5IW9A

Structure of bacteriophage t4 gp25, sheath polymerization initiator
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
NINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate wedge protein gp25
publication title Structure of the T4 baseplate and its function in triggering sheath contraction.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Viral protein
total genus 32
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04965 GPW_gp25 Gene 25-like lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iw9A00
2YX9A 2CG0A 3WA3A 3HIGA 2WO0A 3X40A 1QALA 3NQYA 3PGBA 1IVVA 1W4NA 2CFDA 2CFLA 3X42A 1LVNA 1A2VA 1D6YA 1W7CA 1IU7A 1EKMA 4EV2A 2CFKA 3SX1A 2OQEA 1QAFA 3X3YA 1KSIA 1QAKA 1AVLA 5IW9A 1W6CA 2OQEC 3HIIA 1IVXA 1WMOA 1SIIA 4KFFA 4EV5A 3X3ZA 4EXRA 1W6GA 2CFWA 2CG1A 4KFEA 1D6ZA 3X41A 2BT3A 3WA2X 1SPUA 1W5ZA 1W2ZA 1IQXA 3KIIA 2CFGA 2WOFA 2E2UA 3LOYA 3K5TA 2WOHA 1AVKA 3AMOB 3NBJA 1AV4A 2K0MA 1OACA 3ALAA 3KN4A 4KFDA 3T0UA 2OOVC 1WMPA 1UI8A 2CWUA 1US1A 4BTWA 2C10A 2E2VA 1D6UA 2WGQA 3N9HA 1N9EA 3MPHA 1WMNA 1UI7A 3SXXA 1PU4A 4BTXA 4BTYA 2C11A 3AMOA 1JRQA 1IVWA 2Y73A 3NQZA 3X3XA 1SIHA 1IVUA 2OOVA 3NBBA 2D1WA 2Y74A 2ZL8A 2IA7A 2CWVA 2PNCA 1RKYA 2W0QA 2E2TA 2GU3A 1DYUA 3HI7A 2CWTA 1TU5A 1IQYA 1RJOA
chains in the Genus database with same CATH superfamily
3UB1A 2KCDA 5IEPA 2HMMB 4R9LA 1BNSA 1GS3A 3SOYA 4CJNA 1OHSA 3DM8A 1ROAA 1F8NA 4MJDA 3X40A 1M9GA 2XRXB 3PGBA 4KZ1A 1NB3I 4G1MB 5D82A 5STDA 1VQM3 1W6YA 3AHWA 3U97A 1RGKA 1W01A 1LVNA 1Q864 3BNDA 4MMYB 4GL6A 3CC43 1W7CA 1OGZA 1JB2A 2CFKA 2GBWB 1UDII 4KVHA 1JKGA 3M8CA 4WYKB 3SX1A 1TRPA 5LC7A 4XM4A 1YJW3 3KCHA 2H0HA 3EF8A 3CCU3 1KSIA 5AIHA 2HMOB 1NJI4 3N54B 1QAKA 2KF3A 4FCZA 1AVLA 1U5OA 1UCLA 2HOHA 2XF3A 3E99A 1VQK3 3S27A 1JB5A 1C54A 3LT8A 1RN7A 1YGEA 4BIRA 1HKXA 2ZHXB 3JUMA 3PCRA 4JRFA 4NREA 3NBRA 1JBSA 1EA2A 1YI23 4KFEA 1IYYA 1D6ZA 2YFLB 3GRDA 1K9M4 2CHCA 5D83A 3BNBA 5AIIA 4EYCA 1S723 6RNTA 1W5ZA 2GEYA 1RN1A 3KKGA 4WYKA 1A2PA 3UL6A 1KQS2 1GYBA 1ISKA 3KE7A 2WOFA 1STDA 2W9PA 3NUVA 1KWIA 3NM7A 4ZM8A 1GOUA 3CPW2 3LZAA 3D5IA 1GMRA 1LRAA 2BO9B 2W04A 1BAOA 2C4BA 4JF8A 1GMPA 2XFTA 1ULIB 1N9JA 1B2SA 2R41A 4O3VA 2BU4A 3DGNA 2XH9A 4IIAA 4ORLA 3LMLA 3B7CA 1LNHA 3ZG0A 5AIFA 2R4IA 3RDEA 3STDA 1NB5I 3WR2A 4HM7B 1GY7A 2OOVC 4XBXA 1IV7A 3B8LA 1YJN3 1RDSA 1LOVA 1K28A 1US1A 3SVAA 3KFQC 1A90A 1QVG2 2UX0A 1G96A 3IMAB 3MPHA 4K1VA 1UI7A 1Q824 1PU4A 2O3OA 5AIGA 3Q90A 3J7Yd 3SEDA 2CX1A 1Q814 4BTYA 1JRQA 3NM2A 2FXTA 4K90B 4WWUC 3CC73 4AKZA 3CD63 3CC23 2LYXA 4L8OA 1BRKA 2OOVA 1CH0A 1LNIA 1T2HA 1TFOA 3LTDA 3MYTA 1K8A4 2D1WA 2Y74A 2F56A 1T5YA 2RFRA 3MWZA 2CWVA 3CPOA 2P0XA 2Z76A 3KZTA 4HM2B 3V98A 1Q7HA 1X1WA 1VQ63 2KAAA 1LOWA 1Q40B 3OWUA 3Q2PA 1JN5B 2P0MA 2QIYA 1BU4A 3MG3A 1K734 3QK9A 5RNTA 3HIGA 3WOFB 3I0YA 2GEXA 2SBLA 2Z77A 2WO0A 2YFJB 1QALA 3IPTA 1OHOA 3B4OA 1W4NA 3K0ZA 1QJGA 3ECFA 1FYSA 7RNTA 1I0VA 1YIT3 3K63A 3CCL3 3WDGB 1WQLB 1RGGA 1BVIA 3JUNA 2HMJB 1D6YA 1JBTA 3LYGA 1Q9EA 3S5CA 4N6OB 3G4S3 1Q7Y4 1JNQA 3EBTA 5JBSA 4FMAA 5M1AA 4MMXB 4L7KA 3FH1A 2OQEA 1N5PA 2KF4A 1UCJA 1BSDA 2KRTA 3X3YA 2Z6BA 4CPKA 4EBGA 1BANA 1NU3A 4HZ9B 1Q40A 2D42A 5IW9A 3D3LA 3D79A 3V92A 1JN5A 1VZZA 1RSNA 3S29A 2O9UX 3F14A 3VF1A 3I553 4R1KA 1MGWA 1SIIA 3F7XA 5IF6A 1O7HB 4EV5A 1AQZA 1DVCA 1BSCA 2Z7AA 1I0XA 5JPUA 1I2GA 1YNVX 3WODG 3I563 3AHSA 6GSPA 1M1XB 1RRHA 2IUKA 2W6JH 2F4YA 1B2UA 2KF5A 2IUJA 1UUGB 3FF2A 3G713 3X41A 2IY2A 2L4VA 1GY6A 3UJMA 1SPUA 1KC84 4HJLB 1RN4A 1BNEA 1ZGXA 3NXJA 2B24B 2CFGA 1JV2B 2PZVA 2V1LA 3ZG5A 3DGYA 3EQQB 1UUWB 4K61A 3K5TA 1HU9A 1UCIA 5BIRA 1UGHI 3UNLA 1E3VA 3F9SA 4HAAA 1GY5A 5CF2A 2UUGC 3OW22 2J8XB 5G1LA 2LQVA 2K0MA 2QA43 3RGAA 3B4PA 5G2GA 3RNTA 1RGFA 3CCQ3 1MWSA 4KFDA 1QVF2 4LGQA 2XSOB 3BB9A 3H3HA 3T0UA 1T2IA 1Q42A 1N8QA 1QMAA 3BNEA 3MKIA 1X1UA 1UCKA 2C10A 2GBXB 1O7MB 4FCJA 3LH4A 1DMQA 3KSED 3O8YA 1AR0A 1BSBA 3EE1A 1N9EA 4QWTA 1V74A 4XBTA 4LMIA 1DMMA 2XSHB 2BMQB 2BNGA 3PYJA 3SXXA 2BMRB 4BTXA 3MG2A 3BU4A 2C11A 5AEWB 1BIRA 1RRLA 2ZDJA 1IVWA 4AKYA 1BUQA 4LZIA 5AYSC 5IEOA 1IVUA 1Y4KA 5AYRB 1CYUA 3K7CA 3MG1A 5IG4A 3SLUA 5JPPA 4BL2A 2ZL8A 3OXAA 2AAEA 3DH2A 1RGCA 2E2TA 1V57A 3LXUX 4IPBA 3OWSA 1DYUA 3PS8A 2F5WA 1BNGA 1IQYA 1SQWA 4ILFA 2YX9A 3H51A 1BGSA 2JQ5A 5CXOA 3WA3A 3SYUA 1NO3A 3FGYA 2F86B 1SARA 2JDIH 5FW5A 1MNLA 2HMNB 4EC6A 1HZ1A 1I70A 1YVBI 2QGUA 3CCJ3 3G0KA 1ZS7A 2CFDA 3F7SA 1OHPA 1VQ93 1ROVA 1TTOA 3X42A 1NDOB 1B2MA 2K54A 4Q53A 1GD3A 3GZRA 2CC3A 1S5AA 2BIRA 1TIJA 1A2VA 3FG4A 3JUOA 1IV9A 4FR9A 4L8PA 4R4KA 3VGNA 2BMOB 1IU7A 1I2FA 3OWYA 1CYVA 4EV2A 5AEUB 3EJVA 7STDA 5HGRA 1B27A 1BSAA 2RCDA 1QAFA 1LOXA 1O7GB 1RGEA 2FNQA 2W2CA 1V58A 4N3VA 1YJ93 3L0RA 4U13A 3WMDA 4EW5A 3PZWA 1W6CA 1BNRA 1W02A 1OCVA 2OQEC 1FGOA 1RCKA 3MSOA 3NV0B 4NHFA 2P05A 3GWRA 3HIIA 1J2BA 1FGTA 2STDA 3FSDA 5D81A 4H3UA 1BUJA 1VQ83 1BSEA 1N8R4 1DE3A 1R4YA 4HYZA 3MHEA 4N6NB 4KFFA 2UGIA 3DY5A 3FZWA 4MMZB 4PEJA 3CU3A 3CCM3 3OX9A 3CCS3 1EQKA 1A67A 2F98A 1U8CB 3HZPA 1JZOA 2CX0A 1PY3A 1MWUA 1FA3A 1YGWA 2BT3A 1RMSA 1DETA 3WA2X 3DUKA 2HMLB 1VQP3 1FGRA 5G1KA 3CXC2 1FGQA 1JBRA 1W2ZA 1IQXA 2XEPA 1ZX2A 3K9MC 1WTHA 1L5GB 3IJEB 1M904 3DXOA 1LXEA 1Z1SA 2AADA 2YFIB 5CLKA 1MWTA 1OGXA 3N8BA 1FW7A 1UGIA 1YVSA 3CNXA 2W56B 3VSYA 3DGOA 1JZDA 1RCLA 1I8VA 1CQSA 2RGQA 3AMOB 3Q3FA 1STFI 2WGOA 4HM1B 2RBIA 4HZBB 4LSOA 5CF1A 3CME3 3GZXB 1FUWA 5LC6A 2M7OA 1AV4A 3DMCA 1X1XA 4XBYA 1K41A 1OACA 3FCSB 1FZUA 3GSPA 3G16A 1O7PB 2XR8B 4HBRA 2CW9A 1JKGB 5ELUA 1AY7A 1BRJA 1VQQA 2BHMA 3TDGA 3U1WA 1ZO2A 1GD4A 1UI8A 4GSPA 5AI1A 5M19A 2GU1A 2L1SA 5KP3A 2H0GA 4NPBA 2KXGA 4BTWA 4IT7A 2E2VA 3DZLA 1VQ53 1RHLA 3FLJA 1B21A 1LOYA 1WMNA 2F99A 1EUIC 2P09A 3T8NA 3F8XA 2W56A 3CCR3 1BRSA 8CHOA 3ROBA 2RNTA 4GB5A 1GOYA 1MWRA 4K1UA 1A2KA 3AMOA 3WHOA 4BL3A 1VQ73 5FGOA 4DKIA 5BU4A 2OWPA 1UUVB 5IG0A 4GHOA 3NQZA 1SIHA 4XDWA 3CMA3 1GMQA 1IT7A 4HM5B 5HOHA 2IA7A 2PNCA 1JB4A 4LEHA 2RSXA 4N6MA 5ELJA 2GU3A 1OUNA 3RGRA 4FMBA 2GSPA 2HMKB 2CWTA 1BNIA 1RJOA 2GXFA 3NHXA 4J5KA 2CG0A 3EN1B 4OUQA 3G6E3 1MGRA 1B2ZA 3F40A 5DREA 4BU4A 1BRHA 3BIRA 5I97A 2FGTA 2QEX3 4O8SA 2CK3H 4J9AA 3HK4A 4N6UA 3NQYA 5EQLA 5TGNA 1OH0A 1W00A 5A0OB 1IVVA 1I3FA 1X1YA 3BNCA 2CFLA 7GSPA 1O7WB 3GZBA 3S28A 2CIUA 3URPA 1HYFA 1BRGA 2H0IA 5IG3A 5IENA 1RNBA 1EKMA 2ML6A 3CCV3 1ULJB 1G0TA 1RGHA 1BRNL 2IYJA 1WNHA 1B3SA 3D9RA 1VQN3 1EG9B 4OK0A 4N6LA 3V99A 3EB8A 1I3IA 1I2EA 1PYLA 3LT9A 5IERA 4RNTA 3CNMA 3JUQA 4R9KA 3PCSA 3QRDA 1VQO3 1O7NB 1R4CA 4XB5A 4HM3B 1IVXA 1MOLA 2CH9A 1WMOA 3WOEB 1SJWA 4KT3B 5KP1A 1YHQ3 3EX9A 3X3ZA 2B1XB 1LQMB 3FF0A 1W6GA 4EXRA 4RNZA 2XFSA 2CFWA 3FG1A 3D4AA 3G8ZA 1BNJA 2SARA 1BRIA 4LYLB 1OPYA 2CG1A 2OTJ3 4XDVA 3LTAA 4RBNA 5CK6A 3D5GA 4TX4A 1E3RA 2K3DA 1NNVA 3BLZA 4RZMA 2OTL3 3EC9A 1FUTA 1OF5B 4AEQA 1IDPA 1UW1A 3KIIA 3LTCA 5GSPA 2ML5A 4J5GA 4STDA 4WHAA 9RNTA 4HVNA 5DRVA 4HM0B 3HX8A 2OCTA 1RTUA 3ZFZA 1IQ8A 4WFOA 1IT8A 1VQ43 3GZYB 1TFKA 2E2UA 5BXQA 3LOYA 4HM8B 2WOHA 1KD14 3FKAA 4HM6B 1AVKA 1B2XA 4HM4B 3NBJA 3NX0A 4RNYA 3GAXA 2CKFB 6STDA 1T3BA 2W9QA 1C7HA 5EVHA 1TRQA 1JJ22 3AGNA 1DVDA 5KP4A 1E97A 2I9WA 3ALAA 3EHCA 3KN4A 3PXMA 4H61A 1RNTA 4I4KA 3T8UA 2P38A 3A76A 1TP6A 1BOXA 1NWWA 3AGOA 1LQGC 2CWUA 1CEWI 3A5EA 3DGLA 3EBYA 4N6TA 1ASKA 4OVMA 8RNTA 1RGLA 1OF5A 1N5HA 4HKVB 3FG3A 3HOHA 3Q1CA 5M18A 3JVCA 4CDLA 2ZA4A 3LTBA 3UL5A 1B20A 1D6UA 2WGQA 3N9HA 5IG5A 1YIJ3 3S67A 1W2B2 2A15A 5BVBA 3ER7A 4O02B 1FGMA 1BNFA 2Q07A 1FUSA 2XGNA 3NV0A 1IK3A 3CCE3 3EN8A 4X2OA 1TUHA 4CCVA 2F5MA 1VQL3 2KF6A 3F8HA 1DMNA 4J8TA 2XGLA 2Y73A 3JUPA 2W03A 3OV4A 1GSPA 4HOHA 3X3XA 1G02A 4O2HA 2MF7A 3KSPA 1GOVA 3NBBA 3SOAA 2INXA 4N6V0 1RKYA 2W0QA 2IMJA 5EEOA 4FMCA 4FMDA 4MEIA 4X2HA 4I5QA 1M1K4 4WP5A 4R80A 1EEJA 1RLSA 3DGMA 1PFPA 3HI7A 2MC8A 1WMPA 1TU5A 1RGAA 1TJDA 4FCMA
chains in the Genus database with same CATH topology
3UB1A 2KCDA 5IEPA 2HMMB 4R9LA 1GS3A 3SOYA 1OHSA 3DM8A 1ROAA 1F8NA 4MJDA 3X40A 1M9GA 2XRXB 3PGBA 4KZ1A 1NB3I 4G1MB 5D82A 5STDA 1VQM3 1W6YA 3U97A 1W01A 1Q864 1LVNA 3CC43 3BNDA 4MMYB 4GL6A 1W7CA 1OGZA 1JB2A 2CFKA 2GBWB 4KVHA 1JKGA 3M8CA 4WYKB 3SX1A 5LC7A 4XM4A 1YJW3 3CCU3 3EF8A 1KSIA 5AIHA 2HMOB 1NJI4 3N54B 1QAKA 4FCZA 1AVLA 1U5OA 2XF3A 3E99A 1VQK3 3S27A 1JB5A 3LT8A 1RN7A 1YGEA 1HKXA 3JUMA 3PCRA 4JRFA 4NREA 3NBRA 1EA2A 1YI23 4KFEA 1D6ZA 2YFLB 3GRDA 1K9M4 2CHCA 5D83A 3BNBA 5AIIA 4EYCA 1S723 1W5ZA 2GEYA 3KKGA 4WYKA 3UL6A 1KQS2 1GYBA 1ISKA 3KE7A 2WOFA 1STDA 2W9PA 3NUVA 1KWIA 3NM7A 4ZM8A 3CPW2 3LZAA 2BO9B 2W04A 4JF8A 2XFTA 1ULIB 1N9JA 4O3VA 3DGNA 2XH9A 4IIAA 4ORLA 3LMLA 3B7CA 1LNHA 5AIFA 2R4IA 3RDEA 3STDA 1NB5I 4HM7B 1GY7A 2OOVC 4XBXA 1IV7A 3B8LA 1YJN3 1K28A 1US1A 3SVAA 3KFQC 1A90A 1QVG2 2UX0A 1G96A 3IMAB 3MPHA 4K1VA 1UI7A 1Q824 1PU4A 2O3OA 5AIGA 3Q90A 3J7Yd 3SEDA 1Q814 4BTYA 1JRQA 3NM2A 2FXTA 4K90B 4WWUC 3CC73 4AKZA 3CD63 3CC23 2LYXA 4L8OA 2OOVA 1TFOA 3LTDA 3MYTA 1K8A4 2D1WA 2Y74A 1T5YA 2RFRA 3MWZA 2CWVA 3CPOA 2P0XA 2Z76A 3KZTA 4HM2B 3V98A 1VQ63 3Q2PA 1Q40B 3OWUA 1JN5B 2QIYA 2P0MA 1K734 3MG3A 3QK9A 3HIGA 3WOFB 3I0YA 2GEXA 2SBLA 2Z77A 2WO0A 2YFJB 1QALA 3IPTA 1OHOA 3B4OA 1W4NA 3K0ZA 1QJGA 3ECFA 1YIT3 3K63A 3CCL3 3WDGB 1WQLB 3JUNA 2HMJB 1D6YA 3LYGA 3S5CA 4N6OB 3G4S3 1Q7Y4 1JNQA 3EBTA 5JBSA 4FMAA 4MMXB 4L7KA 3FH1A 2OQEA 1N5PA 2KRTA 3X3YA 2Z6BA 4EBGA 1NU3A 4HZ9B 1Q40A 2D42A 5IW9A 3D3LA 3V92A 1JN5A 1VZZA 3S29A 2O9UX 3F14A 3VF1A 3I553 4R1KA 1SIIA 3F7XA 5IF6A 1O7HB 4EV5A 1DVCA 2Z7AA 5JPUA 3I563 3WODG 1M1XB 1RRHA 2IUKA 2W6JH 2IUJA 3FF2A 3G713 3X41A 2L4VA 1GY6A 3UJMA 1SPUA 1KC84 4HJLB 3NXJA 2B24B 2CFGA 1JV2B 2PZVA 2V1LA 3EQQB 1UUWB 4K61A 3K5TA 1HU9A 3UNLA 1E3VA 3F9SA 1GY5A 5CF2A 3OW22 2LQVA 2K0MA 2QA43 3RGAA 3B4PA 5G2GA 3CCQ3 4KFDA 1QVF2 4LGQA 2XSOB 3BB9A 3H3HA 3T0UA 1Q42A 1N8QA 1QMAA 3BNEA 3MKIA 2C10A 2GBXB 1O7MB 4FCJA 3LH4A 1DMQA 3KSED 3O8YA 1AR0A 3EE1A 1N9EA 4QWTA 1V74A 4XBTA 4LMIA 1DMMA 2XSHB 2BMQB 2BNGA 3PYJA 3SXXA 2BMRB 4BTXA 3MG2A 2C11A 5AEWB 1RRLA 2ZDJA 1IVWA 4AKYA 1BUQA 4LZIA 5AYSC 5IEOA 1IVUA 1Y4KA 5AYRB 1CYUA 3K7CA 3MG1A 5IG4A 3SLUA 5JPPA 2ZL8A 3OXAA 2E2TA 3LXUX 4IPBA 3OWSA 1DYUA 3PS8A 1IQYA 1SQWA 2YX9A 3H51A 2JQ5A 5CXOA 3WA3A 1NO3A 3FGYA 2F86B 2JDIH 5FW5A 1MNLA 2HMNB 4EC6A 1YVBI 3CCJ3 2QGUA 3G0KA 2CFDA 3F7SA 1OHPA 1VQ93 1ROVA 3X42A 1NDOB 2K54A 4Q53A 1GD3A 3GZRA 2CC3A 1S5AA 4FR9A 1TIJA 1A2VA 3FG4A 3JUOA 1IV9A 4L8PA 4R4KA 1L5GB 3VGNA 2BMOB 1IU7A 3OWYA 1CYVA 4EV2A 5AEUB 3EJVA 7STDA 5HGRA 2RCDA 1QAFA 1LOXA 1O7GB 2FNQA 2W2CA 4N3VA 1YJ93 3L0RA 4U13A 3WMDA 3PZWA 1W6CA 1W02A 1OCVA 2OQEC 1FGOA 3MSOA 3NV0B 4NHFA 2P05A 3GWRA 3HIIA 1J2BA 1FGTA 2STDA 3FSDA 5D81A 4H3UA 1VQ83 1N8R4 4HYZA 3MHEA 4N6NB 4KFFA 3DY5A 3FZWA 4MMZB 4PEJA 3CCM3 3CU3A 3CCS3 3OX9A 1EQKA 1A67A 2F98A 1U8CB 3HZPA 1FA3A 2BT3A 3WA2X 3DUKA 2HMLB 1VQP3 1FGRA 3CXC2 1FGQA 1W2ZA 1IQXA 2XEPA 1ZX2A 3K9MC 1WTHA 1M904 3IJEB 3DXOA 1LXEA 1Z1SA 2YFIB 5CLKA 1OGXA 3N8BA 3CNXA 3VSYA 2W56B 3DGOA 2RGQA 1CQSA 3AMOB 4HM1B 1STFI 2WGOA 4HZBB 4LSOA 5CF1A 3CME3 3GZXB 1FUWA 5LC6A 2M7OA 1AV4A 3DMCA 4XBYA 1K41A 1OACA 3FCSB 3G16A 1O7PB 2XR8B 4HBRA 2CW9A 1JKGB 5ELUA 3U1WA 2BHMA 3TDGA 1ZO2A 1GD4A 1UI8A 5AI1A 2GU1A 5KP3A 4BTWA 2KXGA 4IT7A 2E2VA 3DZLA 1VQ53 3FLJA 1WMNA 2F99A 2P09A 3T8NA 3F8XA 2W56A 3CCR3 8CHOA 3ROBA 4GB5A 1VQ73 4K1UA 1A2KA 3AMOA 5FGOA 2OWPA 1UUVB 5IG0A 3NQZA 1SIHA 4XDWA 3CMA3 1IT7A 4HM5B 2IA7A 2PNCA 1JB4A 4LEHA 2RSXA 4N6MA 5ELJA 2GU3A 1OUNA 3RGRA 4FMBA 2HMKB 2CWTA 3NHXA 1RJOA 2GXFA 2CG0A 3EN1B 4OUQA 3G6E3 5DREA 3F40A 5I97A 2FGTA 2QEX3 4O8SA 2CK3H 4J9AA 3HK4A 4N6UA 3NQYA 5EQLA 5TGNA 1OH0A 1W00A 5A0OB 1IVVA 3BNCA 2CFLA 1O7WB 3GZBA 3S28A 2CIUA 5IENA 5IG3A 1EKMA 2ML6A 3CCV3 1ULJB 1WNHA 1VQN3 3D9RA 1EG9B 4OK0A 4N6LA 3V99A 3EB8A 3LT9A 5IERA 3CNMA 3JUQA 4R9KA 3PCSA 3QRDA 1VQO3 1O7NB 1R4CA 4XB5A 4HM3B 1IVXA 1MOLA 2CH9A 1WMOA 3WOEB 1SJWA 5KP1A 1YHQ3 3EX9A 3X3ZA 2B1XB 3FF0A 4EXRA 1W6GA 4RNZA 2XFSA 2CFWA 3FG1A 3G8ZA 2OTJ3 2CG1A 1OPYA 4XDVA 3LTAA 4RBNA 5CK6A 4TX4A 1E3RA 3BLZA 4RZMA 2OTL3 3EC9A 1OF5B 4AEQA 1IDPA 1UW1A 3KIIA 3LTCA 2ML5A 4STDA 4WHAA 4HVNA 5DRVA 4HM0B 3HX8A 2OCTA 1IQ8A 4WFOA 1IT8A 1VQ43 3GZYB 1TFKA 2E2UA 5BXQA 3LOYA 4HM8B 2WOHA 1KD14 3FKAA 4HM6B 1AVKA 4HM4B 3NBJA 3NX0A 4RNYA 3GAXA 2CKFB 6STDA 5EVHA 2W9QA 1C7HA 1JJ22 1DVDA 5KP4A 1E97A 2I9WA 3ALAA 3EHCA 3KN4A 3PXMA 4H61A 4I4KA 3T8UA 2P38A 3A76A 1TP6A 1NWWA 2CWUA 1CEWI 3DGLA 3EBYA 4OVMA 4N6TA 1ASKA 1OF5A 1N5HA 4HKVB 3FG3A 3Q1CA 3JVCA 4CDLA 3LTBA 3UL5A 1D6UA 2WGQA 3N9HA 5IG5A 1YIJ3 3S67A 1W2B2 2A15A 5BVBA 3ER7A 4O02B 1FGMA 2Q07A 2XGNA 3NV0A 1IK3A 3CCE3 3EN8A 4X2OA 1TUHA 4CCVA 1VQL3 3F8HA 1DMNA 4J8TA 2XGLA 2Y73A 3JUPA 2W03A 3OV4A 3X3XA 4O2HA 2MF7A 3KSPA 3NBBA 3SOAA 2INXA 4N6V0 1RKYA 2W0QA 2IMJA 5EEOA 4FMCA 4FMDA 4MEIA 4X2HA 1M1K4 4WP5A 4R80A 3DGMA 1PFPA 3HI7A 2MC8A 1WMPA 1TU5A 4FCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX9 A;  2CG0 A;  3WA3 A;  3HIG A;  2WO0 A;  3X40 A;  1QAL A;  3NQY A;  3PGB A;  1IVV A;  1W4N A;  2CFD A;  2CFL A;  3X42 A;  1LVN A;  1A2V A;  1D6Y A;  1W7C A;  1IU7 A;  1EKM A;  4EV2 A;  2CFK A;  3SX1 A;  2OQE A;  1QAF A;  3X3Y A;  1KSI A;  1QAK A;  1AVL A;  5IW9 A;  1W6C A;  2OQE C;  3HII A;  1IVX A;  1WMO A;  1SII A;  4KFF A;  4EV5 A;  3X3Z A;  4EXR A;  1W6G A;  2CFW A;  2CG1 A;  4KFE A;  1D6Z A;  3X41 A;  2BT3 A;  3WA2 X;  1SPU A;  1W5Z A;  1W2Z A;  1IQX A;  3KII A;  2CFG A;  2WOF A;  2E2U A;  3LOY A;  3K5T A;  2WOH A;  1AVK A;  3AMO B;  3NBJ A;  1AV4 A;  2K0M A;  1OAC A;  3ALA A;  3KN4 A;  4KFD A;  3T0U A;  2OOV C;  1WMP A;  1UI8 A;  2CWU A;  1US1 A;  4BTW A;  2C10 A;  2E2V A;  1D6U A;  2WGQ A;  3N9H A;  1N9E A;  3MPH A;  1WMN A;  1UI7 A;  3SXX A;  1PU4 A;  4BTX A;  4BTY A;  2C11 A;  3AMO A;  1JRQ A;  1IVW A;  2Y73 A;  3NQZ A;  3X3X A;  1SIH A;  1IVU A;  2OOV A;  3NBB A;  2D1W A;  2Y74 A;  2ZL8 A;  2IA7 A;  2CWV A;  2PNC A;  1RKY A;  2W0Q A;  2E2T A;  2GU3 A;  1DYU A;  3HI7 A;  2CWT A;  1TU5 A;  1IQY A;  1RJO A; 
#chains in the Genus database with same CATH topology
 3UB1 A;  2KCD A;  5IEP A;  2HMM B;  4R9L A;  1BNS A;  1GS3 A;  3SOY A;  4CJN A;  1OHS A;  3DM8 A;  1ROA A;  1F8N A;  4MJD A;  3X40 A;  1M9G A;  2XRX B;  3PGB A;  4KZ1 A;  1NB3 I;  4G1M B;  5D82 A;  5STD A;  1VQM 3;  1W6Y A;  3AHW A;  3U97 A;  1RGK A;  1W01 A;  1LVN A;  1Q86 4;  3BND A;  4MMY B;  4GL6 A;  3CC4 3;  1W7C A;  1OGZ A;  1JB2 A;  2CFK A;  2GBW B;  1UDI I;  4KVH A;  1JKG A;  3M8C A;  4WYK B;  3SX1 A;  1TRP A;  5LC7 A;  4XM4 A;  1YJW 3;  3KCH A;  2H0H A;  3EF8 A;  3CCU 3;  1KSI A;  5AIH A;  2HMO B;  1NJI 4;  3N54 B;  1QAK A;  2KF3 A;  4FCZ A;  1AVL A;  1U5O A;  1UCL A;  2HOH A;  2XF3 A;  3E99 A;  1VQK 3;  3S27 A;  1JB5 A;  1C54 A;  3LT8 A;  1RN7 A;  1YGE A;  4BIR A;  1HKX A;  2ZHX B;  3JUM A;  3PCR A;  4JRF A;  4NRE A;  3NBR A;  1JBS A;  1EA2 A;  1YI2 3;  4KFE A;  1IYY A;  1D6Z A;  2YFL B;  3GRD A;  1K9M 4;  2CHC A;  5D83 A;  3BNB A;  5AII A;  4EYC A;  1S72 3;  6RNT A;  1W5Z A;  2GEY A;  1RN1 A;  3KKG A;  4WYK A;  1A2P A;  3UL6 A;  1KQS 2;  1GYB A;  1ISK A;  3KE7 A;  2WOF A;  1STD A;  2W9P A;  3NUV A;  1KWI A;  3NM7 A;  4ZM8 A;  1GOU A;  3CPW 2;  3LZA A;  3D5I A;  1GMR A;  1LRA A;  2BO9 B;  2W04 A;  1BAO A;  2C4B A;  4JF8 A;  1GMP A;  2XFT A;  1ULI B;  1N9J A;  1B2S A;  2R41 A;  4O3V A;  2BU4 A;  3DGN A;  2XH9 A;  4IIA A;  4ORL A;  3LML A;  3B7C A;  1LNH A;  3ZG0 A;  5AIF A;  2R4I A;  3RDE A;  3STD A;  1NB5 I;  3WR2 A;  4HM7 B;  1GY7 A;  2OOV C;  4XBX A;  1IV7 A;  3B8L A;  1YJN 3;  1RDS A;  1LOV A;  1K28 A;  1US1 A;  3SVA A;  3KFQ C;  1A90 A;  1QVG 2;  2UX0 A;  1G96 A;  3IMA B;  3MPH A;  4K1V A;  1UI7 A;  1Q82 4;  1PU4 A;  2O3O A;  5AIG A;  3Q90 A;  3J7Y d;  3SED A;  2CX1 A;  1Q81 4;  4BTY A;  1JRQ A;  3NM2 A;  2FXT A;  4K90 B;  4WWU C;  3CC7 3;  4AKZ A;  3CD6 3;  3CC2 3;  2LYX A;  4L8O A;  1BRK A;  2OOV A;  1CH0 A;  1LNI A;  1T2H A;  1TFO A;  3LTD A;  3MYT A;  1K8A 4;  2D1W A;  2Y74 A;  2F56 A;  1T5Y A;  2RFR A;  3MWZ A;  2CWV A;  3CPO A;  2P0X A;  2Z76 A;  3KZT A;  4HM2 B;  3V98 A;  1Q7H A;  1X1W A;  1VQ6 3;  2KAA A;  1LOW A;  1Q40 B;  3OWU A;  3Q2P A;  1JN5 B;  2P0M A;  2QIY A;  1BU4 A;  3MG3 A;  1K73 4;  3QK9 A;  5RNT A;  3HIG A;  3WOF B;  3I0Y A;  2GEX A;  2SBL A;  2Z77 A;  2WO0 A;  2YFJ B;  1QAL A;  3IPT A;  1OHO A;  3B4O A;  1W4N A;  3K0Z A;  1QJG A;  3ECF A;  1FYS A;  7RNT A;  1I0V A;  1YIT 3;  3K63 A;  3CCL 3;  3WDG B;  1WQL B;  1RGG A;  1BVI A;  3JUN A;  2HMJ B;  1D6Y A;  1JBT A;  3LYG A;  1Q9E A;  3S5C A;  4N6O B;  3G4S 3;  1Q7Y 4;  1JNQ A;  3EBT A;  5JBS A;  4FMA A;  5M1A A;  4MMX B;  4L7K A;  3FH1 A;  2OQE A;  1N5P A;  2KF4 A;  1UCJ A;  1BSD A;  2KRT A;  3X3Y A;  2Z6B A;  4CPK A;  4EBG A;  1BAN A;  1NU3 A;  4HZ9 B;  1Q40 A;  2D42 A;  5IW9 A;  3D3L A;  3D79 A;  3V92 A;  1JN5 A;  1VZZ A;  1RSN A;  3S29 A;  2O9U X;  3F14 A;  3VF1 A;  3I55 3;  4R1K A;  1MGW A;  1SII A;  3F7X A;  5IF6 A;  1O7H B;  4EV5 A;  1AQZ A;  1DVC A;  1BSC A;  2Z7A A;  1I0X A;  5JPU A;  1I2G A;  1YNV X;  3WOD G;  3I56 3;  3AHS A;  6GSP A;  1M1X B;  1RRH A;  2IUK A;  2W6J H;  2F4Y A;  1B2U A;  2KF5 A;  2IUJ A;  1UUG B;  3FF2 A;  3G71 3;  3X41 A;  2IY2 A;  2L4V A;  1GY6 A;  3UJM A;  1SPU A;  1KC8 4;  4HJL B;  1RN4 A;  1BNE A;  1ZGX A;  3NXJ A;  2B24 B;  2CFG A;  1JV2 B;  2PZV A;  2V1L A;  3ZG5 A;  3DGY A;  3EQQ B;  1UUW B;  4K61 A;  3K5T A;  1HU9 A;  1UCI A;  5BIR A;  1UGH I;  3UNL A;  1E3V A;  3F9S A;  4HAA A;  1GY5 A;  5CF2 A;  2UUG C;  3OW2 2;  2J8X B;  5G1L A;  2LQV A;  2K0M A;  2QA4 3;  3RGA A;  3B4P A;  5G2G A;  3RNT A;  1RGF A;  3CCQ 3;  1MWS A;  4KFD A;  1QVF 2;  4LGQ A;  2XSO B;  3BB9 A;  3H3H A;  3T0U A;  1T2I A;  1Q42 A;  1N8Q A;  1QMA A;  3BNE A;  3MKI A;  1X1U A;  1UCK A;  2C10 A;  2GBX B;  1O7M B;  4FCJ A;  3LH4 A;  1DMQ A;  3KSE D;  3O8Y A;  1AR0 A;  1BSB A;  3EE1 A;  1N9E A;  4QWT A;  1V74 A;  4XBT A;  4LMI A;  1DMM A;  2XSH B;  2BMQ B;  2BNG A;  3PYJ A;  3SXX A;  2BMR B;  4BTX A;  3MG2 A;  3BU4 A;  2C11 A;  5AEW B;  1BIR A;  1RRL A;  2ZDJ A;  1IVW A;  4AKY A;  1BUQ A;  4LZI A;  5AYS C;  5IEO A;  1IVU A;  1Y4K A;  5AYR B;  1CYU A;  3K7C A;  3MG1 A;  5IG4 A;  3SLU A;  5JPP A;  4BL2 A;  2ZL8 A;  3OXA A;  2AAE A;  3DH2 A;  1RGC A;  2E2T A;  1V57 A;  3LXU X;  4IPB A;  3OWS A;  1DYU A;  3PS8 A;  2F5W A;  1BNG A;  1IQY A;  1SQW A;  4ILF A;  2YX9 A;  3H51 A;  1BGS A;  2JQ5 A;  5CXO A;  3WA3 A;  3SYU A;  1NO3 A;  3FGY A;  2F86 B;  1SAR A;  2JDI H;  5FW5 A;  1MNL A;  2HMN B;  4EC6 A;  1HZ1 A;  1I70 A;  1YVB I;  2QGU A;  3CCJ 3;  3G0K A;  1ZS7 A;  2CFD A;  3F7S A;  1OHP A;  1VQ9 3;  1ROV A;  1TTO A;  3X42 A;  1NDO B;  1B2M A;  2K54 A;  4Q53 A;  1GD3 A;  3GZR A;  2CC3 A;  1S5A A;  2BIR A;  1TIJ A;  1A2V A;  3FG4 A;  3JUO A;  1IV9 A;  4FR9 A;  4L8P A;  4R4K A;  3VGN A;  2BMO B;  1IU7 A;  1I2F A;  3OWY A;  1CYV A;  4EV2 A;  5AEU B;  3EJV A;  7STD A;  5HGR A;  1B27 A;  1BSA A;  2RCD A;  1QAF A;  1LOX A;  1O7G B;  1RGE A;  2FNQ A;  2W2C A;  1V58 A;  4N3V A;  1YJ9 3;  3L0R A;  4U13 A;  3WMD A;  4EW5 A;  3PZW A;  1W6C A;  1BNR A;  1W02 A;  1OCV A;  2OQE C;  1FGO A;  1RCK A;  3MSO A;  3NV0 B;  4NHF A;  2P05 A;  3GWR A;  3HII A;  1J2B A;  1FGT A;  2STD A;  3FSD A;  5D81 A;  4H3U A;  1BUJ A;  1VQ8 3;  1BSE A;  1N8R 4;  1DE3 A;  1R4Y A;  4HYZ A;  3MHE A;  4N6N B;  4KFF A;  2UGI A;  3DY5 A;  3FZW A;  4MMZ B;  4PEJ A;  3CU3 A;  3CCM 3;  3OX9 A;  3CCS 3;  1EQK A;  1A67 A;  2F98 A;  1U8C B;  3HZP A;  1JZO A;  2CX0 A;  1PY3 A;  1MWU A;  1FA3 A;  1YGW A;  2BT3 A;  1RMS A;  1DET A;  3WA2 X;  3DUK A;  2HML B;  1VQP 3;  1FGR A;  5G1K A;  3CXC 2;  1FGQ A;  1JBR A;  1W2Z A;  1IQX A;  2XEP A;  1ZX2 A;  3K9M C;  1WTH A;  1L5G B;  3IJE B;  1M90 4;  3DXO A;  1LXE A;  1Z1S A;  2AAD A;  2YFI B;  5CLK A;  1MWT A;  1OGX A;  3N8B A;  1FW7 A;  1UGI A;  1YVS A;  3CNX A;  2W56 B;  3VSY A;  3DGO A;  1JZD A;  1RCL A;  1I8V A;  1CQS A;  2RGQ A;  3AMO B;  3Q3F A;  1STF I;  2WGO A;  4HM1 B;  2RBI A;  4HZB B;  4LSO A;  5CF1 A;  3CME 3;  3GZX B;  1FUW A;  5LC6 A;  2M7O A;  1AV4 A;  3DMC A;  1X1X A;  4XBY A;  1K41 A;  1OAC A;  3FCS B;  1FZU A;  3GSP A;  3G16 A;  1O7P B;  2XR8 B;  4HBR A;  2CW9 A;  1JKG B;  5ELU A;  1AY7 A;  1BRJ A;  1VQQ A;  2BHM A;  3TDG A;  3U1W A;  1ZO2 A;  1GD4 A;  1UI8 A;  4GSP A;  5AI1 A;  5M19 A;  2GU1 A;  2L1S A;  5KP3 A;  2H0G A;  4NPB A;  2KXG A;  4BTW A;  4IT7 A;  2E2V A;  3DZL A;  1VQ5 3;  1RHL A;  3FLJ A;  1B21 A;  1LOY A;  1WMN A;  2F99 A;  1EUI C;  2P09 A;  3T8N A;  3F8X A;  2W56 A;  3CCR 3;  1BRS A;  8CHO A;  3ROB A;  2RNT A;  4GB5 A;  1GOY A;  1MWR A;  4K1U A;  1A2K A;  3AMO A;  3WHO A;  4BL3 A;  1VQ7 3;  5FGO A;  4DKI A;  5BU4 A;  2OWP A;  1UUV B;  5IG0 A;  4GHO A;  3NQZ A;  1SIH A;  4XDW A;  3CMA 3;  1GMQ A;  1IT7 A;  4HM5 B;  5HOH A;  2IA7 A;  2PNC A;  1JB4 A;  4LEH A;  2RSX A;  4N6M A;  5ELJ A;  2GU3 A;  1OUN A;  3RGR A;  4FMB A;  2GSP A;  2HMK B;  2CWT A;  1BNI A;  1RJO A;  2GXF A;  3NHX A;  4J5K A;  2CG0 A;  3EN1 B;  4OUQ A;  3G6E 3;  1MGR A;  1B2Z A;  3F40 A;  5DRE A;  4BU4 A;  1BRH A;  3BIR A;  5I97 A;  2FGT A;  2QEX 3;  4O8S A;  2CK3 H;  4J9A A;  3HK4 A;  4N6U A;  3NQY A;  5EQL A;  5TGN A;  1OH0 A;  1W00 A;  5A0O B;  1IVV A;  1I3F A;  1X1Y A;  3BNC A;  2CFL A;  7GSP A;  1O7W B;  3GZB A;  3S28 A;  2CIU A;  3URP A;  1HYF A;  1BRG A;  2H0I A;  5IG3 A;  5IEN A;  1RNB A;  1EKM A;  2ML6 A;  3CCV 3;  1ULJ B;  1G0T A;  1RGH A;  1BRN L;  2IYJ A;  1WNH A;  1B3S A;  3D9R A;  1VQN 3;  1EG9 B;  4OK0 A;  4N6L A;  3V99 A;  3EB8 A;  1I3I A;  1I2E A;  1PYL A;  3LT9 A;  5IER A;  4RNT A;  3CNM A;  3JUQ A;  4R9K A;  3PCS A;  3QRD A;  1VQO 3;  1O7N B;  1R4C A;  4XB5 A;  4HM3 B;  1IVX A;  1MOL A;  2CH9 A;  1WMO A;  3WOE B;  1SJW A;  4KT3 B;  5KP1 A;  1YHQ 3;  3EX9 A;  3X3Z A;  2B1X B;  1LQM B;  3FF0 A;  1W6G A;  4EXR A;  4RNZ A;  2XFS A;  2CFW A;  3FG1 A;  3D4A A;  3G8Z A;  1BNJ A;  2SAR A;  1BRI A;  4LYL B;  1OPY A;  2CG1 A;  2OTJ 3;  4XDV A;  3LTA A;  4RBN A;  5CK6 A;  3D5G A;  4TX4 A;  1E3R A;  2K3D A;  1NNV A;  3BLZ A;  4RZM A;  2OTL 3;  3EC9 A;  1FUT A;  1OF5 B;  4AEQ A;  1IDP A;  1UW1 A;  3KII A;  3LTC A;  5GSP A;  2ML5 A;  4J5G A;  4STD A;  4WHA A;  9RNT A;  4HVN A;  5DRV A;  4HM0 B;  3HX8 A;  2OCT A;  1RTU A;  3ZFZ A;  1IQ8 A;  4WFO A;  1IT8 A;  1VQ4 3;  3GZY B;  1TFK A;  2E2U A;  5BXQ A;  3LOY A;  4HM8 B;  2WOH A;  1KD1 4;  3FKA A;  4HM6 B;  1AVK A;  1B2X A;  4HM4 B;  3NBJ A;  3NX0 A;  4RNY A;  3GAX A;  2CKF B;  6STD A;  1T3B A;  2W9Q A;  1C7H A;  5EVH A;  1TRQ A;  1JJ2 2;  3AGN A;  1DVD A;  5KP4 A;  1E97 A;  2I9W A;  3ALA A;  3EHC A;  3KN4 A;  3PXM A;  4H61 A;  1RNT A;  4I4K A;  3T8U A;  2P38 A;  3A76 A;  1TP6 A;  1BOX A;  1NWW A;  3AGO A;  1LQG C;  2CWU A;  1CEW I;  3A5E A;  3DGL A;  3EBY A;  4N6T A;  1ASK A;  4OVM A;  8RNT A;  1RGL A;  1OF5 A;  1N5H A;  4HKV B;  3FG3 A;  3HOH A;  3Q1C A;  5M18 A;  3JVC A;  4CDL A;  2ZA4 A;  3LTB A;  3UL5 A;  1B20 A;  1D6U A;  2WGQ A;  3N9H A;  5IG5 A;  1YIJ 3;  3S67 A;  1W2B 2;  2A15 A;  5BVB A;  3ER7 A;  4O02 B;  1FGM A;  1BNF A;  2Q07 A;  1FUS A;  2XGN A;  3NV0 A;  1IK3 A;  3CCE 3;  3EN8 A;  4X2O A;  1TUH A;  4CCV A;  2F5M A;  1VQL 3;  2KF6 A;  3F8H A;  1DMN A;  4J8T A;  2XGL A;  2Y73 A;  3JUP A;  2W03 A;  3OV4 A;  1GSP A;  4HOH A;  3X3X A;  1G02 A;  4O2H A;  2MF7 A;  3KSP A;  1GOV A;  3NBB A;  3SOA A;  2INX A;  4N6V 0;  1RKY A;  2W0Q A;  2IMJ A;  5EEO A;  4FMC A;  4FMD A;  4MEI A;  4X2H A;  4I5Q A;  1M1K 4;  4WP5 A;  4R80 A;  1EEJ A;  1RLS A;  3DGM A;  1PFP A;  3HI7 A;  2MC8 A;  1WMP A;  1TU5 A;  1RGA A;  1TJD A;  4FCM A; 
#chains in the Genus database with same CATH homology
 3UB1 A;  2KCD A;  5IEP A;  2HMM B;  4R9L A;  1GS3 A;  3SOY A;  1OHS A;  3DM8 A;  1ROA A;  1F8N A;  4MJD A;  3X40 A;  1M9G A;  2XRX B;  3PGB A;  4KZ1 A;  1NB3 I;  4G1M B;  5D82 A;  5STD A;  1VQM 3;  1W6Y A;  3U97 A;  1W01 A;  1Q86 4;  1LVN A;  3CC4 3;  3BND A;  4MMY B;  4GL6 A;  1W7C A;  1OGZ A;  1JB2 A;  2CFK A;  2GBW B;  4KVH A;  1JKG A;  3M8C A;  4WYK B;  3SX1 A;  5LC7 A;  4XM4 A;  1YJW 3;  3CCU 3;  3EF8 A;  1KSI A;  5AIH A;  2HMO B;  1NJI 4;  3N54 B;  1QAK A;  4FCZ A;  1AVL A;  1U5O A;  2XF3 A;  3E99 A;  1VQK 3;  3S27 A;  1JB5 A;  3LT8 A;  1RN7 A;  1YGE A;  1HKX A;  3JUM A;  3PCR A;  4JRF A;  4NRE A;  3NBR A;  1EA2 A;  1YI2 3;  4KFE A;  1D6Z A;  2YFL B;  3GRD A;  1K9M 4;  2CHC A;  5D83 A;  3BNB A;  5AII A;  4EYC A;  1S72 3;  1W5Z A;  2GEY A;  3KKG A;  4WYK A;  3UL6 A;  1KQS 2;  1GYB A;  1ISK A;  3KE7 A;  2WOF A;  1STD A;  2W9P A;  3NUV A;  1KWI A;  3NM7 A;  4ZM8 A;  3CPW 2;  3LZA A;  2BO9 B;  2W04 A;  4JF8 A;  2XFT A;  1ULI B;  1N9J A;  4O3V A;  3DGN A;  2XH9 A;  4IIA A;  4ORL A;  3LML A;  3B7C A;  1LNH A;  5AIF A;  2R4I A;  3RDE A;  3STD A;  1NB5 I;  4HM7 B;  1GY7 A;  2OOV C;  4XBX A;  1IV7 A;  3B8L A;  1YJN 3;  1K28 A;  1US1 A;  3SVA A;  3KFQ C;  1A90 A;  1QVG 2;  2UX0 A;  1G96 A;  3IMA B;  3MPH A;  4K1V A;  1UI7 A;  1Q82 4;  1PU4 A;  2O3O A;  5AIG A;  3Q90 A;  3J7Y d;  3SED A;  1Q81 4;  4BTY A;  1JRQ A;  3NM2 A;  2FXT A;  4K90 B;  4WWU C;  3CC7 3;  4AKZ A;  3CD6 3;  3CC2 3;  2LYX A;  4L8O A;  2OOV A;  1TFO A;  3LTD A;  3MYT A;  1K8A 4;  2D1W A;  2Y74 A;  1T5Y A;  2RFR A;  3MWZ A;  2CWV A;  3CPO A;  2P0X A;  2Z76 A;  3KZT A;  4HM2 B;  3V98 A;  1VQ6 3;  3Q2P A;  1Q40 B;  3OWU A;  1JN5 B;  2QIY A;  2P0M A;  1K73 4;  3MG3 A;  3QK9 A;  3HIG A;  3WOF B;  3I0Y A;  2GEX A;  2SBL A;  2Z77 A;  2WO0 A;  2YFJ B;  1QAL A;  3IPT A;  1OHO A;  3B4O A;  1W4N A;  3K0Z A;  1QJG A;  3ECF A;  1YIT 3;  3K63 A;  3CCL 3;  3WDG B;  1WQL B;  3JUN A;  2HMJ B;  1D6Y A;  3LYG A;  3S5C A;  4N6O B;  3G4S 3;  1Q7Y 4;  1JNQ A;  3EBT A;  5JBS A;  4FMA A;  4MMX B;  4L7K A;  3FH1 A;  2OQE A;  1N5P A;  2KRT A;  3X3Y A;  2Z6B A;  4EBG A;  1NU3 A;  4HZ9 B;  1Q40 A;  2D42 A;  5IW9 A;  3D3L A;  3V92 A;  1JN5 A;  1VZZ A;  3S29 A;  2O9U X;  3F14 A;  3VF1 A;  3I55 3;  4R1K A;  1SII A;  3F7X A;  5IF6 A;  1O7H B;  4EV5 A;  1DVC A;  2Z7A A;  5JPU A;  3I56 3;  3WOD G;  1M1X B;  1RRH A;  2IUK A;  2W6J H;  2IUJ A;  3FF2 A;  3G71 3;  3X41 A;  2L4V A;  1GY6 A;  3UJM A;  1SPU A;  1KC8 4;  4HJL B;  3NXJ A;  2B24 B;  2CFG A;  1JV2 B;  2PZV A;  2V1L A;  3EQQ B;  1UUW B;  4K61 A;  3K5T A;  1HU9 A;  3UNL A;  1E3V A;  3F9S A;  1GY5 A;  5CF2 A;  3OW2 2;  2LQV A;  2K0M A;  2QA4 3;  3RGA A;  3B4P A;  5G2G A;  3CCQ 3;  4KFD A;  1QVF 2;  4LGQ A;  2XSO B;  3BB9 A;  3H3H A;  3T0U A;  1Q42 A;  1N8Q A;  1QMA A;  3BNE A;  3MKI A;  2C10 A;  2GBX B;  1O7M B;  4FCJ A;  3LH4 A;  1DMQ A;  3KSE D;  3O8Y A;  1AR0 A;  3EE1 A;  1N9E A;  4QWT A;  1V74 A;  4XBT A;  4LMI A;  1DMM A;  2XSH B;  2BMQ B;  2BNG A;  3PYJ A;  3SXX A;  2BMR B;  4BTX A;  3MG2 A;  2C11 A;  5AEW B;  1RRL A;  2ZDJ A;  1IVW A;  4AKY A;  1BUQ A;  4LZI A;  5AYS C;  5IEO A;  1IVU A;  1Y4K A;  5AYR B;  1CYU A;  3K7C A;  3MG1 A;  5IG4 A;  3SLU A;  5JPP A;  2ZL8 A;  3OXA A;  2E2T A;  3LXU X;  4IPB A;  3OWS A;  1DYU A;  3PS8 A;  1IQY A;  1SQW A;  2YX9 A;  3H51 A;  2JQ5 A;  5CXO A;  3WA3 A;  1NO3 A;  3FGY A;  2F86 B;  2JDI H;  5FW5 A;  1MNL A;  2HMN B;  4EC6 A;  1YVB I;  3CCJ 3;  2QGU A;  3G0K A;  2CFD A;  3F7S A;  1OHP A;  1VQ9 3;  1ROV A;  3X42 A;  1NDO B;  2K54 A;  4Q53 A;  1GD3 A;  3GZR A;  2CC3 A;  1S5A A;  4FR9 A;  1TIJ A;  1A2V A;  3FG4 A;  3JUO A;  1IV9 A;  4L8P A;  4R4K A;  1L5G B;  3VGN A;  2BMO B;  1IU7 A;  3OWY A;  1CYV A;  4EV2 A;  5AEU B;  3EJV A;  7STD A;  5HGR A;  2RCD A;  1QAF A;  1LOX A;  1O7G B;  2FNQ A;  2W2C A;  4N3V A;  1YJ9 3;  3L0R A;  4U13 A;  3WMD A;  3PZW A;  1W6C A;  1W02 A;  1OCV A;  2OQE C;  1FGO A;  3MSO A;  3NV0 B;  4NHF A;  2P05 A;  3GWR A;  3HII A;  1J2B A;  1FGT A;  2STD A;  3FSD A;  5D81 A;  4H3U A;  1VQ8 3;  1N8R 4;  4HYZ A;  3MHE A;  4N6N B;  4KFF A;  3DY5 A;  3FZW A;  4MMZ B;  4PEJ A;  3CCM 3;  3CU3 A;  3CCS 3;  3OX9 A;  1EQK A;  1A67 A;  2F98 A;  1U8C B;  3HZP A;  1FA3 A;  2BT3 A;  3WA2 X;  3DUK A;  2HML B;  1VQP 3;  1FGR A;  3CXC 2;  1FGQ A;  1W2Z A;  1IQX A;  2XEP A;  1ZX2 A;  3K9M C;  1WTH A;  1M90 4;  3IJE B;  3DXO A;  1LXE A;  1Z1S A;  2YFI B;  5CLK A;  1OGX A;  3N8B A;  3CNX A;  3VSY A;  2W56 B;  3DGO A;  2RGQ A;  1CQS A;  3AMO B;  4HM1 B;  1STF I;  2WGO A;  4HZB B;  4LSO A;  5CF1 A;  3CME 3;  3GZX B;  1FUW A;  5LC6 A;  2M7O A;  1AV4 A;  3DMC A;  4XBY A;  1K41 A;  1OAC A;  3FCS B;  3G16 A;  1O7P B;  2XR8 B;  4HBR A;  2CW9 A;  1JKG B;  5ELU A;  3U1W A;  2BHM A;  3TDG A;  1ZO2 A;  1GD4 A;  1UI8 A;  5AI1 A;  2GU1 A;  5KP3 A;  4BTW A;  2KXG A;  4IT7 A;  2E2V A;  3DZL A;  1VQ5 3;  3FLJ A;  1WMN A;  2F99 A;  2P09 A;  3T8N A;  3F8X A;  2W56 A;  3CCR 3;  8CHO A;  3ROB A;  4GB5 A;  1VQ7 3;  4K1U A;  1A2K A;  3AMO A;  5FGO A;  2OWP A;  1UUV B;  5IG0 A;  3NQZ A;  1SIH A;  4XDW A;  3CMA 3;  1IT7 A;  4HM5 B;  2IA7 A;  2PNC A;  1JB4 A;  4LEH A;  2RSX A;  4N6M A;  5ELJ A;  2GU3 A;  1OUN A;  3RGR A;  4FMB A;  2HMK B;  2CWT A;  3NHX A;  1RJO A;  2GXF A;  2CG0 A;  3EN1 B;  4OUQ A;  3G6E 3;  5DRE A;  3F40 A;  5I97 A;  2FGT A;  2QEX 3;  4O8S A;  2CK3 H;  4J9A A;  3HK4 A;  4N6U A;  3NQY A;  5EQL A;  5TGN A;  1OH0 A;  1W00 A;  5A0O B;  1IVV A;  3BNC A;  2CFL A;  1O7W B;  3GZB A;  3S28 A;  2CIU A;  5IEN A;  5IG3 A;  1EKM A;  2ML6 A;  3CCV 3;  1ULJ B;  1WNH A;  1VQN 3;  3D9R A;  1EG9 B;  4OK0 A;  4N6L A;  3V99 A;  3EB8 A;  3LT9 A;  5IER A;  3CNM A;  3JUQ A;  4R9K A;  3PCS A;  3QRD A;  1VQO 3;  1O7N B;  1R4C A;  4XB5 A;  4HM3 B;  1IVX A;  1MOL A;  2CH9 A;  1WMO A;  3WOE B;  1SJW A;  5KP1 A;  1YHQ 3;  3EX9 A;  3X3Z A;  2B1X B;  3FF0 A;  4EXR A;  1W6G A;  4RNZ A;  2XFS A;  2CFW A;  3FG1 A;  3G8Z A;  2OTJ 3;  2CG1 A;  1OPY A;  4XDV A;  3LTA A;  4RBN A;  5CK6 A;  4TX4 A;  1E3R A;  3BLZ A;  4RZM A;  2OTL 3;  3EC9 A;  1OF5 B;  4AEQ A;  1IDP A;  1UW1 A;  3KII A;  3LTC A;  2ML5 A;  4STD A;  4WHA A;  4HVN A;  5DRV A;  4HM0 B;  3HX8 A;  2OCT A;  1IQ8 A;  4WFO A;  1IT8 A;  1VQ4 3;  3GZY B;  1TFK A;  2E2U A;  5BXQ A;  3LOY A;  4HM8 B;  2WOH A;  1KD1 4;  3FKA A;  4HM6 B;  1AVK A;  4HM4 B;  3NBJ A;  3NX0 A;  4RNY A;  3GAX A;  2CKF B;  6STD A;  5EVH A;  2W9Q A;  1C7H A;  1JJ2 2;  1DVD A;  5KP4 A;  1E97 A;  2I9W A;  3ALA A;  3EHC A;  3KN4 A;  3PXM A;  4H61 A;  4I4K A;  3T8U A;  2P38 A;  3A76 A;  1TP6 A;  1NWW A;  2CWU A;  1CEW I;  3DGL A;  3EBY A;  4OVM A;  4N6T A;  1ASK A;  1OF5 A;  1N5H A;  4HKV B;  3FG3 A;  3Q1C A;  3JVC A;  4CDL A;  3LTB A;  3UL5 A;  1D6U A;  2WGQ A;  3N9H A;  5IG5 A;  1YIJ 3;  3S67 A;  1W2B 2;  2A15 A;  5BVB A;  3ER7 A;  4O02 B;  1FGM A;  2Q07 A;  2XGN A;  3NV0 A;  1IK3 A;  3CCE 3;  3EN8 A;  4X2O A;  1TUH A;  4CCV A;  1VQL 3;  3F8H A;  1DMN A;  4J8T A;  2XGL A;  2Y73 A;  3JUP A;  2W03 A;  3OV4 A;  3X3X A;  4O2H A;  2MF7 A;  3KSP A;  3NBB A;  3SOA A;  2INX A;  4N6V 0;  1RKY A;  2W0Q A;  2IMJ A;  5EEO A;  4FMC A;  4FMD A;  4MEI A;  4X2H A;  1M1K 4;  4WP5 A;  4R80 A;  3DGM A;  1PFP A;  3HI7 A;  2MC8 A;  1WMP A;  1TU5 A;  4FCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...