5IW9A

Structure of bacteriophage t4 gp25, sheath polymerization initiator
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
b'NINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate wedge protein gp25
molecule tags Viral protein
source organism Enterobacteria phage t4
publication title Structure of the T4 baseplate and its function in triggering sheath contraction.
pubmed doi rcsb
total genus 32
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04965 GPW_gp25 Gene 25-like lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iw9A00
3NQYA 3HI7A 1D6ZA 1AVKA 1PU4A 1W5ZA 3X42A 1QAKA 3X3YA 3PGBA 4EXRA 2OQEA 2CFKA 3NBBA 2WOHA 3ALAA 1LVNA 2C10A 1W6GA 2OQEC 2K0MA 3SXXA 2CFDA 2YX9A 1IVWA 1OACA 3N9HA 1SPUA 3WA3A 1W6CA 1QALA 3X3ZA 1WMNA 2CG0A 2CFWA 4BTYA 1D6YA 1UI8A 3KN4A 2CWTA 2Y73A 3WA2X 1DYUA 2WO0A 2OOVA 2PNCA 2ZL8A 4KFEA 1SIIA 2IA7A 4EV5A 1US1A 5IW9A 2GU3A 1IQYA 2WOFA 1QAFA 3X41A 4BTXA 2BT3A 1W2ZA 4KFFA 4EV2A 1IVVA 1WMPA 1UI7A 1IVXA 1AV4A 2W0QA 3SX1A 3MPHA 1AVLA 1IU7A 1IQXA 1SIHA 1W7CA 1RJOA 1RKYA 1D6UA 2E2TA 2CWUA 4KFDA 3NBJA 2CG1A 1WMOA 1W4NA 2CFLA 3AMOA 3K5TA 1IVUA 3NQZA 4BTWA 1A2VA 2C11A 2WGQA 3X3XA 1N9EA 2E2UA 2CFGA 3HIIA 1TU5A 1KSIA 1EKMA 1JRQA 2OOVC 3T0UA 2E2VA 2D1WA 3HIGA 3LOYA 3X40A 2Y74A 3KIIA 3AMOB 2CWVA
chains in the Genus database with same CATH superfamily
1IV7A 2RSXA 4GB5A 4EC6A 1QVG2 3NQYA 4HM3B 4WWUC 1O7WB 2MC8A 4N6UA 3SYUA 4CDLA 1OHPA 5KP4A 1UGIA 1WQLB 2CW9A 1O7NB 1QJGA 3E99A 3NHXA 1D6ZA 1AVKA 1PU4A 1ISKA 2CIUA 3CCJ3 1GMRA 2LQVA 4DKIA 1W01A 9RNTA 3URPA 1FGRA 4L7KA 1NB5I 3GZBA 1DE3A 1RCKA 4FMDA 1VQL3 2RNTA 3DY5A 3B7CA 3BLZA 3N54B 4RNYA 4WFOA 4FCMA 2CFDA 3MKIA 3V98A 3NV0B 4HBRA 1U8CB 5FW5A 1KC84 2A15A 3FSDA 1OACA 2ML5A 3LTDA 3S5CA 1K734 1SPUA 4OVMA 4RNZA 3WA3A 5LC6A 4BL2A 1JNQA 5M19A 3F7SA 3QRDA 1FW7A 2GSPA 1JN5B 4LEHA 3CCV3 1RGGA 2F4YA 4XDVA 4BTYA 1DVDA 2ML6A 1M1XB 1VZZA 4H3UA 4N6LA 3SOAA 1D6YA 5ELJA 1B2SA 1BRIA 4K61A 3B4PA 2W9PA 1JB5A 1RGLA 2RGQA 4KVHA 1U5OA 2P38A 3CCQ3 2BNGA 2CHCA 1Y4KA 1I2EA 3AHSA 1DMMA 1YHQ3 2CC3A 3EX9A 1Q814 4QWTA 4XBYA 3WODG 2OOVA 5AI1A 3FKAA 3MSOA 4LMIA 4N6MA 1PYLA 1US1A 2ZDJA 1LOYA 1FZUA 1G02A 3EF8A 3ZFZA 1YIT3 3G713 4CCVA 4BTXA 1VQ83 3IMAB 1RGEA 4MMZB 5STDA 4KFFA 2ZA4A 2XRXB 1LOWA 1ZO2A 2KRTA 5HOHA 1RGKA 3IPTA 2XF3A 3HK4A 2IY2A 1JZOA 1M9GA 5AEUB 1AVLA 1I0XA 1IU7A 1SIHA 3NUVA 1MOLA 1BGSA 1Q864 1I2FA 1N8R4 1LXEA 1TTOA 3FF2A 1YGEA 4O8SA 1L5GB 1B2MA 1RGCA 3CMA3 3EN1B 5D82A 2XEPA 2E2TA 3OXAA 5AIHA 1BUJA 4XDWA 2BIRA 1DVCA 1VQM3 1AY7A 2HMOB 1W4NA 3GRDA 4FMAA 1J2BA 2CFLA 1GD4A 3KSED 4MEIA 1HKXA 1UW1A 3FZWA 1VQO3 1N5HA 1TFKA 2YFIB 1W02A 4I5QA 1RCLA 2B1XB 2WGQA 5M1AA 2H0HA 1C54A 1N9EA 2E2UA 3JUNA 1EA2A 2CFGA 2XR8B 1TIJA 3BNDA 3HIIA 3MG1A 1JRQA 3PCRA 3JUOA 3OW22 3QK9A 1JJ22 2IMJA 2UUGC 3CCS3 3SEDA 2RCDA 4N6NB 3LOYA 4N6TA 1JBTA 1JB4A 1VQQA 5HGRA 4K90B 1QMAA 3GZRA 4HKVB 3GSPA 1CH0A 1R4YA 2Y74A 5EVHA 3PS8A 1UCKA 4GL6A 2GEXA 2XFTA 2WGOA 3DGMA 5AYRB 1EQKA 4H61A 4RZMA 2GBWB 1MGWA 1LOVA 2R4IA 2MF7A 1OGXA 3CU3A 3S29A 1B2UA 4J8TA 1BRSA 1E3RA 3WOFB 3D5GA 1I2GA 5IF6A 4MMYB 4N3VA 1BNSA 2CKFB 1QAKA 2RFRA 2IUJA 3EBTA 2HMKB 3X42A 4AEQA 4EXRA 5BIRA 3K0ZA 2OQEA 1BSAA 3LTCA 1BRGA 1JBSA 1BNJA 1ASKA 2QGUA 3NM7A 2CFKA 1OH0A 3FG1A 2BHMA 3NBBA 3JUPA 3KSPA 1ROAA 5IG0A 3WDGB 2F86B 3G6E3 2WOHA 4HM5B 1TFOA 1RGHA 1BUQA 1W6GA 1X1WA 2AADA 3CME3 2K0MA 1AQZA 2GXFA 3EN8A 1W2B2 1MWTA 3FLJA 1UGHI 1MWRA 3VF1A 3T8UA 3N9HA 1LNHA 3DZLA 1VQK3 1R4CA 5LC7A 5AIGA 3EE1A 1NWWA 1QALA 3LYGA 3OWUA 3K9MC 2CFWA 2BU4A 3K7CA 2BMOB 1MWSA 1Q9EA 2Z77A 4XBTA 4G1MB 5KP1A 1UI8A 2RBIA 3KFQC 1S5AA 1ZS7A 3DGYA 3WA2X 3AHWA 1X1YA 2Z7AA 1HU9A 3EBYA 3K63A 4HVNA 3MHEA 1N8QA 3KZTA 1WNHA 5CK6A 3EC9A 4WYKA 1KQS2 1SARA 4HM1B 2BMQB 2P0MA 4X2HA 5D83A 4LYLB 2CX0A 4NREA 4XBXA 4IPBA 4JF8A 2GU3A 4HM8B 3VGNA 2UGIA 1RGFA 1DETA 1JV2B 1OUNA 4EYCA 2W6JH 3X41A 3RGRA 3S28A 1C7HA 4EW5A 2KF5A 1Q40A 4NHFA 1Q7Y4 1HZ1A 1RRLA 1NO3A 5IG4A 2F98A 3UNLA 1UI7A 3ER7A 1A90A 3TDGA 1LNIA 2W0QA 1BRNL 3EQQB 3SX1A 1OF5B 2XSHB 3D5IA 1LOXA 2BMRB 1IQXA 3A76A 3PCSA 1FYSA 3FGYA 1OF5A 3WR2A 4ZM8A 1I70A 4LZIA 3Q90A 4OK0A 3DGNA 1DMQA 1GD3A 4HM7B 1D6UA 3G4S3 3OV4A 4L8PA 5JBSA 3FCSB 2CWUA 5GSPA 2CG1A 2V1LA 4Q53A 3WOEB 2OTJ3 2B24B 3CD63 1WMOA 1V57A 5M18A 1O7HB 1ULJB 1M1K4 1IVUA 3MYTA 1ROVA 3CNMA 3LH4A 2BO9B 4WHAA 1BRJA 3X3XA 5ELUA 4BIRA 2YFJB 1FGTA 1TU5A 2F5MA 1EKMA 1UUVB 7GSPA 3F7XA 4R9KA 3AGNA 5DRVA 1YJN3 1ZX2A 2E2VA 2D1WA 3EHCA 2Z6BA 1BVIA 1W00A 4O02B 4FR9A 2K3DA 2QA43 4HYZA 1LRAA 2ZHXB 1V74A 1AR0A 3GZYB 1B2XA 3O8YA 1TRQA 1NDOB 3T8NA 1X1UA 1RN4A 2SARA 5BVBA 3WHOA 3LXUX 1RGAA 3NM2A 4MJDA 4HZBB 3FH1A 1VQ73 4K1UA 2PZVA 2L4VA 1I8VA 3F40A 3NX0A 3CC73 1V58A 4JRFA 2FGTA 4HAAA 1BSDA 1RMSA 2KXGA 2QEX3 3KE7A 1M904 3ZG0A 4TX4A 1IT7A 1W5ZA 1TJDA 1RRHA 1E3VA 1B27A 4J9AA 3X3YA 6RNTA 3RGAA 1FUSA 3PGBA 5G1LA 3OWSA 1FUWA 5TGNA 2D42A 3CCL3 1GMPA 1I3FA 2R41A 4FMCA 4ORLA 4R4KA 1UCIA 3CCM3 1YNVX 3ALAA 4U13A 1LVNA 1GS3A 1GOYA 3V99A 4EBGA 3SXXA 4AKZA 3CCU3 3OWYA 4STDA 1X1XA 3I553 1PY3A 2P0XA 4HJLB 1KWIA 1FGQA 2C4BA 1GMQA 3RNTA 2KF4A 3FG4A 2W9QA 3G16A 2I9WA 2JDIH 3H51A 5AIIA 2KF3A 3DGOA 2W2CA 1W6CA 2HOHA 1EG9B 6STDA 1I3IA 1BNGA 1OHSA 4IT7A 2FNQA 3CXC2 1YIJ3 3DMCA 3U1WA 1IK3A 3KCHA 3SOYA 3LZAA 4AKYA 1BANA 3B8LA 1JB2A 1VQ63 2FXTA 2QIYA 2Y73A 2XFSA 1VQ93 1BRKA 1Q824 1SJWA 2M7OA 2WO0A 1YGWA 2KAAA 1MWUA 2W04A 3NBRA 3H3HA 1BNEA 1LQGC 5CXOA 2ZL8A 4KZ1A 1O7GB 1SIIA 2IA7A 4EV5A 5A0OB 2P09A 1BSCA 4L8OA 3G0KA 1DMNA 1NU3A 2OTL3 2WOFA 1Q40B 1QAFA 1B20A 4FMBA 1K41A 1TUHA 2L1SA 3JUMA 3LT9A 3LTBA 4RNTA 2SBLA 2BT3A 8RNTA 5IEPA 1W2ZA 3CNXA 1IVVA 3HZPA 1T2HA 1WMPA 3UL6A 3GAXA 3LTAA 3GWRA 3SLUA 4HZ9B 5BU4A 1BSBA 1A67A 1W7CA 2XSOB 1RTUA 1RJOA 1RHLA 1RKYA 4NPBA 2CK3H 1JBRA 4GHOA 2Q07A 3UL5A 3CCR3 2STDA 8CHOA 4CPKA 1OGZA 3KKGA 2GU1A 3NBJA 3NV0A 1PFPA 5D81A 7RNTA 3J7Yd 3K5TA 3U97A 3NQZA 2C11A 3S67A 1VQ43 1VQN3 5FGOA 3PZWA 2YFLB 1GY6A 3I0YA 1UUWB 1EEJA 1BOXA 1IYYA 4N6OB 3MG3A 1RN1A 1BAOA 3F14A 2H0GA 3BNCA 5IG5A 5G2GA 3MG2A 1FGOA 4KT3B 2P05A 3Q1CA 3KIIA 2F5WA 3AMOB 5DREA 4WYKB 2F56A 4LGQA 3NXJA 1YJW3 1E97A 3PYJA 4GSPA 2O3OA 3D9RA 3ROBA 4OUQA 5JPUA 1ZGXA 2Z76A 5G1KA 2CH9A 5JPPA 3CC23 1T3BA 2XGNA 1LQMB 3HI7A 1QVF2 3HX8A 5AEWB 2XH9A 5KP3A 3OX9A 4HM2B 1S723 4N6V0 1RLSA 2KF6A 1BNFA 2XGLA 3CCE3 1NB3I 1OHOA 1IQ8A 1OCVA 3V92A 5IERA 2W56B 1CQSA 5CLKA 1Q42A 1RNTA 1A2KA 2W56A 1K8A4 3MWZA 1EUIC 1YVSA 1JN5A 3F9SA 1JKGA 1BNIA 3UB1A 2C10A 1Z1SA 4R9LA 1BRHA 2OQEC 1FA3A 6GSPA 1KD14 1FGMA 1OPYA 3UJMA 3F8HA 2YX9A 1TRPA 3N8BA 3JUQA 5EEOA 2W03A 1RN7A 1CYVA 4FCJA 3Q2PA 4HM6B 1IVWA 3DH2A 1IT8A 3SVAA 3CPOA 3I563 3X3ZA 1NJI4 2JQ5A 1WMNA 1YVBI 2KCDA 5CF1A 3D4AA 2CG0A 2OWPA 1UUGB 3EB8A 4RBNA 3VSYA 2HMNB 4LSOA 1ULIB 1GYBA 1BSEA 4XB5A 3KN4A 3B4OA 2CWTA 2CX1A 3DXOA 1MGRA 1DYUA 3IJEB 4HM4B 3LMLA 1YI23 1K28A 1F8NA 2OCTA 2PNCA 3CPW2 5RNTA 1IDPA 2K54A 4KFEA 2F99A 1BNRA 1K9M4 1W6YA 3RDEA 4R80A 1JZDA 2J8XB 4O3VA 2H0IA 5CF2A 3Q3FA 5IW9A 4J5KA 3D79A 3ECFA 4O2HA 3STDA 1IQYA 1UCLA 3DM8A 2O9UX 5BXQA 5IG3A 3GZXB 3FF0A 4EV2A 2LYXA 4HOHA 2AAEA 3G8ZA 5AIFA 3ZG5A 5IENA 1G96A 2INXA 3DGLA 1IVXA 1O7PB 1B21A 1AV4A 1YJ93 3MPHA 4XM4A 1STDA 2HMLB 3M8CA 4HM0B 1RDSA 1UDII 3CC43 1RNBA 1SQWA 4X2OA 2UX0A 1UCJA 4FCZA 3DUKA 1CYUA 1GY7A 1BU4A 1B2ZA 5EQLA 1JKGB 1N5PA 1GOVA 3BU4A 4J5GA 1T5YA 3BNBA 2IYJA 3LT8A 4KFDA 5I97A 3F8XA 1WTHA 4MMXB 1G0TA 3JVCA 1GY5A 3AGOA 3AMOA 4R1KA 4BTWA 3BB9A 1IV9A 1A2VA 1NNVA 3D3LA 4IIAA 5IEOA 1STFI 3PXMA 3EJVA 1N9JA 3FG3A 1I0VA 1Q7HA 2GEYA 2GBXB 1KSIA 1RSNA 1FUTA 3A5EA 1CEWI 2HMMB 2OOVC 4BU4A 5AYSC 3T0UA 3HIGA 3X40A 1HYFA 1GOUA 3S27A 7STDA 3HOHA 4PEJA 3WMDA 1VQ53 4I4KA 1BIRA 1O7MB 1T2IA 4WP5A 1VQP3 3BIRA 3BNEA 1A2PA 1MNLA 2CWVA 2IUKA 3L0RA 4ILFA 1GSPA 4BL3A 4K1VA 2HMJB 4CJNA 1B3SA 1TP6A
chains in the Genus database with same CATH topology
1IV7A 2RSXA 4GB5A 4EC6A 1QVG2 3NQYA 4HM3B 4WWUC 1O7WB 2MC8A 4N6UA 4CDLA 1OHPA 5KP4A 1WQLB 2CW9A 1O7NB 1QJGA 3E99A 3NHXA 1D6ZA 1AVKA 1PU4A 1ISKA 2CIUA 3CCJ3 2LQVA 1W01A 1FGRA 4L7KA 1NB5I 3GZBA 4FMDA 1VQL3 3DY5A 3B7CA 3BLZA 3N54B 4RNYA 4WFOA 4FCMA 2CFDA 3MKIA 3V98A 3NV0B 4HBRA 1U8CB 5FW5A 1KC84 2A15A 3FSDA 1OACA 2ML5A 3LTDA 3S5CA 1K734 1SPUA 4OVMA 4RNZA 3WA3A 5LC6A 1JNQA 3F7SA 3QRDA 1JN5B 4LEHA 3CCV3 4XDVA 4BTYA 1DVDA 2ML6A 1M1XB 1VZZA 4H3UA 4N6LA 3SOAA 1D6YA 5ELJA 4K61A 3B4PA 2W9PA 1JB5A 2RGQA 4KVHA 1U5OA 2P38A 3CCQ3 2BNGA 2CHCA 1Y4KA 1DMMA 1YHQ3 2CC3A 3EX9A 1Q814 4QWTA 4XBYA 3WODG 2OOVA 5AI1A 3FKAA 3MSOA 4LMIA 4N6MA 1US1A 2ZDJA 3EF8A 1YIT3 3G713 4CCVA 4BTXA 1VQ83 3IMAB 4MMZB 5STDA 4KFFA 2XRXB 2KRTA 1ZO2A 3IPTA 2XF3A 3HK4A 5AEUB 1M9GA 1AVLA 1IU7A 1SIHA 3NUVA 1MOLA 1Q864 1N8R4 1LXEA 3FF2A 3CMA3 1YGEA 4O8SA 1L5GB 3EN1B 5D82A 2XEPA 2E2TA 3OXAA 5AIHA 4XDWA 1DVCA 1VQM3 2HMOB 3GRDA 1W4NA 1J2BA 4FMAA 2CFLA 1GD4A 3KSED 4MEIA 1HKXA 1UW1A 3FZWA 1VQO3 1N5HA 1TFKA 2YFIB 1W02A 2B1XB 2WGQA 1N9EA 2E2UA 3JUNA 2XR8B 1EA2A 2CFGA 1TIJA 3BNDA 3HIIA 3MG1A 1JRQA 3PCRA 3JUOA 3OW22 3QK9A 1JJ22 2IMJA 3CCS3 3SEDA 2RCDA 4N6NB 3LOYA 4N6TA 1JB4A 5HGRA 4K90B 1QMAA 3GZRA 4HKVB 5EVHA 2Y74A 3PS8A 4GL6A 2GEXA 2XFTA 2WGOA 3DGMA 5AYRB 1EQKA 4H61A 4RZMA 2GBWB 2R4IA 2MF7A 1OGXA 3CU3A 3S29A 4J8TA 1E3RA 3WOFB 5IF6A 4MMYB 4N3VA 2CKFB 2RFRA 1QAKA 2IUJA 3X42A 3EBTA 2HMKB 4AEQA 4EXRA 3K0ZA 2OQEA 3LTCA 1ASKA 2QGUA 3NM7A 2CFKA 1OH0A 3FG1A 2BHMA 3NBBA 3JUPA 3KSPA 1ROAA 5IG0A 3WDGB 2F86B 3G6E3 2WOHA 4HM5B 1TFOA 1BUQA 1W6GA 3CME3 2K0MA 2GXFA 3EN8A 1W2B2 3FLJA 3VF1A 3T8UA 3N9HA 1LNHA 3DZLA 1VQK3 1R4CA 5LC7A 5AIGA 3EE1A 1NWWA 1QALA 3LYGA 3OWUA 3K9MC 2CFWA 3K7CA 2BMOB 5KP1A 2Z77A 4XBTA 4G1MB 1UI8A 3KFQC 1S5AA 3WA2X 2Z7AA 1HU9A 3EBYA 3K63A 4HVNA 3MHEA 1N8QA 3KZTA 1WNHA 5CK6A 3EC9A 4WYKA 1KQS2 5D83A 4HM1B 2BMQB 2P0MA 4X2HA 4NREA 4XBXA 4IPBA 4JF8A 2GU3A 4HM8B 3VGNA 1JV2B 1OUNA 4EYCA 2W6JH 3X41A 3RGRA 3S28A 1C7HA 1Q40A 4NHFA 1Q7Y4 1RRLA 1NO3A 5IG4A 2F98A 3UNLA 1UI7A 3ER7A 1A90A 3TDGA 2W0QA 3EQQB 3SX1A 1OF5B 2XSHB 1LOXA 2BMRB 1IQXA 3A76A 3PCSA 3FGYA 1OF5A 4ZM8A 4LZIA 3Q90A 4OK0A 3DGNA 1DMQA 1GD3A 4HM7B 1D6UA 3G4S3 3OV4A 4L8PA 5JBSA 3FCSB 2CWUA 2CG1A 2V1LA 4Q53A 3WOEB 2OTJ3 2B24B 3CD63 1WMOA 1O7HB 1ULJB 1M1K4 1IVUA 3MYTA 1ROVA 3CNMA 3LH4A 2BO9B 4WHAA 3X3XA 5ELUA 2YFJB 1FGTA 1TU5A 1EKMA 1UUVB 3F7XA 4R9KA 5DRVA 1YJN3 1ZX2A 2E2VA 2D1WA 3EHCA 2Z6BA 1W00A 4O02B 4FR9A 2QA43 4HYZA 1V74A 1AR0A 3GZYB 3O8YA 1NDOB 3T8NA 5BVBA 3LXUX 3NM2A 4MJDA 4HZBB 3FH1A 1VQ73 4K1UA 2PZVA 2L4VA 3F40A 3NX0A 3CC73 4JRFA 2FGTA 2QEX3 2KXGA 1M904 3KE7A 4TX4A 1IT7A 1W5ZA 1RRHA 1E3VA 4J9AA 3X3YA 3RGAA 1FUWA 3PGBA 3OWSA 5TGNA 2D42A 3CCL3 4FMCA 4ORLA 4R4KA 3CCM3 3ALAA 4U13A 1LVNA 1GS3A 3V99A 4EBGA 3SXXA 4AKZA 3CCU3 3OWYA 4STDA 3I553 2P0XA 4HJLB 1KWIA 1FGQA 3FG4A 2W9QA 3G16A 2I9WA 2JDIH 3H51A 5AIIA 3DGOA 2W2CA 1W6CA 1EG9B 6STDA 1OHSA 4IT7A 2FNQA 3CXC2 1YIJ3 3DMCA 3U1WA 1IK3A 3SOYA 4AKYA 3LZAA 3B8LA 1JB2A 1VQ63 2FXTA 2QIYA 2Y73A 2XFSA 1VQ93 1Q824 1SJWA 2M7OA 2WO0A 2W04A 3NBRA 3H3HA 5CXOA 2ZL8A 4KZ1A 1O7GB 1SIIA 2IA7A 4EV5A 5A0OB 2P09A 4L8OA 3G0KA 1DMNA 1NU3A 2OTL3 2WOFA 1Q40B 1QAFA 4FMBA 1K41A 1TUHA 3JUMA 3LT9A 3LTBA 2SBLA 2BT3A 5IEPA 1W2ZA 3CNXA 1IVVA 3HZPA 1WMPA 3UL6A 3GAXA 3LTAA 3GWRA 3SLUA 4HZ9B 1A67A 1W7CA 2XSOB 1RJOA 1RKYA 2CK3H 2Q07A 3UL5A 3CCR3 2STDA 8CHOA 1OGZA 3KKGA 2GU1A 3NBJA 3NV0A 1PFPA 5D81A 3J7Yd 3K5TA 3U97A 3NQZA 2C11A 3S67A 1VQ43 1VQN3 5FGOA 3PZWA 2YFLB 1GY6A 3I0YA 1UUWB 4N6OB 3MG3A 3F14A 3BNCA 5IG5A 5G2GA 3MG2A 1FGOA 2P05A 3Q1CA 3KIIA 3AMOB 5DREA 4WYKB 4LGQA 3NXJA 1YJW3 1E97A 3PYJA 3D9RA 2O3OA 3ROBA 4OUQA 5JPUA 2Z76A 2CH9A 5JPPA 3CC23 2XGNA 3HI7A 1QVF2 3HX8A 5AEWB 2XH9A 5KP3A 3OX9A 4HM2B 1S723 4N6V0 2XGLA 3CCE3 1NB3I 1OHOA 1IQ8A 1OCVA 3V92A 5IERA 2W56B 1CQSA 5CLKA 1Q42A 2W56A 1A2KA 1K8A4 3MWZA 1JN5A 3F9SA 1JKGA 3UB1A 2C10A 1Z1SA 4R9LA 2OQEC 1FA3A 1KD14 1FGMA 1OPYA 3UJMA 3F8HA 2YX9A 3N8BA 3JUQA 5EEOA 2W03A 1RN7A 1CYVA 4FCJA 3Q2PA 4HM6B 1IVWA 1IT8A 3SVAA 3CPOA 3I563 3X3ZA 1NJI4 2JQ5A 1WMNA 1YVBI 2KCDA 5CF1A 2CG0A 2OWPA 3EB8A 4RBNA 3VSYA 2HMNB 4LSOA 1ULIB 1GYBA 4XB5A 3KN4A 3B4OA 2CWTA 3DXOA 3IJEB 1DYUA 4HM4B 3LMLA 1YI23 1K28A 1F8NA 2OCTA 2PNCA 3CPW2 1IDPA 2K54A 4KFEA 2F99A 1K9M4 1W6YA 3RDEA 4R80A 4O3VA 5IW9A 5CF2A 3ECFA 4O2HA 3STDA 1IQYA 3DM8A 2O9UX 5BXQA 5IG3A 3GZXB 3FF0A 4EV2A 2LYXA 3G8ZA 5AIFA 5IENA 1G96A 2INXA 3DGLA 1IVXA 1O7PB 1AV4A 1YJ93 3MPHA 4XM4A 1STDA 2HMLB 3M8CA 4HM0B 3CC43 1SQWA 4X2OA 2UX0A 4FCZA 1CYUA 3DUKA 1GY7A 5EQLA 1JKGB 1N5PA 1T5YA 3BNBA 3LT8A 4KFDA 5I97A 3F8XA 1WTHA 4MMXB 3JVCA 1GY5A 3AMOA 4R1KA 4BTWA 3BB9A 1IV9A 1A2VA 3D3LA 4IIAA 5IEOA 1STFI 3PXMA 3EJVA 1N9JA 3FG3A 2GEYA 2GBXB 1KSIA 1CEWI 2HMMB 2OOVC 5AYSC 3T0UA 3HIGA 3X40A 3S27A 1VQ53 4PEJA 3WMDA 4I4KA 1O7MB 1VQP3 4WP5A 3BNEA 7STDA 1MNLA 2CWVA 2IUKA 3L0RA 4K1VA 2HMJB 1TP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQY A;  3HI7 A;  1D6Z A;  1AVK A;  1PU4 A;  1W5Z A;  3X42 A;  1QAK A;  3X3Y A;  3PGB A;  4EXR A;  2OQE A;  2CFK A;  3NBB A;  2WOH A;  3ALA A;  1LVN A;  2C10 A;  1W6G A;  2OQE C;  2K0M A;  3SXX A;  2CFD A;  2YX9 A;  1IVW A;  1OAC A;  3N9H A;  1SPU A;  3WA3 A;  1W6C A;  1QAL A;  3X3Z A;  1WMN A;  2CG0 A;  2CFW A;  4BTY A;  1D6Y A;  1UI8 A;  3KN4 A;  2CWT A;  2Y73 A;  3WA2 X;  1DYU A;  2WO0 A;  2OOV A;  2PNC A;  2ZL8 A;  4KFE A;  1SII A;  2IA7 A;  4EV5 A;  1US1 A;  5IW9 A;  2GU3 A;  1IQY A;  2WOF A;  1QAF A;  3X41 A;  4BTX A;  2BT3 A;  1W2Z A;  4KFF A;  4EV2 A;  1IVV A;  1WMP A;  1UI7 A;  1IVX A;  1AV4 A;  2W0Q A;  3SX1 A;  3MPH A;  1AVL A;  1IU7 A;  1IQX A;  1SIH A;  1W7C A;  1RJO A;  1RKY A;  1D6U A;  2E2T A;  2CWU A;  4KFD A;  3NBJ A;  2CG1 A;  1WMO A;  1W4N A;  2CFL A;  3AMO A;  3K5T A;  1IVU A;  3NQZ A;  4BTW A;  1A2V A;  2C11 A;  2WGQ A;  3X3X A;  1N9E A;  2E2U A;  2CFG A;  3HII A;  1TU5 A;  1KSI A;  1EKM A;  1JRQ A;  2OOV C;  3T0U A;  2E2V A;  2D1W A;  3HIG A;  3LOY A;  3X40 A;  2Y74 A;  3KII A;  3AMO B;  2CWV A; 
#chains in the Genus database with same CATH topology
 1IV7 A;  2RSX A;  4GB5 A;  4EC6 A;  1QVG 2;  3NQY A;  4HM3 B;  4WWU C;  1O7W B;  2MC8 A;  4N6U A;  3SYU A;  4CDL A;  1OHP A;  5KP4 A;  1UGI A;  1WQL B;  2CW9 A;  1O7N B;  1QJG A;  3E99 A;  3NHX A;  1D6Z A;  1AVK A;  1PU4 A;  1ISK A;  2CIU A;  3CCJ 3;  1GMR A;  2LQV A;  4DKI A;  1W01 A;  9RNT A;  3URP A;  1FGR A;  4L7K A;  1NB5 I;  3GZB A;  1DE3 A;  1RCK A;  4FMD A;  1VQL 3;  2RNT A;  3DY5 A;  3B7C A;  3BLZ A;  3N54 B;  4RNY A;  4WFO A;  4FCM A;  2CFD A;  3MKI A;  3V98 A;  3NV0 B;  4HBR A;  1U8C B;  5FW5 A;  1KC8 4;  2A15 A;  3FSD A;  1OAC A;  2ML5 A;  3LTD A;  3S5C A;  1K73 4;  1SPU A;  4OVM A;  4RNZ A;  3WA3 A;  5LC6 A;  4BL2 A;  1JNQ A;  5M19 A;  3F7S A;  3QRD A;  1FW7 A;  2GSP A;  1JN5 B;  4LEH A;  3CCV 3;  1RGG A;  2F4Y A;  4XDV A;  4BTY A;  1DVD A;  2ML6 A;  1M1X B;  1VZZ A;  4H3U A;  4N6L A;  3SOA A;  1D6Y A;  5ELJ A;  1B2S A;  1BRI A;  4K61 A;  3B4P A;  2W9P A;  1JB5 A;  1RGL A;  2RGQ A;  4KVH A;  1U5O A;  2P38 A;  3CCQ 3;  2BNG A;  2CHC A;  1Y4K A;  1I2E A;  3AHS A;  1DMM A;  1YHQ 3;  2CC3 A;  3EX9 A;  1Q81 4;  4QWT A;  4XBY A;  3WOD G;  2OOV A;  5AI1 A;  3FKA A;  3MSO A;  4LMI A;  4N6M A;  1PYL A;  1US1 A;  2ZDJ A;  1LOY A;  1FZU A;  1G02 A;  3EF8 A;  3ZFZ A;  1YIT 3;  3G71 3;  4CCV A;  4BTX A;  1VQ8 3;  3IMA B;  1RGE A;  4MMZ B;  5STD A;  4KFF A;  2ZA4 A;  2XRX B;  1LOW A;  1ZO2 A;  2KRT A;  5HOH A;  1RGK A;  3IPT A;  2XF3 A;  3HK4 A;  2IY2 A;  1JZO A;  1M9G A;  5AEU B;  1AVL A;  1I0X A;  1IU7 A;  1SIH A;  3NUV A;  1MOL A;  1BGS A;  1Q86 4;  1I2F A;  1N8R 4;  1LXE A;  1TTO A;  3FF2 A;  1YGE A;  4O8S A;  1L5G B;  1B2M A;  1RGC A;  3CMA 3;  3EN1 B;  5D82 A;  2XEP A;  2E2T A;  3OXA A;  5AIH A;  1BUJ A;  4XDW A;  2BIR A;  1DVC A;  1VQM 3;  1AY7 A;  2HMO B;  1W4N A;  3GRD A;  4FMA A;  1J2B A;  2CFL A;  1GD4 A;  3KSE D;  4MEI A;  1HKX A;  1UW1 A;  3FZW A;  1VQO 3;  1N5H A;  1TFK A;  2YFI B;  1W02 A;  4I5Q A;  1RCL A;  2B1X B;  2WGQ A;  5M1A A;  2H0H A;  1C54 A;  1N9E A;  2E2U A;  3JUN A;  1EA2 A;  2CFG A;  2XR8 B;  1TIJ A;  3BND A;  3HII A;  3MG1 A;  1JRQ A;  3PCR A;  3JUO A;  3OW2 2;  3QK9 A;  1JJ2 2;  2IMJ A;  2UUG C;  3CCS 3;  3SED A;  2RCD A;  4N6N B;  3LOY A;  4N6T A;  1JBT A;  1JB4 A;  1VQQ A;  5HGR A;  4K90 B;  1QMA A;  3GZR A;  4HKV B;  3GSP A;  1CH0 A;  1R4Y A;  2Y74 A;  5EVH A;  3PS8 A;  1UCK A;  4GL6 A;  2GEX A;  2XFT A;  2WGO A;  3DGM A;  5AYR B;  1EQK A;  4H61 A;  4RZM A;  2GBW B;  1MGW A;  1LOV A;  2R4I A;  2MF7 A;  1OGX A;  3CU3 A;  3S29 A;  1B2U A;  4J8T A;  1BRS A;  1E3R A;  3WOF B;  3D5G A;  1I2G A;  5IF6 A;  4MMY B;  4N3V A;  1BNS A;  2CKF B;  1QAK A;  2RFR A;  2IUJ A;  3EBT A;  2HMK B;  3X42 A;  4AEQ A;  4EXR A;  5BIR A;  3K0Z A;  2OQE A;  1BSA A;  3LTC A;  1BRG A;  1JBS A;  1BNJ A;  1ASK A;  2QGU A;  3NM7 A;  2CFK A;  1OH0 A;  3FG1 A;  2BHM A;  3NBB A;  3JUP A;  3KSP A;  1ROA A;  5IG0 A;  3WDG B;  2F86 B;  3G6E 3;  2WOH A;  4HM5 B;  1TFO A;  1RGH A;  1BUQ A;  1W6G A;  1X1W A;  2AAD A;  3CME 3;  2K0M A;  1AQZ A;  2GXF A;  3EN8 A;  1W2B 2;  1MWT A;  3FLJ A;  1UGH I;  1MWR A;  3VF1 A;  3T8U A;  3N9H A;  1LNH A;  3DZL A;  1VQK 3;  1R4C A;  5LC7 A;  5AIG A;  3EE1 A;  1NWW A;  1QAL A;  3LYG A;  3OWU A;  3K9M C;  2CFW A;  2BU4 A;  3K7C A;  2BMO B;  1MWS A;  1Q9E A;  2Z77 A;  4XBT A;  4G1M B;  5KP1 A;  1UI8 A;  2RBI A;  3KFQ C;  1S5A A;  1ZS7 A;  3DGY A;  3WA2 X;  3AHW A;  1X1Y A;  2Z7A A;  1HU9 A;  3EBY A;  3K63 A;  4HVN A;  3MHE A;  1N8Q A;  3KZT A;  1WNH A;  5CK6 A;  3EC9 A;  4WYK A;  1KQS 2;  1SAR A;  4HM1 B;  2BMQ B;  2P0M A;  4X2H A;  5D83 A;  4LYL B;  2CX0 A;  4NRE A;  4XBX A;  4IPB A;  4JF8 A;  2GU3 A;  4HM8 B;  3VGN A;  2UGI A;  1RGF A;  1DET A;  1JV2 B;  1OUN A;  4EYC A;  2W6J H;  3X41 A;  3RGR A;  3S28 A;  1C7H A;  4EW5 A;  2KF5 A;  1Q40 A;  4NHF A;  1Q7Y 4;  1HZ1 A;  1RRL A;  1NO3 A;  5IG4 A;  2F98 A;  3UNL A;  1UI7 A;  3ER7 A;  1A90 A;  3TDG A;  1LNI A;  2W0Q A;  1BRN L;  3EQQ B;  3SX1 A;  1OF5 B;  2XSH B;  3D5I A;  1LOX A;  2BMR B;  1IQX A;  3A76 A;  3PCS A;  1FYS A;  3FGY A;  1OF5 A;  3WR2 A;  4ZM8 A;  1I70 A;  4LZI A;  3Q90 A;  4OK0 A;  3DGN A;  1DMQ A;  1GD3 A;  4HM7 B;  1D6U A;  3G4S 3;  3OV4 A;  4L8P A;  5JBS A;  3FCS B;  2CWU A;  5GSP A;  2CG1 A;  2V1L A;  4Q53 A;  3WOE B;  2OTJ 3;  2B24 B;  3CD6 3;  1WMO A;  1V57 A;  5M18 A;  1O7H B;  1ULJ B;  1M1K 4;  1IVU A;  3MYT A;  1ROV A;  3CNM A;  3LH4 A;  2BO9 B;  4WHA A;  1BRJ A;  3X3X A;  5ELU A;  4BIR A;  2YFJ B;  1FGT A;  1TU5 A;  2F5M A;  1EKM A;  1UUV B;  7GSP A;  3F7X A;  4R9K A;  3AGN A;  5DRV A;  1YJN 3;  1ZX2 A;  2E2V A;  2D1W A;  3EHC A;  2Z6B A;  1BVI A;  1W00 A;  4O02 B;  4FR9 A;  2K3D A;  2QA4 3;  4HYZ A;  1LRA A;  2ZHX B;  1V74 A;  1AR0 A;  3GZY B;  1B2X A;  3O8Y A;  1TRQ A;  1NDO B;  3T8N A;  1X1U A;  1RN4 A;  2SAR A;  5BVB A;  3WHO A;  3LXU X;  1RGA A;  3NM2 A;  4MJD A;  4HZB B;  3FH1 A;  1VQ7 3;  4K1U A;  2PZV A;  2L4V A;  1I8V A;  3F40 A;  3NX0 A;  3CC7 3;  1V58 A;  4JRF A;  2FGT A;  4HAA A;  1BSD A;  1RMS A;  2KXG A;  2QEX 3;  3KE7 A;  1M90 4;  3ZG0 A;  4TX4 A;  1IT7 A;  1W5Z A;  1TJD A;  1RRH A;  1E3V A;  1B27 A;  4J9A A;  3X3Y A;  6RNT A;  3RGA A;  1FUS A;  3PGB A;  5G1L A;  3OWS A;  1FUW A;  5TGN A;  2D42 A;  3CCL 3;  1GMP A;  1I3F A;  2R41 A;  4FMC A;  4ORL A;  4R4K A;  1UCI A;  3CCM 3;  1YNV X;  3ALA A;  4U13 A;  1LVN A;  1GS3 A;  1GOY A;  3V99 A;  4EBG A;  3SXX A;  4AKZ A;  3CCU 3;  3OWY A;  4STD A;  1X1X A;  3I55 3;  1PY3 A;  2P0X A;  4HJL B;  1KWI A;  1FGQ A;  2C4B A;  1GMQ A;  3RNT A;  2KF4 A;  3FG4 A;  2W9Q A;  3G16 A;  2I9W A;  2JDI H;  3H51 A;  5AII A;  2KF3 A;  3DGO A;  2W2C A;  1W6C A;  2HOH A;  1EG9 B;  6STD A;  1I3I A;  1BNG A;  1OHS A;  4IT7 A;  2FNQ A;  3CXC 2;  1YIJ 3;  3DMC A;  3U1W A;  1IK3 A;  3KCH A;  3SOY A;  3LZA A;  4AKY A;  1BAN A;  3B8L A;  1JB2 A;  1VQ6 3;  2FXT A;  2QIY A;  2Y73 A;  2XFS A;  1VQ9 3;  1BRK A;  1Q82 4;  1SJW A;  2M7O A;  2WO0 A;  1YGW A;  2KAA A;  1MWU A;  2W04 A;  3NBR A;  3H3H A;  1BNE A;  1LQG C;  5CXO A;  2ZL8 A;  4KZ1 A;  1O7G B;  1SII A;  2IA7 A;  4EV5 A;  5A0O B;  2P09 A;  1BSC A;  4L8O A;  3G0K A;  1DMN A;  1NU3 A;  2OTL 3;  2WOF A;  1Q40 B;  1QAF A;  1B20 A;  4FMB A;  1K41 A;  1TUH A;  2L1S A;  3JUM A;  3LT9 A;  3LTB A;  4RNT A;  2SBL A;  2BT3 A;  8RNT A;  5IEP A;  1W2Z A;  3CNX A;  1IVV A;  3HZP A;  1T2H A;  1WMP A;  3UL6 A;  3GAX A;  3LTA A;  3GWR A;  3SLU A;  4HZ9 B;  5BU4 A;  1BSB A;  1A67 A;  1W7C A;  2XSO B;  1RTU A;  1RJO A;  1RHL A;  1RKY A;  4NPB A;  2CK3 H;  1JBR A;  4GHO A;  2Q07 A;  3UL5 A;  3CCR 3;  2STD A;  8CHO A;  4CPK A;  1OGZ A;  3KKG A;  2GU1 A;  3NBJ A;  3NV0 A;  1PFP A;  5D81 A;  7RNT A;  3J7Y d;  3K5T A;  3U97 A;  3NQZ A;  2C11 A;  3S67 A;  1VQ4 3;  1VQN 3;  5FGO A;  3PZW A;  2YFL B;  1GY6 A;  3I0Y A;  1UUW B;  1EEJ A;  1BOX A;  1IYY A;  4N6O B;  3MG3 A;  1RN1 A;  1BAO A;  3F14 A;  2H0G A;  3BNC A;  5IG5 A;  5G2G A;  3MG2 A;  1FGO A;  4KT3 B;  2P05 A;  3Q1C A;  3KII A;  2F5W A;  3AMO B;  5DRE A;  4WYK B;  2F56 A;  4LGQ A;  3NXJ A;  1YJW 3;  1E97 A;  3PYJ A;  4GSP A;  2O3O A;  3D9R A;  3ROB A;  4OUQ A;  5JPU A;  1ZGX A;  2Z76 A;  5G1K A;  2CH9 A;  5JPP A;  3CC2 3;  1T3B A;  2XGN A;  1LQM B;  3HI7 A;  1QVF 2;  3HX8 A;  5AEW B;  2XH9 A;  5KP3 A;  3OX9 A;  4HM2 B;  1S72 3;  4N6V 0;  1RLS A;  2KF6 A;  1BNF A;  2XGL A;  3CCE 3;  1NB3 I;  1OHO A;  1IQ8 A;  1OCV A;  3V92 A;  5IER A;  2W56 B;  1CQS A;  5CLK A;  1Q42 A;  1RNT A;  1A2K A;  2W56 A;  1K8A 4;  3MWZ A;  1EUI C;  1YVS A;  1JN5 A;  3F9S A;  1JKG A;  1BNI A;  3UB1 A;  2C10 A;  1Z1S A;  4R9L A;  1BRH A;  2OQE C;  1FA3 A;  6GSP A;  1KD1 4;  1FGM A;  1OPY A;  3UJM A;  3F8H A;  2YX9 A;  1TRP A;  3N8B A;  3JUQ A;  5EEO A;  2W03 A;  1RN7 A;  1CYV A;  4FCJ A;  3Q2P A;  4HM6 B;  1IVW A;  3DH2 A;  1IT8 A;  3SVA A;  3CPO A;  3I56 3;  3X3Z A;  1NJI 4;  2JQ5 A;  1WMN A;  1YVB I;  2KCD A;  5CF1 A;  3D4A A;  2CG0 A;  2OWP A;  1UUG B;  3EB8 A;  4RBN A;  3VSY A;  2HMN B;  4LSO A;  1ULI B;  1GYB A;  1BSE A;  4XB5 A;  3KN4 A;  3B4O A;  2CWT A;  2CX1 A;  3DXO A;  1MGR A;  1DYU A;  3IJE B;  4HM4 B;  3LML A;  1YI2 3;  1K28 A;  1F8N A;  2OCT A;  2PNC A;  3CPW 2;  5RNT A;  1IDP A;  2K54 A;  4KFE A;  2F99 A;  1BNR A;  1K9M 4;  1W6Y A;  3RDE A;  4R80 A;  1JZD A;  2J8X B;  4O3V A;  2H0I A;  5CF2 A;  3Q3F A;  5IW9 A;  4J5K A;  3D79 A;  3ECF A;  4O2H A;  3STD A;  1IQY A;  1UCL A;  3DM8 A;  2O9U X;  5BXQ A;  5IG3 A;  3GZX B;  3FF0 A;  4EV2 A;  2LYX A;  4HOH A;  2AAE A;  3G8Z A;  5AIF A;  3ZG5 A;  5IEN A;  1G96 A;  2INX A;  3DGL A;  1IVX A;  1O7P B;  1B21 A;  1AV4 A;  1YJ9 3;  3MPH A;  4XM4 A;  1STD A;  2HML B;  3M8C A;  4HM0 B;  1RDS A;  1UDI I;  3CC4 3;  1RNB A;  1SQW A;  4X2O A;  2UX0 A;  1UCJ A;  4FCZ A;  3DUK A;  1CYU A;  1GY7 A;  1BU4 A;  1B2Z A;  5EQL A;  1JKG B;  1N5P A;  1GOV A;  3BU4 A;  4J5G A;  1T5Y A;  3BNB A;  2IYJ A;  3LT8 A;  4KFD A;  5I97 A;  3F8X A;  1WTH A;  4MMX B;  1G0T A;  3JVC A;  1GY5 A;  3AGO A;  3AMO A;  4R1K A;  4BTW A;  3BB9 A;  1IV9 A;  1A2V A;  1NNV A;  3D3L A;  4IIA A;  5IEO A;  1STF I;  3PXM A;  3EJV A;  1N9J A;  3FG3 A;  1I0V A;  1Q7H A;  2GEY A;  2GBX B;  1KSI A;  1RSN A;  1FUT A;  3A5E A;  1CEW I;  2HMM B;  2OOV C;  4BU4 A;  5AYS C;  3T0U A;  3HIG A;  3X40 A;  1HYF A;  1GOU A;  3S27 A;  7STD A;  3HOH A;  4PEJ A;  3WMD A;  1VQ5 3;  4I4K A;  1BIR A;  1O7M B;  1T2I A;  4WP5 A;  1VQP 3;  3BIR A;  3BNE A;  1A2P A;  1MNL A;  2CWV A;  2IUK A;  3L0R A;  4ILF A;  1GSP A;  4BL3 A;  4K1V A;  2HMJ B;  4CJN A;  1B3S A;  1TP6 A; 
#chains in the Genus database with same CATH homology
 1IV7 A;  2RSX A;  4GB5 A;  4EC6 A;  1QVG 2;  3NQY A;  4HM3 B;  4WWU C;  1O7W B;  2MC8 A;  4N6U A;  4CDL A;  1OHP A;  5KP4 A;  1WQL B;  2CW9 A;  1O7N B;  1QJG A;  3E99 A;  3NHX A;  1D6Z A;  1AVK A;  1PU4 A;  1ISK A;  2CIU A;  3CCJ 3;  2LQV A;  1W01 A;  1FGR A;  4L7K A;  1NB5 I;  3GZB A;  4FMD A;  1VQL 3;  3DY5 A;  3B7C A;  3BLZ A;  3N54 B;  4RNY A;  4WFO A;  4FCM A;  2CFD A;  3MKI A;  3V98 A;  3NV0 B;  4HBR A;  1U8C B;  5FW5 A;  1KC8 4;  2A15 A;  3FSD A;  1OAC A;  2ML5 A;  3LTD A;  3S5C A;  1K73 4;  1SPU A;  4OVM A;  4RNZ A;  3WA3 A;  5LC6 A;  1JNQ A;  3F7S A;  3QRD A;  1JN5 B;  4LEH A;  3CCV 3;  4XDV A;  4BTY A;  1DVD A;  2ML6 A;  1M1X B;  1VZZ A;  4H3U A;  4N6L A;  3SOA A;  1D6Y A;  5ELJ A;  4K61 A;  3B4P A;  2W9P A;  1JB5 A;  2RGQ A;  4KVH A;  1U5O A;  2P38 A;  3CCQ 3;  2BNG A;  2CHC A;  1Y4K A;  1DMM A;  1YHQ 3;  2CC3 A;  3EX9 A;  1Q81 4;  4QWT A;  4XBY A;  3WOD G;  2OOV A;  5AI1 A;  3FKA A;  3MSO A;  4LMI A;  4N6M A;  1US1 A;  2ZDJ A;  3EF8 A;  1YIT 3;  3G71 3;  4CCV A;  4BTX A;  1VQ8 3;  3IMA B;  4MMZ B;  5STD A;  4KFF A;  2XRX B;  2KRT A;  1ZO2 A;  3IPT A;  2XF3 A;  3HK4 A;  5AEU B;  1M9G A;  1AVL A;  1IU7 A;  1SIH A;  3NUV A;  1MOL A;  1Q86 4;  1N8R 4;  1LXE A;  3FF2 A;  3CMA 3;  1YGE A;  4O8S A;  1L5G B;  3EN1 B;  5D82 A;  2XEP A;  2E2T A;  3OXA A;  5AIH A;  4XDW A;  1DVC A;  1VQM 3;  2HMO B;  3GRD A;  1W4N A;  1J2B A;  4FMA A;  2CFL A;  1GD4 A;  3KSE D;  4MEI A;  1HKX A;  1UW1 A;  3FZW A;  1VQO 3;  1N5H A;  1TFK A;  2YFI B;  1W02 A;  2B1X B;  2WGQ A;  1N9E A;  2E2U A;  3JUN A;  2XR8 B;  1EA2 A;  2CFG A;  1TIJ A;  3BND A;  3HII A;  3MG1 A;  1JRQ A;  3PCR A;  3JUO A;  3OW2 2;  3QK9 A;  1JJ2 2;  2IMJ A;  3CCS 3;  3SED A;  2RCD A;  4N6N B;  3LOY A;  4N6T A;  1JB4 A;  5HGR A;  4K90 B;  1QMA A;  3GZR A;  4HKV B;  5EVH A;  2Y74 A;  3PS8 A;  4GL6 A;  2GEX A;  2XFT A;  2WGO A;  3DGM A;  5AYR B;  1EQK A;  4H61 A;  4RZM A;  2GBW B;  2R4I A;  2MF7 A;  1OGX A;  3CU3 A;  3S29 A;  4J8T A;  1E3R A;  3WOF B;  5IF6 A;  4MMY B;  4N3V A;  2CKF B;  2RFR A;  1QAK A;  2IUJ A;  3X42 A;  3EBT A;  2HMK B;  4AEQ A;  4EXR A;  3K0Z A;  2OQE A;  3LTC A;  1ASK A;  2QGU A;  3NM7 A;  2CFK A;  1OH0 A;  3FG1 A;  2BHM A;  3NBB A;  3JUP A;  3KSP A;  1ROA A;  5IG0 A;  3WDG B;  2F86 B;  3G6E 3;  2WOH A;  4HM5 B;  1TFO A;  1BUQ A;  1W6G A;  3CME 3;  2K0M A;  2GXF A;  3EN8 A;  1W2B 2;  3FLJ A;  3VF1 A;  3T8U A;  3N9H A;  1LNH A;  3DZL A;  1VQK 3;  1R4C A;  5LC7 A;  5AIG A;  3EE1 A;  1NWW A;  1QAL A;  3LYG A;  3OWU A;  3K9M C;  2CFW A;  3K7C A;  2BMO B;  5KP1 A;  2Z77 A;  4XBT A;  4G1M B;  1UI8 A;  3KFQ C;  1S5A A;  3WA2 X;  2Z7A A;  1HU9 A;  3EBY A;  3K63 A;  4HVN A;  3MHE A;  1N8Q A;  3KZT A;  1WNH A;  5CK6 A;  3EC9 A;  4WYK A;  1KQS 2;  5D83 A;  4HM1 B;  2BMQ B;  2P0M A;  4X2H A;  4NRE A;  4XBX A;  4IPB A;  4JF8 A;  2GU3 A;  4HM8 B;  3VGN A;  1JV2 B;  1OUN A;  4EYC A;  2W6J H;  3X41 A;  3RGR A;  3S28 A;  1C7H A;  1Q40 A;  4NHF A;  1Q7Y 4;  1RRL A;  1NO3 A;  5IG4 A;  2F98 A;  3UNL A;  1UI7 A;  3ER7 A;  1A90 A;  3TDG A;  2W0Q A;  3EQQ B;  3SX1 A;  1OF5 B;  2XSH B;  1LOX A;  2BMR B;  1IQX A;  3A76 A;  3PCS A;  3FGY A;  1OF5 A;  4ZM8 A;  4LZI A;  3Q90 A;  4OK0 A;  3DGN A;  1DMQ A;  1GD3 A;  4HM7 B;  1D6U A;  3G4S 3;  3OV4 A;  4L8P A;  5JBS A;  3FCS B;  2CWU A;  2CG1 A;  2V1L A;  4Q53 A;  3WOE B;  2OTJ 3;  2B24 B;  3CD6 3;  1WMO A;  1O7H B;  1ULJ B;  1M1K 4;  1IVU A;  3MYT A;  1ROV A;  3CNM A;  3LH4 A;  2BO9 B;  4WHA A;  3X3X A;  5ELU A;  2YFJ B;  1FGT A;  1TU5 A;  1EKM A;  1UUV B;  3F7X A;  4R9K A;  5DRV A;  1YJN 3;  1ZX2 A;  2E2V A;  2D1W A;  3EHC A;  2Z6B A;  1W00 A;  4O02 B;  4FR9 A;  2QA4 3;  4HYZ A;  1V74 A;  1AR0 A;  3GZY B;  3O8Y A;  1NDO B;  3T8N A;  5BVB A;  3LXU X;  3NM2 A;  4MJD A;  4HZB B;  3FH1 A;  1VQ7 3;  4K1U A;  2PZV A;  2L4V A;  3F40 A;  3NX0 A;  3CC7 3;  4JRF A;  2FGT A;  2QEX 3;  2KXG A;  1M90 4;  3KE7 A;  4TX4 A;  1IT7 A;  1W5Z A;  1RRH A;  1E3V A;  4J9A A;  3X3Y A;  3RGA A;  1FUW A;  3PGB A;  3OWS A;  5TGN A;  2D42 A;  3CCL 3;  4FMC A;  4ORL A;  4R4K A;  3CCM 3;  3ALA A;  4U13 A;  1LVN A;  1GS3 A;  3V99 A;  4EBG A;  3SXX A;  4AKZ A;  3CCU 3;  3OWY A;  4STD A;  3I55 3;  2P0X A;  4HJL B;  1KWI A;  1FGQ A;  3FG4 A;  2W9Q A;  3G16 A;  2I9W A;  2JDI H;  3H51 A;  5AII A;  3DGO A;  2W2C A;  1W6C A;  1EG9 B;  6STD A;  1OHS A;  4IT7 A;  2FNQ A;  3CXC 2;  1YIJ 3;  3DMC A;  3U1W A;  1IK3 A;  3SOY A;  4AKY A;  3LZA A;  3B8L A;  1JB2 A;  1VQ6 3;  2FXT A;  2QIY A;  2Y73 A;  2XFS A;  1VQ9 3;  1Q82 4;  1SJW A;  2M7O A;  2WO0 A;  2W04 A;  3NBR A;  3H3H A;  5CXO A;  2ZL8 A;  4KZ1 A;  1O7G B;  1SII A;  2IA7 A;  4EV5 A;  5A0O B;  2P09 A;  4L8O A;  3G0K A;  1DMN A;  1NU3 A;  2OTL 3;  2WOF A;  1Q40 B;  1QAF A;  4FMB A;  1K41 A;  1TUH A;  3JUM A;  3LT9 A;  3LTB A;  2SBL A;  2BT3 A;  5IEP A;  1W2Z A;  3CNX A;  1IVV A;  3HZP A;  1WMP A;  3UL6 A;  3GAX A;  3LTA A;  3GWR A;  3SLU A;  4HZ9 B;  1A67 A;  1W7C A;  2XSO B;  1RJO A;  1RKY A;  2CK3 H;  2Q07 A;  3UL5 A;  3CCR 3;  2STD A;  8CHO A;  1OGZ A;  3KKG A;  2GU1 A;  3NBJ A;  3NV0 A;  1PFP A;  5D81 A;  3J7Y d;  3K5T A;  3U97 A;  3NQZ A;  2C11 A;  3S67 A;  1VQ4 3;  1VQN 3;  5FGO A;  3PZW A;  2YFL B;  1GY6 A;  3I0Y A;  1UUW B;  4N6O B;  3MG3 A;  3F14 A;  3BNC A;  5IG5 A;  5G2G A;  3MG2 A;  1FGO A;  2P05 A;  3Q1C A;  3KII A;  3AMO B;  5DRE A;  4WYK B;  4LGQ A;  3NXJ A;  1YJW 3;  1E97 A;  3PYJ A;  3D9R A;  2O3O A;  3ROB A;  4OUQ A;  5JPU A;  2Z76 A;  2CH9 A;  5JPP A;  3CC2 3;  2XGN A;  3HI7 A;  1QVF 2;  3HX8 A;  5AEW B;  2XH9 A;  5KP3 A;  3OX9 A;  4HM2 B;  1S72 3;  4N6V 0;  2XGL A;  3CCE 3;  1NB3 I;  1OHO A;  1IQ8 A;  1OCV A;  3V92 A;  5IER A;  2W56 B;  1CQS A;  5CLK A;  1Q42 A;  2W56 A;  1A2K A;  1K8A 4;  3MWZ A;  1JN5 A;  3F9S A;  1JKG A;  3UB1 A;  2C10 A;  1Z1S A;  4R9L A;  2OQE C;  1FA3 A;  1KD1 4;  1FGM A;  1OPY A;  3UJM A;  3F8H A;  2YX9 A;  3N8B A;  3JUQ A;  5EEO A;  2W03 A;  1RN7 A;  1CYV A;  4FCJ A;  3Q2P A;  4HM6 B;  1IVW A;  1IT8 A;  3SVA A;  3CPO A;  3I56 3;  3X3Z A;  1NJI 4;  2JQ5 A;  1WMN A;  1YVB I;  2KCD A;  5CF1 A;  2CG0 A;  2OWP A;  3EB8 A;  4RBN A;  3VSY A;  2HMN B;  4LSO A;  1ULI B;  1GYB A;  4XB5 A;  3KN4 A;  3B4O A;  2CWT A;  3DXO A;  3IJE B;  1DYU A;  4HM4 B;  3LML A;  1YI2 3;  1K28 A;  1F8N A;  2OCT A;  2PNC A;  3CPW 2;  1IDP A;  2K54 A;  4KFE A;  2F99 A;  1K9M 4;  1W6Y A;  3RDE A;  4R80 A;  4O3V A;  5IW9 A;  5CF2 A;  3ECF A;  4O2H A;  3STD A;  1IQY A;  3DM8 A;  2O9U X;  5BXQ A;  5IG3 A;  3GZX B;  3FF0 A;  4EV2 A;  2LYX A;  3G8Z A;  5AIF A;  5IEN A;  1G96 A;  2INX A;  3DGL A;  1IVX A;  1O7P B;  1AV4 A;  1YJ9 3;  3MPH A;  4XM4 A;  1STD A;  2HML B;  3M8C A;  4HM0 B;  3CC4 3;  1SQW A;  4X2O A;  2UX0 A;  4FCZ A;  1CYU A;  3DUK A;  1GY7 A;  5EQL A;  1JKG B;  1N5P A;  1T5Y A;  3BNB A;  3LT8 A;  4KFD A;  5I97 A;  3F8X A;  1WTH A;  4MMX B;  3JVC A;  1GY5 A;  3AMO A;  4R1K A;  4BTW A;  3BB9 A;  1IV9 A;  1A2V A;  3D3L A;  4IIA A;  5IEO A;  1STF I;  3PXM A;  3EJV A;  1N9J A;  3FG3 A;  2GEY A;  2GBX B;  1KSI A;  1CEW I;  2HMM B;  2OOV C;  5AYS C;  3T0U A;  3HIG A;  3X40 A;  3S27 A;  1VQ5 3;  4PEJ A;  3WMD A;  4I4K A;  1O7M B;  1VQP 3;  4WP5 A;  3BNE A;  7STD A;  1MNL A;  2CWV A;  2IUK A;  3L0R A;  4K1V A;  2HMJ B;  1TP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...