5IW9A

Structure of bacteriophage t4 gp25, sheath polymerization initiator
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
126
Chain Sequence
NINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Baseplate wedge protein gp25
publication title Structure of the T4 baseplate and its function in triggering sheath contraction.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 32
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04965 GPW_gp25 Gene 25-like lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iw9A00
3HI7A 1WMPA 3SX1A 2CG1A 1AVKA 3AMOB 3NQZA 3SXXA 1OACA 1D6YA 2WOHA 4BTXA 2GU3A 1W4NA 2CFGA 2BT3A 2Y73A 4BTWA 2Y74A 1D6UA 2C11A 1D6ZA 1IQXA 1KSIA 1RKYA 1WMOA 3WA3A 3LOYA 1W6CA 1W6GA 2IA7A 1IVVA 1IVXA 3X42A 1PU4A 2OQEA 3K5TA 3X40A 2YX9A 1US1A 3NQYA 3NBJA 2CFKA 3AMOA 3MPHA 3T0UA 1IU7A 1N9EA 2OOVC 2CG0A 3KIIA 2CWVA 1AV4A 3X3ZA 1SIIA 5IW9A 3KN4A 1LVNA 2WO0A 2W0QA 2E2VA 3HIGA 3X3YA 1IVWA 2CWTA 1AVLA 2PNCA 2WOFA 4KFFA 1IVUA 1W5ZA 1QAFA 3HIIA 3ALAA 2OQEC 1UI7A 2ZL8A 3N9HA 2CFDA 2C10A 1EKMA 2CWUA 2WGQA 2E2TA 3PGBA 1W7CA 1IQYA 4KFEA 2CFLA 1DYUA 4BTYA 3NBBA 1A2VA 1QAKA 1QALA 3X41A 4KFDA 1JRQA 1SPUA 3X3XA 2CFWA 4EV2A 2D1WA 2E2UA 1UI8A 1SIHA 1TU5A 1RJOA 1W2ZA 4EV5A 4EXRA 1WMNA 2OOVA 3WA2X 2K0MA
chains in the Genus database with same CATH superfamily
2F99A 1Q40B 2CG1A 3NXJA 1EA2A 1Q9EA 5KP3A 1R4YA 2WOHA 3MG1A 4BTXA 2SARA 1ZGXA 2CFGA 2WGOA 2YFIB 4XBYA 1YJN3 2GXFA 3CNXA 5CLKA 3FGYA 3K0ZA 3Q3FA 2C11A 5DRVA 3HOHA 3EBTA 1KC84 2XFSA 2KXGA 4HM0B 3BU4A 1WMOA 4R80A 4J5GA 3CC43 3LOYA 4GSPA 2OCTA 5DREA 2FXTA 3EHCA 1OGZA 2QIYA 3RNTA 3PXMA 3ZG0A 2B1XB 3CXC2 2IA7A 3NHXA 1IVVA 4XBTA 5IG4A 2OQEA 2MF7A 3JVCA 3LYGA 4GHOA 4NPBA 2ZA4A 1RN4A 1RDSA 4MMXB 3DXOA 4MMZB 3BNEA 3X40A 1GYBA 1FA3A 1US1A 3B7CA 3GZRA 4R9KA 2YFLB 5AI1A 2CFKA 4Q53A 1IYYA 2HMJB 1I3IA 1JNQA 4HM1B 3T0UA 1A67A 1BUQA 1F8NA 5TGNA 1IK3A 3JUNA 5G1LA 6GSPA 1ZS7A 2CG0A 1B2UA 1BUJA 1BSAA 5D83A 2K54A 5AEUB 1FGQA 1RNBA 1VQN3 2D42A 4IPBA 2CKFB 1SIIA 6RNTA 1OF5A 3G0KA 4X2OA 3SOYA 3MWZA 1X1WA 1UGIA 1AQZA 2W04A 3BNDA 4HKVB 4IIAA 2M7OA 1BNFA 4XM4A 3I0YA 2C4BA 4TX4A 2W56A 3HIGA 1CYUA 2F86B 2CWTA 1BNIA 1YIJ3 5D81A 5GSPA 4LYLB 2BU4A 1JB5A 1OHPA 3GSPA 2PNCA 1RRHA 4STDA 3EB8A 3ROBA 1RSNA 1O7MB 2GEYA 2P38A 1Q7Y4 3CD63 4FCMA 1A2PA 4H3UA 3DZLA 1O7HB 4XDVA 1J2BA 3A76A 3CC23 4R4KA 5JPPA 1I2EA 2B24B 5CF1A 1CEWI 1Q42A 1UUVB 1FUSA 1PYLA 2ZL8A 1VQ93 3SYUA 1FGMA 3BLZA 1GOUA 2CFDA 1R4CA 2RFRA 2IYJA 4OVMA 1MGWA 1OHSA 4HM3B 1K8A4 1BVIA 1E3VA 2CIUA 1UGHI 1QJGA 1JB2A 2GBWB 1E97A 2O3OA 1AR0A 1KQS2 1IQYA 4K90B 3S27A 4RZMA 3CNMA 1YNVX 4HM5B 2Z6BA 1DYUA 1RGGA 2RBIA 1JBSA 1VQ73 3JUMA 1BGSA 1I2FA 2HOHA 3EC9A 7RNTA 3JUQA 4FR9A 4J9AA 3PCRA 4RNTA 4KFDA 4XBXA 2CK3H 3X3XA 5LC6A 2YFJB 1VQK3 5BU4A 1MWTA 2OTJ3 2OTL3 1SIHA 1L5GB 1YVSA 3MKIA 1S5AA 5CF2A 3D4AA 1UDII 4EV5A 1HKXA 4OK0A 2GBXB 1DMNA 1JKGB 2OOVA 1IQ8A 1Q864 3KFQC 3DGLA 1T3BA 2V1LA 1MNLA 4WP5A 1VQQA 1GD3A 2Z76A 3HI7A 4MJDA 4WHAA 2KF5A 1AVKA 4LEHA 4RNZA 2FNQA 1FYSA 3FZWA 2W6JH 5BVBA 2J8XB 2UX0A 1O7NB 1AY7A 3LXUX 2UUGC 3Q90A 2Y73A 4DKIA 4CCVA 2HMOB 3PS8A 2Y74A 3DGOA 1CYVA 5KP1A 4JF8A 5JPUA 1IQXA 1O7GB 1OUNA 1WTHA 1T2IA 1RMSA 2XFTA 2UGIA 5I97A 1BNGA 1U8CB 1I70A 1DVCA 1W2B2 1E3RA 1X1XA 1TTOA 1W6CA 3BNBA 3FF0A 2KAAA 4LGQA 5A0OB 9RNTA 1JBRA 1FUWA 3D5IA 1A2KA 4RNYA 3CCJ3 3ECFA 3K5TA 4MMYB 3PZWA 3UL5A 1GMQA 2I9WA 3NQYA 5EEOA 3NBJA 3ZG5A 7GSPA 1Q824 1OHOA 3AMOA 1GOYA 1RGHA 1RTUA 1ULJB 3MPHA 1B2XA 1RN7A 4HM8B 4PEJA 4JRFA 1ROVA 1NB5I 1VQP3 4N6UA 4BU4A 1I0XA 4L8PA 2XR8B 2RGQA 4XDWA 4XB5A 3G6E3 2CWVA 1B20A 2PZVA 3SVAA 3DMCA 3X3ZA 1K41A 1M1K4 1PFPA 2F56A 1B3SA 1GMPA 4R9LA 1K28A 1B2ZA 3X3YA 3IPTA 1IVWA 1RGEA 3B8LA 3NV0A 5HGRA 1NJI4 1RGLA 2GSPA 4BL3A 1YJ93 5KP4A 3EF8A 1BNJA 3RGRA 2F98A 3LZAA 2INXA 1RGCA 2JQ5A 2Q07A 4KFFA 1DE3A 1BSBA 1TJDA 1T2HA 2CC3A 1T5YA 3ALAA 1NU3A 1TP6A 2OQEC 1UI7A 3GWRA 3KCHA 4J8TA 3DM8A 7STDA 5AYSC 4I4KA 2Z7AA 3G713 3CCE3 1QVG2 2C10A 2XSHB 4G1MB 1STDA 5LC7A 2O9UX 1FGTA 3D3LA 1V74A 1G96A 2WGQA 3PCSA 1EG9B 4FCJA 1I3FA 1FGRA 1Q814 1RCKA 3SLUA 1JZDA 1BU4A 2RCDA 1W6YA 4WWUC 4AKZA 5EVHA 1CH0A 2STDA 5BIRA 1BAOA 3JUOA 1BRIA 2W2CA 2GEXA 1SARA 2L4VA 2P0MA 3NM2A 1UCLA 1M904 1QAKA 3B4PA 4HVNA 3WHOA 1NDOB 1YIT3 4CJNA 3GZYB 5IERA 1NO3A 5JBSA 1BSDA 4IT7A 1MWUA 1RCLA 4HM7B 4NHFA 1YGWA 4I5QA 2H0HA 4HBRA 3I563 1UI8A 3J7Yd 1ULIB 1TU5A 1MWRA 3D9RA 2LYXA 3OXAA 3K7CA 1LOXA 2JDIH 3FCSB 4BL2A 3G16A 2F5MA 4CDLA 1G02A 1A90A 2BMOB 3UJMA 8RNTA 1CQSA 3NBRA 3WOFB 3FSDA 1WMPA 1BRJA 3LT9A 5HOHA 2XRXB 1VQO3 3NQZA 3SXXA 3VSYA 4WFOA 2ML5A 2GU1A 1NWWA 2GU3A 1W4NA 3VGNA 2HMNB 3WODG 1GMRA 2BT3A 2P0XA 1YVBI 3ZFZA 4BTWA 4ORLA 3AGNA 1VQL3 3CME3 5CK6A 1GSPA 1RKYA 3MYTA 1FUTA 1JN5A 3WA3A 3FG3A 4O2HA 1OF5B 1QVF2 5AEWB 3AHSA 4WYKA 4EW5A 2A15A 1VQ83 1DETA 1O7PB 2L1SA 1W6GA 3I553 1IVXA 3X42A 2W56B 5ELJA 3DGNA 3FKAA 4KT3B 1PU4A 1BRGA 3G4S3 3CCQ3 1VZZA 4K61A 1Q40A 1BRHA 1TRQA 3F14A 1BSEA 5IENA 1B21A 4J5KA 5AIGA 3U1WA 3LT8A 3H3HA 4GL6A 1BIRA 1Z1SA 5G1KA 3NUVA 4O3VA 1RRLA 1IU7A 1X1YA 2KF4A 1GD4A 3F8HA 1N9EA 3MG3A 1G0TA 3N8BA 4KVHA 3S29A 3GRDA 2OOVC 1B27A 1B2MA 4NREA 2R4IA 3Q1CA 3N54B 1N8R4 3DY5A 3G8ZA 3Q2PA 1FGOA 1BRSA 1OH0A 3D79A 3V98A 3TDGA 3WOEB 1EEJA 4H61A 1AV4A 2SBLA 1K734 1K9M4 3CPOA 1DVDA 1SQWA 3F8XA 1OCVA 1TFOA 3FG1A 3MSOA 3NM7A 3IJEB 4ILFA 1ZX2A 3LTDA 1RGAA 1OPYA 4EC6A 5IF6A 4K1VA 1LRAA 1DMQA 1X1UA 5EQLA 2W9PA 3JUPA 2H0GA 3GZXB 2LQVA 1MWSA 1YGEA 1KD14 2XEPA 1ROAA 4GB5A 3KE7A 1LXEA 3UL6A 1UCIA 1PY3A 2WOFA 3MHEA 3BB9A 3RGAA 1UW1A 2ML6A 3MG2A 3CPW2 1WNHA 1IVUA 1LNHA 3STDA 5CXOA 5AIFA 1Y4KA 1W5ZA 1QAFA 3HIIA 1FZUA 2HMLB 2BIRA 1WQLB 3LMLA 3LTCA 1BNSA 1Q7HA 1JV2B 4EYCA 4KZ1A 1BANA 1EKMA 3CCU3 3KSED 3FG4A 3PGBA 5IG3A 2QEX3 8CHOA 1W7CA 1LNIA 1BNRA 2P09A 2XH9A 3F7SA 2W03A 4RBNA 1IDPA 1ISKA 5STDA 2CX0A 4BTYA 1QMAA 2BMQB 4N6NB 1N9JA 2F5WA 3SOAA 2BHMA 1GS3A 1JBTA 3M8CA 1QALA 3V92A 1BOXA 3X41A 3EE1A 1HYFA 4N3VA 3OW22 3CU3A 4FMDA 1RGKA 1LOYA 4N6MA 2CFWA 2IUJA 4HZBB 3LTBA 2BNGA 2XF3A 4EV2A 2D1WA 1C54A 2XSOB 1BSCA 1NB3I 1RHLA 3E99A 3S5CA 1W2ZA 4HYZA 1MGRA 3O8YA 4FMBA 5IEPA 1C7HA 3H51A 1BNEA 3F7XA 4LZIA 2RNTA 1WMNA 3WA2X 4CPKA 2KRTA 2K0MA 4U13A 3CCS3 2R41A 3L0RA 3SX1A 4OUQA 1GY7A 4X2HA 4R1KA 3DH2A 1W02A 3AMOB 4BIRA 1W01A 1OACA 1D6YA 1M1XB 3HX8A 1MOLA 1TRPA 1YHQ3 1N8QA 4HZ9B 3KZTA 3LH4A 6STDA 3WMDA 1VQM3 1GOVA 4EBGA 2CX1A 2FGTA 2IY2A 3UB1A 3OWUA 3WR2A 1D6UA 4QWTA 2MC8A 3KSPA 3CC73 1EQKA 1D6ZA 1HZ1A 1LOVA 3AGOA 3S67A 1KSIA 3S28A 1RN1A 3CCR3 2AADA 2KF6A 2K3DA 3V99A 1IT7A 3T8NA 1UCJA 3IMAB 1JKGA 1V57A 3URPA 1LQGC 3NV0B 2OWPA 5FGOA 3D5GA 5IG0A 1W00A 3LTAA 2YX9A 3FH1A 4AKYA 1RLSA 4L7KA 3DGMA 2ZHXB 1GY5A 1UUGB 1I0VA 3FF2A 3KKGA 1O7WB 4HM4B 4N6V0 1ZO2A 1N5HA 1RNTA 1NNVA 3OV4A 5BXQA 1S723 3UNLA 1YJW3 3EX9A 2QA43 3OWYA 3RDEA 4K1UA 3K63A 3KIIA 4O02B 4O8SA 2F4YA 1GY6A 2XGLA 1JJ22 4N6TA 3F40A 2KCDA 5IW9A 2CHCA 3KN4A 3EQQB 4FMCA 5AIHA 1LVNA 1U5OA 3WDGB 3NX0A 1BRKA 2WO0A 4HJLB 1TIJA 2W0QA 3A5EA 4N6OB 2E2VA 3F9SA 1IT8A 1JZOA 2BO9B 5RNTA 5IG5A 3QRDA 1ASKA 3T8UA 1I2GA 2HMMB 1VQ53 1AVLA 1IV9A 2Z77A 1LOWA 5M19A 3CCM3 4FMAA 5ELUA 2ZDJA 4HOHA 5AIIA 5M18A 3FLJA 1STFI 1VQ43 1VQ63 3AHWA 3CCV3 1OGXA 5D82A 3CCL3 3GAXA 3N9HA 2CW9A 3DGYA 4HAAA 4L8OA 3EBYA 3EJVA 4HM6B 1IV7A 3BNCA 1YI23 2CWUA 1HU9A 1LQMB 1UUWB 1B2SA 5M1AA 1SJWA 2BMRB 2E2TA 2IMJA 3EN1B 3QK9A 4LMIA 2XGNA 2HMKB 2AAEA 1EUIC 1UCKA 2IUKA 3DUKA 4KFEA 4LSOA 4ZM8A 2CFLA 2QGUA 3OX9A 2RSXA 3NBBA 4N6LA 3CMA3 3EN8A 1A2VA 3HK4A 4MEIA 1I8VA 1BRNL 1V58A 1M9GA 1N5PA 5G2GA 3PYJA 4FCZA 2W9QA 1KWIA 1TUHA 1JRQA 1TFKA 2P05A 1SPUA 1RGFA 2KF3A 3ER7A 4HM2B 1FW7A 3BIRA 1JB4A 3K9MC 2E2UA 2H0IA 5FW5A 3VF1A 1JN5B 1DMMA 5IEOA 1RJOA 3B4OA 3GZBA 4WYKB 4EXRA 3U97A 4AEQA 3HZPA 3OWSA 5AYRB 2CH9A 3SEDA
chains in the Genus database with same CATH topology
2F99A 1Q40B 2CG1A 3NXJA 1EA2A 5KP3A 2WOHA 3MG1A 4BTXA 2CFGA 2WGOA 2YFIB 4XBYA 1YJN3 2GXFA 3CNXA 5CLKA 3FGYA 3K0ZA 2C11A 5DRVA 3EBTA 1KC84 2XFSA 2KXGA 4HM0B 1WMOA 4R80A 3CC43 3LOYA 2OCTA 5DREA 2FXTA 3EHCA 1OGZA 2QIYA 3PXMA 2B1XB 3CXC2 2IA7A 3NHXA 1IVVA 4XBTA 5IG4A 2OQEA 2MF7A 3JVCA 3LYGA 4MMXB 1FA3A 3DXOA 4MMZB 3BNEA 3X40A 1GYBA 1US1A 3B7CA 3GZRA 4R9KA 2YFLB 5AI1A 2CFKA 4Q53A 2HMJB 1JNQA 4HM1B 3T0UA 1A67A 1BUQA 1F8NA 5TGNA 1IK3A 3JUNA 2CG0A 5D83A 2K54A 5AEUB 1FGQA 1VQN3 2D42A 4IPBA 2CKFB 1SIIA 1OF5A 3G0KA 4X2OA 3SOYA 3MWZA 4IIAA 2W04A 7STDA 3BNDA 4HKVB 4XM4A 2M7OA 3I0YA 4TX4A 2W56A 3HIGA 1CYUA 2F86B 2CWTA 1YIJ3 5D81A 1JB5A 1OHPA 2PNCA 1RRHA 4STDA 3EB8A 3ROBA 2P38A 1O7MB 2GEYA 1Q7Y4 3CD63 4FCMA 4H3UA 3DZLA 1O7HB 4XDVA 1J2BA 3A76A 3CC23 4R4KA 5JPPA 2B24B 5CF1A 1CEWI 1Q42A 1UUVB 2ZL8A 1VQ93 1FGMA 3BLZA 2CFDA 1R4CA 2RFRA 4OVMA 1OHSA 4HM3B 1K8A4 1E3VA 2CIUA 1QJGA 1JB2A 2GBWB 1E97A 2O3OA 1AR0A 1KQS2 1IQYA 4K90B 3S27A 4RZMA 3CNMA 4HM5B 2Z6BA 1DYUA 1VQ73 3JUMA 3EC9A 3JUQA 4FR9A 4J9AA 3PCRA 4KFDA 4XBXA 2CK3H 3X3XA 5LC6A 2YFJB 1VQK3 2OTJ3 2OTL3 1SIHA 1L5GB 3MKIA 1S5AA 5CF2A 4EV5A 1HKXA 4OK0A 2GBXB 1DMNA 1JKGB 2OOVA 1IQ8A 1Q864 3KFQC 3DGLA 2V1LA 1MNLA 4WP5A 1GD3A 2Z76A 3HI7A 4MJDA 4WHAA 1AVKA 4LEHA 4RNZA 2FNQA 3FZWA 2W6JH 5BVBA 2UX0A 1O7NB 3LXUX 3Q90A 2Y73A 4CCVA 2HMOB 3PS8A 2Y74A 3DGOA 1CYVA 5KP1A 4JF8A 5JPUA 1IQXA 1O7GB 1OUNA 1WTHA 2XFTA 5I97A 1U8CB 1DVCA 1W2B2 1E3RA 5A0OB 3BNBA 1W6CA 4LGQA 3FF0A 1FUWA 1A2KA 4RNYA 3CCJ3 3ECFA 3K5TA 4MMYB 3PZWA 3UL5A 2I9WA 3NQYA 5EEOA 3NBJA 1Q824 1OHOA 3AMOA 1ULJB 3MPHA 1RN7A 4HM8B 4PEJA 4JRFA 1ROVA 1NB5I 1VQP3 4N6UA 4L8PA 2XR8B 2RGQA 4XDWA 4XB5A 3G6E3 2CWVA 2PZVA 3SVAA 3DMCA 3X3ZA 1K41A 1M1K4 1PFPA 4R9LA 1K28A 3X3YA 3IPTA 1IVWA 3B8LA 3NV0A 5HGRA 1NJI4 1YJ93 5KP4A 3EF8A 3RGRA 2F98A 3LZAA 2INXA 2JQ5A 2Q07A 4KFFA 2CC3A 1T5YA 3ALAA 1NU3A 1TP6A 2OQEC 1UI7A 3GWRA 4J8TA 3DM8A 5AYSC 4I4KA 2Z7AA 3G713 3CCE3 1QVG2 2C10A 2XSHB 4G1MB 1STDA 5LC7A 2O9UX 1FGTA 3D3LA 1V74A 1G96A 2WGQA 3PCSA 1EG9B 4FCJA 1FGRA 1Q814 3SLUA 2RCDA 1W6YA 4WWUC 4AKZA 5EVHA 2STDA 3JUOA 2W2CA 2GEXA 2L4VA 2P0MA 3NM2A 1M904 1QAKA 3B4PA 4HVNA 1NDOB 1YIT3 3GZYB 5IERA 1NO3A 4IT7A 4HM7B 4NHFA 4HBRA 3I563 1UI8A 3J7Yd 1ULIB 1TU5A 3D9RA 2LYXA 3OXAA 3K7CA 1LOXA 2JDIH 3FCSB 3G16A 4CDLA 1A90A 2BMOB 3UJMA 1CQSA 3NBRA 3WOFB 3FSDA 1WMPA 3LT9A 1VQO3 2XRXB 3NQZA 3SXXA 3VSYA 4WFOA 2ML5A 2GU1A 1NWWA 2GU3A 1W4NA 3VGNA 2HMNB 3WODG 2P0XA 2BT3A 1YVBI 4BTWA 4ORLA 1VQL3 3CME3 5CK6A 1RKYA 3MYTA 1JN5A 3WA3A 3FG3A 4O2HA 1OF5B 1QVF2 5AEWB 4WYKA 1VQ83 2A15A 1O7PB 1W6GA 3I553 1IVXA 3X42A 2W56B 5ELJA 3DGNA 3FKAA 1PU4A 3CCQ3 1VZZA 4K61A 1Q40A 3F14A 5IENA 3U1WA 5AIGA 3LT8A 3H3HA 4GL6A 1Z1SA 3NUVA 4O3VA 1RRLA 1IU7A 3F8HA 3MG3A 1GD4A 3N8BA 1N9EA 3S29A 4KVHA 3GRDA 2OOVC 4NREA 2R4IA 3Q1CA 3N54B 1N8R4 3DY5A 3G8ZA 3Q2PA 1FGOA 1OH0A 3V98A 3TDGA 3WOEB 4H61A 1AV4A 2SBLA 1K734 1K9M4 3CPOA 1DVDA 1SQWA 3F8XA 1OCVA 1TFOA 3FG1A 3MSOA 3NM7A 3IJEB 1ZX2A 3LTDA 1OPYA 4EC6A 5IF6A 4K1VA 1DMQA 5EQLA 2W9PA 3JUPA 3GZXB 2LQVA 1YGEA 1KD14 2XEPA 1ROAA 4GB5A 3KE7A 1LXEA 3UL6A 2WOFA 3MHEA 3BB9A 3RGAA 1UW1A 2ML6A 3MG2A 3CPW2 1WNHA 1IVUA 1LNHA 3STDA 5CXOA 5AIFA 1Y4KA 1W5ZA 1QAFA 3HIIA 2HMLB 1WQLB 3LMLA 3LTCA 1JV2B 4EYCA 4KZ1A 1EKMA 3CCU3 3KSED 3FG4A 3PGBA 5IG3A 2QEX3 8CHOA 1W7CA 2P09A 2XH9A 3F7SA 2W03A 4RBNA 1IDPA 1ISKA 5STDA 4BTYA 1QMAA 2BMQB 4N6NB 1N9JA 3SOAA 1GS3A 2BHMA 3M8CA 1QALA 3V92A 3X41A 3EE1A 4N3VA 3OW22 3CU3A 4FMDA 4N6MA 2CFWA 2IUJA 4HZBB 3LTBA 2BNGA 2XF3A 4EV2A 2D1WA 2XSOB 3S5CA 1NB3I 3E99A 1W2ZA 4HYZA 3O8YA 4FMBA 5IEPA 1C7HA 3H51A 3F7XA 4LZIA 1WMNA 3WA2X 2KRTA 2K0MA 4U13A 3CCS3 3L0RA 3SX1A 4OUQA 1GY7A 4X2HA 4R1KA 1W02A 3AMOB 1W01A 1OACA 1D6YA 1M1XB 3HX8A 1MOLA 1YHQ3 1N8QA 4HZ9B 3KZTA 3LH4A 6STDA 3WMDA 1VQM3 4EBGA 2FGTA 3UB1A 3OWUA 1D6UA 4QWTA 2MC8A 3KSPA 3CC73 1EQKA 1D6ZA 3S67A 3S28A 1KSIA 3CCR3 3V99A 1IT7A 3T8NA 3IMAB 1JKGA 3NV0B 2OWPA 5FGOA 5IG0A 1W00A 3LTAA 2YX9A 3FH1A 4AKYA 4L7KA 3DGMA 5JBSA 1GY5A 3FF2A 3KKGA 4N6V0 4HM4B 1O7WB 3G4S3 1ZO2A 1N5HA 3OV4A 5BXQA 1S723 3UNLA 1YJW3 3EX9A 2QA43 3OWYA 3RDEA 4K1UA 3K63A 3KIIA 4O02B 4O8SA 2XGLA 1GY6A 1JJ22 4N6TA 3F40A 2KCDA 5IW9A 2CHCA 3KN4A 3EQQB 4FMCA 5AIHA 1LVNA 1U5OA 3WDGB 3NX0A 2WO0A 4HJLB 1TIJA 2W0QA 4N6OB 2E2VA 3F9SA 1IT8A 2BO9B 5IG5A 3QRDA 1ASKA 3T8UA 2HMMB 1VQ53 1AVLA 1IV9A 2Z77A 3CCM3 4FMAA 5ELUA 2ZDJA 5AIIA 3FLJA 1STFI 1VQ43 1VQ63 3CCV3 1OGXA 5D82A 3CCL3 3GAXA 3N9HA 2CW9A 4L8OA 1YI23 3EBYA 3EJVA 4HM6B 1IV7A 3BNCA 2CWUA 1HU9A 1UUWB 1SJWA 2BMRB 2E2TA 2IMJA 3EN1B 3QK9A 4LMIA 2XGNA 2HMKB 2IUKA 3DUKA 4KFEA 4LSOA 4ZM8A 2CFLA 2QGUA 3OX9A 2RSXA 3NBBA 4N6LA 3CMA3 3EN8A 1A2VA 3HK4A 4MEIA 1M9GA 1N5PA 5G2GA 3PYJA 4FCZA 2W9QA 1KWIA 1TUHA 1JRQA 1TFKA 2P05A 1SPUA 3ER7A 4HM2B 1JB4A 3K9MC 2E2UA 5FW5A 3VF1A 1JN5B 1DMMA 5IEOA 1RJOA 3B4OA 3GZBA 4WYKB 4EXRA 3U97A 4AEQA 3HZPA 3OWSA 5AYRB 2CH9A 3SEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HI7 A;  1WMP A;  3SX1 A;  2CG1 A;  1AVK A;  3AMO B;  3NQZ A;  3SXX A;  1OAC A;  1D6Y A;  2WOH A;  4BTX A;  2GU3 A;  1W4N A;  2CFG A;  2BT3 A;  2Y73 A;  4BTW A;  2Y74 A;  1D6U A;  2C11 A;  1D6Z A;  1IQX A;  1KSI A;  1RKY A;  1WMO A;  3WA3 A;  3LOY A;  1W6C A;  1W6G A;  2IA7 A;  1IVV A;  1IVX A;  3X42 A;  1PU4 A;  2OQE A;  3K5T A;  3X40 A;  2YX9 A;  1US1 A;  3NQY A;  3NBJ A;  2CFK A;  3AMO A;  3MPH A;  3T0U A;  1IU7 A;  1N9E A;  2OOV C;  2CG0 A;  3KII A;  2CWV A;  1AV4 A;  3X3Z A;  1SII A;  5IW9 A;  3KN4 A;  1LVN A;  2WO0 A;  2W0Q A;  2E2V A;  3HIG A;  3X3Y A;  1IVW A;  2CWT A;  1AVL A;  2PNC A;  2WOF A;  4KFF A;  1IVU A;  1W5Z A;  1QAF A;  3HII A;  3ALA A;  2OQE C;  1UI7 A;  2ZL8 A;  3N9H A;  2CFD A;  2C10 A;  1EKM A;  2CWU A;  2WGQ A;  2E2T A;  3PGB A;  1W7C A;  1IQY A;  4KFE A;  2CFL A;  1DYU A;  4BTY A;  3NBB A;  1A2V A;  1QAK A;  1QAL A;  3X41 A;  4KFD A;  1JRQ A;  1SPU A;  3X3X A;  2CFW A;  4EV2 A;  2D1W A;  2E2U A;  1UI8 A;  1SIH A;  1TU5 A;  1RJO A;  1W2Z A;  4EV5 A;  4EXR A;  1WMN A;  2OOV A;  3WA2 X;  2K0M A; 
#chains in the Genus database with same CATH topology
 2F99 A;  1Q40 B;  2CG1 A;  3NXJ A;  1EA2 A;  1Q9E A;  5KP3 A;  1R4Y A;  2WOH A;  3MG1 A;  4BTX A;  2SAR A;  1ZGX A;  2CFG A;  2WGO A;  2YFI B;  4XBY A;  1YJN 3;  2GXF A;  3CNX A;  5CLK A;  3FGY A;  3K0Z A;  3Q3F A;  2C11 A;  5DRV A;  3HOH A;  3EBT A;  1KC8 4;  2XFS A;  2KXG A;  4HM0 B;  3BU4 A;  1WMO A;  4R80 A;  4J5G A;  3CC4 3;  3LOY A;  4GSP A;  2OCT A;  5DRE A;  2FXT A;  3EHC A;  1OGZ A;  2QIY A;  3RNT A;  3PXM A;  3ZG0 A;  2B1X B;  3CXC 2;  2IA7 A;  3NHX A;  1IVV A;  4XBT A;  5IG4 A;  2OQE A;  2MF7 A;  3JVC A;  3LYG A;  4GHO A;  4NPB A;  2ZA4 A;  1RN4 A;  1RDS A;  4MMX B;  3DXO A;  4MMZ B;  3BNE A;  3X40 A;  1GYB A;  1FA3 A;  1US1 A;  3B7C A;  3GZR A;  4R9K A;  2YFL B;  5AI1 A;  2CFK A;  4Q53 A;  1IYY A;  2HMJ B;  1I3I A;  1JNQ A;  4HM1 B;  3T0U A;  1A67 A;  1BUQ A;  1F8N A;  5TGN A;  1IK3 A;  3JUN A;  5G1L A;  6GSP A;  1ZS7 A;  2CG0 A;  1B2U A;  1BUJ A;  1BSA A;  5D83 A;  2K54 A;  5AEU B;  1FGQ A;  1RNB A;  1VQN 3;  2D42 A;  4IPB A;  2CKF B;  1SII A;  6RNT A;  1OF5 A;  3G0K A;  4X2O A;  3SOY A;  3MWZ A;  1X1W A;  1UGI A;  1AQZ A;  2W04 A;  3BND A;  4HKV B;  4IIA A;  2M7O A;  1BNF A;  4XM4 A;  3I0Y A;  2C4B A;  4TX4 A;  2W56 A;  3HIG A;  1CYU A;  2F86 B;  2CWT A;  1BNI A;  1YIJ 3;  5D81 A;  5GSP A;  4LYL B;  2BU4 A;  1JB5 A;  1OHP A;  3GSP A;  2PNC A;  1RRH A;  4STD A;  3EB8 A;  3ROB A;  1RSN A;  1O7M B;  2GEY A;  2P38 A;  1Q7Y 4;  3CD6 3;  4FCM A;  1A2P A;  4H3U A;  3DZL A;  1O7H B;  4XDV A;  1J2B A;  3A76 A;  3CC2 3;  4R4K A;  5JPP A;  1I2E A;  2B24 B;  5CF1 A;  1CEW I;  1Q42 A;  1UUV B;  1FUS A;  1PYL A;  2ZL8 A;  1VQ9 3;  3SYU A;  1FGM A;  3BLZ A;  1GOU A;  2CFD A;  1R4C A;  2RFR A;  2IYJ A;  4OVM A;  1MGW A;  1OHS A;  4HM3 B;  1K8A 4;  1BVI A;  1E3V A;  2CIU A;  1UGH I;  1QJG A;  1JB2 A;  2GBW B;  1E97 A;  2O3O A;  1AR0 A;  1KQS 2;  1IQY A;  4K90 B;  3S27 A;  4RZM A;  3CNM A;  1YNV X;  4HM5 B;  2Z6B A;  1DYU A;  1RGG A;  2RBI A;  1JBS A;  1VQ7 3;  3JUM A;  1BGS A;  1I2F A;  2HOH A;  3EC9 A;  7RNT A;  3JUQ A;  4FR9 A;  4J9A A;  3PCR A;  4RNT A;  4KFD A;  4XBX A;  2CK3 H;  3X3X A;  5LC6 A;  2YFJ B;  1VQK 3;  5BU4 A;  1MWT A;  2OTJ 3;  2OTL 3;  1SIH A;  1L5G B;  1YVS A;  3MKI A;  1S5A A;  5CF2 A;  3D4A A;  1UDI I;  4EV5 A;  1HKX A;  4OK0 A;  2GBX B;  1DMN A;  1JKG B;  2OOV A;  1IQ8 A;  1Q86 4;  3KFQ C;  3DGL A;  1T3B A;  2V1L A;  1MNL A;  4WP5 A;  1VQQ A;  1GD3 A;  2Z76 A;  3HI7 A;  4MJD A;  4WHA A;  2KF5 A;  1AVK A;  4LEH A;  4RNZ A;  2FNQ A;  1FYS A;  3FZW A;  2W6J H;  5BVB A;  2J8X B;  2UX0 A;  1O7N B;  1AY7 A;  3LXU X;  2UUG C;  3Q90 A;  2Y73 A;  4DKI A;  4CCV A;  2HMO B;  3PS8 A;  2Y74 A;  3DGO A;  1CYV A;  5KP1 A;  4JF8 A;  5JPU A;  1IQX A;  1O7G B;  1OUN A;  1WTH A;  1T2I A;  1RMS A;  2XFT A;  2UGI A;  5I97 A;  1BNG A;  1U8C B;  1I70 A;  1DVC A;  1W2B 2;  1E3R A;  1X1X A;  1TTO A;  1W6C A;  3BNB A;  3FF0 A;  2KAA A;  4LGQ A;  5A0O B;  9RNT A;  1JBR A;  1FUW A;  3D5I A;  1A2K A;  4RNY A;  3CCJ 3;  3ECF A;  3K5T A;  4MMY B;  3PZW A;  3UL5 A;  1GMQ A;  2I9W A;  3NQY A;  5EEO A;  3NBJ A;  3ZG5 A;  7GSP A;  1Q82 4;  1OHO A;  3AMO A;  1GOY A;  1RGH A;  1RTU A;  1ULJ B;  3MPH A;  1B2X A;  1RN7 A;  4HM8 B;  4PEJ A;  4JRF A;  1ROV A;  1NB5 I;  1VQP 3;  4N6U A;  4BU4 A;  1I0X A;  4L8P A;  2XR8 B;  2RGQ A;  4XDW A;  4XB5 A;  3G6E 3;  2CWV A;  1B20 A;  2PZV A;  3SVA A;  3DMC A;  3X3Z A;  1K41 A;  1M1K 4;  1PFP A;  2F56 A;  1B3S A;  1GMP A;  4R9L A;  1K28 A;  1B2Z A;  3X3Y A;  3IPT A;  1IVW A;  1RGE A;  3B8L A;  3NV0 A;  5HGR A;  1NJI 4;  1RGL A;  2GSP A;  4BL3 A;  1YJ9 3;  5KP4 A;  3EF8 A;  1BNJ A;  3RGR A;  2F98 A;  3LZA A;  2INX A;  1RGC A;  2JQ5 A;  2Q07 A;  4KFF A;  1DE3 A;  1BSB A;  1TJD A;  1T2H A;  2CC3 A;  1T5Y A;  3ALA A;  1NU3 A;  1TP6 A;  2OQE C;  1UI7 A;  3GWR A;  3KCH A;  4J8T A;  3DM8 A;  7STD A;  5AYS C;  4I4K A;  2Z7A A;  3G71 3;  3CCE 3;  1QVG 2;  2C10 A;  2XSH B;  4G1M B;  1STD A;  5LC7 A;  2O9U X;  1FGT A;  3D3L A;  1V74 A;  1G96 A;  2WGQ A;  3PCS A;  1EG9 B;  4FCJ A;  1I3F A;  1FGR A;  1Q81 4;  1RCK A;  3SLU A;  1JZD A;  1BU4 A;  2RCD A;  1W6Y A;  4WWU C;  4AKZ A;  5EVH A;  1CH0 A;  2STD A;  5BIR A;  1BAO A;  3JUO A;  1BRI A;  2W2C A;  2GEX A;  1SAR A;  2L4V A;  2P0M A;  3NM2 A;  1UCL A;  1M90 4;  1QAK A;  3B4P A;  4HVN A;  3WHO A;  1NDO B;  1YIT 3;  4CJN A;  3GZY B;  5IER A;  1NO3 A;  5JBS A;  1BSD A;  4IT7 A;  1MWU A;  1RCL A;  4HM7 B;  4NHF A;  1YGW A;  4I5Q A;  2H0H A;  4HBR A;  3I56 3;  1UI8 A;  3J7Y d;  1ULI B;  1TU5 A;  1MWR A;  3D9R A;  2LYX A;  3OXA A;  3K7C A;  1LOX A;  2JDI H;  3FCS B;  4BL2 A;  3G16 A;  2F5M A;  4CDL A;  1G02 A;  1A90 A;  2BMO B;  3UJM A;  8RNT A;  1CQS A;  3NBR A;  3WOF B;  3FSD A;  1WMP A;  1BRJ A;  3LT9 A;  5HOH A;  2XRX B;  1VQO 3;  3NQZ A;  3SXX A;  3VSY A;  4WFO A;  2ML5 A;  2GU1 A;  1NWW A;  2GU3 A;  1W4N A;  3VGN A;  2HMN B;  3WOD G;  1GMR A;  2BT3 A;  2P0X A;  1YVB I;  3ZFZ A;  4BTW A;  4ORL A;  3AGN A;  1VQL 3;  3CME 3;  5CK6 A;  1GSP A;  1RKY A;  3MYT A;  1FUT A;  1JN5 A;  3WA3 A;  3FG3 A;  4O2H A;  1OF5 B;  1QVF 2;  5AEW B;  3AHS A;  4WYK A;  4EW5 A;  2A15 A;  1VQ8 3;  1DET A;  1O7P B;  2L1S A;  1W6G A;  3I55 3;  1IVX A;  3X42 A;  2W56 B;  5ELJ A;  3DGN A;  3FKA A;  4KT3 B;  1PU4 A;  1BRG A;  3G4S 3;  3CCQ 3;  1VZZ A;  4K61 A;  1Q40 A;  1BRH A;  1TRQ A;  3F14 A;  1BSE A;  5IEN A;  1B21 A;  4J5K A;  5AIG A;  3U1W A;  3LT8 A;  3H3H A;  4GL6 A;  1BIR A;  1Z1S A;  5G1K A;  3NUV A;  4O3V A;  1RRL A;  1IU7 A;  1X1Y A;  2KF4 A;  1GD4 A;  3F8H A;  1N9E A;  3MG3 A;  1G0T A;  3N8B A;  4KVH A;  3S29 A;  3GRD A;  2OOV C;  1B27 A;  1B2M A;  4NRE A;  2R4I A;  3Q1C A;  3N54 B;  1N8R 4;  3DY5 A;  3G8Z A;  3Q2P A;  1FGO A;  1BRS A;  1OH0 A;  3D79 A;  3V98 A;  3TDG A;  3WOE B;  1EEJ A;  4H61 A;  1AV4 A;  2SBL A;  1K73 4;  1K9M 4;  3CPO A;  1DVD A;  1SQW A;  3F8X A;  1OCV A;  1TFO A;  3FG1 A;  3MSO A;  3NM7 A;  3IJE B;  4ILF A;  1ZX2 A;  3LTD A;  1RGA A;  1OPY A;  4EC6 A;  5IF6 A;  4K1V A;  1LRA A;  1DMQ A;  1X1U A;  5EQL A;  2W9P A;  3JUP A;  2H0G A;  3GZX B;  2LQV A;  1MWS A;  1YGE A;  1KD1 4;  2XEP A;  1ROA A;  4GB5 A;  3KE7 A;  1LXE A;  3UL6 A;  1UCI A;  1PY3 A;  2WOF A;  3MHE A;  3BB9 A;  3RGA A;  1UW1 A;  2ML6 A;  3MG2 A;  3CPW 2;  1WNH A;  1IVU A;  1LNH A;  3STD A;  5CXO A;  5AIF A;  1Y4K A;  1W5Z A;  1QAF A;  3HII A;  1FZU A;  2HML B;  2BIR A;  1WQL B;  3LML A;  3LTC A;  1BNS A;  1Q7H A;  1JV2 B;  4EYC A;  4KZ1 A;  1BAN A;  1EKM A;  3CCU 3;  3KSE D;  3FG4 A;  3PGB A;  5IG3 A;  2QEX 3;  8CHO A;  1W7C A;  1LNI A;  1BNR A;  2P09 A;  2XH9 A;  3F7S A;  2W03 A;  4RBN A;  1IDP A;  1ISK A;  5STD A;  2CX0 A;  4BTY A;  1QMA A;  2BMQ B;  4N6N B;  1N9J A;  2F5W A;  3SOA A;  2BHM A;  1GS3 A;  1JBT A;  3M8C A;  1QAL A;  3V92 A;  1BOX A;  3X41 A;  3EE1 A;  1HYF A;  4N3V A;  3OW2 2;  3CU3 A;  4FMD A;  1RGK A;  1LOY A;  4N6M A;  2CFW A;  2IUJ A;  4HZB B;  3LTB A;  2BNG A;  2XF3 A;  4EV2 A;  2D1W A;  1C54 A;  2XSO B;  1BSC A;  1NB3 I;  1RHL A;  3E99 A;  3S5C A;  1W2Z A;  4HYZ A;  1MGR A;  3O8Y A;  4FMB A;  5IEP A;  1C7H A;  3H51 A;  1BNE A;  3F7X A;  4LZI A;  2RNT A;  1WMN A;  3WA2 X;  4CPK A;  2KRT A;  2K0M A;  4U13 A;  3CCS 3;  2R41 A;  3L0R A;  3SX1 A;  4OUQ A;  1GY7 A;  4X2H A;  4R1K A;  3DH2 A;  1W02 A;  3AMO B;  4BIR A;  1W01 A;  1OAC A;  1D6Y A;  1M1X B;  3HX8 A;  1MOL A;  1TRP A;  1YHQ 3;  1N8Q A;  4HZ9 B;  3KZT A;  3LH4 A;  6STD A;  3WMD A;  1VQM 3;  1GOV A;  4EBG A;  2CX1 A;  2FGT A;  2IY2 A;  3UB1 A;  3OWU A;  3WR2 A;  1D6U A;  4QWT A;  2MC8 A;  3KSP A;  3CC7 3;  1EQK A;  1D6Z A;  1HZ1 A;  1LOV A;  3AGO A;  3S67 A;  1KSI A;  3S28 A;  1RN1 A;  3CCR 3;  2AAD A;  2KF6 A;  2K3D A;  3V99 A;  1IT7 A;  3T8N A;  1UCJ A;  3IMA B;  1JKG A;  1V57 A;  3URP A;  1LQG C;  3NV0 B;  2OWP A;  5FGO A;  3D5G A;  5IG0 A;  1W00 A;  3LTA A;  2YX9 A;  3FH1 A;  4AKY A;  1RLS A;  4L7K A;  3DGM A;  2ZHX B;  1GY5 A;  1UUG B;  1I0V A;  3FF2 A;  3KKG A;  1O7W B;  4HM4 B;  4N6V 0;  1ZO2 A;  1N5H A;  1RNT A;  1NNV A;  3OV4 A;  5BXQ A;  1S72 3;  3UNL A;  1YJW 3;  3EX9 A;  2QA4 3;  3OWY A;  3RDE A;  4K1U A;  3K63 A;  3KII A;  4O02 B;  4O8S A;  2F4Y A;  1GY6 A;  2XGL A;  1JJ2 2;  4N6T A;  3F40 A;  2KCD A;  5IW9 A;  2CHC A;  3KN4 A;  3EQQ B;  4FMC A;  5AIH A;  1LVN A;  1U5O A;  3WDG B;  3NX0 A;  1BRK A;  2WO0 A;  4HJL B;  1TIJ A;  2W0Q A;  3A5E A;  4N6O B;  2E2V A;  3F9S A;  1IT8 A;  1JZO A;  2BO9 B;  5RNT A;  5IG5 A;  3QRD A;  1ASK A;  3T8U A;  1I2G A;  2HMM B;  1VQ5 3;  1AVL A;  1IV9 A;  2Z77 A;  1LOW A;  5M19 A;  3CCM 3;  4FMA A;  5ELU A;  2ZDJ A;  4HOH A;  5AII A;  5M18 A;  3FLJ A;  1STF I;  1VQ4 3;  1VQ6 3;  3AHW A;  3CCV 3;  1OGX A;  5D82 A;  3CCL 3;  3GAX A;  3N9H A;  2CW9 A;  3DGY A;  4HAA A;  4L8O A;  3EBY A;  3EJV A;  4HM6 B;  1IV7 A;  3BNC A;  1YI2 3;  2CWU A;  1HU9 A;  1LQM B;  1UUW B;  1B2S A;  5M1A A;  1SJW A;  2BMR B;  2E2T A;  2IMJ A;  3EN1 B;  3QK9 A;  4LMI A;  2XGN A;  2HMK B;  2AAE A;  1EUI C;  1UCK A;  2IUK A;  3DUK A;  4KFE A;  4LSO A;  4ZM8 A;  2CFL A;  2QGU A;  3OX9 A;  2RSX A;  3NBB A;  4N6L A;  3CMA 3;  3EN8 A;  1A2V A;  3HK4 A;  4MEI A;  1I8V A;  1BRN L;  1V58 A;  1M9G A;  1N5P A;  5G2G A;  3PYJ A;  4FCZ A;  2W9Q A;  1KWI A;  1TUH A;  1JRQ A;  1TFK A;  2P05 A;  1SPU A;  1RGF A;  2KF3 A;  3ER7 A;  4HM2 B;  1FW7 A;  3BIR A;  1JB4 A;  3K9M C;  2E2U A;  2H0I A;  5FW5 A;  3VF1 A;  1JN5 B;  1DMM A;  5IEO A;  1RJO A;  3B4O A;  3GZB A;  4WYK B;  4EXR A;  3U97 A;  4AEQ A;  3HZP A;  3OWS A;  5AYR B;  2CH9 A;  3SED A; 
#chains in the Genus database with same CATH homology
 2F99 A;  1Q40 B;  2CG1 A;  3NXJ A;  1EA2 A;  5KP3 A;  2WOH A;  3MG1 A;  4BTX A;  2CFG A;  2WGO A;  2YFI B;  4XBY A;  1YJN 3;  2GXF A;  3CNX A;  5CLK A;  3FGY A;  3K0Z A;  2C11 A;  5DRV A;  3EBT A;  1KC8 4;  2XFS A;  2KXG A;  4HM0 B;  1WMO A;  4R80 A;  3CC4 3;  3LOY A;  2OCT A;  5DRE A;  2FXT A;  3EHC A;  1OGZ A;  2QIY A;  3PXM A;  2B1X B;  3CXC 2;  2IA7 A;  3NHX A;  1IVV A;  4XBT A;  5IG4 A;  2OQE A;  2MF7 A;  3JVC A;  3LYG A;  4MMX B;  1FA3 A;  3DXO A;  4MMZ B;  3BNE A;  3X40 A;  1GYB A;  1US1 A;  3B7C A;  3GZR A;  4R9K A;  2YFL B;  5AI1 A;  2CFK A;  4Q53 A;  2HMJ B;  1JNQ A;  4HM1 B;  3T0U A;  1A67 A;  1BUQ A;  1F8N A;  5TGN A;  1IK3 A;  3JUN A;  2CG0 A;  5D83 A;  2K54 A;  5AEU B;  1FGQ A;  1VQN 3;  2D42 A;  4IPB A;  2CKF B;  1SII A;  1OF5 A;  3G0K A;  4X2O A;  3SOY A;  3MWZ A;  4IIA A;  2W04 A;  7STD A;  3BND A;  4HKV B;  4XM4 A;  2M7O A;  3I0Y A;  4TX4 A;  2W56 A;  3HIG A;  1CYU A;  2F86 B;  2CWT A;  1YIJ 3;  5D81 A;  1JB5 A;  1OHP A;  2PNC A;  1RRH A;  4STD A;  3EB8 A;  3ROB A;  2P38 A;  1O7M B;  2GEY A;  1Q7Y 4;  3CD6 3;  4FCM A;  4H3U A;  3DZL A;  1O7H B;  4XDV A;  1J2B A;  3A76 A;  3CC2 3;  4R4K A;  5JPP A;  2B24 B;  5CF1 A;  1CEW I;  1Q42 A;  1UUV B;  2ZL8 A;  1VQ9 3;  1FGM A;  3BLZ A;  2CFD A;  1R4C A;  2RFR A;  4OVM A;  1OHS A;  4HM3 B;  1K8A 4;  1E3V A;  2CIU A;  1QJG A;  1JB2 A;  2GBW B;  1E97 A;  2O3O A;  1AR0 A;  1KQS 2;  1IQY A;  4K90 B;  3S27 A;  4RZM A;  3CNM A;  4HM5 B;  2Z6B A;  1DYU A;  1VQ7 3;  3JUM A;  3EC9 A;  3JUQ A;  4FR9 A;  4J9A A;  3PCR A;  4KFD A;  4XBX A;  2CK3 H;  3X3X A;  5LC6 A;  2YFJ B;  1VQK 3;  2OTJ 3;  2OTL 3;  1SIH A;  1L5G B;  3MKI A;  1S5A A;  5CF2 A;  4EV5 A;  1HKX A;  4OK0 A;  2GBX B;  1DMN A;  1JKG B;  2OOV A;  1IQ8 A;  1Q86 4;  3KFQ C;  3DGL A;  2V1L A;  1MNL A;  4WP5 A;  1GD3 A;  2Z76 A;  3HI7 A;  4MJD A;  4WHA A;  1AVK A;  4LEH A;  4RNZ A;  2FNQ A;  3FZW A;  2W6J H;  5BVB A;  2UX0 A;  1O7N B;  3LXU X;  3Q90 A;  2Y73 A;  4CCV A;  2HMO B;  3PS8 A;  2Y74 A;  3DGO A;  1CYV A;  5KP1 A;  4JF8 A;  5JPU A;  1IQX A;  1O7G B;  1OUN A;  1WTH A;  2XFT A;  5I97 A;  1U8C B;  1DVC A;  1W2B 2;  1E3R A;  5A0O B;  3BNB A;  1W6C A;  4LGQ A;  3FF0 A;  1FUW A;  1A2K A;  4RNY A;  3CCJ 3;  3ECF A;  3K5T A;  4MMY B;  3PZW A;  3UL5 A;  2I9W A;  3NQY A;  5EEO A;  3NBJ A;  1Q82 4;  1OHO A;  3AMO A;  1ULJ B;  3MPH A;  1RN7 A;  4HM8 B;  4PEJ A;  4JRF A;  1ROV A;  1NB5 I;  1VQP 3;  4N6U A;  4L8P A;  2XR8 B;  2RGQ A;  4XDW A;  4XB5 A;  3G6E 3;  2CWV A;  2PZV A;  3SVA A;  3DMC A;  3X3Z A;  1K41 A;  1M1K 4;  1PFP A;  4R9L A;  1K28 A;  3X3Y A;  3IPT A;  1IVW A;  3B8L A;  3NV0 A;  5HGR A;  1NJI 4;  1YJ9 3;  5KP4 A;  3EF8 A;  3RGR A;  2F98 A;  3LZA A;  2INX A;  2JQ5 A;  2Q07 A;  4KFF A;  2CC3 A;  1T5Y A;  3ALA A;  1NU3 A;  1TP6 A;  2OQE C;  1UI7 A;  3GWR A;  4J8T A;  3DM8 A;  5AYS C;  4I4K A;  2Z7A A;  3G71 3;  3CCE 3;  1QVG 2;  2C10 A;  2XSH B;  4G1M B;  1STD A;  5LC7 A;  2O9U X;  1FGT A;  3D3L A;  1V74 A;  1G96 A;  2WGQ A;  3PCS A;  1EG9 B;  4FCJ A;  1FGR A;  1Q81 4;  3SLU A;  2RCD A;  1W6Y A;  4WWU C;  4AKZ A;  5EVH A;  2STD A;  3JUO A;  2W2C A;  2GEX A;  2L4V A;  2P0M A;  3NM2 A;  1M90 4;  1QAK A;  3B4P A;  4HVN A;  1NDO B;  1YIT 3;  3GZY B;  5IER A;  1NO3 A;  4IT7 A;  4HM7 B;  4NHF A;  4HBR A;  3I56 3;  1UI8 A;  3J7Y d;  1ULI B;  1TU5 A;  3D9R A;  2LYX A;  3OXA A;  3K7C A;  1LOX A;  2JDI H;  3FCS B;  3G16 A;  4CDL A;  1A90 A;  2BMO B;  3UJM A;  1CQS A;  3NBR A;  3WOF B;  3FSD A;  1WMP A;  3LT9 A;  1VQO 3;  2XRX B;  3NQZ A;  3SXX A;  3VSY A;  4WFO A;  2ML5 A;  2GU1 A;  1NWW A;  2GU3 A;  1W4N A;  3VGN A;  2HMN B;  3WOD G;  2P0X A;  2BT3 A;  1YVB I;  4BTW A;  4ORL A;  1VQL 3;  3CME 3;  5CK6 A;  1RKY A;  3MYT A;  1JN5 A;  3WA3 A;  3FG3 A;  4O2H A;  1OF5 B;  1QVF 2;  5AEW B;  4WYK A;  1VQ8 3;  2A15 A;  1O7P B;  1W6G A;  3I55 3;  1IVX A;  3X42 A;  2W56 B;  5ELJ A;  3DGN A;  3FKA A;  1PU4 A;  3CCQ 3;  1VZZ A;  4K61 A;  1Q40 A;  3F14 A;  5IEN A;  3U1W A;  5AIG A;  3LT8 A;  3H3H A;  4GL6 A;  1Z1S A;  3NUV A;  4O3V A;  1RRL A;  1IU7 A;  3F8H A;  3MG3 A;  1GD4 A;  3N8B A;  1N9E A;  3S29 A;  4KVH A;  3GRD A;  2OOV C;  4NRE A;  2R4I A;  3Q1C A;  3N54 B;  1N8R 4;  3DY5 A;  3G8Z A;  3Q2P A;  1FGO A;  1OH0 A;  3V98 A;  3TDG A;  3WOE B;  4H61 A;  1AV4 A;  2SBL A;  1K73 4;  1K9M 4;  3CPO A;  1DVD A;  1SQW A;  3F8X A;  1OCV A;  1TFO A;  3FG1 A;  3MSO A;  3NM7 A;  3IJE B;  1ZX2 A;  3LTD A;  1OPY A;  4EC6 A;  5IF6 A;  4K1V A;  1DMQ A;  5EQL A;  2W9P A;  3JUP A;  3GZX B;  2LQV A;  1YGE A;  1KD1 4;  2XEP A;  1ROA A;  4GB5 A;  3KE7 A;  1LXE A;  3UL6 A;  2WOF A;  3MHE A;  3BB9 A;  3RGA A;  1UW1 A;  2ML6 A;  3MG2 A;  3CPW 2;  1WNH A;  1IVU A;  1LNH A;  3STD A;  5CXO A;  5AIF A;  1Y4K A;  1W5Z A;  1QAF A;  3HII A;  2HML B;  1WQL B;  3LML A;  3LTC A;  1JV2 B;  4EYC A;  4KZ1 A;  1EKM A;  3CCU 3;  3KSE D;  3FG4 A;  3PGB A;  5IG3 A;  2QEX 3;  8CHO A;  1W7C A;  2P09 A;  2XH9 A;  3F7S A;  2W03 A;  4RBN A;  1IDP A;  1ISK A;  5STD A;  4BTY A;  1QMA A;  2BMQ B;  4N6N B;  1N9J A;  3SOA A;  1GS3 A;  2BHM A;  3M8C A;  1QAL A;  3V92 A;  3X41 A;  3EE1 A;  4N3V A;  3OW2 2;  3CU3 A;  4FMD A;  4N6M A;  2CFW A;  2IUJ A;  4HZB B;  3LTB A;  2BNG A;  2XF3 A;  4EV2 A;  2D1W A;  2XSO B;  3S5C A;  1NB3 I;  3E99 A;  1W2Z A;  4HYZ A;  3O8Y A;  4FMB A;  5IEP A;  1C7H A;  3H51 A;  3F7X A;  4LZI A;  1WMN A;  3WA2 X;  2KRT A;  2K0M A;  4U13 A;  3CCS 3;  3L0R A;  3SX1 A;  4OUQ A;  1GY7 A;  4X2H A;  4R1K A;  1W02 A;  3AMO B;  1W01 A;  1OAC A;  1D6Y A;  1M1X B;  3HX8 A;  1MOL A;  1YHQ 3;  1N8Q A;  4HZ9 B;  3KZT A;  3LH4 A;  6STD A;  3WMD A;  1VQM 3;  4EBG A;  2FGT A;  3UB1 A;  3OWU A;  1D6U A;  4QWT A;  2MC8 A;  3KSP A;  3CC7 3;  1EQK A;  1D6Z A;  3S67 A;  3S28 A;  1KSI A;  3CCR 3;  3V99 A;  1IT7 A;  3T8N A;  3IMA B;  1JKG A;  3NV0 B;  2OWP A;  5FGO A;  5IG0 A;  1W00 A;  3LTA A;  2YX9 A;  3FH1 A;  4AKY A;  4L7K A;  3DGM A;  5JBS A;  1GY5 A;  3FF2 A;  3KKG A;  4N6V 0;  4HM4 B;  1O7W B;  3G4S 3;  1ZO2 A;  1N5H A;  3OV4 A;  5BXQ A;  1S72 3;  3UNL A;  1YJW 3;  3EX9 A;  2QA4 3;  3OWY A;  3RDE A;  4K1U A;  3K63 A;  3KII A;  4O02 B;  4O8S A;  2XGL A;  1GY6 A;  1JJ2 2;  4N6T A;  3F40 A;  2KCD A;  5IW9 A;  2CHC A;  3KN4 A;  3EQQ B;  4FMC A;  5AIH A;  1LVN A;  1U5O A;  3WDG B;  3NX0 A;  2WO0 A;  4HJL B;  1TIJ A;  2W0Q A;  4N6O B;  2E2V A;  3F9S A;  1IT8 A;  2BO9 B;  5IG5 A;  3QRD A;  1ASK A;  3T8U A;  2HMM B;  1VQ5 3;  1AVL A;  1IV9 A;  2Z77 A;  3CCM 3;  4FMA A;  5ELU A;  2ZDJ A;  5AII A;  3FLJ A;  1STF I;  1VQ4 3;  1VQ6 3;  3CCV 3;  1OGX A;  5D82 A;  3CCL 3;  3GAX A;  3N9H A;  2CW9 A;  4L8O A;  1YI2 3;  3EBY A;  3EJV A;  4HM6 B;  1IV7 A;  3BNC A;  2CWU A;  1HU9 A;  1UUW B;  1SJW A;  2BMR B;  2E2T A;  2IMJ A;  3EN1 B;  3QK9 A;  4LMI A;  2XGN A;  2HMK B;  2IUK A;  3DUK A;  4KFE A;  4LSO A;  4ZM8 A;  2CFL A;  2QGU A;  3OX9 A;  2RSX A;  3NBB A;  4N6L A;  3CMA 3;  3EN8 A;  1A2V A;  3HK4 A;  4MEI A;  1M9G A;  1N5P A;  5G2G A;  3PYJ A;  4FCZ A;  2W9Q A;  1KWI A;  1TUH A;  1JRQ A;  1TFK A;  2P05 A;  1SPU A;  3ER7 A;  4HM2 B;  1JB4 A;  3K9M C;  2E2U A;  5FW5 A;  3VF1 A;  1JN5 B;  1DMM A;  5IEO A;  1RJO A;  3B4O A;  3GZB A;  4WYK B;  4EXR A;  3U97 A;  4AEQ A;  3HZP A;  3OWS A;  5AYR B;  2CH9 A;  3SED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...