5IW9A

Structure of bacteriophage t4 gp25, sheath polymerization initiator
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
b'NINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate wedge protein gp25
publication title Structure of the T4 baseplate and its function in triggering sheath contraction.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Viral protein
total genus 32
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04965 GPW_gp25 Gene 25-like lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iw9A00
2OQEC 2WO0A 1US1A 3HIGA 3WA3A 2PNCA 1IVUA 1W6CA 3K5TA 1WMPA 1PU4A 2CWVA 2K0MA 3ALAA 3N9HA 3NQZA 1WMNA 2CG1A 1UI8A 1WMOA 2GU3A 2Y73A 2CFKA 1IVXA 1A2VA 1JRQA 1RKYA 3X3YA 4EV5A 2E2TA 1W4NA 1IVWA 3LOYA 2WOFA 2E2VA 2OOVA 4EV2A 3SX1A 3X42A 1EKMA 1D6YA 1UI7A 3X41A 2OOVC 2CG0A 2YX9A 2CFGA 1QALA 2C11A 1AV4A 3KIIA 2CFLA 1W2ZA 1W6GA 1TU5A 1RJOA 1DYUA 1W5ZA 2CWTA 2W0QA 3X3ZA 3X40A 1IQYA 2CFWA 1SPUA 1KSIA 1SIHA 3HIIA 1LVNA 2D1WA 1OACA 3NQYA 1AVKA 4BTWA 1D6ZA 5IW9A 1IU7A 3WA2X 4BTYA 1SIIA 3NBBA 2WOHA 2WGQA 3AMOA 3HI7A 2E2UA 2CWUA 2CFDA 3SXXA 3AMOB 4KFEA 3NBJA 3KN4A 1AVLA 2C10A 2Y74A 1IVVA 3MPHA 2IA7A 1W7CA 3PGBA 2BT3A 3X3XA 1IQXA 1D6UA 4EXRA 1QAFA 2OQEA 3T0UA 4BTXA 1QAKA 2ZL8A 4KFFA 1N9EA 4KFDA
chains in the Genus database with same CATH superfamily
2ZHXB 3I563 5AIFA 2WO0A 1VQ93 1RN4A 3S5CA 3GZXB 4I4KA 4XBXA 1NDOB 1AQZA 1BRIA 1GSPA 2KF3A 4KVHA 5DREA 1VQ43 2GSPA 3UL5A 3F8XA 1BNEA 4WWUC 1NB5I 1VQ73 3FGYA 1OHSA 2LYXA 3ALAA 2HMLB 4HJLB 2RFRA 3UL6A 1BNSA 4R4KA 1LXEA 1W2B2 3MSOA 5DRVA 4XBYA 3ZG0A 1JBSA 4FCJA 3CD63 1I2EA 1UCKA 2KF5A 1EEJA 4GHOA 3CNXA 1J2BA 3V98A 3D79A 4ILFA 3B8LA 3EHCA 3U97A 1QMAA 3LTCA 1OH0A 3BU4A 2RSXA 1X1YA 1YVSA 2W6JH 3X3YA 5M18A 1DETA 2M7OA 2XR8B 1W4NA 1V74A 3FH1A 2HMKB 1I70A 3SVAA 2MC8A 2GBWB 3FLJA 5BVBA 3CCL3 1NU3A 5AIGA 1BIRA 5HGRA 1M1K4 1W02A 1U8CB 1S723 1JNQA 1TJDA 2QIYA 2BMOB 2ZA4A 2OOVA 4N3VA 3CCR3 1JKGA 3EC9A 1R4YA 3LTAA 3B4OA 1V58A 3X41A 1AY7A 2CG0A 4HAAA 1FYSA 3QK9A 4O8SA 3AHWA 1G96A 3Q90A 1QALA 4J5KA 4R1KA 1RN7A 1BNIA 1BNRA 3NUVA 1K41A 3HOHA 3HX8A 1Q42A 2CFLA 1W2ZA 4I5QA 3CCU3 2OTJ3 3D5GA 1V57A 3K63A 1W6GA 5JBSA 1N5PA 3IPTA 4WP5A 3EX9A 1N9JA 3DXOA 1UUGB 3FG3A 3F14A 3G16A 4MMXB 1YNVX 2XFTA 4WHAA 1RGCA 4L7KA 3V92A 4LGQA 1DYUA 1W5ZA 1X1UA 2BMQB 4CPKA 1BRGA 1TIJA 3DZLA 1M1XB 3IJEB 4BU4A 1LNIA 1JV2B 1CYUA 3ZG5A 3S29A 1TUHA 5M1AA 5IENA 1FUWA 2XRXB 1SIHA 1TFOA 4HYZA 1LQGC 4GL6A 4L8OA 1W6YA 3S28A 3NQYA 2KF4A 3E99A 1KQS2 1N8QA 1BANA 4CCVA 5IW9A 1Y4KA 3H3HA 3UNLA 1GY6A 3WA2X 3RGAA 4DKIA 1OGXA 4BTYA 3U1WA 4AEQA 1IDPA 1O7PB 2WOHA 2WGQA 3MWZA 1ZS7A 5IEOA 1VQ63 1LQMB 2CFDA 3PXMA 3NV0A 3KN4A 1E97A 2C10A 5ELJA 3G8ZA 1MOLA 2C4BA 3MPHA 1PY3A 4MEIA 1YJN3 4NPBA 1G0TA 5AIIA 3OV4A 2BT3A 3O8YA 3H51A 1RGEA 3KSPA 1CEWI 1LOYA 1Z1SA 3MG3A 2W2CA 1DMQA 1X1WA 1UUVB 1GOYA 4KFFA 3PZWA 4KFDA 4X2HA 5ELUA 3AHSA 1YIJ3 1C54A 2F99A 1GD3A 3WA3A 5BIRA 1B21A 3OX9A 1RGAA 1RN1A 3STDA 1RGGA 4GSPA 4HM6B 1B2MA 1RGFA 3T8NA 2F86B 3B7CA 1VQL3 1CH0A 3D3LA 1GOUA 1K8A4 3F7XA 3GAXA 1OPYA 5KP3A 3SLUA 3WOEB 1TRQA 3ZFZA 3LT9A 3J7Yd 1WMNA 3CC43 2H0GA 3EBYA 2KRTA 3FG4A 3WMDA 2BO9B 1LOXA 5JPPA 3MKIA 2L1SA 1OHOA 1UI8A 1WMOA 2V1LA 2FGTA 3HZPA 3MYTA 5AEWB 2GU3A 2QEX3 3CMA3 1DMMA 1I0XA 1VQQA 3MHEA 4K61A 4O2HA 3M8CA 4HM2B 4STDA 5CLKA 1STDA 1F8NA 1JZOA 1KWIA 4MJDA 2P0MA 5FGOA 1M904 1MGRA 1RKYA 1BSCA 2UUGC 3DM8A 2J8XB 1Q864 2XGNA 3CNMA 1MWUA 1A2KA 1ULIB 3G6E3 2JQ5A 1O7NB 5IG5A 2WOFA 1N8R4 3PYJA 3NM7A 4HOHA 3X42A 3DY5A 4EC6A 1FA3A 2B24B 3PCSA 2W04A 2HMNB 2RNTA 1KC84 1JKGB 2OCTA 1JBRA 3KZTA 4XB5A 2W56A 2Z77A 5GSPA 3MG2A 1ROVA 2BMRB 2W03A 1ULJB 3FF2A 1AV4A 1TP6A 2Q07A 1SARA 3FG1A 4FCMA 5M19A 3DGYA 1BRSA 1JB5A 3FCSB 3NXJA 4HZBB 1A90A 4RNZA 2D42A 3JVCA 2F98A 3VSYA 1BSAA 4HM0B 3KSED 5CF2A 2HMOB 2GBXB 1EUIC 2CWTA 2RBIA 3CCE3 3X40A 4TX4A 5EVHA 1B27A 4ORLA 3GWRA 1FZUA 4R80A 3L0RA 2CFWA 3DMCA 3QRDA 1GMPA 3WOFB 1R4CA 4N6TA 4WFOA 5LC7A 2GEYA 2HMJB 2O9UX 4FMAA 1YJ93 1E3RA 2AADA 1BNGA 5LC6A 1FGMA 1AVKA 2I9WA 3SEDA 1D6ZA 2CKFB 9RNTA 1A67A 1BSBA 1RCKA 1HU9A 1MWTA 3FF0A 1LRAA 1SIIA 1YHQ3 2SARA 3DH2A 2FNQA 5EQLA 5RNTA 3VGNA 1YI23 1NJI4 1RGKA 2CHCA 1FUTA 1S5AA 2CC3A 2GU1A 3VF1A 2H0HA 3B4PA 1Q814 4KFEA 2P0XA 2K3DA 5AIHA 1CYVA 5IERA 2A15A 1IT8A 3BLZA 1B2SA 1IV7A 1IVVA 1BSEA 2F56A 2JDIH 3NV0B 4XDVA 4EXRA 1K9M4 1QAFA 3CPOA 3SOAA 4RBNA 1FUSA 2P38A 3DUKA 4HZ9B 4XM4A 4BTXA 1IK3A 2W9PA 3CXC2 2XSHB 1N9EA 1I3IA 3HK4A 2OQEC 1BGSA 1GS3A 3PCRA 4GB5A 1GMRA 3FZWA 5IG4A 1RRHA 1FGQA 4G1MB 1RRLA 1B2ZA 2IUKA 3BB9A 3FSDA 4HVNA 1BRKA 7GSPA 1KD14 3N54B 3UJMA 1B2XA 1NWWA 1W6CA 2Z6BA 3EB8A 1GY5A 3K5TA 4FR9A 1WMPA 1WNHA 1VQO3 1MWRA 1JB4A 3K7CA 1B2UA 2K0MA 3N9HA 3K9MC 2MF7A 3EN8A 3NQZA 1I2GA 1OHPA 4N6V0 3SOYA 3UB1A 5IEPA 3CME3 3DGMA 4Q53A 1VQ83 2CG1A 4HM5B 2FXTA 1RDSA 6RNTA 4LSOA 5TGNA 1CQSA 2UX0A 1PYLA 1QVG2 1VQK3 2GEXA 3WODG 1BSDA 2W9QA 1TFKA 1RSNA 3F40A 3JUNA 1FGTA 4MMYB 1IVXA 1A2VA 1JRQA 1Q40A 3CU3A 4FMCA 4HM7B 1GOVA 4R9LA 5AYSC 3G713 3KKGA 1Q7Y4 4EV5A 2YFJB 3OWYA 5G1KA 5AYRB 2IUJA 1ZGXA 1RGLA 4OUQA 3Q1CA 1JBTA 4FCZA 6STDA 2E2VA 2KXGA 5AI1A 1T3BA 4EV2A 3SX1A 1I2FA 1EQKA 3BNCA 1N5HA 1TRPA 3NBRA 3Q2PA 1EKMA 1O7MB 5CXOA 3SYUA 1ZO2A 2PZVA 1B20A 1UI7A 2OOVC 1Q7HA 3GZBA 3CCS3 4EW5A 3RNTA 4QWTA 1AR0A 1M9GA 2F4YA 4BL2A 1O7WB 1QVF2 2C11A 5JPUA 2W56B 3KIIA 3OWUA 5FW5A 1JZDA 1DE3A 3D5IA 1LOWA 1RNTA 3WDGB 1SQWA 4XDWA 3PS8A 1QJGA 1RLSA 3GZYB 1TU5A 3ECFA 1RGHA 3CC73 2W0QA 2CIUA 2CW9A 4WYKA 4RNYA 4KT3B 1IQYA 5AEUB 1DMNA 2BHMA 1UCJA 1GYBA 3LXUX 1T2IA 2INXA 4FMBA 4K1UA 1OF5A 1NO3A 1KSIA 1YVBI 2IY2A 4R9KA 2QA43 1IV9A 3RGRA 1BU4A 4CJNA 1UGIA 3HIIA 1LVNA 1TTOA 1EG9B 2Z7AA 4U13A 1JB2A 2OWPA 1OACA 1YIT3 1BOXA 1GD4A 1VQN3 1UCLA 3A5EA 2CX1A 4X2OA 4IIAA 1RMSA 1NNVA 1Q824 7RNTA 3AMOA 3HI7A 3CCM3 1A2PA 1PFPA 2CWUA 4L8PA 1STFI 2BU4A 1T5YA 4PEJA 1O7HB 2LQVA 3S27A 1IYYA 3BNDA 5IG0A 3AGOA 4J5GA 3BIRA 3NBJA 3S67A 1O7GB 2WGOA 3ER7A 4IPBA 4O3VA 1BAOA 3TDGA 4RZMA 5CF1A 1K28A 2B1XB 2IA7A 1W00A 1RCLA 3N8BA 3PGBA 2RGQA 1GMQA 1X1XA 3URPA 4HBRA 4AKYA 4BL3A 1ZX2A 1D6UA 1JN5A 1FGRA 1MNLA 2XEPA 3LTDA 1ROAA 1YGEA 2O3OA 3T0UA 2XSOB 1QAKA 2ZL8A 2BIRA 2HMMB 1OGZA 3OW22 2L4VA 1ISKA 3JUOA 1DVCA 3DGLA 1C7HA 1NB3I 2XF3A 4H61A 1US1A 3HIGA 3F8HA 2PNCA 3DGNA 3A76A 1MGWA 1IVUA 3KFQC 2CX0A 3GZRA 4NREA 1ASKA 3ROBA 3NM2A 3T8UA 1YJW3 3LT8A 5A0OB 1PU4A 2CWVA 5KP1A 2AAEA 1WTHA 1SJWA 1DVDA 4N6MA 2R4IA 4HKVB 1IQ8A 1U5OA 4O02B 8RNTA 3EBTA 4N6UA 6GSPA 1RHLA 1RNBA 5D83A 5I97A 2ZDJA 5IF6A 4FMDA 4JF8A 1T2HA 4LYLB 2Y73A 2F5MA 4LMIA 1UCIA 3FKAA 3MG1A 5EEOA 1VZZA 1LOVA 1I3FA 1BUQA 2CFKA 3RDEA 2R41A 4CDLA 1BVIA 2P05A 1UUWB 1HZ1A 3K0ZA 3G4S3 2ML5A 2E2TA 2OTL3 1Q40B 1K734 4OK0A 1E3VA 2YFIB 2XGLA 3LTBA 1IVWA 1RTUA 2BNGA 2XH9A 3F7SA 4LZIA 4HM8B 3LOYA 2CK3H 3NX0A 4LEHA 4HM1B 3D4AA 4N6OB 3GSPA 3OXAA 1D6YA 4K90B 1IT7A 1VQ53 2YX9A 4BIRA 4N6NB 2CFGA 3D9RA 3Q3FA 2IYJA 4K1VA 8CHOA 3CC23 1I0VA 5HOHA 1I8VA 4OVMA 3CCV3 1WQLB 1BNFA 2H0IA 3F9SA 3NHXA 4H3UA 1FGOA 5IG3A 1BRNL 3CCJ3 4N6LA 3LMLA 1VQP3 2ML6A 1GY7A 1B3SA 3I553 1YGWA 2Z76A 5G1LA 3WR2A 3EF8A 1EA2A 1RJOA 1G02A 2IMJA 3BNBA 3IMAB 4JRFA 3EE1A 3X3ZA 3CPW2 3KE7A 1HYFA 3LH4A 2HOHA 2KAAA 3JUPA 4HM3B 1LNHA 4IT7A 2XFSA 3G0KA 3AGNA 1W01A 3EJVA 5G2GA 1SPUA 1L5GB 4WYKB 3V99A 1UW1A 2GXFA 3OWSA 3EN1B 3I0YA 1BNJA 4NHFA 4ZM8A 4HM4B 4KZ1A 1OF5B 2D1WA 5BXQA 5D81A 1FW7A 2UGIA 4AKZA 4BTWA 2KF6A 1HKXA 1IU7A 1MWSA 1OCVA 4J9AA 3CCQ3 1UDII 1UGHI 3GRDA 3NBBA 3KCHA 3LZAA 2QGUA 2RCDA 1BRJA 2F5WA 2E2UA 2P09A 1BUJA 3LYGA 1JJ22 2STDA 3DGOA 3SXXA 2YFLB 5BU4A 3AMOB 1Q9EA 3JUQA 1OUNA 5CK6A 1BRHA 2KCDA 1AVLA 2Y74A 4J8TA 5KP4A 1W7CA 3X3XA 3JUMA 1IQXA 3EQQB 1VQM3 4RNTA 2OQEA 4EYCA 5D82A 4MMZB 2K54A 5STDA 4EBGA 4XBTA 2SBLA 7STDA 2CH9A 3BNEA 1JN5B 3WHOA
chains in the Genus database with same CATH topology
3I563 5AIFA 2WO0A 1VQ93 3S5CA 3GZXB 4I4KA 4XBXA 1NDOB 5DREA 4KVHA 1VQ43 3UL5A 3F8XA 4WWUC 1NB5I 1VQ73 3FGYA 1OHSA 2LYXA 3ALAA 2HMLB 4HJLB 2RFRA 3UL6A 4R4KA 1LXEA 1W2B2 3MSOA 5DRVA 4XBYA 4FCJA 3CD63 3CNXA 1J2BA 3V98A 3B8LA 3EHCA 3U97A 1QMAA 3LTCA 1OH0A 2RSXA 2W6JH 3X3YA 2M7OA 2XR8B 1W4NA 1V74A 3FH1A 2HMKB 3SVAA 2MC8A 2GBWB 3FLJA 5BVBA 3CCL3 1NU3A 5AIGA 5HGRA 1M1K4 1W02A 1U8CB 1S723 1JNQA 2QIYA 2BMOB 2OOVA 4N3VA 3CCR3 1JKGA 3EC9A 3LTAA 3B4OA 3X41A 4O8SA 2CG0A 3QK9A 1G96A 3Q90A 1QALA 4R1KA 1RN7A 3NUVA 1K41A 3HX8A 1Q42A 2CFLA 1W2ZA 3CCU3 2OTJ3 3K63A 1W6GA 5JBSA 1N5PA 3IPTA 4WP5A 3EX9A 1N9JA 3DXOA 3FG3A 3G16A 3F14A 4MMXB 2XFTA 4WHAA 4L7KA 3V92A 4LGQA 1DYUA 1W5ZA 2BMQB 1TIJA 3DZLA 1M1XB 3IJEB 1JV2B 1CYUA 3S29A 1TUHA 1FUWA 5IENA 2XRXB 1SIHA 1TFOA 4HYZA 4GL6A 4L8OA 1W6YA 3S28A 3NQYA 3E99A 1KQS2 1N8QA 4CCVA 5IW9A 1Y4KA 3H3HA 3UNLA 1GY6A 3WA2X 3RGAA 1OGXA 4BTYA 3U1WA 4AEQA 1IDPA 1O7PB 2WOHA 2WGQA 3MWZA 5IEOA 1VQ63 2CFDA 3PXMA 3NV0A 3KN4A 1E97A 2C10A 5ELJA 3G8ZA 1MOLA 3MPHA 4MEIA 1YJN3 5AIIA 3OV4A 2BT3A 3O8YA 3H51A 3KSPA 1CEWI 1Z1SA 3MG3A 2W2CA 1DMQA 1UUVB 4KFFA 3PZWA 4KFDA 4X2HA 5ELUA 1YIJ3 2F99A 1GD3A 3WA3A 3OX9A 3STDA 4HM6B 3T8NA 2F86B 3B7CA 1VQL3 3D3LA 1K8A4 3F7XA 3GAXA 1OPYA 5KP3A 3SLUA 3WOEB 3LT9A 3J7Yd 1WMNA 3CC43 3EBYA 2KRTA 3FG4A 3WMDA 2BO9B 1LOXA 5JPPA 3MKIA 3HZPA 1OHOA 1UI8A 1WMOA 2V1LA 2FGTA 3MYTA 5AEWB 2GU3A 2QEX3 3CMA3 1DMMA 4K61A 3MHEA 4O2HA 3M8CA 4HM2B 4STDA 5CLKA 1STDA 1F8NA 1KWIA 4MJDA 2P0MA 5FGOA 1M904 1RKYA 3DM8A 1Q864 2XGNA 3CNMA 1A2KA 1ULIB 3G6E3 2JQ5A 1O7NB 5IG5A 2WOFA 1N8R4 3PYJA 3NM7A 3X42A 3DY5A 4EC6A 1FA3A 2B24B 3PCSA 2W04A 2HMNB 1KC84 1JKGB 2OCTA 3KZTA 4XB5A 2W56A 2Z77A 3MG2A 1ROVA 2BMRB 2W03A 1ULJB 3FF2A 1AV4A 1TP6A 2Q07A 4FCMA 3FG1A 1JB5A 3FCSB 4HZBB 1A90A 4RNZA 2D42A 3JVCA 2F98A 3VSYA 4HM0B 3KSED 2HMOB 2GBXB 3CCE3 2CWTA 3X40A 4TX4A 5EVHA 4ORLA 3GWRA 4R80A 3L0RA 2CFWA 3DMCA 3QRDA 3WOFB 1R4CA 4N6TA 4WFOA 5LC7A 2GEYA 2HMJB 2O9UX 4FMAA 1YJ93 1E3RA 5LC6A 1FGMA 1AVKA 2I9WA 3SEDA 1D6ZA 2CKFB 1A67A 3FF0A 1HU9A 1SIIA 1YHQ3 5EQLA 2FNQA 1NJI4 1YI23 3VGNA 2CHCA 1S5AA 2CC3A 2GU1A 3VF1A 3B4PA 1Q814 4KFEA 2P0XA 5AIHA 1CYVA 5IERA 2A15A 1IT8A 3BLZA 1IV7A 1IVVA 2JDIH 3NV0B 4XDVA 4EXRA 1K9M4 1QAFA 3CPOA 3SOAA 4RBNA 2P38A 3DUKA 4HZ9B 4XM4A 4BTXA 1IK3A 2W9PA 3CXC2 2XSHB 1N9EA 3HK4A 2OQEC 3PCRA 1GS3A 4GB5A 3FZWA 5IG4A 1RRHA 1FGQA 4G1MB 1RRLA 2IUKA 3BB9A 3FSDA 4HVNA 1KD14 3N54B 3UJMA 1NWWA 1W6CA 2Z6BA 3EB8A 1GY5A 3K5TA 4FR9A 1WMPA 1WNHA 1VQO3 1JB4A 3K7CA 3NXJA 2K0MA 3N9HA 3K9MC 2MF7A 3EN8A 3NQZA 4N6V0 1OHPA 3SOYA 3UB1A 5IEPA 3CME3 1VQ83 3DGMA 4Q53A 2CG1A 4HM5B 2FXTA 4LSOA 5TGNA 1CQSA 2UX0A 1QVG2 1VQK3 2GEXA 3WODG 2W9QA 1TFKA 3F40A 3JUNA 1FGTA 4MMYB 1IVXA 1A2VA 1JRQA 1Q40A 3CU3A 4FMCA 4HM7B 3G713 4R9LA 5AYSC 3CCV3 3KKGA 1Q7Y4 4EV5A 2YFJB 3OWYA 5AYRB 2IUJA 4OUQA 3Q1CA 4FCZA 6STDA 2E2VA 2KXGA 5AI1A 4EV2A 3SX1A 1EQKA 3BNCA 1N5HA 3Q2PA 3NBRA 5CXOA 1EKMA 1O7MB 1ZO2A 2PZVA 1UI7A 2OOVC 3GZBA 3CCS3 4QWTA 1M9GA 1AR0A 1O7WB 1QVF2 2C11A 5JPUA 2W56B 3KIIA 3OWUA 5FW5A 3WDGB 1SQWA 4XDWA 3PS8A 1QJGA 1TU5A 3GZYB 3ECFA 3CC73 2W0QA 2CIUA 2CW9A 4WYKA 4RNYA 1IQYA 5AEUB 1DMNA 2BHMA 1GYBA 3LXUX 2INXA 4FMBA 4K1UA 1OF5A 1NO3A 1KSIA 1YVBI 4R9KA 2QA43 1IV9A 3RGRA 3HIIA 4U13A 1LVNA 1EG9B 2Z7AA 1JB2A 2OWPA 1OACA 1YIT3 1GD4A 1VQN3 4X2OA 4IIAA 1Q824 3AMOA 3HI7A 3CCM3 1PFPA 2CWUA 4L8PA 1STFI 1T5YA 4PEJA 1O7HB 2LQVA 3S27A 3BNDA 5IG0A 3NBJA 3S67A 1O7GB 2WGOA 3ER7A 4IPBA 4O3VA 3TDGA 4RZMA 5CF1A 1K28A 2B1XB 2IA7A 1W00A 3N8BA 3PGBA 2RGQA 4AKYA 4HBRA 1D6UA 2XEPA 1MNLA 1JN5A 1FGRA 1ZX2A 3LTDA 1ROAA 1YGEA 2O3OA 3T0UA 2XSOB 1QAKA 2ZL8A 2HMMB 1OGZA 3OW22 2L4VA 1ISKA 3JUOA 1DVCA 3DGLA 1C7HA 1NB3I 2XF3A 4H61A 1US1A 3HIGA 3F8HA 2PNCA 3DGNA 3A76A 1IVUA 3KFQC 3GZRA 4NREA 1ASKA 3ROBA 3NM2A 3T8UA 1YJW3 3LT8A 5A0OB 1PU4A 2CWVA 5KP1A 1WTHA 1SJWA 1DVDA 4N6MA 2R4IA 4HKVB 1IQ8A 1U5OA 4O02B 3EBTA 4N6UA 5D83A 5I97A 2ZDJA 5IF6A 4FMDA 4JF8A 2Y73A 4LMIA 3FKAA 3MG1A 5EEOA 1VZZA 1BUQA 2CFKA 3RDEA 4CDLA 2P05A 1UUWB 3K0ZA 3G4S3 2ML5A 2E2TA 2OTL3 1Q40B 1K734 4OK0A 1E3VA 2YFIB 2XGLA 3LTBA 1IVWA 2BNGA 2XH9A 4LZIA 3F7SA 4HM8B 3LOYA 2CK3H 3NX0A 4LEHA 4HM1B 4N6OB 3OXAA 1D6YA 4K90B 1IT7A 1VQ53 2YX9A 4N6NB 2CFGA 3D9RA 4K1VA 8CHOA 3CC23 4OVMA 1WQLB 3F9SA 3NHXA 4H3UA 1FGOA 5IG3A 3CCJ3 4N6LA 3LMLA 1VQP3 2ML6A 1GY7A 3I553 2Z76A 3EF8A 1EA2A 1RJOA 3BNBA 2IMJA 3IMAB 4JRFA 3X3ZA 3EE1A 3CPW2 3KE7A 3LH4A 3JUPA 4HM3B 1LNHA 4IT7A 2XFSA 3G0KA 1L5GB 1W01A 3EJVA 5G2GA 1SPUA 3V99A 4WYKB 1UW1A 2GXFA 3OWSA 3EN1B 3I0YA 4ZM8A 4NHFA 4HM4B 4KZ1A 1OF5B 2D1WA 5BXQA 5D81A 4AKZA 4BTWA 1HKXA 1IU7A 1OCVA 4J9AA 3CCQ3 3GRDA 3NBBA 3LZAA 2QGUA 2RCDA 2E2UA 2P09A 3LYGA 1JJ22 2STDA 3DGOA 3SXXA 2YFLB 3AMOB 3JUQA 1OUNA 5CK6A 2KCDA 1AVLA 2Y74A 4J8TA 5KP4A 1W7CA 3X3XA 3JUMA 1IQXA 3EQQB 1VQM3 2OQEA 4EYCA 5D82A 4MMZB 2K54A 5STDA 4EBGA 4XBTA 2SBLA 7STDA 2CH9A 3BNEA 1JN5B 5CF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQE C;  2WO0 A;  1US1 A;  3HIG A;  3WA3 A;  2PNC A;  1IVU A;  1W6C A;  3K5T A;  1WMP A;  1PU4 A;  2CWV A;  2K0M A;  3ALA A;  3N9H A;  3NQZ A;  1WMN A;  2CG1 A;  1UI8 A;  1WMO A;  2GU3 A;  2Y73 A;  2CFK A;  1IVX A;  1A2V A;  1JRQ A;  1RKY A;  3X3Y A;  4EV5 A;  2E2T A;  1W4N A;  1IVW A;  3LOY A;  2WOF A;  2E2V A;  2OOV A;  4EV2 A;  3SX1 A;  3X42 A;  1EKM A;  1D6Y A;  1UI7 A;  3X41 A;  2OOV C;  2CG0 A;  2YX9 A;  2CFG A;  1QAL A;  2C11 A;  1AV4 A;  3KII A;  2CFL A;  1W2Z A;  1W6G A;  1TU5 A;  1RJO A;  1DYU A;  1W5Z A;  2CWT A;  2W0Q A;  3X3Z A;  3X40 A;  1IQY A;  2CFW A;  1SPU A;  1KSI A;  1SIH A;  3HII A;  1LVN A;  2D1W A;  1OAC A;  3NQY A;  1AVK A;  4BTW A;  1D6Z A;  5IW9 A;  1IU7 A;  3WA2 X;  4BTY A;  1SII A;  3NBB A;  2WOH A;  2WGQ A;  3AMO A;  3HI7 A;  2E2U A;  2CWU A;  2CFD A;  3SXX A;  3AMO B;  4KFE A;  3NBJ A;  3KN4 A;  1AVL A;  2C10 A;  2Y74 A;  1IVV A;  3MPH A;  2IA7 A;  1W7C A;  3PGB A;  2BT3 A;  3X3X A;  1IQX A;  1D6U A;  4EXR A;  1QAF A;  2OQE A;  3T0U A;  4BTX A;  1QAK A;  2ZL8 A;  4KFF A;  1N9E A;  4KFD A; 
#chains in the Genus database with same CATH topology
 2ZHX B;  3I56 3;  5AIF A;  2WO0 A;  1VQ9 3;  1RN4 A;  3S5C A;  3GZX B;  4I4K A;  4XBX A;  1NDO B;  1AQZ A;  1BRI A;  1GSP A;  2KF3 A;  4KVH A;  5DRE A;  1VQ4 3;  2GSP A;  3UL5 A;  3F8X A;  1BNE A;  4WWU C;  1NB5 I;  1VQ7 3;  3FGY A;  1OHS A;  2LYX A;  3ALA A;  2HML B;  4HJL B;  2RFR A;  3UL6 A;  1BNS A;  4R4K A;  1LXE A;  1W2B 2;  3MSO A;  5DRV A;  4XBY A;  3ZG0 A;  1JBS A;  4FCJ A;  3CD6 3;  1I2E A;  1UCK A;  2KF5 A;  1EEJ A;  4GHO A;  3CNX A;  1J2B A;  3V98 A;  3D79 A;  4ILF A;  3B8L A;  3EHC A;  3U97 A;  1QMA A;  3LTC A;  1OH0 A;  3BU4 A;  2RSX A;  1X1Y A;  1YVS A;  2W6J H;  3X3Y A;  5M18 A;  1DET A;  2M7O A;  2XR8 B;  1W4N A;  1V74 A;  3FH1 A;  2HMK B;  1I70 A;  3SVA A;  2MC8 A;  2GBW B;  3FLJ A;  5BVB A;  3CCL 3;  1NU3 A;  5AIG A;  1BIR A;  5HGR A;  1M1K 4;  1W02 A;  1U8C B;  1S72 3;  1JNQ A;  1TJD A;  2QIY A;  2BMO B;  2ZA4 A;  2OOV A;  4N3V A;  3CCR 3;  1JKG A;  3EC9 A;  1R4Y A;  3LTA A;  3B4O A;  1V58 A;  3X41 A;  1AY7 A;  2CG0 A;  4HAA A;  1FYS A;  3QK9 A;  4O8S A;  3AHW A;  1G96 A;  3Q90 A;  1QAL A;  4J5K A;  4R1K A;  1RN7 A;  1BNI A;  1BNR A;  3NUV A;  1K41 A;  3HOH A;  3HX8 A;  1Q42 A;  2CFL A;  1W2Z A;  4I5Q A;  3CCU 3;  2OTJ 3;  3D5G A;  1V57 A;  3K63 A;  1W6G A;  5JBS A;  1N5P A;  3IPT A;  4WP5 A;  3EX9 A;  1N9J A;  3DXO A;  1UUG B;  3FG3 A;  3F14 A;  3G16 A;  4MMX B;  1YNV X;  2XFT A;  4WHA A;  1RGC A;  4L7K A;  3V92 A;  4LGQ A;  1DYU A;  1W5Z A;  1X1U A;  2BMQ B;  4CPK A;  1BRG A;  1TIJ A;  3DZL A;  1M1X B;  3IJE B;  4BU4 A;  1LNI A;  1JV2 B;  1CYU A;  3ZG5 A;  3S29 A;  1TUH A;  5M1A A;  5IEN A;  1FUW A;  2XRX B;  1SIH A;  1TFO A;  4HYZ A;  1LQG C;  4GL6 A;  4L8O A;  1W6Y A;  3S28 A;  3NQY A;  2KF4 A;  3E99 A;  1KQS 2;  1N8Q A;  1BAN A;  4CCV A;  5IW9 A;  1Y4K A;  3H3H A;  3UNL A;  1GY6 A;  3WA2 X;  3RGA A;  4DKI A;  1OGX A;  4BTY A;  3U1W A;  4AEQ A;  1IDP A;  1O7P B;  2WOH A;  2WGQ A;  3MWZ A;  1ZS7 A;  5IEO A;  1VQ6 3;  1LQM B;  2CFD A;  3PXM A;  3NV0 A;  3KN4 A;  1E97 A;  2C10 A;  5ELJ A;  3G8Z A;  1MOL A;  2C4B A;  3MPH A;  1PY3 A;  4MEI A;  1YJN 3;  4NPB A;  1G0T A;  5AII A;  3OV4 A;  2BT3 A;  3O8Y A;  3H51 A;  1RGE A;  3KSP A;  1CEW I;  1LOY A;  1Z1S A;  3MG3 A;  2W2C A;  1DMQ A;  1X1W A;  1UUV B;  1GOY A;  4KFF A;  3PZW A;  4KFD A;  4X2H A;  5ELU A;  3AHS A;  1YIJ 3;  1C54 A;  2F99 A;  1GD3 A;  3WA3 A;  5BIR A;  1B21 A;  3OX9 A;  1RGA A;  1RN1 A;  3STD A;  1RGG A;  4GSP A;  4HM6 B;  1B2M A;  1RGF A;  3T8N A;  2F86 B;  3B7C A;  1VQL 3;  1CH0 A;  3D3L A;  1GOU A;  1K8A 4;  3F7X A;  3GAX A;  1OPY A;  5KP3 A;  3SLU A;  3WOE B;  1TRQ A;  3ZFZ A;  3LT9 A;  3J7Y d;  1WMN A;  3CC4 3;  2H0G A;  3EBY A;  2KRT A;  3FG4 A;  3WMD A;  2BO9 B;  1LOX A;  5JPP A;  3MKI A;  2L1S A;  1OHO A;  1UI8 A;  1WMO A;  2V1L A;  2FGT A;  3HZP A;  3MYT A;  5AEW B;  2GU3 A;  2QEX 3;  3CMA 3;  1DMM A;  1I0X A;  1VQQ A;  3MHE A;  4K61 A;  4O2H A;  3M8C A;  4HM2 B;  4STD A;  5CLK A;  1STD A;  1F8N A;  1JZO A;  1KWI A;  4MJD A;  2P0M A;  5FGO A;  1M90 4;  1MGR A;  1RKY A;  1BSC A;  2UUG C;  3DM8 A;  2J8X B;  1Q86 4;  2XGN A;  3CNM A;  1MWU A;  1A2K A;  1ULI B;  3G6E 3;  2JQ5 A;  1O7N B;  5IG5 A;  2WOF A;  1N8R 4;  3PYJ A;  3NM7 A;  4HOH A;  3X42 A;  3DY5 A;  4EC6 A;  1FA3 A;  2B24 B;  3PCS A;  2W04 A;  2HMN B;  2RNT A;  1KC8 4;  1JKG B;  2OCT A;  1JBR A;  3KZT A;  4XB5 A;  2W56 A;  2Z77 A;  5GSP A;  3MG2 A;  1ROV A;  2BMR B;  2W03 A;  1ULJ B;  3FF2 A;  1AV4 A;  1TP6 A;  2Q07 A;  1SAR A;  3FG1 A;  4FCM A;  5M19 A;  3DGY A;  1BRS A;  1JB5 A;  3FCS B;  3NXJ A;  4HZB B;  1A90 A;  4RNZ A;  2D42 A;  3JVC A;  2F98 A;  3VSY A;  1BSA A;  4HM0 B;  3KSE D;  5CF2 A;  2HMO B;  2GBX B;  1EUI C;  2CWT A;  2RBI A;  3CCE 3;  3X40 A;  4TX4 A;  5EVH A;  1B27 A;  4ORL A;  3GWR A;  1FZU A;  4R80 A;  3L0R A;  2CFW A;  3DMC A;  3QRD A;  1GMP A;  3WOF B;  1R4C A;  4N6T A;  4WFO A;  5LC7 A;  2GEY A;  2HMJ B;  2O9U X;  4FMA A;  1YJ9 3;  1E3R A;  2AAD A;  1BNG A;  5LC6 A;  1FGM A;  1AVK A;  2I9W A;  3SED A;  1D6Z A;  2CKF B;  9RNT A;  1A67 A;  1BSB A;  1RCK A;  1HU9 A;  1MWT A;  3FF0 A;  1LRA A;  1SII A;  1YHQ 3;  2SAR A;  3DH2 A;  2FNQ A;  5EQL A;  5RNT A;  3VGN A;  1YI2 3;  1NJI 4;  1RGK A;  2CHC A;  1FUT A;  1S5A A;  2CC3 A;  2GU1 A;  3VF1 A;  2H0H A;  3B4P A;  1Q81 4;  4KFE A;  2P0X A;  2K3D A;  5AIH A;  1CYV A;  5IER A;  2A15 A;  1IT8 A;  3BLZ A;  1B2S A;  1IV7 A;  1IVV A;  1BSE A;  2F56 A;  2JDI H;  3NV0 B;  4XDV A;  4EXR A;  1K9M 4;  1QAF A;  3CPO A;  3SOA A;  4RBN A;  1FUS A;  2P38 A;  3DUK A;  4HZ9 B;  4XM4 A;  4BTX A;  1IK3 A;  2W9P A;  3CXC 2;  2XSH B;  1N9E A;  1I3I A;  3HK4 A;  2OQE C;  1BGS A;  1GS3 A;  3PCR A;  4GB5 A;  1GMR A;  3FZW A;  5IG4 A;  1RRH A;  1FGQ A;  4G1M B;  1RRL A;  1B2Z A;  2IUK A;  3BB9 A;  3FSD A;  4HVN A;  1BRK A;  7GSP A;  1KD1 4;  3N54 B;  3UJM A;  1B2X A;  1NWW A;  1W6C A;  2Z6B A;  3EB8 A;  1GY5 A;  3K5T A;  4FR9 A;  1WMP A;  1WNH A;  1VQO 3;  1MWR A;  1JB4 A;  3K7C A;  1B2U A;  2K0M A;  3N9H A;  3K9M C;  2MF7 A;  3EN8 A;  3NQZ A;  1I2G A;  1OHP A;  4N6V 0;  3SOY A;  3UB1 A;  5IEP A;  3CME 3;  3DGM A;  4Q53 A;  1VQ8 3;  2CG1 A;  4HM5 B;  2FXT A;  1RDS A;  6RNT A;  4LSO A;  5TGN A;  1CQS A;  2UX0 A;  1PYL A;  1QVG 2;  1VQK 3;  2GEX A;  3WOD G;  1BSD A;  2W9Q A;  1TFK A;  1RSN A;  3F40 A;  3JUN A;  1FGT A;  4MMY B;  1IVX A;  1A2V A;  1JRQ A;  1Q40 A;  3CU3 A;  4FMC A;  4HM7 B;  1GOV A;  4R9L A;  5AYS C;  3G71 3;  3KKG A;  1Q7Y 4;  4EV5 A;  2YFJ B;  3OWY A;  5G1K A;  5AYR B;  2IUJ A;  1ZGX A;  1RGL A;  4OUQ A;  3Q1C A;  1JBT A;  4FCZ A;  6STD A;  2E2V A;  2KXG A;  5AI1 A;  1T3B A;  4EV2 A;  3SX1 A;  1I2F A;  1EQK A;  3BNC A;  1N5H A;  1TRP A;  3NBR A;  3Q2P A;  1EKM A;  1O7M B;  5CXO A;  3SYU A;  1ZO2 A;  2PZV A;  1B20 A;  1UI7 A;  2OOV C;  1Q7H A;  3GZB A;  3CCS 3;  4EW5 A;  3RNT A;  4QWT A;  1AR0 A;  1M9G A;  2F4Y A;  4BL2 A;  1O7W B;  1QVF 2;  2C11 A;  5JPU A;  2W56 B;  3KII A;  3OWU A;  5FW5 A;  1JZD A;  1DE3 A;  3D5I A;  1LOW A;  1RNT A;  3WDG B;  1SQW A;  4XDW A;  3PS8 A;  1QJG A;  1RLS A;  3GZY B;  1TU5 A;  3ECF A;  1RGH A;  3CC7 3;  2W0Q A;  2CIU A;  2CW9 A;  4WYK A;  4RNY A;  4KT3 B;  1IQY A;  5AEU B;  1DMN A;  2BHM A;  1UCJ A;  1GYB A;  3LXU X;  1T2I A;  2INX A;  4FMB A;  4K1U A;  1OF5 A;  1NO3 A;  1KSI A;  1YVB I;  2IY2 A;  4R9K A;  2QA4 3;  1IV9 A;  3RGR A;  1BU4 A;  4CJN A;  1UGI A;  3HII A;  1LVN A;  1TTO A;  1EG9 B;  2Z7A A;  4U13 A;  1JB2 A;  2OWP A;  1OAC A;  1YIT 3;  1BOX A;  1GD4 A;  1VQN 3;  1UCL A;  3A5E A;  2CX1 A;  4X2O A;  4IIA A;  1RMS A;  1NNV A;  1Q82 4;  7RNT A;  3AMO A;  3HI7 A;  3CCM 3;  1A2P A;  1PFP A;  2CWU A;  4L8P A;  1STF I;  2BU4 A;  1T5Y A;  4PEJ A;  1O7H B;  2LQV A;  3S27 A;  1IYY A;  3BND A;  5IG0 A;  3AGO A;  4J5G A;  3BIR A;  3NBJ A;  3S67 A;  1O7G B;  2WGO A;  3ER7 A;  4IPB A;  4O3V A;  1BAO A;  3TDG A;  4RZM A;  5CF1 A;  1K28 A;  2B1X B;  2IA7 A;  1W00 A;  1RCL A;  3N8B A;  3PGB A;  2RGQ A;  1GMQ A;  1X1X A;  3URP A;  4HBR A;  4AKY A;  4BL3 A;  1ZX2 A;  1D6U A;  1JN5 A;  1FGR A;  1MNL A;  2XEP A;  3LTD A;  1ROA A;  1YGE A;  2O3O A;  3T0U A;  2XSO B;  1QAK A;  2ZL8 A;  2BIR A;  2HMM B;  1OGZ A;  3OW2 2;  2L4V A;  1ISK A;  3JUO A;  1DVC A;  3DGL A;  1C7H A;  1NB3 I;  2XF3 A;  4H61 A;  1US1 A;  3HIG A;  3F8H A;  2PNC A;  3DGN A;  3A76 A;  1MGW A;  1IVU A;  3KFQ C;  2CX0 A;  3GZR A;  4NRE A;  1ASK A;  3ROB A;  3NM2 A;  3T8U A;  1YJW 3;  3LT8 A;  5A0O B;  1PU4 A;  2CWV A;  5KP1 A;  2AAE A;  1WTH A;  1SJW A;  1DVD A;  4N6M A;  2R4I A;  4HKV B;  1IQ8 A;  1U5O A;  4O02 B;  8RNT A;  3EBT A;  4N6U A;  6GSP A;  1RHL A;  1RNB A;  5D83 A;  5I97 A;  2ZDJ A;  5IF6 A;  4FMD A;  4JF8 A;  1T2H A;  4LYL B;  2Y73 A;  2F5M A;  4LMI A;  1UCI A;  3FKA A;  3MG1 A;  5EEO A;  1VZZ A;  1LOV A;  1I3F A;  1BUQ A;  2CFK A;  3RDE A;  2R41 A;  4CDL A;  1BVI A;  2P05 A;  1UUW B;  1HZ1 A;  3K0Z A;  3G4S 3;  2ML5 A;  2E2T A;  2OTL 3;  1Q40 B;  1K73 4;  4OK0 A;  1E3V A;  2YFI B;  2XGL A;  3LTB A;  1IVW A;  1RTU A;  2BNG A;  2XH9 A;  3F7S A;  4LZI A;  4HM8 B;  3LOY A;  2CK3 H;  3NX0 A;  4LEH A;  4HM1 B;  3D4A A;  4N6O B;  3GSP A;  3OXA A;  1D6Y A;  4K90 B;  1IT7 A;  1VQ5 3;  2YX9 A;  4BIR A;  4N6N B;  2CFG A;  3D9R A;  3Q3F A;  2IYJ A;  4K1V A;  8CHO A;  3CC2 3;  1I0V A;  5HOH A;  1I8V A;  4OVM A;  3CCV 3;  1WQL B;  1BNF A;  2H0I A;  3F9S A;  3NHX A;  4H3U A;  1FGO A;  5IG3 A;  1BRN L;  3CCJ 3;  4N6L A;  3LML A;  1VQP 3;  2ML6 A;  1GY7 A;  1B3S A;  3I55 3;  1YGW A;  2Z76 A;  5G1L A;  3WR2 A;  3EF8 A;  1EA2 A;  1RJO A;  1G02 A;  2IMJ A;  3BNB A;  3IMA B;  4JRF A;  3EE1 A;  3X3Z A;  3CPW 2;  3KE7 A;  1HYF A;  3LH4 A;  2HOH A;  2KAA A;  3JUP A;  4HM3 B;  1LNH A;  4IT7 A;  2XFS A;  3G0K A;  3AGN A;  1W01 A;  3EJV A;  5G2G A;  1SPU A;  1L5G B;  4WYK B;  3V99 A;  1UW1 A;  2GXF A;  3OWS A;  3EN1 B;  3I0Y A;  1BNJ A;  4NHF A;  4ZM8 A;  4HM4 B;  4KZ1 A;  1OF5 B;  2D1W A;  5BXQ A;  5D81 A;  1FW7 A;  2UGI A;  4AKZ A;  4BTW A;  2KF6 A;  1HKX A;  1IU7 A;  1MWS A;  1OCV A;  4J9A A;  3CCQ 3;  1UDI I;  1UGH I;  3GRD A;  3NBB A;  3KCH A;  3LZA A;  2QGU A;  2RCD A;  1BRJ A;  2F5W A;  2E2U A;  2P09 A;  1BUJ A;  3LYG A;  1JJ2 2;  2STD A;  3DGO A;  3SXX A;  2YFL B;  5BU4 A;  3AMO B;  1Q9E A;  3JUQ A;  1OUN A;  5CK6 A;  1BRH A;  2KCD A;  1AVL A;  2Y74 A;  4J8T A;  5KP4 A;  1W7C A;  3X3X A;  3JUM A;  1IQX A;  3EQQ B;  1VQM 3;  4RNT A;  2OQE A;  4EYC A;  5D82 A;  4MMZ B;  2K54 A;  5STD A;  4EBG A;  4XBT A;  2SBL A;  7STD A;  2CH9 A;  3BNE A;  1JN5 B;  3WHO A; 
#chains in the Genus database with same CATH homology
 3I56 3;  5AIF A;  2WO0 A;  1VQ9 3;  3S5C A;  3GZX B;  4I4K A;  4XBX A;  1NDO B;  5DRE A;  4KVH A;  1VQ4 3;  3UL5 A;  3F8X A;  4WWU C;  1NB5 I;  1VQ7 3;  3FGY A;  1OHS A;  2LYX A;  3ALA A;  2HML B;  4HJL B;  2RFR A;  3UL6 A;  4R4K A;  1LXE A;  1W2B 2;  3MSO A;  5DRV A;  4XBY A;  4FCJ A;  3CD6 3;  3CNX A;  1J2B A;  3V98 A;  3B8L A;  3EHC A;  3U97 A;  1QMA A;  3LTC A;  1OH0 A;  2RSX A;  2W6J H;  3X3Y A;  2M7O A;  2XR8 B;  1W4N A;  1V74 A;  3FH1 A;  2HMK B;  3SVA A;  2MC8 A;  2GBW B;  3FLJ A;  5BVB A;  3CCL 3;  1NU3 A;  5AIG A;  5HGR A;  1M1K 4;  1W02 A;  1U8C B;  1S72 3;  1JNQ A;  2QIY A;  2BMO B;  2OOV A;  4N3V A;  3CCR 3;  1JKG A;  3EC9 A;  3LTA A;  3B4O A;  3X41 A;  4O8S A;  2CG0 A;  3QK9 A;  1G96 A;  3Q90 A;  1QAL A;  4R1K A;  1RN7 A;  3NUV A;  1K41 A;  3HX8 A;  1Q42 A;  2CFL A;  1W2Z A;  3CCU 3;  2OTJ 3;  3K63 A;  1W6G A;  5JBS A;  1N5P A;  3IPT A;  4WP5 A;  3EX9 A;  1N9J A;  3DXO A;  3FG3 A;  3G16 A;  3F14 A;  4MMX B;  2XFT A;  4WHA A;  4L7K A;  3V92 A;  4LGQ A;  1DYU A;  1W5Z A;  2BMQ B;  1TIJ A;  3DZL A;  1M1X B;  3IJE B;  1JV2 B;  1CYU A;  3S29 A;  1TUH A;  1FUW A;  5IEN A;  2XRX B;  1SIH A;  1TFO A;  4HYZ A;  4GL6 A;  4L8O A;  1W6Y A;  3S28 A;  3NQY A;  3E99 A;  1KQS 2;  1N8Q A;  4CCV A;  5IW9 A;  1Y4K A;  3H3H A;  3UNL A;  1GY6 A;  3WA2 X;  3RGA A;  1OGX A;  4BTY A;  3U1W A;  4AEQ A;  1IDP A;  1O7P B;  2WOH A;  2WGQ A;  3MWZ A;  5IEO A;  1VQ6 3;  2CFD A;  3PXM A;  3NV0 A;  3KN4 A;  1E97 A;  2C10 A;  5ELJ A;  3G8Z A;  1MOL A;  3MPH A;  4MEI A;  1YJN 3;  5AII A;  3OV4 A;  2BT3 A;  3O8Y A;  3H51 A;  3KSP A;  1CEW I;  1Z1S A;  3MG3 A;  2W2C A;  1DMQ A;  1UUV B;  4KFF A;  3PZW A;  4KFD A;  4X2H A;  5ELU A;  1YIJ 3;  2F99 A;  1GD3 A;  3WA3 A;  3OX9 A;  3STD A;  4HM6 B;  3T8N A;  2F86 B;  3B7C A;  1VQL 3;  3D3L A;  1K8A 4;  3F7X A;  3GAX A;  1OPY A;  5KP3 A;  3SLU A;  3WOE B;  3LT9 A;  3J7Y d;  1WMN A;  3CC4 3;  3EBY A;  2KRT A;  3FG4 A;  3WMD A;  2BO9 B;  1LOX A;  5JPP A;  3MKI A;  3HZP A;  1OHO A;  1UI8 A;  1WMO A;  2V1L A;  2FGT A;  3MYT A;  5AEW B;  2GU3 A;  2QEX 3;  3CMA 3;  1DMM A;  4K61 A;  3MHE A;  4O2H A;  3M8C A;  4HM2 B;  4STD A;  5CLK A;  1STD A;  1F8N A;  1KWI A;  4MJD A;  2P0M A;  5FGO A;  1M90 4;  1RKY A;  3DM8 A;  1Q86 4;  2XGN A;  3CNM A;  1A2K A;  1ULI B;  3G6E 3;  2JQ5 A;  1O7N B;  5IG5 A;  2WOF A;  1N8R 4;  3PYJ A;  3NM7 A;  3X42 A;  3DY5 A;  4EC6 A;  1FA3 A;  2B24 B;  3PCS A;  2W04 A;  2HMN B;  1KC8 4;  1JKG B;  2OCT A;  3KZT A;  4XB5 A;  2W56 A;  2Z77 A;  3MG2 A;  1ROV A;  2BMR B;  2W03 A;  1ULJ B;  3FF2 A;  1AV4 A;  1TP6 A;  2Q07 A;  4FCM A;  3FG1 A;  1JB5 A;  3FCS B;  4HZB B;  1A90 A;  4RNZ A;  2D42 A;  3JVC A;  2F98 A;  3VSY A;  4HM0 B;  3KSE D;  2HMO B;  2GBX B;  3CCE 3;  2CWT A;  3X40 A;  4TX4 A;  5EVH A;  4ORL A;  3GWR A;  4R80 A;  3L0R A;  2CFW A;  3DMC A;  3QRD A;  3WOF B;  1R4C A;  4N6T A;  4WFO A;  5LC7 A;  2GEY A;  2HMJ B;  2O9U X;  4FMA A;  1YJ9 3;  1E3R A;  5LC6 A;  1FGM A;  1AVK A;  2I9W A;  3SED A;  1D6Z A;  2CKF B;  1A67 A;  3FF0 A;  1HU9 A;  1SII A;  1YHQ 3;  5EQL A;  2FNQ A;  1NJI 4;  1YI2 3;  3VGN A;  2CHC A;  1S5A A;  2CC3 A;  2GU1 A;  3VF1 A;  3B4P A;  1Q81 4;  4KFE A;  2P0X A;  5AIH A;  1CYV A;  5IER A;  2A15 A;  1IT8 A;  3BLZ A;  1IV7 A;  1IVV A;  2JDI H;  3NV0 B;  4XDV A;  4EXR A;  1K9M 4;  1QAF A;  3CPO A;  3SOA A;  4RBN A;  2P38 A;  3DUK A;  4HZ9 B;  4XM4 A;  4BTX A;  1IK3 A;  2W9P A;  3CXC 2;  2XSH B;  1N9E A;  3HK4 A;  2OQE C;  3PCR A;  1GS3 A;  4GB5 A;  3FZW A;  5IG4 A;  1RRH A;  1FGQ A;  4G1M B;  1RRL A;  2IUK A;  3BB9 A;  3FSD A;  4HVN A;  1KD1 4;  3N54 B;  3UJM A;  1NWW A;  1W6C A;  2Z6B A;  3EB8 A;  1GY5 A;  3K5T A;  4FR9 A;  1WMP A;  1WNH A;  1VQO 3;  1JB4 A;  3K7C A;  3NXJ A;  2K0M A;  3N9H A;  3K9M C;  2MF7 A;  3EN8 A;  3NQZ A;  4N6V 0;  1OHP A;  3SOY A;  3UB1 A;  5IEP A;  3CME 3;  1VQ8 3;  3DGM A;  4Q53 A;  2CG1 A;  4HM5 B;  2FXT A;  4LSO A;  5TGN A;  1CQS A;  2UX0 A;  1QVG 2;  1VQK 3;  2GEX A;  3WOD G;  2W9Q A;  1TFK A;  3F40 A;  3JUN A;  1FGT A;  4MMY B;  1IVX A;  1A2V A;  1JRQ A;  1Q40 A;  3CU3 A;  4FMC A;  4HM7 B;  3G71 3;  4R9L A;  5AYS C;  3CCV 3;  3KKG A;  1Q7Y 4;  4EV5 A;  2YFJ B;  3OWY A;  5AYR B;  2IUJ A;  4OUQ A;  3Q1C A;  4FCZ A;  6STD A;  2E2V A;  2KXG A;  5AI1 A;  4EV2 A;  3SX1 A;  1EQK A;  3BNC A;  1N5H A;  3Q2P A;  3NBR A;  5CXO A;  1EKM A;  1O7M B;  1ZO2 A;  2PZV A;  1UI7 A;  2OOV C;  3GZB A;  3CCS 3;  4QWT A;  1M9G A;  1AR0 A;  1O7W B;  1QVF 2;  2C11 A;  5JPU A;  2W56 B;  3KII A;  3OWU A;  5FW5 A;  3WDG B;  1SQW A;  4XDW A;  3PS8 A;  1QJG A;  1TU5 A;  3GZY B;  3ECF A;  3CC7 3;  2W0Q A;  2CIU A;  2CW9 A;  4WYK A;  4RNY A;  1IQY A;  5AEU B;  1DMN A;  2BHM A;  1GYB A;  3LXU X;  2INX A;  4FMB A;  4K1U A;  1OF5 A;  1NO3 A;  1KSI A;  1YVB I;  4R9K A;  2QA4 3;  1IV9 A;  3RGR A;  3HII A;  4U13 A;  1LVN A;  1EG9 B;  2Z7A A;  1JB2 A;  2OWP A;  1OAC A;  1YIT 3;  1GD4 A;  1VQN 3;  4X2O A;  4IIA A;  1Q82 4;  3AMO A;  3HI7 A;  3CCM 3;  1PFP A;  2CWU A;  4L8P A;  1STF I;  1T5Y A;  4PEJ A;  1O7H B;  2LQV A;  3S27 A;  3BND A;  5IG0 A;  3NBJ A;  3S67 A;  1O7G B;  2WGO A;  3ER7 A;  4IPB A;  4O3V A;  3TDG A;  4RZM A;  5CF1 A;  1K28 A;  2B1X B;  2IA7 A;  1W00 A;  3N8B A;  3PGB A;  2RGQ A;  4AKY A;  4HBR A;  1D6U A;  2XEP A;  1MNL A;  1JN5 A;  1FGR A;  1ZX2 A;  3LTD A;  1ROA A;  1YGE A;  2O3O A;  3T0U A;  2XSO B;  1QAK A;  2ZL8 A;  2HMM B;  1OGZ A;  3OW2 2;  2L4V A;  1ISK A;  3JUO A;  1DVC A;  3DGL A;  1C7H A;  1NB3 I;  2XF3 A;  4H61 A;  1US1 A;  3HIG A;  3F8H A;  2PNC A;  3DGN A;  3A76 A;  1IVU A;  3KFQ C;  3GZR A;  4NRE A;  1ASK A;  3ROB A;  3NM2 A;  3T8U A;  1YJW 3;  3LT8 A;  5A0O B;  1PU4 A;  2CWV A;  5KP1 A;  1WTH A;  1SJW A;  1DVD A;  4N6M A;  2R4I A;  4HKV B;  1IQ8 A;  1U5O A;  4O02 B;  3EBT A;  4N6U A;  5D83 A;  5I97 A;  2ZDJ A;  5IF6 A;  4FMD A;  4JF8 A;  2Y73 A;  4LMI A;  3FKA A;  3MG1 A;  5EEO A;  1VZZ A;  1BUQ A;  2CFK A;  3RDE A;  4CDL A;  2P05 A;  1UUW B;  3K0Z A;  3G4S 3;  2ML5 A;  2E2T A;  2OTL 3;  1Q40 B;  1K73 4;  4OK0 A;  1E3V A;  2YFI B;  2XGL A;  3LTB A;  1IVW A;  2BNG A;  2XH9 A;  4LZI A;  3F7S A;  4HM8 B;  3LOY A;  2CK3 H;  3NX0 A;  4LEH A;  4HM1 B;  4N6O B;  3OXA A;  1D6Y A;  4K90 B;  1IT7 A;  1VQ5 3;  2YX9 A;  4N6N B;  2CFG A;  3D9R A;  4K1V A;  8CHO A;  3CC2 3;  4OVM A;  1WQL B;  3F9S A;  3NHX A;  4H3U A;  1FGO A;  5IG3 A;  3CCJ 3;  4N6L A;  3LML A;  1VQP 3;  2ML6 A;  1GY7 A;  3I55 3;  2Z76 A;  3EF8 A;  1EA2 A;  1RJO A;  3BNB A;  2IMJ A;  3IMA B;  4JRF A;  3X3Z A;  3EE1 A;  3CPW 2;  3KE7 A;  3LH4 A;  3JUP A;  4HM3 B;  1LNH A;  4IT7 A;  2XFS A;  3G0K A;  1L5G B;  1W01 A;  3EJV A;  5G2G A;  1SPU A;  3V99 A;  4WYK B;  1UW1 A;  2GXF A;  3OWS A;  3EN1 B;  3I0Y A;  4ZM8 A;  4NHF A;  4HM4 B;  4KZ1 A;  1OF5 B;  2D1W A;  5BXQ A;  5D81 A;  4AKZ A;  4BTW A;  1HKX A;  1IU7 A;  1OCV A;  4J9A A;  3CCQ 3;  3GRD A;  3NBB A;  3LZA A;  2QGU A;  2RCD A;  2E2U A;  2P09 A;  3LYG A;  1JJ2 2;  2STD A;  3DGO A;  3SXX A;  2YFL B;  3AMO B;  3JUQ A;  1OUN A;  5CK6 A;  2KCD A;  1AVL A;  2Y74 A;  4J8T A;  5KP4 A;  1W7C A;  3X3X A;  3JUM A;  1IQX A;  3EQQ B;  1VQM 3;  2OQE A;  4EYC A;  5D82 A;  4MMZ B;  2K54 A;  5STD A;  4EBG A;  4XBT A;  2SBL A;  7STD A;  2CH9 A;  3BNE A;  1JN5 B;  5CF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...