA 3STDA 4HVNA 4ZM8A 2BO9B 1BSDA 3B4PA 3FLJA 3S27A 3SLUA 2W04A 3CNXA 3VF1A 5TGNA 1BNRA 2W03A 3DMCA 2RCDA 1LOYA 2IY2A 2ZL8A 2QIYA 3F14A 2QA43 1NU3A 4HZBB 5EQLA 3FH1A 1W01A 4LGQA 3WOFB 1E97A 4N3VA 1JN5B 1VQK3 1VQ53 2WO0A 2CX1A 1BUJA 1W00A 1RNBA 5IENA 2SARA 1RCKA 4WYKA 3WDGB 3GSPA 1BSBA 3DXOA 3D4AA 5KP3A 3NBRA 1JNQA 4AEQA 3CCL3 3OW22 3FZWA 3KN4A 5KP4A 1HU9A 3LMLA 1B2XA 3L0RA 3DM8A 3S29A 5JBSA 2L4VA 1M904 4XBXA 2C4BA 1BNGA 4BL3A 4XDWA 1YIJ3 2ZHXB 1QMAA 3LTDA 4OK0A 1G02A 1FGRA 1QALA 1FW7A 3NUVA 5LC7A 2IA7A 1MWTA 4J8TA 5AIGA 1O7GB 1Q40A 3DGYA 2OOVC 1ASKA 1RRHA 4HJLB 1A2VA 4R9KA 2CFLA 3HX8A 4ORLA 4RBNA 2Z77A 3JUPA 5IERA 1ZX2A 3UL5A 1I2FA 3RGAA 2ML6A 3BNEA 3GZBA 4IT7A 3ZG5A 1RJOA 5EEOA 1QAKA 1DETA 3CPW2 3ER7A 1WQLB 1J2BA 1E3VA 4WP5A 1B20A 4DKIA 1T2IA 5AI1A 2D42A 2AADA 5JPPA 4KVHA 1VQ83 5ELJA 2HMNB 2HMKB 1JJ22 3GWRA 1AR0A 1GOYA 1OACA 3F9SA 3K0ZA 4JF8A 3LZAA 2F99A 3K63A 3MPHA 4N6UA 3Q3FA 2RGQA 5HGRA 1F8NA 1N8QA 1O7PB 3F7XA 2FNQA 2XFSA 2MC8A 3EN8A 3KSPA 3X3XA 5RNTA 3CME3 4I4KA 3MWZA 3NM2A 3VGNA 1STDA 1LQGC 1ULIB 1MWUA 1EEJA 1T3BA 2OTL3 3TDGA 1SIIA 1OF5B 1I0XA 4J5GA 2E2VA 4J5KA 2O3OA 1M1K4 1GY6A 1EA2A 1VQO3 1AQZA 4R4KA 1LOVA 3WHOA 3BNBA 3OX9A 3DGNA 4L7KA 3LTCA 3CC23 1FGOA 1RNTA 4FMBA 5D82A 3CCM3 5IW9A 4K1UA 5AIIA 4FMAA 1BOXA 1V58A 5IG0A 3EBYA 1W7CA 2ZA4A 4NPBA 1YJN3 3Q1CA 1W2B2 3NX0A 5STDA 1TRQA 2CK3H 5CF2A 4OUQA 3DGOA 5IG5A 1RGKA 1TP6A 3JUMA 4GB5A 3NBJA 3AHSA 1OH0A 1FGQA 3ECFA 3GAXA 3S5CA 1Q7Y4 5DREA 4OVMA 2OCTA 1K9M4 3NQZA 3CCU3 1Z1SA
chains in the Genus database with same CATH topology
1VQ73 3B7CA 3FCSB 1STFI 1N9JA 2XGNA 3QRDA 2CHCA 2GEXA 2OWPA 3EJVA 5AYRB 5D83A 2HMOB 3AMOA 1YIT3 2Z7AA 4PEJA 3PCSA 3G16A 3IJEB 5BXQA 1K28A 2INXA 2BMOB 2P0MA 3AMOB 2OOVA 2CWUA 1WTHA 4G1MB 2F98A 1W02A 3CC73 3HK4A 1LNHA 1VZZA 4Q53A 3ROBA 3I553 3MG2A 1OCVA 1LOXA 4O8SA 5DRVA 3FGYA 3KKGA 5D81A 1IVWA 1YVBI 3S67A 2K0MA 1D6ZA 1C7HA 3NV0A 3GZXB 4EV2A 1JB5A 2JQ5A 1UUVB 2FXTA 4X2OA 1UI7A 1S723 1QAFA 3IMAB 3MKIA 3NHXA 3G0KA 1UI8A 2V1LA 1KWIA 4N6MA 2RSXA 1O7MB 1JV2B 3OWUA 3J7Yd 1NWWA 1W4NA 1YGEA 4U13A 2BHMA 1IU7A 1OHPA 4R80A 1FUWA 1N9EA 3MYTA 3SVAA 3GRDA 5IEOA 4WFOA 1G96A 5CLKA 3FKAA 4WHAA 2XEPA 3PS8A 3FSDA 4XM4A 1GYBA 3FG4A 2YFLB 1GY5A 3MHEA 1Y4KA 3CMA3 1IT8A 3EF8A 3SOAA 2W9PA 1N8R4 2YX9A 3N9HA 1US1A 4KFEA 4MJDA 2IUJA 4L8OA 2HMLB 2QGUA 3KSED 5AIFA 3LOYA 4R1KA 2CW9A 1OUNA 2WGQA 1FGTA 2C11A 2KRTA 3V98A 1SPUA 3V92A 3G6E3 5CXOA 2YFIB 1K734 5ELUA 2KXGA 4GL6A 2I9WA 4HYZA 4LZIA 1VQ63 2WOHA 2STDA 3JUQA 4HM8B 2UX0A 4R9LA 4IPBA 5EVHA 3CCR3 5AIHA 2FGTA 5JPUA 1A2KA 2GXFA 1M1XB 1W6YA 2GBWB 2XH9A 3F8HA 1JB2A 4RZMA 1VQM3 3HIGA 2GEYA 2W0QA 3KIIA 3H3HA 1AVLA 2GU1A 3EB8A 1QVG2 4HM7B 2Z76A 4BTXA 4BTYA 3PCRA 4X2HA 8CHOA 4N6LA 1OF5A 3MG1A 2Y73A 4N6V0 3LYGA 1FGMA 2XSOB 1JB4A 2P05A 3NV0B 3OV4A 3HIIA 3FG1A 4HM3B 2QEX3 4H61A 3JUNA 4O02B 3K5TA 1T5YA 1U8CB 4NHFA 3EHCA 2IMJA 4LMIA 3Q2PA 1Q824 3X3YA 2BMRB 3U1WA 3D3LA 3B8LA 3SX1A 3ALAA 3QK9A 1LXEA 2K54A 3CNMA 4LSOA 3HI7A 3NM7A 2W9QA 3JUOA 1LVNA 3T0UA 3CCS3 2M7OA 3DY5A 4EYCA 4HM5B 2CFDA 4FMCA 1OHOA 4CDLA 4TX4A 2CG1A 3N54B 1VQ43 1VQ93 3PZWA 2YFJB 3PYJA 4FCMA 3NXJA 1YI23 2E2UA 3K7CA 4EBGA 2XSHB 3X3ZA 2LQVA 1K8A4 1UW1A 2R4IA 3U97A 1HKXA 5FW5A 2WOFA 2IUKA 2CWTA 3GZYB 3X42A 1V74A 3WODG 3N8BA 4FMDA 4K90B 3MSOA 4MMXB 1Q814 2Z6BA 3F40A 3D9RA 3DGMA 4STDA 2HMJB 3VSYA 5BVBA 1W6GA 4K1VA 2W56A 4CCVA 1D6UA 3LH4A 3OWSA 1Q40B 1EQKA 3DGLA 4FR9A 1IVXA 5A0OB 1TIJA 2LYXA 1AV4A 1W6CA 2CG0A 5G2GA 4XDVA 1TUHA 4HM1B 1CYVA 3X40A 3BLZA 3WOEB 4KFDA 3T8UA 2F86B 2ML5A 4H3UA 1NB3I 2XF3A 3CCJ3 2PZVA 5IG4A 3WA2X 1RRLA 4EC6A 3PGBA 3EX9A 3G713 1JRQA 3F7SA 3V99A 3HZPA 3WA3A 3EC9A 5AEWB 3DUKA 5AYSC 1SIHA 2CFWA 2CKFB 2W56B 2ZDJA 3EE1A 2BT3A 4RNYA 7STDA 1R4CA 1IV7A 2Y74A 1CYUA 1DMNA 3UNLA 5IG3A 2B1XB 4NREA 1JN5A 3SOYA 1YHQ3 2HMMB 2CFKA 4EV5A 1CQSA 1TFOA 1W5ZA 3I0YA 3MG3A 1O7NB 2O9UX 4KZ1A 1EG9B 2WGOA 6STDA 1IK3A 1DMMA 2W6JH 1JKGA 1GY7A 3RGRA 1NJI4 5IF6A 2D1WA 4J9AA 5CK6A 2MF7A 1K41A 3CU3A 3JVCA 2OTJ3 3FF2A 1IT7A 2CC3A 2KCDA 3CXC2 1NB5I 1IQ8A 3B4OA 3CPOA 4N6OB 1ISKA 1IQYA 4MMYB 4HM0B 3H51A 3CCQ3 1L5GB 1KQS2 5IEPA 1DMQA 3RDEA 1YJ93 3KFQC 3I563 4MMZB 3CCE3 1N5PA 1N5HA 1O7HB 3SEDA 4AKZA 1ROVA 1SQWA 4JRFA 4HKVB 5CF1A 2CH9A 4BTWA 3CCV3 1E3RA 3EN1B 1ULJB 1KC84 2P0XA 1IVUA 4QWTA 3LXUX 2B24B 1O7WB 1S5AA 1VQL3 1WMPA 1W2ZA 5LC6A 1UUWB 2XR8B 2W2CA 3KZTA 1KSIA 1OPYA 4O2HA 3CC43 1GD3A 3BNCA 3S28A 1WNHA 1IVVA 1AVKA 4EXRA 2BMQB 1VQP3 2Q07A 4K61A 4L8PA 3EQQB 2XRXB 1GD4A 1PFPA 1RN7A 1WMOA 1BUQA 1KD14 4WWUC 4FCJA 3BB9A 4HZ9B 3FG3A 1OHSA 4XBTA 5AEUB 1PU4A 1Q864 1QVF2 1YJW3 1ROAA 3OWYA 3O8YA 3K9MC 2RFRA 3UJMA 1QJGA 4N6TA 4FCZA 1MOLA 4KFFA 4N6NB 5KP1A 1GS3A 3E99A 3BNDA 1OGXA 1IQXA 3NBBA 3WMDA 2CIUA 3PXMA 4RNZA 4HM2B 1ZO2A 1DVDA 4XB5A 2GU3A 1DYUA 3DZLA 3FF0A 1RKYA 3A76A 1A67A 3OXAA 1U5OA 2SBLA 2XFTA 1IV9A 1CEWI 1JKGB 1IDPA 2C10A 2P38A 2A15A 2PNCA 2OQEC 3UB1A 1VQN3 3LTAA 3T8NA 2BNGA 2XGLA 3EBTA 1TU5A 4HM6B 3LTBA 2CWVA 3NQYA 1SJWA 1TFKA 3CD63 1A90A 3F8XA 4LEHA 4WYKB 3LT8A 2JDIH 5FGOA 1M9GA 4HBRA 1EKMA 3LT9A 4HM4B 2OQEA 3UL6A 4IIAA 1NDOB 1OGZA 3Q90A 4MEIA 4AKYA 1Q42A 3KE7A 2E2TA 3SXXA 4O3VA 3IPTA 3G8ZA 2CFGA 2P09A 3G4S3 3X41A 1MNLA 1WMNA 1DVCA 1FA3A 3M8CA 5I97A 3GZRA 1D6YA 2GBXB 1NO3A 4XBYA 3STDA 4HVNA 4ZM8A 2BO9B 3VF1A 3B4PA 3FLJA 3S27A 3SLUA 2W04A 3CNXA 5TGNA 2W03A 3DMCA 2RCDA 2ZL8A 2QIYA 3F14A 2QA43 1NU3A 4HZBB 5EQLA 3FH1A 1W01A 4LGQA 3WOFB 1E97A 4N3VA 1JN5B 1VQK3 1VQ53 2WO0A 1W00A 5IENA 4WYKA 3WDGB 3DXOA 3OW22 5KP3A 4AEQA 3NBRA 1JNQA 3CCL3 3FZWA 3KN4A 5KP4A 1HU9A 3LMLA 3L0RA 3DM8A 3S29A 5JBSA 2L4VA 1M904 4XBXA 1YIJ3 4XDWA 1QMAA 3LTDA 4OK0A 1QALA 1FGRA 3NUVA 5LC7A 2IA7A 4J8TA 5AIGA 1O7GB 1Q40A 2OOVC 1ASKA 1RRHA 4HJLB 1A2VA 4R9KA 2CFLA 3HX8A 4ORLA 4RBNA 2Z77A 3JUPA 5IERA 1ZX2A 3UL5A 3RGAA 2ML6A 3BNEA 3GZBA 4IT7A 1RJOA 5EEOA 1QAKA 3CPW2 3ER7A 1WQLB 1J2BA 1E3VA 4WP5A 5AI1A 2D42A 5JPPA 4KVHA 1VQ83 5ELJA 2HMNB 2HMKB 1JJ22 3GWRA 1AR0A 1OACA 3F9SA 3K0ZA 4JF8A 3LZAA 2F99A 3K63A 3MPHA 4N6UA 2RGQA 5HGRA 1F8NA 1N8QA 1O7PB 3F7XA 2FNQA 2XFSA 2MC8A 3EN8A 3KSPA 3X3XA 3CME3 4I4KA 3MWZA 3NM2A 3VGNA 1STDA 1ULIB 2OTL3 3TDGA 1SIIA 1OF5B 2E2VA 2O3OA 1M1K4 1GY6A 1EA2A 1VQO3 4R4KA 3BNBA 3OX9A 3DGNA 4L7KA 3LTCA 3CC23 1FGOA 4FMBA 5D82A 3CCM3 5IW9A 4K1UA 5AIIA 4FMAA 5IG0A 3EBYA 1W7CA 1YJN3 1W2B2 3Q1CA 3NX0A 5STDA 2CK3H 5CF2A 4OUQA 3DGOA 5IG5A 3JUMA 1TP6A 4GB5A 3NBJA 3ECFA 1OH0A 1FGQA 3S5CA 3GAXA 1Q7Y4 5DREA 4OVMA 2OCTA 1K9M4 3NQZA 3CCU3 1Z1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 3;  1Q82 4;  1VQM 3;  2OTJ 3;  1VQ8 3;  1M1K 4;  1YI2 3;  1VQO 3;  1YIJ 3;  1M90 4;  3CC4 3;  1JJ2 2;  3CC2 3;  3CXC 2;  3CMA 3;  3CCM 3;  1N8R 4;  1K8A 4;  1QVG 2;  1YHQ 3;  3CCQ 3;  1YIT 3;  1YJN 3;  1W2B 2;  1VQP 3;  1KQS 2;  1S72 3;  2QA4 3;  1YJ9 3;  3I56 3;  3CCE 3;  3CCS 3;  3CCJ 3;  1K73 4;  3G6E 3;  3CME 3;  1Q81 4;  1KD1 4;  1VQK 3;  1VQ5 3;  1VQ9 3;  1VQN 3;  1QVF 2;  2QEX 3;  3CC7 3;  1Q86 4;  3G71 3;  3G4S 3;  3CCV 3;  1YJW 3;  1Q7Y 4;  3I55 3;  1VQ6 3;  1NJI 4;  1KC8 4;  1K9M 4;  3CPW 2;  3CCU 3;  3OW2 2;  3CCR 3;  2OTL 3;  3CCL 3;  1VQ4 3;  3CD6 3;  1VQL 3; 
#chains in the Genus database with same CATH topology
 1VQ7 3;  3B7C A;  1JBS A;  3FCS B;  1T2H A;  4LYL B;  4EW5 A;  1B2M A;  1BSE A;  1UUG B;  1STF I;  1N9J A;  2XGN A;  3QRD A;  2CHC A;  2GEX A;  2OWP A;  2UGI A;  3EJV A;  5M19 A;  5AYR B;  5D83 A;  2HMO B;  3AMO A;  1YIT 3;  2Z7A A;  4PEJ A;  3PCS A;  4HAA A;  3G16 A;  3IJE B;  1YVS A;  5BXQ A;  1BGS A;  1K28 A;  2INX A;  1HYF A;  2BMO B;  2CX0 A;  2P0M A;  3AMO B;  2OOV A;  2CWU A;  1WTH A;  4G1M B;  2H0I A;  2F98 A;  1W02 A;  3CC7 3;  2KF6 A;  3HK4 A;  1LNH A;  1VZZ A;  2RBI A;  3A5E A;  4HOH A;  4Q53 A;  3ROB A;  3MG2 A;  3I55 3;  1JBR A;  1OCV A;  1LOX A;  4O8S A;  5DRV A;  1GMP A;  3FGY A;  1RGG A;  3KKG A;  5D81 A;  1IVW A;  1YVB I;  3S67 A;  2K0M A;  1D6Z A;  1YNV X;  1RGL A;  1C7H A;  3AGO A;  3NV0 A;  1RGH A;  3D79 A;  3GZX B;  4EV2 A;  1JB5 A;  2JQ5 A;  1UUV B;  2FXT A;  4X2O A;  2KF4 A;  1Q9E A;  1UI7 A;  1S72 3;  1QAF A;  2F5M A;  3IMA B;  3MKI A;  3NHX A;  3G0K A;  1UI8 A;  2V1L A;  1KWI A;  4N6M A;  1JZD A;  1O7M B;  1JV2 B;  2RSX A;  3OWU A;  3J7Y d;  1BRI A;  1FUT A;  1NWW A;  1W4N A;  1YGE A;  4U13 A;  2BHM A;  1IU7 A;  1OHP A;  2F4Y A;  4R80 A;  2BU4 A;  8RNT A;  1FUW A;  1N9E A;  3MYT A;  3SVA A;  1RMS A;  3GRD A;  5IEO A;  4WFO A;  1G96 A;  1RDS A;  5CLK A;  3FKA A;  1X1W A;  4GHO A;  2XEP A;  4WHA A;  3PS8 A;  4BIR A;  3FSD A;  4XM4 A;  2AAE A;  3AHW A;  2H0H A;  1GYB A;  3FG4 A;  1TTO A;  2YFL B;  1GY5 A;  3MHE A;  1Y4K A;  3CMA 3;  1I0V A;  1PY3 A;  1IT8 A;  3EF8 A;  3SOA A;  2W9P A;  1BNJ A;  1N8R 4;  2YX9 A;  3N9H A;  1US1 A;  1LQM B;  4ILF A;  4KFE A;  4MJD A;  3WR2 A;  2IUJ A;  4L8O A;  2HML B;  2QGU A;  3KSE D;  1BRJ A;  5AIF A;  1B27 A;  3LOY A;  4R1K A;  2H0G A;  2CW9 A;  1OUN A;  1I2G A;  1MWS A;  2WGQ A;  1FUS A;  1FGT A;  2C11 A;  2KRT A;  1SPU A;  3V98 A;  3V92 A;  5CXO A;  2YFI B;  3G6E 3;  1K73 4;  5ELU A;  1BSA A;  2KXG A;  4GL6 A;  1C54 A;  2I9W A;  4HYZ A;  4LZI A;  1VQ6 3;  2WOH A;  2STD A;  3JUQ A;  4HM8 B;  2UX0 A;  4R9L A;  1HZ1 A;  4IPB A;  5EVH A;  3CCR 3;  5AIH A;  1B3S A;  2FGT A;  5JPU A;  1A2K A;  2GXF A;  6RNT A;  1M1X B;  1W6Y A;  2GBW B;  2XH9 A;  3F8H A;  1JB2 A;  4RZM A;  1VQM 3;  3HIG A;  1I2E A;  2GEY A;  4KT3 B;  2W0Q A;  3KII A;  3H3H A;  1AVL A;  2UUG C;  1V57 A;  2GU1 A;  2KF5 A;  4BL2 A;  3EB8 A;  1QVG 2;  4HM7 B;  2Z76 A;  4BTX A;  4BTY A;  3PCR A;  3SYU A;  4X2H A;  8CHO A;  4N6L A;  1OF5 A;  2F5W A;  3MG1 A;  2Y73 A;  4N6V 0;  2RNT A;  1FGM A;  2XSO B;  3LYG A;  1JB4 A;  1BVI A;  1RCL A;  2P05 A;  1AY7 A;  3HII A;  3NV0 B;  3OV4 A;  3FG1 A;  4HM3 B;  2QEX 3;  4H61 A;  3JUN A;  4O02 B;  1GOV A;  3K5T A;  1T5Y A;  1U8C B;  3D5I A;  4NHF A;  3EHC A;  7GSP A;  1BAO A;  1GSP A;  2IMJ A;  1BNE A;  2IYJ A;  4LMI A;  3Q2P A;  1BNS A;  1Q7H A;  3X3Y A;  4CJN A;  1Q82 4;  2BMR B;  3U1W A;  1BRS A;  3D3L A;  3B8L A;  3SX1 A;  1I70 A;  1RGF A;  3ALA A;  3QK9 A;  1LXE A;  2K54 A;  1JZO A;  1B2Z A;  3CNM A;  4LSO A;  1IYY A;  3HI7 A;  3NM7 A;  2W9Q A;  3JUO A;  2F56 A;  1BSC A;  1LVN A;  3T0U A;  3CCS 3;  2M7O A;  3DY5 A;  4EYC A;  4HM5 B;  1RHL A;  2CFD A;  1OHO A;  3D5G A;  4FMC A;  5M18 A;  4CDL A;  1RN4 A;  4TX4 A;  2CG1 A;  7RNT A;  3N54 B;  1BRN L;  1VQ4 3;  1VQ9 3;  3PZW A;  2YFJ B;  3PYJ A;  4FCM A;  1LRA A;  3NXJ A;  1YI2 3;  2E2U A;  1X1X A;  3K7C A;  1BNF A;  4EBG A;  2XSH B;  1LOW A;  3X3Z A;  1MGR A;  2LQV A;  1K8A 4;  1UW1 A;  1ZS7 A;  1GMQ A;  2R4I A;  3U97 A;  3BIR A;  1HKX A;  5FW5 A;  2WOF A;  2IUK A;  2CWT A;  3GZY B;  3X42 A;  1V74 A;  3WOD G;  3N8B A;  4FMD A;  4K90 B;  3MSO A;  4MMX B;  1Q81 4;  2Z6B A;  1BRK A;  3F40 A;  1BNI A;  1NNV A;  3D9R A;  3DGM A;  1ZGX A;  2HMJ B;  4STD A;  3VSY A;  5BVB A;  1W6G A;  4K1V A;  2W56 A;  4CCV A;  1D6U A;  3LH4 A;  3OWS A;  1Q40 B;  1EQK A;  1JBT A;  3DGL A;  4RNT A;  4FR9 A;  1IVX A;  1MWR A;  1CH0 A;  5A0O B;  1TIJ A;  2LYX A;  1AV4 A;  1W6C A;  2R41 A;  2CG0 A;  5G2G A;  1I3F A;  3ZG0 A;  4XDV A;  1TUH A;  4HM1 B;  1CYV A;  3X40 A;  3BLZ A;  3WOE B;  4KFD A;  3T8U A;  2F86 B;  2ML5 A;  4H3U A;  1NB3 I;  1FYS A;  2XF3 A;  3CCJ 3;  2PZV A;  1SAR A;  5IG4 A;  3WA2 X;  1RRL A;  4EC6 A;  3PGB A;  1MGW A;  3EX9 A;  3G71 3;  1BAN A;  1JRQ A;  3F7S A;  3V99 A;  3HZP A;  3WA3 A;  3EC9 A;  1GOU A;  1UGI A;  5AEW B;  3DUK A;  5AYS C;  1SIH A;  2CFW A;  2CKF B;  1B21 A;  2W56 B;  2ZDJ A;  3EE1 A;  2BT3 A;  4RNY A;  3BU4 A;  7STD A;  1R4C A;  4I5Q A;  1IV7 A;  2Y74 A;  1CYU A;  1DMN A;  3UNL A;  5IG3 A;  2B1X B;  4NRE A;  1JN5 A;  5G1L A;  3SOY A;  1YHQ 3;  1VQQ A;  2HMM B;  2GSP A;  1B2S A;  2CFK A;  4EV5 A;  1CQS A;  1TFO A;  1W5Z A;  1UCK A;  3HOH A;  1O7N B;  2O9U X;  3I0Y A;  3MG3 A;  1EG9 B;  2WGO A;  6STD A;  2KAA A;  1IK3 A;  5G1K A;  1DMM A;  6GSP A;  2W6J H;  1JKG A;  1GY7 A;  3RGR A;  5BIR A;  1NJI 4;  5IF6 A;  2D1W A;  4J9A A;  5CK6 A;  2MF7 A;  1K41 A;  1B2U A;  3CU3 A;  3JVC A;  5HOH A;  2K3D A;  4CPK A;  1RLS A;  2OTJ 3;  1RGA A;  1GMR A;  3FF2 A;  1BRH A;  1IT7 A;  3AGN A;  1X1Y A;  2CC3 A;  2KCD A;  2KF3 A;  3CXC 2;  1NB5 I;  1IQ8 A;  3B4O A;  1YGW A;  3CPO A;  4N6O B;  1ISK A;  1RN1 A;  1IQY A;  1A2P A;  4MMY B;  4HM0 B;  3ZFZ A;  3H51 A;  3CCQ 3;  1FZU A;  1UCL A;  1L5G B;  1RSN A;  1KQS 2;  5IEP A;  1DMQ A;  3RDE A;  1YJ9 3;  3KFQ C;  3I56 3;  4MMZ B;  3CCE 3;  1N5P A;  1N5H A;  1O7H B;  3SED A;  4AKZ A;  1ROV A;  1SQW A;  4JRF A;  4HKV B;  5CF1 A;  2CH9 A;  4GSP A;  4BTW A;  3CCV 3;  1E3R A;  2J8X B;  3EN1 B;  1ULJ B;  1KC8 4;  2P0X A;  1IVU A;  4QWT A;  1I3I A;  3LXU X;  2B24 B;  1O7W B;  1PYL A;  1S5A A;  1VQL 3;  1WMP A;  1W2Z A;  1EUI C;  5LC6 A;  1UUW B;  2XR8 B;  2W2C A;  3KZT A;  1KSI A;  1OPY A;  9RNT A;  4O2H A;  1RGE A;  3CC4 3;  1GD3 A;  3BNC A;  3S28 A;  1WNH A;  1IVV A;  2HOH A;  1AVK A;  4EXR A;  4KZ1 A;  2BMQ B;  3KCH A;  1VQP 3;  2Q07 A;  4K61 A;  4L8P A;  3EQQ B;  4BU4 A;  1TJD A;  1BRG A;  1RGC A;  2XRX B;  1UDI I;  1GD4 A;  1PFP A;  1RN7 A;  1WMO A;  5GSP A;  1BUQ A;  1KD1 4;  4WWU C;  4FCJ A;  3BB9 A;  4HZ9 B;  3FG3 A;  1OHS A;  4XBT A;  5AEU B;  1PU4 A;  1Q86 4;  1QVF 2;  1YJW 3;  5M1A A;  1ROA A;  3OWY A;  3O8Y A;  3K9M C;  2RFR A;  3UJM A;  1QJG A;  1X1U A;  4FCZ A;  1MOL A;  4KFF A;  4N6N B;  4N6T A;  1GS3 A;  3URP A;  5KP1 A;  3E99 A;  3BND A;  1OGX A;  1IQX A;  3NBB A;  3WMD A;  2CIU A;  3PXM A;  4RNZ A;  4HM2 B;  1ZO2 A;  1DVD A;  4XB5 A;  2GU3 A;  1DYU A;  3DZL A;  3FF0 A;  5BU4 A;  2L1S A;  1RKY A;  1LNI A;  1BIR A;  3A76 A;  1A67 A;  3OXA A;  1U5O A;  1IV9 A;  1CEW I;  1JKG B;  1IDP A;  2SBL A;  2XFT A;  2C10 A;  2P38 A;  2A15 A;  2PNC A;  2OQE C;  3UB1 A;  1VQN 3;  3LTA A;  3T8N A;  2BNG A;  2XGL A;  3EBT A;  1TU5 A;  4HM6 B;  3LTB A;  2CWV A;  3NQY A;  1SJW A;  1TFK A;  3CD6 3;  1I8V A;  1A90 A;  3F8X A;  4LEH A;  4WYK B;  3LT8 A;  2JDI H;  5FGO A;  1M9G A;  1TRP A;  4HBR A;  1RTU A;  3DH2 A;  1DE3 A;  1EKM A;  3LT9 A;  4HM4 B;  2OQE A;  3RNT A;  3UL6 A;  4IIA A;  1BU4 A;  1NDO B;  1OGZ A;  1R4Y A;  3Q90 A;  4MEI A;  1UCI A;  4AKY A;  1Q42 A;  3KE7 A;  1UCJ A;  2E2T A;  4O3V A;  3SXX A;  3IPT A;  3G8Z A;  2CFG A;  2P09 A;  3G4S 3;  3X41 A;  1MNL A;  1UGH I;  1DVC A;  1WMN A;  1FA3 A;  2BIR A;  1G0T A;  3M8C A;  5I97 A;  3GZR A;  1D6Y A;  2GBX B;  1NO3 A;  4XBY A;  3STD A;  4HVN A;  4ZM8 A;  2BO9 B;  1BSD A;  3B4P A;  3FLJ A;  3S27 A;  3SLU A;  2W04 A;  3CNX A;  3VF1 A;  5TGN A;  1BNR A;  2W03 A;  3DMC A;  2RCD A;  1LOY A;  2IY2 A;  2ZL8 A;  2QIY A;  3F14 A;  2QA4 3;  1NU3 A;  4HZB B;  5EQL A;  3FH1 A;  1W01 A;  4LGQ A;  3WOF B;  1E97 A;  4N3V A;  1JN5 B;  1VQK 3;  1VQ5 3;  2WO0 A;  2CX1 A;  1BUJ A;  1W00 A;  1RNB A;  5IEN A;  2SAR A;  1RCK A;  4WYK A;  3WDG B;  3GSP A;  1BSB A;  3DXO A;  3D4A A;  5KP3 A;  3NBR A;  1JNQ A;  4AEQ A;  3CCL 3;  3OW2 2;  3FZW A;  3KN4 A;  5KP4 A;  1HU9 A;  3LML A;  1B2X A;  3L0R A;  3DM8 A;  3S29 A;  5JBS A;  2L4V A;  1M90 4;  4XBX A;  2C4B A;  1BNG A;  4BL3 A;  4XDW A;  1YIJ 3;  2ZHX B;  1QMA A;  3LTD A;  4OK0 A;  1G02 A;  1FGR A;  1QAL A;  1FW7 A;  3NUV A;  5LC7 A;  2IA7 A;  1MWT A;  4J8T A;  5AIG A;  1O7G B;  1Q40 A;  3DGY A;  2OOV C;  1ASK A;  1RRH A;  4HJL B;  1A2V A;  4R9K A;  2CFL A;  3HX8 A;  4ORL A;  4RBN A;  2Z77 A;  3JUP A;  5IER A;  1ZX2 A;  3UL5 A;  1I2F A;  3RGA A;  2ML6 A;  3BNE A;  3GZB A;  4IT7 A;  3ZG5 A;  1RJO A;  5EEO A;  1QAK A;  1DET A;  3CPW 2;  3ER7 A;  1WQL B;  1J2B A;  1E3V A;  4WP5 A;  1B20 A;  4DKI A;  1T2I A;  5AI1 A;  2D42 A;  2AAD A;  5JPP A;  4KVH A;  1VQ8 3;  5ELJ A;  2HMN B;  2HMK B;  1JJ2 2;  3GWR A;  1AR0 A;  1GOY A;  1OAC A;  3F9S A;  3K0Z A;  4JF8 A;  3LZA A;  2F99 A;  3K63 A;  3MPH A;  4N6U A;  3Q3F A;  2RGQ A;  5HGR A;  1F8N A;  1N8Q A;  1O7P B;  3F7X A;  2FNQ A;  2XFS A;  2MC8 A;  3EN8 A;  3KSP A;  3X3X A;  5RNT A;  3CME 3;  4I4K A;  3MWZ A;  3NM2 A;  3VGN A;  1STD A;  1LQG C;  1ULI B;  1MWU A;  1EEJ A;  1T3B A;  2OTL 3;  3TDG A;  1SII A;  1OF5 B;  1I0X A;  4J5G A;  2E2V A;  4J5K A;  2O3O A;  1M1K 4;  1GY6 A;  1EA2 A;  1VQO 3;  1AQZ A;  4R4K A;  1LOV A;  3WHO A;  3BNB A;  3OX9 A;  3DGN A;  4L7K A;  3LTC A;  3CC2 3;  1FGO A;  1RNT A;  4FMB A;  5D82 A;  3CCM 3;  5IW9 A;  4K1U A;  5AII A;  4FMA A;  1BOX A;  1V58 A;  5IG0 A;  3EBY A;  1W7C A;  2ZA4 A;  4NPB A;  1YJN 3;  3Q1C A;  1W2B 2;  3NX0 A;  5STD A;  1TRQ A;  2CK3 H;  5CF2 A;  4OUQ A;  3DGO A;  5IG5 A;  1RGK A;  1TP6 A;  3JUM A;  4GB5 A;  3NBJ A;  3AHS A;  1OH0 A;  1FGQ A;  3ECF A;  3GAX A;  3S5C A;  1Q7Y 4;  5DRE A;  4OVM A;  2OCT A;  1K9M 4;  3NQZ A;  3CCU 3;  1Z1S A; 
#chains in the Genus database with same CATH homology
 1VQ7 3;  3B7C A;  3FCS B;  1STF I;  1N9J A;  2XGN A;  3QRD A;  2CHC A;  2GEX A;  2OWP A;  3EJV A;  5AYR B;  5D83 A;  2HMO B;  3AMO A;  1YIT 3;  2Z7A A;  4PEJ A;  3PCS A;  3G16 A;  3IJE B;  5BXQ A;  1K28 A;  2INX A;  2BMO B;  2P0M A;  3AMO B;  2OOV A;  2CWU A;  1WTH A;  4G1M B;  2F98 A;  1W02 A;  3CC7 3;  3HK4 A;  1LNH A;  1VZZ A;  4Q53 A;  3ROB A;  3I55 3;  3MG2 A;  1OCV A;  1LOX A;  4O8S A;  5DRV A;  3FGY A;  3KKG A;  5D81 A;  1IVW A;  1YVB I;  3S67 A;  2K0M A;  1D6Z A;  1C7H A;  3NV0 A;  3GZX B;  4EV2 A;  1JB5 A;  2JQ5 A;  1UUV B;  2FXT A;  4X2O A;  1UI7 A;  1S72 3;  1QAF A;  3IMA B;  3MKI A;  3NHX A;  3G0K A;  1UI8 A;  2V1L A;  1KWI A;  4N6M A;  2RSX A;  1O7M B;  1JV2 B;  3OWU A;  3J7Y d;  1NWW A;  1W4N A;  1YGE A;  4U13 A;  2BHM A;  1IU7 A;  1OHP A;  4R80 A;  1FUW A;  1N9E A;  3MYT A;  3SVA A;  3GRD A;  5IEO A;  4WFO A;  1G96 A;  5CLK A;  3FKA A;  4WHA A;  2XEP A;  3PS8 A;  3FSD A;  4XM4 A;  1GYB A;  3FG4 A;  2YFL B;  1GY5 A;  3MHE A;  1Y4K A;  3CMA 3;  1IT8 A;  3EF8 A;  3SOA A;  2W9P A;  1N8R 4;  2YX9 A;  3N9H A;  1US1 A;  4KFE A;  4MJD A;  2IUJ A;  4L8O A;  2HML B;  2QGU A;  3KSE D;  5AIF A;  3LOY A;  4R1K A;  2CW9 A;  1OUN A;  2WGQ A;  1FGT A;  2C11 A;  2KRT A;  3V98 A;  1SPU A;  3V92 A;  3G6E 3;  5CXO A;  2YFI B;  1K73 4;  5ELU A;  2KXG A;  4GL6 A;  2I9W A;  4HYZ A;  4LZI A;  1VQ6 3;  2WOH A;  2STD A;  3JUQ A;  4HM8 B;  2UX0 A;  4R9L A;  4IPB A;  5EVH A;  3CCR 3;  5AIH A;  2FGT A;  5JPU A;  1A2K A;  2GXF A;  1M1X B;  1W6Y A;  2GBW B;  2XH9 A;  3F8H A;  1JB2 A;  4RZM A;  1VQM 3;  3HIG A;  2GEY A;  2W0Q A;  3KII A;  3H3H A;  1AVL A;  2GU1 A;  3EB8 A;  1QVG 2;  4HM7 B;  2Z76 A;  4BTX A;  4BTY A;  3PCR A;  4X2H A;  8CHO A;  4N6L A;  1OF5 A;  3MG1 A;  2Y73 A;  4N6V 0;  3LYG A;  1FGM A;  2XSO B;  1JB4 A;  2P05 A;  3NV0 B;  3OV4 A;  3HII A;  3FG1 A;  4HM3 B;  2QEX 3;  4H61 A;  3JUN A;  4O02 B;  3K5T A;  1T5Y A;  1U8C B;  4NHF A;  3EHC A;  2IMJ A;  4LMI A;  3Q2P A;  1Q82 4;  3X3Y A;  2BMR B;  3U1W A;  3D3L A;  3B8L A;  3SX1 A;  3ALA A;  3QK9 A;  1LXE A;  2K54 A;  3CNM A;  4LSO A;  3HI7 A;  3NM7 A;  2W9Q A;  3JUO A;  1LVN A;  3T0U A;  3CCS 3;  2M7O A;  3DY5 A;  4EYC A;  4HM5 B;  2CFD A;  4FMC A;  1OHO A;  4CDL A;  4TX4 A;  2CG1 A;  3N54 B;  1VQ4 3;  1VQ9 3;  3PZW A;  2YFJ B;  3PYJ A;  4FCM A;  3NXJ A;  1YI2 3;  2E2U A;  3K7C A;  4EBG A;  2XSH B;  3X3Z A;  2LQV A;  1K8A 4;  1UW1 A;  2R4I A;  3U97 A;  1HKX A;  5FW5 A;  2WOF A;  2IUK A;  2CWT A;  3GZY B;  3X42 A;  1V74 A;  3WOD G;  3N8B A;  4FMD A;  4K90 B;  3MSO A;  4MMX B;  1Q81 4;  2Z6B A;  3F40 A;  3D9R A;  3DGM A;  4STD A;  2HMJ B;  3VSY A;  5BVB A;  1W6G A;  4K1V A;  2W56 A;  4CCV A;  1D6U A;  3LH4 A;  3OWS A;  1Q40 B;  1EQK A;  3DGL A;  4FR9 A;  1IVX A;  5A0O B;  1TIJ A;  2LYX A;  1AV4 A;  1W6C A;  2CG0 A;  5G2G A;  4XDV A;  1TUH A;  4HM1 B;  1CYV A;  3X40 A;  3BLZ A;  3WOE B;  4KFD A;  3T8U A;  2F86 B;  2ML5 A;  4H3U A;  1NB3 I;  2XF3 A;  3CCJ 3;  2PZV A;  5IG4 A;  3WA2 X;  1RRL A;  4EC6 A;  3PGB A;  3EX9 A;  3G71 3;  1JRQ A;  3F7S A;  3V99 A;  3HZP A;  3WA3 A;  3EC9 A;  5AEW B;  3DUK A;  5AYS C;  1SIH A;  2CFW A;  2CKF B;  2W56 B;  2ZDJ A;  3EE1 A;  2BT3 A;  4RNY A;  7STD A;  1R4C A;  1IV7 A;  2Y74 A;  1CYU A;  1DMN A;  3UNL A;  5IG3 A;  2B1X B;  4NRE A;  1JN5 A;  3SOY A;  1YHQ 3;  2HMM B;  2CFK A;  4EV5 A;  1CQS A;  1TFO A;  1W5Z A;  3I0Y A;  3MG3 A;  1O7N B;  2O9U X;  4KZ1 A;  1EG9 B;  2WGO A;  6STD A;  1IK3 A;  1DMM A;  2W6J H;  1JKG A;  1GY7 A;  3RGR A;  1NJI 4;  5IF6 A;  2D1W A;  4J9A A;  5CK6 A;  2MF7 A;  1K41 A;  3CU3 A;  3JVC A;  2OTJ 3;  3FF2 A;  1IT7 A;  2CC3 A;  2KCD A;  3CXC 2;  1NB5 I;  1IQ8 A;  3B4O A;  3CPO A;  4N6O B;  1ISK A;  1IQY A;  4MMY B;  4HM0 B;  3H51 A;  3CCQ 3;  1L5G B;  1KQS 2;  5IEP A;  1DMQ A;  3RDE A;  1YJ9 3;  3KFQ C;  3I56 3;  4MMZ B;  3CCE 3;  1N5P A;  1N5H A;  1O7H B;  3SED A;  4AKZ A;  1ROV A;  1SQW A;  4JRF A;  4HKV B;  5CF1 A;  2CH9 A;  4BTW A;  3CCV 3;  1E3R A;  3EN1 B;  1ULJ B;  1KC8 4;  2P0X A;  1IVU A;  4QWT A;  3LXU X;  2B24 B;  1O7W B;  1S5A A;  1VQL 3;  1WMP A;  1W2Z A;  5LC6 A;  1UUW B;  2XR8 B;  2W2C A;  3KZT A;  1KSI A;  1OPY A;  4O2H A;  3CC4 3;  1GD3 A;  3BNC A;  3S28 A;  1WNH A;  1IVV A;  1AVK A;  4EXR A;  2BMQ B;  1VQP 3;  2Q07 A;  4K61 A;  4L8P A;  3EQQ B;  2XRX B;  1GD4 A;  1PFP A;  1RN7 A;  1WMO A;  1BUQ A;  1KD1 4;  4WWU C;  4FCJ A;  3BB9 A;  4HZ9 B;  3FG3 A;  1OHS A;  4XBT A;  5AEU B;  1PU4 A;  1Q86 4;  1QVF 2;  1YJW 3;  1ROA A;  3OWY A;  3O8Y A;  3K9M C;  2RFR A;  3UJM A;  1QJG A;  4N6T A;  4FCZ A;  1MOL A;  4KFF A;  4N6N B;  5KP1 A;  1GS3 A;  3E99 A;  3BND A;  1OGX A;  1IQX A;  3NBB A;  3WMD A;  2CIU A;  3PXM A;  4RNZ A;  4HM2 B;  1ZO2 A;  1DVD A;  4XB5 A;  2GU3 A;  1DYU A;  3DZL A;  3FF0 A;  1RKY A;  3A76 A;  1A67 A;  3OXA A;  1U5O A;  2SBL A;  2XFT A;  1IV9 A;  1CEW I;  1JKG B;  1IDP A;  2C10 A;  2P38 A;  2A15 A;  2PNC A;  2OQE C;  3UB1 A;  1VQN 3;  3LTA A;  3T8N A;  2BNG A;  2XGL A;  3EBT A;  1TU5 A;  4HM6 B;  3LTB A;  2CWV A;  3NQY A;  1SJW A;  1TFK A;  3CD6 3;  1A90 A;  3F8X A;  4LEH A;  4WYK B;  3LT8 A;  2JDI H;  5FGO A;  1M9G A;  4HBR A;  1EKM A;  3LT9 A;  4HM4 B;  2OQE A;  3UL6 A;  4IIA A;  1NDO B;  1OGZ A;  3Q90 A;  4MEI A;  4AKY A;  1Q42 A;  3KE7 A;  2E2T A;  3SXX A;  4O3V A;  3IPT A;  3G8Z A;  2CFG A;  2P09 A;  3G4S 3;  3X41 A;  1MNL A;  1WMN A;  1DVC A;  1FA3 A;  3M8C A;  5I97 A;  3GZR A;  1D6Y A;  2GBX B;  1NO3 A;  4XBY A;  3STD A;  4HVN A;  4ZM8 A;  2BO9 B;  3VF1 A;  3B4P A;  3FLJ A;  3S27 A;  3SLU A;  2W04 A;  3CNX A;  5TGN A;  2W03 A;  3DMC A;  2RCD A;  2ZL8 A;  2QIY A;  3F14 A;  2QA4 3;  1NU3 A;  4HZB B;  5EQL A;  3FH1 A;  1W01 A;  4LGQ A;  3WOF B;  1E97 A;  4N3V A;  1JN5 B;  1VQK 3;  1VQ5 3;  2WO0 A;  1W00 A;  5IEN A;  4WYK A;  3WDG B;  3DXO A;  3OW2 2;  5KP3 A;  4AEQ A;  3NBR A;  1JNQ A;  3CCL 3;  3FZW A;  3KN4 A;  5KP4 A;  1HU9 A;  3LML A;  3L0R A;  3DM8 A;  3S29 A;  5JBS A;  2L4V A;  1M90 4;  4XBX A;  1YIJ 3;  4XDW A;  1QMA A;  3LTD A;  4OK0 A;  1QAL A;  1FGR A;  3NUV A;  5LC7 A;  2IA7 A;  4J8T A;  5AIG A;  1O7G B;  1Q40 A;  2OOV C;  1ASK A;  1RRH A;  4HJL B;  1A2V A;  4R9K A;  2CFL A;  3HX8 A;  4ORL A;  4RBN A;  2Z77 A;  3JUP A;  5IER A;  1ZX2 A;  3UL5 A;  3RGA A;  2ML6 A;  3BNE A;  3GZB A;  4IT7 A;  1RJO A;  5EEO A;  1QAK A;  3CPW 2;  3ER7 A;  1WQL B;  1J2B A;  1E3V A;  4WP5 A;  5AI1 A;  2D42 A;  5JPP A;  4KVH A;  1VQ8 3;  5ELJ A;  2HMN B;  2HMK B;  1JJ2 2;  3GWR A;  1AR0 A;  1OAC A;  3F9S A;  3K0Z A;  4JF8 A;  3LZA A;  2F99 A;  3K63 A;  3MPH A;  4N6U A;  2RGQ A;  5HGR A;  1F8N A;  1N8Q A;  1O7P B;  3F7X A;  2FNQ A;  2XFS A;  2MC8 A;  3EN8 A;  3KSP A;  3X3X A;  3CME 3;  4I4K A;  3MWZ A;  3NM2 A;  3VGN A;  1STD A;  1ULI B;  2OTL 3;  3TDG A;  1SII A;  1OF5 B;  2E2V A;  2O3O A;  1M1K 4;  1GY6 A;  1EA2 A;  1VQO 3;  4R4K A;  3BNB A;  3OX9 A;  3DGN A;  4L7K A;  3LTC A;  3CC2 3;  1FGO A;  4FMB A;  5D82 A;  3CCM 3;  5IW9 A;  4K1U A;  5AII A;  4FMA A;  5IG0 A;  3EBY A;  1W7C A;  1YJN 3;  1W2B 2;  3Q1C A;  3NX0 A;  5STD A;  2CK3 H;  5CF2 A;  4OUQ A;  3DGO A;  5IG5 A;  3JUM A;  1TP6 A;  4GB5 A;  3NBJ A;  3ECF A;  1OH0 A;  1FGQ A;  3S5C A;  3GAX A;  1Q7Y 4;  5DRE A;  4OVM A;  2OCT A;  1K9M 4;  3NQZ A;  3CCU 3;  1Z1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...