5IW9A

Structure of bacteriophage t4 gp25, sheath polymerization initiator
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
NINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the T4 baseplate and its function in triggering sheath contraction.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Viral protein
molecule keywords Baseplate wedge protein gp25
total genus 32
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04965 GPW_gp25 Gene 25-like lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iw9A00
2CWTA 3NQYA 2E2UA 1WMNA 4BTXA 1N9EA 1RJOA 1IQYA 3LOYA 2CFDA 3K5TA 1D6YA 1W5ZA 3NBBA 2CG0A 2C10A 3T0UA 1RKYA 3X3ZA 2PNCA 2IA7A 4EXRA 2CWVA 1WMPA 2E2TA 1EKMA 3AMOA 3X41A 2Y73A 1W6CA 3ALAA 2CFWA 1KSIA 1QAFA 1PU4A 2BT3A 3SX1A 3HIIA 2OOVC 1US1A 1W2ZA 3AMOB 1QALA 1IU7A 2CFKA 2D1WA 3N9HA 2CG1A 3X40A 2C11A 2ZL8A 2OOVA 2OQEC 3X3XA 4KFEA 1W4NA 3NBJA 3HI7A 1IVVA 2OQEA 4EV2A 1SIHA 4BTWA 3SXXA 1UI8A 1IQXA 4EV5A 2CFGA 1W7CA 1QAKA 1IVWA 3PGBA 1IVUA 2YX9A 3HIGA 2CFLA 1AVLA 2E2VA 2WOHA 2W0QA 3MPHA 1DYUA 1AV4A 2WOFA 3NQZA 4KFDA 1D6UA 1SIIA 2Y74A 1AVKA 2WO0A 3KN4A 3WA3A 3WA2X 3X42A 3X3YA 2GU3A 2CWUA 1UI7A 4BTYA 4KFFA 3KIIA 2K0MA 1OACA 1LVNA 1A2VA 5IW9A 1D6ZA 1WMOA 1TU5A 2WGQA 1SPUA 1IVXA 1JRQA 1W6GA
chains in the Genus database with same CATH superfamily
1T2IA 2INXA 1DVCA 3E99A 5JBSA 3PXMA 3CXC2 4MMZB 2CWTA 2XRXB 1BRJA 1NO3A 3BNBA 3G4S3 1BANA 5LC6A 2YFIB 4BTXA 4ZM8A 4HM6B 8RNTA 3B4OA 1MNLA 3NM7A 4HAAA 1B2MA 2ZDJA 1BNJA 1GY7A 2BHMA 4OK0A 3EBYA 2CFDA 1EA2A 2HMMB 1KQS2 2IMJA 1W5ZA 3LTAA 3MG1A 3F7XA 1UCLA 1BU4A 2CG0A 2UUGC 3M8CA 3CMA3 3CPOA 4FCZA 1RNTA 2B24B 3S67A 3X3ZA 1JNQA 2I9WA 5JPPA 1NNVA 5A0OB 1BRKA 2ZHXB 3GZXB 3X41A 3WDGB 1B20A 2HOHA 1YIT3 1G96A 1W2B2 1F8NA 1I2EA 2XFTA 2CFWA 4BL3A 1PY3A 1GSPA 2ML6A 3FSDA 1ZGXA 4R1KA 2OOVC 3OWYA 4HYZA 1TUHA 3ECFA 3BIRA 2SBLA 2D1WA 1GD3A 1LOXA 3D9RA 1T2HA 5STDA 1YIJ3 1G02A 5EEOA 3FF2A 1A2KA 3PZWA 3QRDA 4KVHA 1RGEA 1I3IA 1U5OA 4LGQA 3UL6A 3V98A 2OTJ3 4K61A 2OQEC 3NXJA 3LYGA 1BGSA 3AHSA 1N5HA 3GAXA 3K9MC 3FF0A 3NUVA 8CHOA 2P0MA 2RGQA 3QK9A 2XFSA 3EJVA 1SIHA 1B2UA 3D4AA 1VQP3 3LXUX 3EBTA 2BMOB 3SOYA 7STDA 2K3DA 1TJDA 4J9AA 1CH0A 1A90A 4N6V0 1OUNA 3PGBA 5BIRA 2B1XB 1IVUA 1HYFA 3JUMA 1K734 2XSHB 2CFLA 1GMRA 1JBSA 1E97A 1Q814 1VQ43 4HJLB 3IJEB 2QIYA 2W0QA 1RTUA 1E3RA 2JDIH 3BB9A 3D79A 1QJGA 4HM5B 3MPHA 1BNSA 4NREA 2W9QA 1SIIA 3GWRA 2Y74A 2CKFB 1YJW3 1RMSA 2WO0A 3SVAA 1N8R4 2UX0A 3KN4A 3SYUA 1LOYA 1UCKA 2D42A 4CCVA 5DREA 1RDSA 3X42A 1BSBA 4HM3B 1NU3A 2HMLB 4ILFA 2IUJA 3LT8A 1MWRA 1X1UA 4N6NB 3VGNA 1EQKA 1KD14 2A15A 1TTOA 2CX0A 2YFLB 5G2GA 2STDA 3I563 2K54A 3CC73 3CCM3 5G1LA 1LVNA 1X1YA 3DMCA 4LSOA 5IG0A 3EX9A 1JZDA 1LNHA 4FMDA 4GL6A 5IF6A 1TU5A 1RN4A 1JB5A 2KRTA 1GMQA 3EN1B 1R4CA 5GSPA 1JB4A 4MJDA 4WYKA 4WP5A 4WWUC 1JBTA 1JZOA 1RSNA 1C7HA 3MSOA 1TFKA 3G0KA 2CC3A 1O7MB 3MG3A 1WMNA 3NQYA 3FLJA 1Q824 1NB5I 3CPW2 1O7GB 4FMCA 2J8XB 1RGLA 3URPA 1N9EA 2XGNA 4LEHA 4U13A 5AIIA 1K28A 1U8CB 5CF1A 1RGGA 1I8VA 1QMAA 1W02A 2PZVA 3JUQA 4LYLB 1M1XB 5IG3A 2QEX3 2L4VA 1V58A 3D5GA 4DKIA 3KSED 1ZS7A 1RHLA 2WGOA 1OF5A 3T0UA 1LXEA 1RGAA 3NV0A 1QVG2 1QVF2 3ER7A 1B2ZA 4G1MB 3LTCA 2V1LA 3BU4A 1Q9EA 1GY5A 7GSPA 2Z76A 2OWPA 2M7OA 5AEWB 1EKMA 2KF3A 3AMOA 4GHOA 4K90B 4R9KA 3HOHA 1I0XA 2Y73A 4KT3B 3RGAA 1MGWA 1VQK3 3SEDA 3UNLA 1KSIA 1PU4A 1IQ8A 4EW5A 2OTL3 3G8ZA 3G713 5CF2A 1IT7A 2R4IA 3MYTA 4WYKB 4I5QA 1PFPA 1RRLA 3CCJ3 3AGNA 3EHCA 3CCR3 1VQ73 1FGOA 3N9HA 3EQQB 4STDA 2C11A 3KCHA 5CK6A 3Q90A 5D81A 1EEJA 1N8QA 4ORLA 3S27A 3EB8A 2OOVA 4L8PA 1X1XA 3DXOA 3G16A 5EQLA 3JUNA 1C54A 4OVMA 3FGYA 3X3XA 2YFJB 2W9PA 5AIGA 3FG1A 3VSYA 1JKGA 3NBJA 2CIUA 2F86B 3HI7A 4EV2A 2ML5A 4XBYA 5M19A 1K8A4 1GD4A 3SXXA 2KF6A 4RNTA 4IPBA 5ELUA 3F8HA 4AEQA 2CFGA 1TFOA 1AY7A 2HMJB 1R4YA 6STDA 2UGIA 4XDWA 5HGRA 2XGLA 5M1AA 4XBTA 4O2HA 5FW5A 3CNXA 1LNIA 2F5MA 1BNGA 4KZ1A 3CCU3 3OWUA 5AI1A 3UL5A 2E2VA 1TIJA 1AQZA 3MG2A 3DZLA 4N6UA 1WNHA 5G1KA 3Q2PA 4TX4A 1BNIA 1O7HB 3CCV3 2XEPA 3LZAA 4X2HA 1Q40A 1D6UA 1BRHA 1FW7A 1CQSA 1KC84 3HZPA 2CHCA 1JN5B 4MMYB 2FNQA 2RSXA 3WA3A 1FZUA 3CNMA 1YHQ3 1OHOA 2QGUA 3BNEA 4CJNA 3N8BA 1UI7A 4FCJA 1BUJA 3F8XA 3WR2A 6GSPA 4BTYA 4KFFA 1VZZA 3DGNA 3GZRA 5BXQA 3NX0A 1OCVA 5HOHA 3OWSA 2AAEA 1J2BA 4FR9A 1ZX2A 9RNTA 1BVIA 1FGQA 2P0XA 4EYCA 1OACA 1DETA 1LQGC 3BLZA 5IW9A 1YJN3 1UGIA 3A76A 2BIRA 3RDEA 1I0VA 4WHAA 4MMXB 3DH2A 1CYVA 1IVXA 3MWZA 1K41A 5DRVA 1BSEA 3Q3FA 1Q7HA 5KP3A 1LRAA 2E2UA 1RN1A 1RLSA 1VQL3 1WTHA 2HMNB 3KFQC 1RJOA 1FUWA 1CEWI 2P38A 1VQ53 2MC8A 4LZIA 3LOYA 4X2OA 5LC7A 1D6YA 1BSAA 2CH9A 1JBRA 1BAOA 1I70A 3GRDA 1G0TA 1STDA 2KF4A 2XH9A 5D82A 1HU9A 3D5IA 3BNDA 1BNRA 1BRSA 6RNTA 5TGNA 2PNCA 2RFRA 3K7CA 3OXAA 2XSOB 1WMPA 3I0YA 1PYLA 4AKZA 1EUIC 1MWTA 3N54B 1UCIA 1NDOB 1ULJB 3ALAA 3B4PA 2GBXB 3K0ZA 3KZTA 5JPUA 1VQ63 5IG4A 4RBNA 3SX1A 5D83A 3HIIA 2O3OA 2GU1A 1US1A 1W2ZA 1QALA 1IU7A 2AADA 3CU3A 1RCLA 1FUSA 2CG1A 1Q40B 4J5GA 4N6MA 5AEUB 1B3SA 1O7PB 4IT7A 1SQWA 1OPYA 4RNYA 3S29A 3LMLA 1FGTA 1LQMB 2MF7A 2SARA 4H3UA 1KWIA 3OW22 1YI23 4EC6A 2Q07A 1RCKA 3EF8A 4MEIA 1FGMA 3F9SA 3FKAA 3ZG5A 3NBRA 7RNTA 3CCQ3 2HMOB 1TRQA 3ZG0A 4HZ9B 5KP4A 1IVVA 1M904 1FGRA 3IPTA 3JUOA 1MWUA 1B27A 4BTWA 4I4KA 1OHPA 5IEOA 3RGRA 1UI8A 2W56B 5AYSC 4HVNA 3MKIA 4EV5A 1OH0A 1W7CA 2ZA4A 4NPBA 3FCSB 2KF5A 4JF8A 3KKGA 4QWTA 1IVWA 1SJWA 1EG9B 3O8YA 3CCS3 3FG3A 1A67A 3EN8A 2YX9A 3HIGA 1BSCA 3DGMA 1S723 1AVLA 4L7KA 3H3HA 3CCE3 2Z6BA 3B7CA 4K1UA 3DGLA 3JVCA 4HM7B 4XBXA 1B2SA 1TP6A 4N6TA 1OGZA 1IT8A 2WOFA 1DMQA 1NB3I 4JRFA 4KFDA 3S5CA 1M9GA 3CC23 3HX8A 1RGFA 4HZBB 1GOYA 2HMKB 1JV2B 3PCSA 1BNEA 1UUGB 2H0HA 2BMQB 3A5EA 3KSPA 4HM4B 2BU4A 2R41A 3I553 1M1K4 1FUTA 1MWSA 5AIHA 3ROBA 3J7Yd 1GS3A 3AHWA 2GU3A 3PYJA 5RNTA 1N5PA 2W56A 1NWWA 1STFI 3SLUA 4RNZA 2QA43 1CYUA 2BMRB 1L5GB 1RNBA 5IERA 3F7SA 4O3VA 2IYJA 2RBIA 3KIIA 1V74A 3PCRA 3EC9A 4HM1B 5ELJA 3DGYA 3CC43 1GOVA 3F40A 3CCL3 5IENA 3GZBA 1LOVA 3DUKA 1E3VA 1T3BA 2RNTA 3D3LA 2CK3H 4N6OB 4CPKA 4HM2B 1ROVA 1Y4KA 1IK3A 1DMMA 4H61A 3LT9A 2GBWB 2WGQA 3NM2A 5FGOA 2P05A 3BNCA 1DE3A 2XR8B 3GSPA 1JRQA 1N9JA 1OGXA 2GSPA 1IV9A 3U1WA 3LTDA 1BOXA 5BVBA 4R80A 1GYBA 2CX1A 1V57A 4FCMA 3UB1A 2W04A 1YVBI 1YNVX 5CLKA 4N6LA 4AKYA 3NV0B 2F56A 2F99A 2H0GA 5I97A 1RGHA 1BRGA 1LOWA 3DGOA 1I3FA 3PS8A 5IEPA 1IDPA 3CME3 2OCTA 1IQYA 2KXGA 2RCDA 1A2PA 4HM8B 3K5TA 4J8TA 4RZMA 3NBBA 3FG4A 4PEJA 2C4BA 1HZ1A 2C10A 1RKYA 1ROAA 4NHFA 3EE1A 5AIFA 1SARA 2IA7A 3FZWA 4R4KA 3S28A 4EXRA 2CWVA 1K9M4 2E2TA 3LH4A 4GSPA 1IYYA 2W03A 1ULIB 1UGHI 1W6CA 4K1VA 3UJMA 1JB2A 1QAFA 1YJ93 2BT3A 1WQLB 1VQ93 3AGOA 3GZYB 2BNGA 3T8NA 3AMOB 1VQN3 3WHOA 1TRPA 4BU4A 3STDA 4WFOA 2CFKA 3RNTA 3V92A 1ISKA 1I2GA 3X40A 1FYSA 5KP1A 2F4YA 2W6JH 3JUPA 3ZFZA 2ZL8A 5CXOA 1GY6A 1S5AA 3K63A 4IIAA 4XDVA 3LTBA 3SOAA 3V99A 1BUQA 3H51A 3IMAB 4HOHA 4KFEA 1W4NA 4XM4A 2XF3A 3U97A 4HKVB 1YGEA 4HBRA 4LMIA 1B2XA 4HM0B 4OUQA 2OQEA 1UCJA 2GEYA 1VQO3 4XB5A 3HK4A 2L1SA 4FMBA 4O8SA 1VQM3 3CD63 5EVHA 2LYXA 3WODG 1W6YA 2W2CA 1ZO2A 1IQXA 1W01A 5AYRB 1QAKA 1RGCA 3DM8A 1X1WA 1JKGB 4EBGA 2F98A 2F5WA 1MOLA 2JQ5A 4O02B 3TDGA 3G6E3 1Q864 1DVDA 2CW9A 3Q1CA 3WOFB 1UW1A 1FA3A 2WOHA 1OF5B 1JN5A 3T8UA 5M18A 1RRHA 3DY5A 1YVSA 1Z1SA 1BIRA 3KE7A 3FH1A 2FGTA 3VF1A 1DYUA 1BSDA 1AV4A 1UUVB 2IUKA 1B21A 3NQZA 1BRIA 4GB5A 1T5YA 1UDII 1O7WB 3MHEA 1W00A 4FMAA 1HKXA 2IY2A 1AVKA 4N3VA 1AR0A 2Z77A 1Q7Y4 3L0RA 3WOEB 2BO9B 1DMNA 1IV7A 3WA2X 1UUWB 3X3YA 5BU4A 2CWUA 4R9LA 1MGRA 1GOUA 2O9UX 3F14A 3OV4A 1YGWA 1GMPA 2GXFA 3NHXA 4CDLA 2KCDA 4BIRA 3OX9A 1BNFA 1I2FA 2K0MA 4L8OA 1JJ22 2LQVA 4BL2A 1VQQA 3WMDA 5IG5A 2Z7AA 1VQ83 1A2VA 2H0IA 4Q53A 2FXTA 3B8LA 1NJI4 1D6ZA 1WMOA 4J5KA 1OHSA 1SPUA 2KAAA 2P09A 2GEXA 1ASKA 1BRNL 1RN7A 1W6GA 1O7NB 1Q42A 1RGKA
chains in the Genus database with same CATH topology
2INXA 3E99A 1DVCA 5JBSA 3CXC2 3PXMA 4MMZB 2CWTA 2XRXB 1NO3A 3BNBA 3G4S3 5LC6A 2YFIB 4BTXA 4ZM8A 4HM6B 3B4OA 1MNLA 3NM7A 2ZDJA 4OK0A 1GY7A 2BHMA 3EBYA 2CFDA 1EA2A 2HMMB 1KQS2 2IMJA 1W5ZA 3LTAA 3MG1A 3F7XA 2CG0A 3M8CA 3CMA3 3CPOA 4FCZA 3S67A 2B24B 3X3ZA 1JNQA 2I9WA 5JPPA 5A0OB 3GZXB 3X41A 3WDGB 1YIT3 1G96A 1W2B2 1F8NA 2XFTA 2CFWA 2ML6A 3FSDA 4R1KA 2OOVC 3OWYA 4HYZA 1TUHA 3ECFA 2SBLA 2D1WA 1GD3A 1LOXA 3D9RA 5STDA 1YIJ3 5EEOA 3FF2A 1A2KA 3PZWA 3QRDA 4KVHA 1U5OA 3UL6A 4LGQA 2OTJ3 3V98A 4K61A 2OQEC 3NXJA 3LYGA 1N5HA 3GAXA 3K9MC 3FF0A 3NUVA 8CHOA 2P0MA 2RGQA 3QK9A 2XFSA 3EJVA 1SIHA 1VQP3 3LXUX 3EBTA 2BMOB 3SOYA 7STDA 4J9AA 1A90A 4N6V0 1OUNA 3PGBA 2B1XB 1IVUA 3JUMA 1K734 2XSHB 2CFLA 1E97A 1Q814 1VQ43 4HJLB 3IJEB 2QIYA 2W0QA 1E3RA 2JDIH 3BB9A 1QJGA 4HM5B 3MPHA 4NREA 2W9QA 1SIIA 3GWRA 2Y74A 2CKFB 1YJW3 2WO0A 3SVAA 1N8R4 2UX0A 3KN4A 2D42A 4CCVA 5DREA 3X42A 4HM3B 1NU3A 2HMLB 2IUJA 3LT8A 4N6NB 3VGNA 1EQKA 1KD14 2A15A 5G2GA 2YFLB 2STDA 3I563 2K54A 3CC73 3CCM3 1LVNA 3DMCA 4LSOA 5IG0A 3EX9A 1LNHA 4FMDA 4GL6A 5IF6A 1TU5A 1JB5A 2KRTA 3EN1B 1R4CA 1JB4A 4MJDA 4WYKA 4WP5A 4WWUC 1C7HA 3MSOA 1TFKA 3G0KA 2CC3A 1O7MB 3MG3A 1WMNA 3NQYA 3FLJA 1Q824 1NB5I 3CPW2 1O7GB 4FMCA 1N9EA 2XGNA 4LEHA 4U13A 5AIIA 1K28A 1U8CB 5CF1A 1QMAA 3JUQA 1W02A 2PZVA 5IG3A 2QEX3 1M1XB 2L4VA 3KSED 2WGOA 1OF5A 3T0UA 1LXEA 3NV0A 1QVG2 1QVF2 3ER7A 4G1MB 3LTCA 2V1LA 1GY5A 2Z76A 2OWPA 2M7OA 5AEWB 1EKMA 3AMOA 4K90B 4R9KA 2Y73A 3RGAA 1VQK3 3SEDA 3UNLA 1KSIA 1PU4A 1IQ8A 2OTL3 3G8ZA 3G713 5CF2A 1IT7A 2R4IA 3MYTA 4WYKB 1PFPA 1RRLA 3CCJ3 3EHCA 3CCR3 1VQ73 1FGOA 3N9HA 3EQQB 4STDA 2C11A 5D81A 5CK6A 3Q90A 3S27A 1N8QA 4ORLA 3EB8A 2OOVA 4L8PA 3DXOA 3G16A 5EQLA 3JUNA 4OVMA 3FGYA 3X3XA 2YFJB 2W9PA 5AIGA 3FG1A 3VSYA 1JKGA 3NBJA 2CIUA 2F86B 3HI7A 4EV2A 2ML5A 4XBYA 1K8A4 1GD4A 3SXXA 4AEQA 4IPBA 5ELUA 3F8HA 2CFGA 1TFOA 2HMJB 6STDA 4XDWA 5HGRA 2XGLA 4XBTA 4O2HA 5FW5A 3CNXA 4KZ1A 3CCU3 3OWUA 5AI1A 3UL5A 2E2VA 1TIJA 3MG2A 3DZLA 4N6UA 1WNHA 3Q2PA 4TX4A 1O7HB 3CCV3 2XEPA 3LZAA 4X2HA 1Q40A 1D6UA 1CQSA 1KC84 3HZPA 2CHCA 1JN5B 2FNQA 2RSXA 3WA3A 1YHQ3 3CNMA 1OHOA 2QGUA 3BNEA 3N8BA 1UI7A 4FCJA 3F8XA 4BTYA 4KFFA 1VZZA 3DGNA 3GZRA 5BXQA 3NX0A 1OCVA 3OWSA 1J2BA 4FR9A 1ZX2A 1FGQA 2P0XA 4EYCA 1OACA 3BLZA 5IW9A 1YJN3 3A76A 3RDEA 4WHAA 4MMXB 1CYVA 1IVXA 3MWZA 1K41A 5DRVA 5KP3A 2E2UA 1VQL3 1WTHA 2HMNB 3KFQC 1RJOA 1FUWA 1CEWI 2P38A 1VQ53 2MC8A 4LZIA 3LOYA 4X2OA 5LC7A 1D6YA 2CH9A 3GRDA 1STDA 2XH9A 5D82A 1HU9A 3BNDA 5TGNA 2PNCA 2RFRA 3K7CA 3OXAA 2XSOB 1WMPA 3I0YA 4AKZA 3N54B 4MMYB 1NDOB 1ULJB 3ALAA 3B4PA 2GBXB 3K0ZA 3KZTA 5JPUA 1VQ63 5IG4A 4RBNA 3SX1A 5D83A 3HIIA 2O3OA 2GU1A 1US1A 1W2ZA 1QALA 1IU7A 3CU3A 2CG1A 1Q40B 4N6MA 5AEUB 1O7PB 4IT7A 1SQWA 1OPYA 4RNYA 3S29A 3LMLA 1FGTA 2MF7A 4H3UA 3OW22 1KWIA 1YI23 4EC6A 2Q07A 3EF8A 4MEIA 1FGMA 3F9SA 3FKAA 3NBRA 3CCQ3 2HMOB 5KP4A 4HZ9B 1M904 1IVVA 1FGRA 3IPTA 3JUOA 4BTWA 4I4KA 1OHPA 5IEOA 3RGRA 1UI8A 2W56B 5AYSC 4HVNA 3MKIA 4EV5A 1OH0A 1W7CA 3FCSB 4JF8A 3KKGA 4QWTA 1IVWA 1SJWA 1EG9B 3O8YA 3CCS3 3FG3A 1A67A 3EN8A 2YX9A 3HIGA 3DGMA 1S723 1AVLA 4L7KA 3H3HA 3CCE3 2Z6BA 3B7CA 4K1UA 3DGLA 3JVCA 4HM7B 4XBXA 1TP6A 4N6TA 1OGZA 2WOFA 1IT8A 1DMQA 1NB3I 4JRFA 4KFDA 3S5CA 1M9GA 3CC23 3HX8A 4HZBB 2HMKB 1JV2B 3PCSA 2BMQB 3KSPA 4HM4B 3I553 1M1K4 5AIHA 3ROBA 3J7Yd 1GS3A 2GU3A 3PYJA 1N5PA 2W56A 1NWWA 1STFI 3SLUA 4RNZA 2QA43 1CYUA 2BMRB 1L5GB 5IERA 3F7SA 4O3VA 3KIIA 1V74A 3PCRA 3EC9A 4HM1B 5ELJA 3CC43 3F40A 3CCL3 5IENA 3GZBA 3DUKA 1E3VA 3D3LA 2CK3H 4N6OB 4HM2B 1ROVA 1Y4KA 1IK3A 1DMMA 4H61A 3LT9A 2GBWB 2WGQA 3NM2A 5FGOA 2P05A 3BNCA 2XR8B 1JRQA 1N9JA 1OGXA 3U1WA 1IV9A 3LTDA 5BVBA 4R80A 1GYBA 4FCMA 3UB1A 2W04A 1YVBI 5CLKA 4N6LA 4AKYA 3NV0B 2F99A 5I97A 3DGOA 3PS8A 5IEPA 1IDPA 3CME3 2OCTA 1IQYA 2KXGA 2RCDA 4HM8B 4RZMA 3K5TA 4J8TA 3NBBA 3FG4A 4PEJA 2C10A 1RKYA 1ROAA 4NHFA 3EE1A 5AIFA 2IA7A 3FZWA 4R4KA 3S28A 4EXRA 2CWVA 1K9M4 2E2TA 3LH4A 2W03A 1ULIB 1W6CA 4K1VA 3UJMA 1JB2A 1QAFA 1YJ93 2BT3A 1WQLB 1VQ93 3GZYB 2BNGA 3T8NA 3AMOB 1VQN3 3STDA 4WFOA 2CFKA 3V92A 1ISKA 3X40A 5KP1A 2W6JH 3JUPA 2ZL8A 5CXOA 1GY6A 1S5AA 3K63A 4IIAA 4XDVA 3LTBA 3SOAA 3V99A 1BUQA 3H51A 3IMAB 4KFEA 4XM4A 1W4NA 3U97A 2XF3A 4HKVB 1YGEA 4HBRA 4LMIA 4HM0B 4OUQA 2OQEA 2GEYA 1VQO3 4XB5A 3HK4A 4FMBA 4O8SA 1VQM3 3CD63 5EVHA 2LYXA 3WODG 1W6YA 2W2CA 1ZO2A 1IQXA 1W01A 5AYRB 1QAKA 3DM8A 1JKGB 4EBGA 2F98A 1MOLA 2JQ5A 4O02B 3TDGA 3G6E3 1Q864 1DVDA 2CW9A 3Q1CA 3WOFB 1UW1A 1FA3A 2WOHA 1OF5B 1JN5A 3T8UA 1RRHA 3DY5A 1Z1SA 3KE7A 3FH1A 2FGTA 3VF1A 1DYUA 1UUVB 1AV4A 2IUKA 3NQZA 4GB5A 1T5YA 1O7WB 3MHEA 1W00A 4FMAA 1HKXA 1AVKA 4N3VA 1AR0A 2Z77A 1Q7Y4 3L0RA 3WOEB 2BO9B 1DMNA 1IV7A 3WA2X 1UUWB 3X3YA 2CWUA 4R9LA 2O9UX 3F14A 3OV4A 2GXFA 3NHXA 4CDLA 2KCDA 3OX9A 1JJ22 2K0MA 4L8OA 2LQVA 3WMDA 5IG5A 2Z7AA 1VQ83 1A2VA 4Q53A 2FXTA 3B8LA 1NJI4 1D6ZA 1WMOA 1OHSA 1SPUA 2P09A 2GEXA 1ASKA 1RN7A 1W6GA 1O7NB 1Q42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWT A;  3NQY A;  2E2U A;  1WMN A;  4BTX A;  1N9E A;  1RJO A;  1IQY A;  3LOY A;  2CFD A;  3K5T A;  1D6Y A;  1W5Z A;  3NBB A;  2CG0 A;  2C10 A;  3T0U A;  1RKY A;  3X3Z A;  2PNC A;  2IA7 A;  4EXR A;  2CWV A;  1WMP A;  2E2T A;  1EKM A;  3AMO A;  3X41 A;  2Y73 A;  1W6C A;  3ALA A;  2CFW A;  1KSI A;  1QAF A;  1PU4 A;  2BT3 A;  3SX1 A;  3HII A;  2OOV C;  1US1 A;  1W2Z A;  3AMO B;  1QAL A;  1IU7 A;  2CFK A;  2D1W A;  3N9H A;  2CG1 A;  3X40 A;  2C11 A;  2ZL8 A;  2OOV A;  2OQE C;  3X3X A;  4KFE A;  1W4N A;  3NBJ A;  3HI7 A;  1IVV A;  2OQE A;  4EV2 A;  1SIH A;  4BTW A;  3SXX A;  1UI8 A;  1IQX A;  4EV5 A;  2CFG A;  1W7C A;  1QAK A;  1IVW A;  3PGB A;  1IVU A;  2YX9 A;  3HIG A;  2CFL A;  1AVL A;  2E2V A;  2WOH A;  2W0Q A;  3MPH A;  1DYU A;  1AV4 A;  2WOF A;  3NQZ A;  4KFD A;  1D6U A;  1SII A;  2Y74 A;  1AVK A;  2WO0 A;  3KN4 A;  3WA3 A;  3WA2 X;  3X42 A;  3X3Y A;  2GU3 A;  2CWU A;  1UI7 A;  4BTY A;  4KFF A;  3KII A;  2K0M A;  1OAC A;  1LVN A;  1A2V A;  5IW9 A;  1D6Z A;  1WMO A;  1TU5 A;  2WGQ A;  1SPU A;  1IVX A;  1JRQ A;  1W6G A; 
#chains in the Genus database with same CATH topology
 1T2I A;  2INX A;  1DVC A;  3E99 A;  5JBS A;  3PXM A;  3CXC 2;  4MMZ B;  2CWT A;  2XRX B;  1BRJ A;  1NO3 A;  3BNB A;  3G4S 3;  1BAN A;  5LC6 A;  2YFI B;  4BTX A;  4ZM8 A;  4HM6 B;  8RNT A;  3B4O A;  1MNL A;  3NM7 A;  4HAA A;  1B2M A;  2ZDJ A;  1BNJ A;  1GY7 A;  2BHM A;  4OK0 A;  3EBY A;  2CFD A;  1EA2 A;  2HMM B;  1KQS 2;  2IMJ A;  1W5Z A;  3LTA A;  3MG1 A;  3F7X A;  1UCL A;  1BU4 A;  2CG0 A;  2UUG C;  3M8C A;  3CMA 3;  3CPO A;  4FCZ A;  1RNT A;  2B24 B;  3S67 A;  3X3Z A;  1JNQ A;  2I9W A;  5JPP A;  1NNV A;  5A0O B;  1BRK A;  2ZHX B;  3GZX B;  3X41 A;  3WDG B;  1B20 A;  2HOH A;  1YIT 3;  1G96 A;  1W2B 2;  1F8N A;  1I2E A;  2XFT A;  2CFW A;  4BL3 A;  1PY3 A;  1GSP A;  2ML6 A;  3FSD A;  1ZGX A;  4R1K A;  2OOV C;  3OWY A;  4HYZ A;  1TUH A;  3ECF A;  3BIR A;  2SBL A;  2D1W A;  1GD3 A;  1LOX A;  3D9R A;  1T2H A;  5STD A;  1YIJ 3;  1G02 A;  5EEO A;  3FF2 A;  1A2K A;  3PZW A;  3QRD A;  4KVH A;  1RGE A;  1I3I A;  1U5O A;  4LGQ A;  3UL6 A;  3V98 A;  2OTJ 3;  4K61 A;  2OQE C;  3NXJ A;  3LYG A;  1BGS A;  3AHS A;  1N5H A;  3GAX A;  3K9M C;  3FF0 A;  3NUV A;  8CHO A;  2P0M A;  2RGQ A;  3QK9 A;  2XFS A;  3EJV A;  1SIH A;  1B2U A;  3D4A A;  1VQP 3;  3LXU X;  3EBT A;  2BMO B;  3SOY A;  7STD A;  2K3D A;  1TJD A;  4J9A A;  1CH0 A;  1A90 A;  4N6V 0;  1OUN A;  3PGB A;  5BIR A;  2B1X B;  1IVU A;  1HYF A;  3JUM A;  1K73 4;  2XSH B;  2CFL A;  1GMR A;  1JBS A;  1E97 A;  1Q81 4;  1VQ4 3;  4HJL B;  3IJE B;  2QIY A;  2W0Q A;  1RTU A;  1E3R A;  2JDI H;  3BB9 A;  3D79 A;  1QJG A;  4HM5 B;  3MPH A;  1BNS A;  4NRE A;  2W9Q A;  1SII A;  3GWR A;  2Y74 A;  2CKF B;  1YJW 3;  1RMS A;  2WO0 A;  3SVA A;  1N8R 4;  2UX0 A;  3KN4 A;  3SYU A;  1LOY A;  1UCK A;  2D42 A;  4CCV A;  5DRE A;  1RDS A;  3X42 A;  1BSB A;  4HM3 B;  1NU3 A;  2HML B;  4ILF A;  2IUJ A;  3LT8 A;  1MWR A;  1X1U A;  4N6N B;  3VGN A;  1EQK A;  1KD1 4;  2A15 A;  1TTO A;  2CX0 A;  2YFL B;  5G2G A;  2STD A;  3I56 3;  2K54 A;  3CC7 3;  3CCM 3;  5G1L A;  1LVN A;  1X1Y A;  3DMC A;  4LSO A;  5IG0 A;  3EX9 A;  1JZD A;  1LNH A;  4FMD A;  4GL6 A;  5IF6 A;  1TU5 A;  1RN4 A;  1JB5 A;  2KRT A;  1GMQ A;  3EN1 B;  1R4C A;  5GSP A;  1JB4 A;  4MJD A;  4WYK A;  4WP5 A;  4WWU C;  1JBT A;  1JZO A;  1RSN A;  1C7H A;  3MSO A;  1TFK A;  3G0K A;  2CC3 A;  1O7M B;  3MG3 A;  1WMN A;  3NQY A;  3FLJ A;  1Q82 4;  1NB5 I;  3CPW 2;  1O7G B;  4FMC A;  2J8X B;  1RGL A;  3URP A;  1N9E A;  2XGN A;  4LEH A;  4U13 A;  5AII A;  1K28 A;  1U8C B;  5CF1 A;  1RGG A;  1I8V A;  1QMA A;  1W02 A;  2PZV A;  3JUQ A;  4LYL B;  1M1X B;  5IG3 A;  2QEX 3;  2L4V A;  1V58 A;  3D5G A;  4DKI A;  3KSE D;  1ZS7 A;  1RHL A;  2WGO A;  1OF5 A;  3T0U A;  1LXE A;  1RGA A;  3NV0 A;  1QVG 2;  1QVF 2;  3ER7 A;  1B2Z A;  4G1M B;  3LTC A;  2V1L A;  3BU4 A;  1Q9E A;  1GY5 A;  7GSP A;  2Z76 A;  2OWP A;  2M7O A;  5AEW B;  1EKM A;  2KF3 A;  3AMO A;  4GHO A;  4K90 B;  4R9K A;  3HOH A;  1I0X A;  2Y73 A;  4KT3 B;  3RGA A;  1MGW A;  1VQK 3;  3SED A;  3UNL A;  1KSI A;  1PU4 A;  1IQ8 A;  4EW5 A;  2OTL 3;  3G8Z A;  3G71 3;  5CF2 A;  1IT7 A;  2R4I A;  3MYT A;  4WYK B;  4I5Q A;  1PFP A;  1RRL A;  3CCJ 3;  3AGN A;  3EHC A;  3CCR 3;  1VQ7 3;  1FGO A;  3N9H A;  3EQQ B;  4STD A;  2C11 A;  3KCH A;  5CK6 A;  3Q90 A;  5D81 A;  1EEJ A;  1N8Q A;  4ORL A;  3S27 A;  3EB8 A;  2OOV A;  4L8P A;  1X1X A;  3DXO A;  3G16 A;  5EQL A;  3JUN A;  1C54 A;  4OVM A;  3FGY A;  3X3X A;  2YFJ B;  2W9P A;  5AIG A;  3FG1 A;  3VSY A;  1JKG A;  3NBJ A;  2CIU A;  2F86 B;  3HI7 A;  4EV2 A;  2ML5 A;  4XBY A;  5M19 A;  1K8A 4;  1GD4 A;  3SXX A;  2KF6 A;  4RNT A;  4IPB A;  5ELU A;  3F8H A;  4AEQ A;  2CFG A;  1TFO A;  1AY7 A;  2HMJ B;  1R4Y A;  6STD A;  2UGI A;  4XDW A;  5HGR A;  2XGL A;  5M1A A;  4XBT A;  4O2H A;  5FW5 A;  3CNX A;  1LNI A;  2F5M A;  1BNG A;  4KZ1 A;  3CCU 3;  3OWU A;  5AI1 A;  3UL5 A;  2E2V A;  1TIJ A;  1AQZ A;  3MG2 A;  3DZL A;  4N6U A;  1WNH A;  5G1K A;  3Q2P A;  4TX4 A;  1BNI A;  1O7H B;  3CCV 3;  2XEP A;  3LZA A;  4X2H A;  1Q40 A;  1D6U A;  1BRH A;  1FW7 A;  1CQS A;  1KC8 4;  3HZP A;  2CHC A;  1JN5 B;  4MMY B;  2FNQ A;  2RSX A;  3WA3 A;  1FZU A;  3CNM A;  1YHQ 3;  1OHO A;  2QGU A;  3BNE A;  4CJN A;  3N8B A;  1UI7 A;  4FCJ A;  1BUJ A;  3F8X A;  3WR2 A;  6GSP A;  4BTY A;  4KFF A;  1VZZ A;  3DGN A;  3GZR A;  5BXQ A;  3NX0 A;  1OCV A;  5HOH A;  3OWS A;  2AAE A;  1J2B A;  4FR9 A;  1ZX2 A;  9RNT A;  1BVI A;  1FGQ A;  2P0X A;  4EYC A;  1OAC A;  1DET A;  1LQG C;  3BLZ A;  5IW9 A;  1YJN 3;  1UGI A;  3A76 A;  2BIR A;  3RDE A;  1I0V A;  4WHA A;  4MMX B;  3DH2 A;  1CYV A;  1IVX A;  3MWZ A;  1K41 A;  5DRV A;  1BSE A;  3Q3F A;  1Q7H A;  5KP3 A;  1LRA A;  2E2U A;  1RN1 A;  1RLS A;  1VQL 3;  1WTH A;  2HMN B;  3KFQ C;  1RJO A;  1FUW A;  1CEW I;  2P38 A;  1VQ5 3;  2MC8 A;  4LZI A;  3LOY A;  4X2O A;  5LC7 A;  1D6Y A;  1BSA A;  2CH9 A;  1JBR A;  1BAO A;  1I70 A;  3GRD A;  1G0T A;  1STD A;  2KF4 A;  2XH9 A;  5D82 A;  1HU9 A;  3D5I A;  3BND A;  1BNR A;  1BRS A;  6RNT A;  5TGN A;  2PNC A;  2RFR A;  3K7C A;  3OXA A;  2XSO B;  1WMP A;  3I0Y A;  1PYL A;  4AKZ A;  1EUI C;  1MWT A;  3N54 B;  1UCI A;  1NDO B;  1ULJ B;  3ALA A;  3B4P A;  2GBX B;  3K0Z A;  3KZT A;  5JPU A;  1VQ6 3;  5IG4 A;  4RBN A;  3SX1 A;  5D83 A;  3HII A;  2O3O A;  2GU1 A;  1US1 A;  1W2Z A;  1QAL A;  1IU7 A;  2AAD A;  3CU3 A;  1RCL A;  1FUS A;  2CG1 A;  1Q40 B;  4J5G A;  4N6M A;  5AEU B;  1B3S A;  1O7P B;  4IT7 A;  1SQW A;  1OPY A;  4RNY A;  3S29 A;  3LML A;  1FGT A;  1LQM B;  2MF7 A;  2SAR A;  4H3U A;  1KWI A;  3OW2 2;  1YI2 3;  4EC6 A;  2Q07 A;  1RCK A;  3EF8 A;  4MEI A;  1FGM A;  3F9S A;  3FKA A;  3ZG5 A;  3NBR A;  7RNT A;  3CCQ 3;  2HMO B;  1TRQ A;  3ZG0 A;  4HZ9 B;  5KP4 A;  1IVV A;  1M90 4;  1FGR A;  3IPT A;  3JUO A;  1MWU A;  1B27 A;  4BTW A;  4I4K A;  1OHP A;  5IEO A;  3RGR A;  1UI8 A;  2W56 B;  5AYS C;  4HVN A;  3MKI A;  4EV5 A;  1OH0 A;  1W7C A;  2ZA4 A;  4NPB A;  3FCS B;  2KF5 A;  4JF8 A;  3KKG A;  4QWT A;  1IVW A;  1SJW A;  1EG9 B;  3O8Y A;  3CCS 3;  3FG3 A;  1A67 A;  3EN8 A;  2YX9 A;  3HIG A;  1BSC A;  3DGM A;  1S72 3;  1AVL A;  4L7K A;  3H3H A;  3CCE 3;  2Z6B A;  3B7C A;  4K1U A;  3DGL A;  3JVC A;  4HM7 B;  4XBX A;  1B2S A;  1TP6 A;  4N6T A;  1OGZ A;  1IT8 A;  2WOF A;  1DMQ A;  1NB3 I;  4JRF A;  4KFD A;  3S5C A;  1M9G A;  3CC2 3;  3HX8 A;  1RGF A;  4HZB B;  1GOY A;  2HMK B;  1JV2 B;  3PCS A;  1BNE A;  1UUG B;  2H0H A;  2BMQ B;  3A5E A;  3KSP A;  4HM4 B;  2BU4 A;  2R41 A;  3I55 3;  1M1K 4;  1FUT A;  1MWS A;  5AIH A;  3ROB A;  3J7Y d;  1GS3 A;  3AHW A;  2GU3 A;  3PYJ A;  5RNT A;  1N5P A;  2W56 A;  1NWW A;  1STF I;  3SLU A;  4RNZ A;  2QA4 3;  1CYU A;  2BMR B;  1L5G B;  1RNB A;  5IER A;  3F7S A;  4O3V A;  2IYJ A;  2RBI A;  3KII A;  1V74 A;  3PCR A;  3EC9 A;  4HM1 B;  5ELJ A;  3DGY A;  3CC4 3;  1GOV A;  3F40 A;  3CCL 3;  5IEN A;  3GZB A;  1LOV A;  3DUK A;  1E3V A;  1T3B A;  2RNT A;  3D3L A;  2CK3 H;  4N6O B;  4CPK A;  4HM2 B;  1ROV A;  1Y4K A;  1IK3 A;  1DMM A;  4H61 A;  3LT9 A;  2GBW B;  2WGQ A;  3NM2 A;  5FGO A;  2P05 A;  3BNC A;  1DE3 A;  2XR8 B;  3GSP A;  1JRQ A;  1N9J A;  1OGX A;  2GSP A;  1IV9 A;  3U1W A;  3LTD A;  1BOX A;  5BVB A;  4R80 A;  1GYB A;  2CX1 A;  1V57 A;  4FCM A;  3UB1 A;  2W04 A;  1YVB I;  1YNV X;  5CLK A;  4N6L A;  4AKY A;  3NV0 B;  2F56 A;  2F99 A;  2H0G A;  5I97 A;  1RGH A;  1BRG A;  1LOW A;  3DGO A;  1I3F A;  3PS8 A;  5IEP A;  1IDP A;  3CME 3;  2OCT A;  1IQY A;  2KXG A;  2RCD A;  1A2P A;  4HM8 B;  3K5T A;  4J8T A;  4RZM A;  3NBB A;  3FG4 A;  4PEJ A;  2C4B A;  1HZ1 A;  2C10 A;  1RKY A;  1ROA A;  4NHF A;  3EE1 A;  5AIF A;  1SAR A;  2IA7 A;  3FZW A;  4R4K A;  3S28 A;  4EXR A;  2CWV A;  1K9M 4;  2E2T A;  3LH4 A;  4GSP A;  1IYY A;  2W03 A;  1ULI B;  1UGH I;  1W6C A;  4K1V A;  3UJM A;  1JB2 A;  1QAF A;  1YJ9 3;  2BT3 A;  1WQL B;  1VQ9 3;  3AGO A;  3GZY B;  2BNG A;  3T8N A;  3AMO B;  1VQN 3;  3WHO A;  1TRP A;  4BU4 A;  3STD A;  4WFO A;  2CFK A;  3RNT A;  3V92 A;  1ISK A;  1I2G A;  3X40 A;  1FYS A;  5KP1 A;  2F4Y A;  2W6J H;  3JUP A;  3ZFZ A;  2ZL8 A;  5CXO A;  1GY6 A;  1S5A A;  3K63 A;  4IIA A;  4XDV A;  3LTB A;  3SOA A;  3V99 A;  1BUQ A;  3H51 A;  3IMA B;  4HOH A;  4KFE A;  1W4N A;  4XM4 A;  2XF3 A;  3U97 A;  4HKV B;  1YGE A;  4HBR A;  4LMI A;  1B2X A;  4HM0 B;  4OUQ A;  2OQE A;  1UCJ A;  2GEY A;  1VQO 3;  4XB5 A;  3HK4 A;  2L1S A;  4FMB A;  4O8S A;  1VQM 3;  3CD6 3;  5EVH A;  2LYX A;  3WOD G;  1W6Y A;  2W2C A;  1ZO2 A;  1IQX A;  1W01 A;  5AYR B;  1QAK A;  1RGC A;  3DM8 A;  1X1W A;  1JKG B;  4EBG A;  2F98 A;  2F5W A;  1MOL A;  2JQ5 A;  4O02 B;  3TDG A;  3G6E 3;  1Q86 4;  1DVD A;  2CW9 A;  3Q1C A;  3WOF B;  1UW1 A;  1FA3 A;  2WOH A;  1OF5 B;  1JN5 A;  3T8U A;  5M18 A;  1RRH A;  3DY5 A;  1YVS A;  1Z1S A;  1BIR A;  3KE7 A;  3FH1 A;  2FGT A;  3VF1 A;  1DYU A;  1BSD A;  1AV4 A;  1UUV B;  2IUK A;  1B21 A;  3NQZ A;  1BRI A;  4GB5 A;  1T5Y A;  1UDI I;  1O7W B;  3MHE A;  1W00 A;  4FMA A;  1HKX A;  2IY2 A;  1AVK A;  4N3V A;  1AR0 A;  2Z77 A;  1Q7Y 4;  3L0R A;  3WOE B;  2BO9 B;  1DMN A;  1IV7 A;  3WA2 X;  1UUW B;  3X3Y A;  5BU4 A;  2CWU A;  4R9L A;  1MGR A;  1GOU A;  2O9U X;  3F14 A;  3OV4 A;  1YGW A;  1GMP A;  2GXF A;  3NHX A;  4CDL A;  2KCD A;  4BIR A;  3OX9 A;  1BNF A;  1I2F A;  2K0M A;  4L8O A;  1JJ2 2;  2LQV A;  4BL2 A;  1VQQ A;  3WMD A;  5IG5 A;  2Z7A A;  1VQ8 3;  1A2V A;  2H0I A;  4Q53 A;  2FXT A;  3B8L A;  1NJI 4;  1D6Z A;  1WMO A;  4J5K A;  1OHS A;  1SPU A;  2KAA A;  2P09 A;  2GEX A;  1ASK A;  1BRN L;  1RN7 A;  1W6G A;  1O7N B;  1Q42 A;  1RGK A; 
#chains in the Genus database with same CATH homology
 2INX A;  3E99 A;  1DVC A;  5JBS A;  3CXC 2;  3PXM A;  4MMZ B;  2CWT A;  2XRX B;  1NO3 A;  3BNB A;  3G4S 3;  5LC6 A;  2YFI B;  4BTX A;  4ZM8 A;  4HM6 B;  3B4O A;  1MNL A;  3NM7 A;  2ZDJ A;  4OK0 A;  1GY7 A;  2BHM A;  3EBY A;  2CFD A;  1EA2 A;  2HMM B;  1KQS 2;  2IMJ A;  1W5Z A;  3LTA A;  3MG1 A;  3F7X A;  2CG0 A;  3M8C A;  3CMA 3;  3CPO A;  4FCZ A;  3S67 A;  2B24 B;  3X3Z A;  1JNQ A;  2I9W A;  5JPP A;  5A0O B;  3GZX B;  3X41 A;  3WDG B;  1YIT 3;  1G96 A;  1W2B 2;  1F8N A;  2XFT A;  2CFW A;  2ML6 A;  3FSD A;  4R1K A;  2OOV C;  3OWY A;  4HYZ A;  1TUH A;  3ECF A;  2SBL A;  2D1W A;  1GD3 A;  1LOX A;  3D9R A;  5STD A;  1YIJ 3;  5EEO A;  3FF2 A;  1A2K A;  3PZW A;  3QRD A;  4KVH A;  1U5O A;  3UL6 A;  4LGQ A;  2OTJ 3;  3V98 A;  4K61 A;  2OQE C;  3NXJ A;  3LYG A;  1N5H A;  3GAX A;  3K9M C;  3FF0 A;  3NUV A;  8CHO A;  2P0M A;  2RGQ A;  3QK9 A;  2XFS A;  3EJV A;  1SIH A;  1VQP 3;  3LXU X;  3EBT A;  2BMO B;  3SOY A;  7STD A;  4J9A A;  1A90 A;  4N6V 0;  1OUN A;  3PGB A;  2B1X B;  1IVU A;  3JUM A;  1K73 4;  2XSH B;  2CFL A;  1E97 A;  1Q81 4;  1VQ4 3;  4HJL B;  3IJE B;  2QIY A;  2W0Q A;  1E3R A;  2JDI H;  3BB9 A;  1QJG A;  4HM5 B;  3MPH A;  4NRE A;  2W9Q A;  1SII A;  3GWR A;  2Y74 A;  2CKF B;  1YJW 3;  2WO0 A;  3SVA A;  1N8R 4;  2UX0 A;  3KN4 A;  2D42 A;  4CCV A;  5DRE A;  3X42 A;  4HM3 B;  1NU3 A;  2HML B;  2IUJ A;  3LT8 A;  4N6N B;  3VGN A;  1EQK A;  1KD1 4;  2A15 A;  5G2G A;  2YFL B;  2STD A;  3I56 3;  2K54 A;  3CC7 3;  3CCM 3;  1LVN A;  3DMC A;  4LSO A;  5IG0 A;  3EX9 A;  1LNH A;  4FMD A;  4GL6 A;  5IF6 A;  1TU5 A;  1JB5 A;  2KRT A;  3EN1 B;  1R4C A;  1JB4 A;  4MJD A;  4WYK A;  4WP5 A;  4WWU C;  1C7H A;  3MSO A;  1TFK A;  3G0K A;  2CC3 A;  1O7M B;  3MG3 A;  1WMN A;  3NQY A;  3FLJ A;  1Q82 4;  1NB5 I;  3CPW 2;  1O7G B;  4FMC A;  1N9E A;  2XGN A;  4LEH A;  4U13 A;  5AII A;  1K28 A;  1U8C B;  5CF1 A;  1QMA A;  3JUQ A;  1W02 A;  2PZV A;  5IG3 A;  2QEX 3;  1M1X B;  2L4V A;  3KSE D;  2WGO A;  1OF5 A;  3T0U A;  1LXE A;  3NV0 A;  1QVG 2;  1QVF 2;  3ER7 A;  4G1M B;  3LTC A;  2V1L A;  1GY5 A;  2Z76 A;  2OWP A;  2M7O A;  5AEW B;  1EKM A;  3AMO A;  4K90 B;  4R9K A;  2Y73 A;  3RGA A;  1VQK 3;  3SED A;  3UNL A;  1KSI A;  1PU4 A;  1IQ8 A;  2OTL 3;  3G8Z A;  3G71 3;  5CF2 A;  1IT7 A;  2R4I A;  3MYT A;  4WYK B;  1PFP A;  1RRL A;  3CCJ 3;  3EHC A;  3CCR 3;  1VQ7 3;  1FGO A;  3N9H A;  3EQQ B;  4STD A;  2C11 A;  5D81 A;  5CK6 A;  3Q90 A;  3S27 A;  1N8Q A;  4ORL A;  3EB8 A;  2OOV A;  4L8P A;  3DXO A;  3G16 A;  5EQL A;  3JUN A;  4OVM A;  3FGY A;  3X3X A;  2YFJ B;  2W9P A;  5AIG A;  3FG1 A;  3VSY A;  1JKG A;  3NBJ A;  2CIU A;  2F86 B;  3HI7 A;  4EV2 A;  2ML5 A;  4XBY A;  1K8A 4;  1GD4 A;  3SXX A;  4AEQ A;  4IPB A;  5ELU A;  3F8H A;  2CFG A;  1TFO A;  2HMJ B;  6STD A;  4XDW A;  5HGR A;  2XGL A;  4XBT A;  4O2H A;  5FW5 A;  3CNX A;  4KZ1 A;  3CCU 3;  3OWU A;  5AI1 A;  3UL5 A;  2E2V A;  1TIJ A;  3MG2 A;  3DZL A;  4N6U A;  1WNH A;  3Q2P A;  4TX4 A;  1O7H B;  3CCV 3;  2XEP A;  3LZA A;  4X2H A;  1Q40 A;  1D6U A;  1CQS A;  1KC8 4;  3HZP A;  2CHC A;  1JN5 B;  2FNQ A;  2RSX A;  3WA3 A;  1YHQ 3;  3CNM A;  1OHO A;  2QGU A;  3BNE A;  3N8B A;  1UI7 A;  4FCJ A;  3F8X A;  4BTY A;  4KFF A;  1VZZ A;  3DGN A;  3GZR A;  5BXQ A;  3NX0 A;  1OCV A;  3OWS A;  1J2B A;  4FR9 A;  1ZX2 A;  1FGQ A;  2P0X A;  4EYC A;  1OAC A;  3BLZ A;  5IW9 A;  1YJN 3;  3A76 A;  3RDE A;  4WHA A;  4MMX B;  1CYV A;  1IVX A;  3MWZ A;  1K41 A;  5DRV A;  5KP3 A;  2E2U A;  1VQL 3;  1WTH A;  2HMN B;  3KFQ C;  1RJO A;  1FUW A;  1CEW I;  2P38 A;  1VQ5 3;  2MC8 A;  4LZI A;  3LOY A;  4X2O A;  5LC7 A;  1D6Y A;  2CH9 A;  3GRD A;  1STD A;  2XH9 A;  5D82 A;  1HU9 A;  3BND A;  5TGN A;  2PNC A;  2RFR A;  3K7C A;  3OXA A;  2XSO B;  1WMP A;  3I0Y A;  4AKZ A;  3N54 B;  4MMY B;  1NDO B;  1ULJ B;  3ALA A;  3B4P A;  2GBX B;  3K0Z A;  3KZT A;  5JPU A;  1VQ6 3;  5IG4 A;  4RBN A;  3SX1 A;  5D83 A;  3HII A;  2O3O A;  2GU1 A;  1US1 A;  1W2Z A;  1QAL A;  1IU7 A;  3CU3 A;  2CG1 A;  1Q40 B;  4N6M A;  5AEU B;  1O7P B;  4IT7 A;  1SQW A;  1OPY A;  4RNY A;  3S29 A;  3LML A;  1FGT A;  2MF7 A;  4H3U A;  3OW2 2;  1KWI A;  1YI2 3;  4EC6 A;  2Q07 A;  3EF8 A;  4MEI A;  1FGM A;  3F9S A;  3FKA A;  3NBR A;  3CCQ 3;  2HMO B;  5KP4 A;  4HZ9 B;  1M90 4;  1IVV A;  1FGR A;  3IPT A;  3JUO A;  4BTW A;  4I4K A;  1OHP A;  5IEO A;  3RGR A;  1UI8 A;  2W56 B;  5AYS C;  4HVN A;  3MKI A;  4EV5 A;  1OH0 A;  1W7C A;  3FCS B;  4JF8 A;  3KKG A;  4QWT A;  1IVW A;  1SJW A;  1EG9 B;  3O8Y A;  3CCS 3;  3FG3 A;  1A67 A;  3EN8 A;  2YX9 A;  3HIG A;  3DGM A;  1S72 3;  1AVL A;  4L7K A;  3H3H A;  3CCE 3;  2Z6B A;  3B7C A;  4K1U A;  3DGL A;  3JVC A;  4HM7 B;  4XBX A;  1TP6 A;  4N6T A;  1OGZ A;  2WOF A;  1IT8 A;  1DMQ A;  1NB3 I;  4JRF A;  4KFD A;  3S5C A;  1M9G A;  3CC2 3;  3HX8 A;  4HZB B;  2HMK B;  1JV2 B;  3PCS A;  2BMQ B;  3KSP A;  4HM4 B;  3I55 3;  1M1K 4;  5AIH A;  3ROB A;  3J7Y d;  1GS3 A;  2GU3 A;  3PYJ A;  1N5P A;  2W56 A;  1NWW A;  1STF I;  3SLU A;  4RNZ A;  2QA4 3;  1CYU A;  2BMR B;  1L5G B;  5IER A;  3F7S A;  4O3V A;  3KII A;  1V74 A;  3PCR A;  3EC9 A;  4HM1 B;  5ELJ A;  3CC4 3;  3F40 A;  3CCL 3;  5IEN A;  3GZB A;  3DUK A;  1E3V A;  3D3L A;  2CK3 H;  4N6O B;  4HM2 B;  1ROV A;  1Y4K A;  1IK3 A;  1DMM A;  4H61 A;  3LT9 A;  2GBW B;  2WGQ A;  3NM2 A;  5FGO A;  2P05 A;  3BNC A;  2XR8 B;  1JRQ A;  1N9J A;  1OGX A;  3U1W A;  1IV9 A;  3LTD A;  5BVB A;  4R80 A;  1GYB A;  4FCM A;  3UB1 A;  2W04 A;  1YVB I;  5CLK A;  4N6L A;  4AKY A;  3NV0 B;  2F99 A;  5I97 A;  3DGO A;  3PS8 A;  5IEP A;  1IDP A;  3CME 3;  2OCT A;  1IQY A;  2KXG A;  2RCD A;  4HM8 B;  4RZM A;  3K5T A;  4J8T A;  3NBB A;  3FG4 A;  4PEJ A;  2C10 A;  1RKY A;  1ROA A;  4NHF A;  3EE1 A;  5AIF A;  2IA7 A;  3FZW A;  4R4K A;  3S28 A;  4EXR A;  2CWV A;  1K9M 4;  2E2T A;  3LH4 A;  2W03 A;  1ULI B;  1W6C A;  4K1V A;  3UJM A;  1JB2 A;  1QAF A;  1YJ9 3;  2BT3 A;  1WQL B;  1VQ9 3;  3GZY B;  2BNG A;  3T8N A;  3AMO B;  1VQN 3;  3STD A;  4WFO A;  2CFK A;  3V92 A;  1ISK A;  3X40 A;  5KP1 A;  2W6J H;  3JUP A;  2ZL8 A;  5CXO A;  1GY6 A;  1S5A A;  3K63 A;  4IIA A;  4XDV A;  3LTB A;  3SOA A;  3V99 A;  1BUQ A;  3H51 A;  3IMA B;  4KFE A;  4XM4 A;  1W4N A;  3U97 A;  2XF3 A;  4HKV B;  1YGE A;  4HBR A;  4LMI A;  4HM0 B;  4OUQ A;  2OQE A;  2GEY A;  1VQO 3;  4XB5 A;  3HK4 A;  4FMB A;  4O8S A;  1VQM 3;  3CD6 3;  5EVH A;  2LYX A;  3WOD G;  1W6Y A;  2W2C A;  1ZO2 A;  1IQX A;  1W01 A;  5AYR B;  1QAK A;  3DM8 A;  1JKG B;  4EBG A;  2F98 A;  1MOL A;  2JQ5 A;  4O02 B;  3TDG A;  3G6E 3;  1Q86 4;  1DVD A;  2CW9 A;  3Q1C A;  3WOF B;  1UW1 A;  1FA3 A;  2WOH A;  1OF5 B;  1JN5 A;  3T8U A;  1RRH A;  3DY5 A;  1Z1S A;  3KE7 A;  3FH1 A;  2FGT A;  3VF1 A;  1DYU A;  1UUV B;  1AV4 A;  2IUK A;  3NQZ A;  4GB5 A;  1T5Y A;  1O7W B;  3MHE A;  1W00 A;  4FMA A;  1HKX A;  1AVK A;  4N3V A;  1AR0 A;  2Z77 A;  1Q7Y 4;  3L0R A;  3WOE B;  2BO9 B;  1DMN A;  1IV7 A;  3WA2 X;  1UUW B;  3X3Y A;  2CWU A;  4R9L A;  2O9U X;  3F14 A;  3OV4 A;  2GXF A;  3NHX A;  4CDL A;  2KCD A;  3OX9 A;  1JJ2 2;  2K0M A;  4L8O A;  2LQV A;  3WMD A;  5IG5 A;  2Z7A A;  1VQ8 3;  1A2V A;  4Q53 A;  2FXT A;  3B8L A;  1NJI 4;  1D6Z A;  1WMO A;  1OHS A;  1SPU A;  2P09 A;  2GEX A;  1ASK A;  1RN7 A;  1W6G A;  1O7N B;  1Q42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...