1BNGA

Barnase s85c/h102c disulfide mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNCDRILYSSDWLIYKTTDCYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Disulfide mutants of barnase. I: Changes in stability and structure assessed by biophysical methods and X-ray crystallography.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bngA00
1I2GA 1GMQA 1BOXA 4HOHA 1GOYA 2SARA 1B20A 1B2SA 1I8VA 3SYUA 1FW7A 1RGCA 1C54A 1YVSA 4BU4A 2F4YA 1HZ1A 1T2HA 2AADA 3KCHA 3A5EA 4J5KA 1B2UA 1GOUA 1B3SA 1I0XA 2KF4A 1TRPA 1X1YA 7GSPA 1BU4A 5GSPA 1FUTA 4BIRA 3AHSA 1JBSA 1BSCA 1BNJA 1LOWA 3D5GA 6GSPA 1RHLA 4HAAA 1BSBA 1LOYA 1BNIA 1LOVA 1BNSA 1RGFA 5HOHA 1RGKA 1DE3A 1LNIA 1BANA 1BRIA 3DH2A 1G02A 3WR2A 2F5MA 1BRHA 1I2EA 1BRJA 1FYSA 1BSEA 1B27A 2AAEA 1MGWA 1BUJA 1UCIA 3BU4A 1FZUA 1UCKA 1X1XA 1BNGA 4J5GA 1R4YA 2F56A 1AY7A 2KF5A 1Q9EA 2KAAA 1RSNA 3AGOA 1T2IA 1GSPA 1RGLA 8RNTA 1RNTA 1RCLA 1BSDA 6RNTA 3URPA 1RN1A 1I3IA 1BIRA 1TTOA 1UCJA 2ZA4A 1B2MA 1UCLA 1MGRA 1A2PA 3GSPA 1BRSA 1LRAA 1RGGA 1BVIA 1HYFA 3DGYA 1FUSA 1BAOA 3Q3FA 1RGHA 2BIRA 2BU4A 1GMPA 1B2XA 1DETA 3BIRA 1SARA 1B2ZA 3AGNA 2KF3A 1YGWA 1AQZA 3HOHA 2KF6A 5RNTA 1GMRA 9RNTA 2F5WA 4GHOA 1BRKA 1RGAA 2HOHA 1PYLA 4GSPA 1BRNL 1RDSA 1B21A 3RNTA 3D4AA 1BNEA 1TRQA 4RNTA 1BRGA 3AHWA 3D5IA 1JBTA 1PY3A 1RNBA 1I70A 2C4BA 1JBRA 5BIRA 1RMSA 3WHOA 1BNRA 2RBIA 7RNTA 2GSPA 1GOVA 1ZGXA 1X1UA 1RCKA 1RN4A 1I3FA 1BGSA 1RGEA 2RNTA 1CH0A 1RLSA 1RTUA 1X1WA 1BNFA 1IYYA 1I2FA 5BU4A 1YNVX 1I0VA 1BSAA
chains in the Genus database with same CATH superfamily
3LOYA 3NBJA 1TP6A 4MMXB 4HOHA 3M8CA 3CCS3 3HK4A 1VZZA 2K54A 5G1KA 3CME3 3FCSB 3IPTA 1JN5A 2P05A 1RGCA 1SIIA 1O7MB 5AIIA 4HM1B 1HZ1A 3PYJA 1V57A 3OWUA 3A5EA 3MG2A 1OF5A 4FMBA 5TGNA 2QGUA 1VQM3 3T0UA 1S723 1I0XA 1GY6A 3FZWA 1TRPA 2Q07A 1Q814 2W04A 3KE7A 4Q53A 5D81A 1BU4A 2P09A 1FUTA 2GU3A 3KIIA 3VGNA 1OHPA 5CXOA 2XH9A 4BIRA 2D1WA 3QRDA 3DY5A 3D5GA 3F7XA 1VQ93 6GSPA 4HZ9B 1QAFA 1LOXA 4FMCA 4AKZA 2QIYA 1BNIA 3B4OA 1VQL3 1IVWA 3S5CA 5HOHA 1RGKA 3ECFA 2Y74A 5EVHA 1TU5A 3ROBA 1YIJ3 4WYKA 1Q7HA 2W6JH 3CCU3 2P0MA 3H51A 1YJW3 1I2EA 2W9QA 1BRJA 1FYSA 1NWWA 1Q42A 2CG0A 2M7OA 1B27A 1SJWA 2OOVC 1K8A4 1W5ZA 1TIJA 1MGWA 3FSDA 2OTL3 3SXXA 5ELJA 2CFWA 3NX0A 3BU4A 2WO0A 4OUQA 3U1WA 4J8TA 1BNGA 4J5GA 2OTJ3 1R4YA 3FG4A 1OUNA 2BHMA 3EBTA 3VSYA 1RSNA 1TFKA 1Y4KA 5IEOA 1OH0A 3LTDA 2CG1A 3G16A 2YX9A 1RKYA 1VQQA 3FG1A 1QVF2 3I563 1RN7A 1F8NA 1BSDA 3ER7A 3PZWA 4HM0B 5LC7A 3SLUA 4ORLA 1RN1A 1IVXA 3CD63 1TTOA 1EG9B 3FG3A 2GBXB 1NB5I 2W56B 1G0TA 2ZL8A 1IQ8A 1UGHI 3GSPA 1BRSA 3LT9A 3QK9A 1BVIA 4FCMA 2OOVA 3CC23 2F98A 2QEX3 3EE1A 1WMPA 4HJLB 1W6YA 3CCQ3 3H3HA 3UB1A 1N9JA 4K1UA 3BIRA 3G4S3 3MSOA 3EBYA 2YFJB 2KF3A 3X41A 2I9WA 1AQZA 1BUQA 1UUVB 2KF6A 5RNTA 1GMRA 2CK3H 1N9EA 1V58A 1WMOA 2KCDA 4IIAA 9RNTA 1E3VA 2R4IA 4RBNA 4HZBB 1VQ43 1PYLA 3I553 1RDSA 3OWYA 1N8QA 2KRTA 3D4AA 4RNTA 1TRQA 1W02A 4LEHA 1US1A 2CX0A 1O7HB 1OHSA 4R80A 2C4BA 3B7CA 4NPBA 3STDA 1JBRA 1RMSA 2HMLB 4LMIA 4CJNA 3GZRA 5IERA 4X2HA 2IY2A 1QMAA 1ZGXA 5AEUB 1X1UA 1JB5A 1RCKA 2XSHB 4I4KA 3NXJA 1YJN3 1GY5A 2CFKA 4L8PA 4RNZA 2YFIB 5LC6A 3RDEA 4EV5A 1DE3A 4HM4B 3WA3A 4EBGA 1BSAA 3AGOA 3EQQB 1OGXA 1GMQA 3N8BA 3T8NA 2CWTA 3J7Yd 2OQEC 2W9PA 5CF1A 3DXOA 1GOYA 1JZOA 2SARA 4XB5A 1B20A 4R1KA 3U97A 2CFLA 3SYUA 4IT7A 1KD14 3BNBA 1YVSA 1M1XB 2F4YA 5IEPA 3SOAA 1VQO3 1Q40A 5CF2A 4XM4A 5IG3A 1IVVA 3AMOA 1GYBA 1IT7A 3NQZA 4XBYA 4J5KA 3LTCA 5BXQA 1ZO2A 2IUJA 1B3SA 1X1YA 1FGMA 3KN4A 3SVAA 3SEDA 1JBSA 5AI1A 1BSCA 3HI7A 1JKGB 4MMYB 1IQYA 2MF7A 4N6V0 5M19A 2OQEA 1MOLA 3EB8A 3K63A 4ZM8A 2GEYA 3EHCA 2HMKB 1NJI4 1S5AA 4CPKA 4O8SA 4O02B 1VQP3 1UUGB 3KSPA 1LOYA 3LH4A 5CLKA 2CWUA 1RJOA 1W6CA 2BMOB 1O7WB 1M9GA 2YFLB 3GAXA 4STDA 1ZX2A 1YIT3 3G713 1LNIA 1G02A 3LYGA 5FGOA 3WR2A 1YI23 1RRHA 1M1K4 1SPUA 1TFOA 5KP4A 2FXTA 3CMA3 5DREA 1GY7A 1UCIA 4EV2A 5D82A 3E99A 1FZUA 1UCKA 3A76A 3MYTA 4JF8A 3KKGA 2INXA 3CCE3 5IW9A 2KXGA 1VQK3 1Q9EA 1W00A 3DMCA 3EN8A 3CCR3 4WYKB 1VQ83 4GL6A 2H0GA 3NBRA 5DRVA 2W0QA 4L7KA 2CWVA 2Z76A 2CC3A 1GSPA 1RGLA 1A2VA 1OACA 3DGNA 2J8XB 1WMNA 4FMDA 4LGQA 2A15A 3MPHA 4BL3A 1CQSA 2BMQB 3FH1A 1BIRA 3BNDA 1B2MA 1UCLA 3KFQC 1QAKA 2JDIH 1RGGA 1LRAA 1ULIB 3DGYA 3CCV3 3PGBA 4WFOA 3EN1B 3F8XA 4HM7B 3S29A 3CPW2 2IA7A 4MJDA 2BU4A 2SBLA 3HX8A 1GMPA 3GZBA 1L5GB 3DGMA 4BTWA 1SARA 3AGNA 3CNMA 5A0OB 1YGWA 3GZYB 1UDII 4I5QA 4HVNA 2OWPA 3I0YA 1MWSA 4EXRA 1BRKA 3Q1CA 1RGAA 2XFSA 3F7SA 5AEWB 3MG3A 5AYRB 1JB4A 4WWUC 1BRNL 2P38A 2UUGC 2XR8B 5EEOA 1W2ZA 5IG5A 4EC6A 1BNEA 3IJEB 5ELUA 2UGIA 1BRGA 1W6GA 1K734 1AVKA 2E2TA 3D5IA 4HBRA 1J2BA 4X2OA 1I70A 3JUPA 3WHOA 1BNRA 2F86B 1FGOA 4H61A 4K90B 1Q824 1QALA 2RNTA 5JBSA 5CK6A 3V98A 3WOEB 1IQXA 1BNFA 1IYYA 3X40A 3B4PA 1NNVA 5BU4A 4AKYA 1EQKA 4BTXA 1I2GA 1UGIA 4KFEA 3BLZA 2QA43 2XF3A 3LTBA 1ROVA 3K7CA 2BMRB 1B2SA 1C7HA 2C11A 1A67A 2GXFA 1GD4A 3T8UA 4BU4A 1DVDA 1T2HA 2K0MA 3CCJ3 3FLJA 2ZHXB 1WNHA 3MWZA 2WOHA 3X3YA 3HIGA 4OVMA 1SIHA 2W56A 3S67A 2MC8A 3BNEA 5GSPA 2CW9A 4J9AA 1BNJA 1LOWA 1MWTA 4HM5B 4HKVB 2HMNB 4N6OB 1IV9A 1JB2A 2GU1A 3ZFZA 2B24B 1IT8A 1UUWB 2O9UX 4N6UA 1IU7A 1N8R4 1BSBA 2JQ5A 2H0HA 4H3UA 1LOVA 1LQMB 3PXMA 1RGFA 1R4CA 4G1MB 2PNCA 4HM2B 4R9LA 1DYUA 1VQ63 1BANA 1W4NA 4RNYA 1ULJB 1RRLA 1LQGC 1BRIA 1AVLA 3DH2A 3HIIA 3NV0B 4FMAA 4R9KA 3S27A 1BRHA 3G8ZA 1EA2A 2CKFB 2XEPA 3OV4A 3F8HA 1GS3A 2CH9A 2AAEA 3BB9A 3JUMA 3UJMA 3ZG0A 2IUKA 2Z6BA 2IMJA 1LVNA 1O7PB 1X1XA 1OCVA 1NO3A 4FCZA 4KT3B 4CDLA 4IPBA 1Q864 1N5PA 3UL5A 1JN5B 2Z77A 4K1VA 4EW5A 1JNQA 1KC84 4L8OA 1PU4A 2WOFA 1MWUA 3DZLA 3JVCA 5G1LA 3DUKA 1CYUA 3X3ZA 1RCLA 4N6MA 3F40A 1OF5B 6RNTA 1D6UA 2ZA4A 4XBTA 1KWIA 2HMOB 2R41A 1A2PA 1MNLA 4BTYA 2OCTA 1JRQA 3LXUX 1JV2B 1TJDA 5M1AA 1BAOA 3Q3FA 2LQVA 2FGTA 1E3RA 2O3OA 5FW5A 4JRFA 2XSOB 4N3VA 1JZDA 4XDVA 1B2XA 5KP3A 3ZG5A 1DETA 4LZIA 2F99A 3RGAA 2E2UA 1B2ZA 3F9SA 3F14A 3CC43 3KSED 2W03A 3WDGB 3G6E3 3V99A 1YJ93 7STDA 3PCSA 3FKAA 3OWSA 1NU3A 3CCM3 1VQN3 1JKGA 3OX9A 4KFDA 4O2HA 4QWTA 4R4KA 5JPPA 4N6NB 4GSPA 3UL6A 1B21A 3EX9A 3RNTA 1MWRA 3NBBA 4KFFA 3K5TA 3EF8A 3CXC2 2CIUA 1GD3A 2CX1A 3NM2A 5BIRA 4LYLB 1WQLB 2BO9B 5AIHA 7RNTA 2GSPA 3LTAA 1OGZA 2L1SA 1OPYA 2BT3A 3LZAA 5AIGA 3OW22 1FGRA 1DVCA 2V1LA 1IDPA 1I3FA 3NQYA 4K61A 1RGEA 1RTUA 1RLSA 1X1WA 5HGRA 3N9HA 2CFDA 1YNVX 1I0VA 2GBWB 2XGNA 2XGLA 3LMLA 4EYCA 1KQS2 1BOXA 1UW1A 3FGYA 3NUVA 2XFTA 2ML5A 1AV4A 1I8VA 1FW7A 3WODG 2FNQA 1UI8A 3TDGA 1M904 1C54A 1KSIA 8CHOA 4FR9A 3WA2X 3LT8A 2AADA 4NREA 1OHOA 3KCHA 3WMDA 4DKIA 2E2VA 2W2CA 1B2UA 1TUHA 2GEXA 1GOUA 3CPOA 3CCL3 4TX4A 5AYSC 2RSXA 2KF4A 4N6LA 5M18A 1U5OA 3VF1A 3GZXB 7GSPA 3MG1A 3K0ZA 3AHSA 3FF2A 1AR0A 2RGQA 1IV7A 3DM8A 3O8YA 4KZ1A 4MEIA 1VQ53 1FA3A 3N54B 1W2B2 1LNHA 1RHLA 3CNXA 3D79A 4HAAA 1QVG2 1PFPA 1DMMA 1ASKA 1LXEA 3D3LA 4KVHA 4PEJA 1T5YA 5BVBA 2UX0A 2WGQA 1BNSA 1T3BA 4RZMA 1IK3A 1G96A 4XBXA 1ZS7A 5IG0A 3DGLA 2C10A 2RCDA 1V74A 1EUIC 4XDWA 5D83A 2F5MA 2B1XB 3RGRA 2D42A 3X3XA 5IF6A 1D6YA 5IENA 1BSEA 1FGQA 3L0RA 4HM3B 1BUJA 4ILFA 1O7GB 1N5HA 3MHEA 1HKXA 3HZPA 2XRXB 2P0XA 3MKIA 3JUNA 3UNLA 3FF0A 4CCVA 3CC73 1HU9A 4WHAA 3S28A 2F56A 2H0IA 1A2KA 1AY7A 2KF5A 2K3DA 1CYVA 3JUOA 2WGOA 4BL2A 4N6TA 1A90A 2KAAA 3BNCA 3B8LA 1FUWA 1Q40B 1E97A 5IG4A 3AMOB 1T2IA 1FGTA 1Z1SA 4HM6B 8RNTA 4NHFA 3KZTA 1RNTA 3WOFB 1YGEA 3NHXA 1WTHA 1K9M4 3URPA 3CU3A 4FCJA 1ROAA 1I3IA 1UCJA 1ISKA 3DGOA 1EEJA 5G2GA 1MGRA 3Q2PA 3Q90A 2Y73A 4U13A 2CHCA 2L4VA 1HYFA 4HM8B 3SX1A 2RFRA 4GB5A 1YVBI 1FUSA 1UI7A 3EJVA 4O3VA 1YHQ3 3D9RA 1RGHA 1CEWI 2Z7AA 3NM7A 2BIRA 2PZVA 2CFGA 2HMMB 5KP1A 3JUQA 1DMNA 1STFI 3HOHA 5JPUA 2F5WA 4GHOA 2HOHA 3PS8A 5STDA 3PCRA 3EC9A 1JJ22 1K28A 2STDA 5I97A 3V92A 3K9MC 3OXAA 3SOYA 1IVUA 3GWRA 1Q7Y4 1NB3I 1STDA 3IMAB 2ML6A 2HMJB 3AHWA 1JBTA 1PY3A 1U8CB 1VQ73 1DMQA 1RNBA 1W01A 1K41A 2BNGA 2ZDJA 2RBIA 1GOVA 1O7NB 3G0KA 3NV0A 3X42A 4AEQA 2LYXA 2IYJA 1RN4A 1EKMA 1BGSA 4OK0A 5EQLA 1SQWA 4LSOA 1CH0A 3GRDA 4HYZA 1NDOB 4WP5A 1QJGA 1W7CA 1I2FA 4MMZB 3ALAA 6STDA 1D6ZA 5AIFA
chains in the Genus database with same CATH topology
1I2GA 1GMQA 1BOXA 4HOHA 1GOYA 2SARA 1B20A 1B2SA 1I8VA 3SYUA 1FW7A 1RGCA 1C54A 1YVSA 4BU4A 2F4YA 1HZ1A 1T2HA 2AADA 3KCHA 3A5EA 4J5KA 1B2UA 1GOUA 1B3SA 1I0XA 2KF4A 1TRPA 1X1YA 7GSPA 1BU4A 5GSPA 1FUTA 4BIRA 3AHSA 1JBSA 1BSCA 1BNJA 1LOWA 3D5GA 6GSPA 1RHLA 4HAAA 1BSBA 1LOYA 1BNIA 1LOVA 1BNSA 1RGFA 5HOHA 1RGKA 1DE3A 1LNIA 1BANA 1BRIA 3DH2A 1G02A 3WR2A 2F5MA 1BRHA 1I2EA 1BRJA 1FYSA 1BSEA 1B27A 2AAEA 1MGWA 1BUJA 1UCIA 3BU4A 1FZUA 1UCKA 1X1XA 1BNGA 4J5GA 1R4YA 2F56A 1AY7A 2KF5A 1Q9EA 2KAAA 1RSNA 3AGOA 1T2IA 1GSPA 1RGLA 8RNTA 1RNTA 1RCLA 1BSDA 6RNTA 3URPA 1RN1A 1I3IA 1BIRA 1TTOA 1UCJA 2ZA4A 1B2MA 1UCLA 1MGRA 1A2PA 3GSPA 1BRSA 1LRAA 1RGGA 1BVIA 1HYFA 3DGYA 1FUSA 1BAOA 3Q3FA 1RGHA 2BIRA 2BU4A 1GMPA 1B2XA 1DETA 3BIRA 1SARA 1B2ZA 3AGNA 2KF3A 1YGWA 1AQZA 3HOHA 2KF6A 5RNTA 1GMRA 9RNTA 2F5WA 4GHOA 1BRKA 1RGAA 2HOHA 1PYLA 4GSPA 1BRNL 1RDSA 1B21A 3RNTA 3D4AA 1BNEA 1TRQA 4RNTA 1BRGA 3AHWA 3D5IA 1JBTA 1PY3A 1RNBA 1I70A 2C4BA 1JBRA 5BIRA 1RMSA 3WHOA 1BNRA 2RBIA 7RNTA 2GSPA 1GOVA 1ZGXA 1X1UA 1RCKA 1RN4A 1I3FA 1BGSA 1RGEA 2RNTA 1CH0A 1RLSA 1RTUA 1X1WA 1BNFA 1IYYA 1I2FA 5BU4A 1YNVX 1I0VA 1BSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2G A;  1GMQ A;  1BOX A;  4HOH A;  1GOY A;  2SAR A;  1B20 A;  1B2S A;  1I8V A;  3SYU A;  1FW7 A;  1RGC A;  1C54 A;  1YVS A;  4BU4 A;  2F4Y A;  1HZ1 A;  1T2H A;  2AAD A;  3KCH A;  3A5E A;  4J5K A;  1B2U A;  1GOU A;  1B3S A;  1I0X A;  2KF4 A;  1TRP A;  1X1Y A;  7GSP A;  1BU4 A;  5GSP A;  1FUT A;  4BIR A;  3AHS A;  1JBS A;  1BSC A;  1BNJ A;  1LOW A;  3D5G A;  6GSP A;  1RHL A;  4HAA A;  1BSB A;  1LOY A;  1BNI A;  1LOV A;  1BNS A;  1RGF A;  5HOH A;  1RGK A;  1DE3 A;  1LNI A;  1BAN A;  1BRI A;  3DH2 A;  1G02 A;  3WR2 A;  2F5M A;  1BRH A;  1I2E A;  1BRJ A;  1FYS A;  1BSE A;  1B27 A;  2AAE A;  1MGW A;  1BUJ A;  1UCI A;  3BU4 A;  1FZU A;  1UCK A;  1X1X A;  1BNG A;  4J5G A;  1R4Y A;  2F56 A;  1AY7 A;  2KF5 A;  1Q9E A;  2KAA A;  1RSN A;  3AGO A;  1T2I A;  1GSP A;  1RGL A;  8RNT A;  1RNT A;  1RCL A;  1BSD A;  6RNT A;  3URP A;  1RN1 A;  1I3I A;  1BIR A;  1TTO A;  1UCJ A;  2ZA4 A;  1B2M A;  1UCL A;  1MGR A;  1A2P A;  3GSP A;  1BRS A;  1LRA A;  1RGG A;  1BVI A;  1HYF A;  3DGY A;  1FUS A;  1BAO A;  3Q3F A;  1RGH A;  2BIR A;  2BU4 A;  1GMP A;  1B2X A;  1DET A;  3BIR A;  1SAR A;  1B2Z A;  3AGN A;  2KF3 A;  1YGW A;  1AQZ A;  3HOH A;  2KF6 A;  5RNT A;  1GMR A;  9RNT A;  2F5W A;  4GHO A;  1BRK A;  1RGA A;  2HOH A;  1PYL A;  4GSP A;  1BRN L;  1RDS A;  1B21 A;  3RNT A;  3D4A A;  1BNE A;  1TRQ A;  4RNT A;  1BRG A;  3AHW A;  3D5I A;  1JBT A;  1PY3 A;  1RNB A;  1I70 A;  2C4B A;  1JBR A;  5BIR A;  1RMS A;  3WHO A;  1BNR A;  2RBI A;  7RNT A;  2GSP A;  1GOV A;  1ZGX A;  1X1U A;  1RCK A;  1RN4 A;  1I3F A;  1BGS A;  1RGE A;  2RNT A;  1CH0 A;  1RLS A;  1RTU A;  1X1W A;  1BNF A;  1IYY A;  1I2F A;  5BU4 A;  1YNV X;  1I0V A;  1BSA A; 
#chains in the Genus database with same CATH topology
 3LOY A;  3NBJ A;  1TP6 A;  4MMX B;  4HOH A;  3M8C A;  3CCS 3;  3HK4 A;  1VZZ A;  2K54 A;  5G1K A;  3CME 3;  3FCS B;  3IPT A;  1JN5 A;  2P05 A;  1RGC A;  1SII A;  1O7M B;  5AII A;  4HM1 B;  1HZ1 A;  3PYJ A;  1V57 A;  3OWU A;  3A5E A;  3MG2 A;  1OF5 A;  4FMB A;  5TGN A;  2QGU A;  1VQM 3;  3T0U A;  1S72 3;  1I0X A;  1GY6 A;  3FZW A;  1TRP A;  2Q07 A;  1Q81 4;  2W04 A;  3KE7 A;  4Q53 A;  5D81 A;  1BU4 A;  2P09 A;  1FUT A;  2GU3 A;  3KII A;  3VGN A;  1OHP A;  5CXO A;  2XH9 A;  4BIR A;  2D1W A;  3QRD A;  3DY5 A;  3D5G A;  3F7X A;  1VQ9 3;  6GSP A;  4HZ9 B;  1QAF A;  1LOX A;  4FMC A;  4AKZ A;  2QIY A;  1BNI A;  3B4O A;  1VQL 3;  1IVW A;  3S5C A;  5HOH A;  1RGK A;  3ECF A;  2Y74 A;  5EVH A;  1TU5 A;  3ROB A;  1YIJ 3;  4WYK A;  1Q7H A;  2W6J H;  3CCU 3;  2P0M A;  3H51 A;  1YJW 3;  1I2E A;  2W9Q A;  1BRJ A;  1FYS A;  1NWW A;  1Q42 A;  2CG0 A;  2M7O A;  1B27 A;  1SJW A;  2OOV C;  1K8A 4;  1W5Z A;  1TIJ A;  1MGW A;  3FSD A;  2OTL 3;  3SXX A;  5ELJ A;  2CFW A;  3NX0 A;  3BU4 A;  2WO0 A;  4OUQ A;  3U1W A;  4J8T A;  1BNG A;  4J5G A;  2OTJ 3;  1R4Y A;  3FG4 A;  1OUN A;  2BHM A;  3EBT A;  3VSY A;  1RSN A;  1TFK A;  1Y4K A;  5IEO A;  1OH0 A;  3LTD A;  2CG1 A;  3G16 A;  2YX9 A;  1RKY A;  1VQQ A;  3FG1 A;  1QVF 2;  3I56 3;  1RN7 A;  1F8N A;  1BSD A;  3ER7 A;  3PZW A;  4HM0 B;  5LC7 A;  3SLU A;  4ORL A;  1RN1 A;  1IVX A;  3CD6 3;  1TTO A;  1EG9 B;  3FG3 A;  2GBX B;  1NB5 I;  2W56 B;  1G0T A;  2ZL8 A;  1IQ8 A;  1UGH I;  3GSP A;  1BRS A;  3LT9 A;  3QK9 A;  1BVI A;  4FCM A;  2OOV A;  3CC2 3;  2F98 A;  2QEX 3;  3EE1 A;  1WMP A;  4HJL B;  1W6Y A;  3CCQ 3;  3H3H A;  3UB1 A;  1N9J A;  4K1U A;  3BIR A;  3G4S 3;  3MSO A;  3EBY A;  2YFJ B;  2KF3 A;  3X41 A;  2I9W A;  1AQZ A;  1BUQ A;  1UUV B;  2KF6 A;  5RNT A;  1GMR A;  2CK3 H;  1N9E A;  1V58 A;  1WMO A;  2KCD A;  4IIA A;  9RNT A;  1E3V A;  2R4I A;  4RBN A;  4HZB B;  1VQ4 3;  1PYL A;  3I55 3;  1RDS A;  3OWY A;  1N8Q A;  2KRT A;  3D4A A;  4RNT A;  1TRQ A;  1W02 A;  4LEH A;  1US1 A;  2CX0 A;  1O7H B;  1OHS A;  4R80 A;  2C4B A;  3B7C A;  4NPB A;  3STD A;  1JBR A;  1RMS A;  2HML B;  4LMI A;  4CJN A;  3GZR A;  5IER A;  4X2H A;  2IY2 A;  1QMA A;  1ZGX A;  5AEU B;  1X1U A;  1JB5 A;  1RCK A;  2XSH B;  4I4K A;  3NXJ A;  1YJN 3;  1GY5 A;  2CFK A;  4L8P A;  4RNZ A;  2YFI B;  5LC6 A;  3RDE A;  4EV5 A;  1DE3 A;  4HM4 B;  3WA3 A;  4EBG A;  1BSA A;  3AGO A;  3EQQ B;  1OGX A;  1GMQ A;  3N8B A;  3T8N A;  2CWT A;  3J7Y d;  2OQE C;  2W9P A;  5CF1 A;  3DXO A;  1GOY A;  1JZO A;  2SAR A;  4XB5 A;  1B20 A;  4R1K A;  3U97 A;  2CFL A;  3SYU A;  4IT7 A;  1KD1 4;  3BNB A;  1YVS A;  1M1X B;  2F4Y A;  5IEP A;  3SOA A;  1VQO 3;  1Q40 A;  5CF2 A;  4XM4 A;  5IG3 A;  1IVV A;  3AMO A;  1GYB A;  1IT7 A;  3NQZ A;  4XBY A;  4J5K A;  3LTC A;  5BXQ A;  1ZO2 A;  2IUJ A;  1B3S A;  1X1Y A;  1FGM A;  3KN4 A;  3SVA A;  3SED A;  1JBS A;  5AI1 A;  1BSC A;  3HI7 A;  1JKG B;  4MMY B;  1IQY A;  2MF7 A;  4N6V 0;  5M19 A;  2OQE A;  1MOL A;  3EB8 A;  3K63 A;  4ZM8 A;  2GEY A;  3EHC A;  2HMK B;  1NJI 4;  1S5A A;  4CPK A;  4O8S A;  4O02 B;  1VQP 3;  1UUG B;  3KSP A;  1LOY A;  3LH4 A;  5CLK A;  2CWU A;  1RJO A;  1W6C A;  2BMO B;  1O7W B;  1M9G A;  2YFL B;  3GAX A;  4STD A;  1ZX2 A;  1YIT 3;  3G71 3;  1LNI A;  1G02 A;  3LYG A;  5FGO A;  3WR2 A;  1YI2 3;  1RRH A;  1M1K 4;  1SPU A;  1TFO A;  5KP4 A;  2FXT A;  3CMA 3;  5DRE A;  1GY7 A;  1UCI A;  4EV2 A;  5D82 A;  3E99 A;  1FZU A;  1UCK A;  3A76 A;  3MYT A;  4JF8 A;  3KKG A;  2INX A;  3CCE 3;  5IW9 A;  2KXG A;  1VQK 3;  1Q9E A;  1W00 A;  3DMC A;  3EN8 A;  3CCR 3;  4WYK B;  1VQ8 3;  4GL6 A;  2H0G A;  3NBR A;  5DRV A;  2W0Q A;  4L7K A;  2CWV A;  2Z76 A;  2CC3 A;  1GSP A;  1RGL A;  1A2V A;  1OAC A;  3DGN A;  2J8X B;  1WMN A;  4FMD A;  4LGQ A;  2A15 A;  3MPH A;  4BL3 A;  1CQS A;  2BMQ B;  3FH1 A;  1BIR A;  3BND A;  1B2M A;  1UCL A;  3KFQ C;  1QAK A;  2JDI H;  1RGG A;  1LRA A;  1ULI B;  3DGY A;  3CCV 3;  3PGB A;  4WFO A;  3EN1 B;  3F8X A;  4HM7 B;  3S29 A;  3CPW 2;  2IA7 A;  4MJD A;  2BU4 A;  2SBL A;  3HX8 A;  1GMP A;  3GZB A;  1L5G B;  3DGM A;  4BTW A;  1SAR A;  3AGN A;  3CNM A;  5A0O B;  1YGW A;  3GZY B;  1UDI I;  4I5Q A;  4HVN A;  2OWP A;  3I0Y A;  1MWS A;  4EXR A;  1BRK A;  3Q1C A;  1RGA A;  2XFS A;  3F7S A;  5AEW B;  3MG3 A;  5AYR B;  1JB4 A;  4WWU C;  1BRN L;  2P38 A;  2UUG C;  2XR8 B;  5EEO A;  1W2Z A;  5IG5 A;  4EC6 A;  1BNE A;  3IJE B;  5ELU A;  2UGI A;  1BRG A;  1W6G A;  1K73 4;  1AVK A;  2E2T A;  3D5I A;  4HBR A;  1J2B A;  4X2O A;  1I70 A;  3JUP A;  3WHO A;  1BNR A;  2F86 B;  1FGO A;  4H61 A;  4K90 B;  1Q82 4;  1QAL A;  2RNT A;  5JBS A;  5CK6 A;  3V98 A;  3WOE B;  1IQX A;  1BNF A;  1IYY A;  3X40 A;  3B4P A;  1NNV A;  5BU4 A;  4AKY A;  1EQK A;  4BTX A;  1I2G A;  1UGI A;  4KFE A;  3BLZ A;  2QA4 3;  2XF3 A;  3LTB A;  1ROV A;  3K7C A;  2BMR B;  1B2S A;  1C7H A;  2C11 A;  1A67 A;  2GXF A;  1GD4 A;  3T8U A;  4BU4 A;  1DVD A;  1T2H A;  2K0M A;  3CCJ 3;  3FLJ A;  2ZHX B;  1WNH A;  3MWZ A;  2WOH A;  3X3Y A;  3HIG A;  4OVM A;  1SIH A;  2W56 A;  3S67 A;  2MC8 A;  3BNE A;  5GSP A;  2CW9 A;  4J9A A;  1BNJ A;  1LOW A;  1MWT A;  4HM5 B;  4HKV B;  2HMN B;  4N6O B;  1IV9 A;  1JB2 A;  2GU1 A;  3ZFZ A;  2B24 B;  1IT8 A;  1UUW B;  2O9U X;  4N6U A;  1IU7 A;  1N8R 4;  1BSB A;  2JQ5 A;  2H0H A;  4H3U A;  1LOV A;  1LQM B;  3PXM A;  1RGF A;  1R4C A;  4G1M B;  2PNC A;  4HM2 B;  4R9L A;  1DYU A;  1VQ6 3;  1BAN A;  1W4N A;  4RNY A;  1ULJ B;  1RRL A;  1LQG C;  1BRI A;  1AVL A;  3DH2 A;  3HII A;  3NV0 B;  4FMA A;  4R9K A;  3S27 A;  1BRH A;  3G8Z A;  1EA2 A;  2CKF B;  2XEP A;  3OV4 A;  3F8H A;  1GS3 A;  2CH9 A;  2AAE A;  3BB9 A;  3JUM A;  3UJM A;  3ZG0 A;  2IUK A;  2Z6B A;  2IMJ A;  1LVN A;  1O7P B;  1X1X A;  1OCV A;  1NO3 A;  4FCZ A;  4KT3 B;  4CDL A;  4IPB A;  1Q86 4;  1N5P A;  3UL5 A;  1JN5 B;  2Z77 A;  4K1V A;  4EW5 A;  1JNQ A;  1KC8 4;  4L8O A;  1PU4 A;  2WOF A;  1MWU A;  3DZL A;  3JVC A;  5G1L A;  3DUK A;  1CYU A;  3X3Z A;  1RCL A;  4N6M A;  3F40 A;  1OF5 B;  6RNT A;  1D6U A;  2ZA4 A;  4XBT A;  1KWI A;  2HMO B;  2R41 A;  1A2P A;  1MNL A;  4BTY A;  2OCT A;  1JRQ A;  3LXU X;  1JV2 B;  1TJD A;  5M1A A;  1BAO A;  3Q3F A;  2LQV A;  2FGT A;  1E3R A;  2O3O A;  5FW5 A;  4JRF A;  2XSO B;  4N3V A;  1JZD A;  4XDV A;  1B2X A;  5KP3 A;  3ZG5 A;  1DET A;  4LZI A;  2F99 A;  3RGA A;  2E2U A;  1B2Z A;  3F9S A;  3F14 A;  3CC4 3;  3KSE D;  2W03 A;  3WDG B;  3G6E 3;  3V99 A;  1YJ9 3;  7STD A;  3PCS A;  3FKA A;  3OWS A;  1NU3 A;  3CCM 3;  1VQN 3;  1JKG A;  3OX9 A;  4KFD A;  4O2H A;  4QWT A;  4R4K A;  5JPP A;  4N6N B;  4GSP A;  3UL6 A;  1B21 A;  3EX9 A;  3RNT A;  1MWR A;  3NBB A;  4KFF A;  3K5T A;  3EF8 A;  3CXC 2;  2CIU A;  1GD3 A;  2CX1 A;  3NM2 A;  5BIR A;  4LYL B;  1WQL B;  2BO9 B;  5AIH A;  7RNT A;  2GSP A;  3LTA A;  1OGZ A;  2L1S A;  1OPY A;  2BT3 A;  3LZA A;  5AIG A;  3OW2 2;  1FGR A;  1DVC A;  2V1L A;  1IDP A;  1I3F A;  3NQY A;  4K61 A;  1RGE A;  1RTU A;  1RLS A;  1X1W A;  5HGR A;  3N9H A;  2CFD A;  1YNV X;  1I0V A;  2GBW B;  2XGN A;  2XGL A;  3LML A;  4EYC A;  1KQS 2;  1BOX A;  1UW1 A;  3FGY A;  3NUV A;  2XFT A;  2ML5 A;  1AV4 A;  1I8V A;  1FW7 A;  3WOD G;  2FNQ A;  1UI8 A;  3TDG A;  1M90 4;  1C54 A;  1KSI A;  8CHO A;  4FR9 A;  3WA2 X;  3LT8 A;  2AAD A;  4NRE A;  1OHO A;  3KCH A;  3WMD A;  4DKI A;  2E2V A;  2W2C A;  1B2U A;  1TUH A;  2GEX A;  1GOU A;  3CPO A;  3CCL 3;  4TX4 A;  5AYS C;  2RSX A;  2KF4 A;  4N6L A;  5M18 A;  1U5O A;  3VF1 A;  3GZX B;  7GSP A;  3MG1 A;  3K0Z A;  3AHS A;  3FF2 A;  1AR0 A;  2RGQ A;  1IV7 A;  3DM8 A;  3O8Y A;  4KZ1 A;  4MEI A;  1VQ5 3;  1FA3 A;  3N54 B;  1W2B 2;  1LNH A;  1RHL A;  3CNX A;  3D79 A;  4HAA A;  1QVG 2;  1PFP A;  1DMM A;  1ASK A;  1LXE A;  3D3L A;  4KVH A;  4PEJ A;  1T5Y A;  5BVB A;  2UX0 A;  2WGQ A;  1BNS A;  1T3B A;  4RZM A;  1IK3 A;  1G96 A;  4XBX A;  1ZS7 A;  5IG0 A;  3DGL A;  2C10 A;  2RCD A;  1V74 A;  1EUI C;  4XDW A;  5D83 A;  2F5M A;  2B1X B;  3RGR A;  2D42 A;  3X3X A;  5IF6 A;  1D6Y A;  5IEN A;  1BSE A;  1FGQ A;  3L0R A;  4HM3 B;  1BUJ A;  4ILF A;  1O7G B;  1N5H A;  3MHE A;  1HKX A;  3HZP A;  2XRX B;  2P0X A;  3MKI A;  3JUN A;  3UNL A;  3FF0 A;  4CCV A;  3CC7 3;  1HU9 A;  4WHA A;  3S28 A;  2F56 A;  2H0I A;  1A2K A;  1AY7 A;  2KF5 A;  2K3D A;  1CYV A;  3JUO A;  2WGO A;  4BL2 A;  4N6T A;  1A90 A;  2KAA A;  3BNC A;  3B8L A;  1FUW A;  1Q40 B;  1E97 A;  5IG4 A;  3AMO B;  1T2I A;  1FGT A;  1Z1S A;  4HM6 B;  8RNT A;  4NHF A;  3KZT A;  1RNT A;  3WOF B;  1YGE A;  3NHX A;  1WTH A;  1K9M 4;  3URP A;  3CU3 A;  4FCJ A;  1ROA A;  1I3I A;  1UCJ A;  1ISK A;  3DGO A;  1EEJ A;  5G2G A;  1MGR A;  3Q2P A;  3Q90 A;  2Y73 A;  4U13 A;  2CHC A;  2L4V A;  1HYF A;  4HM8 B;  3SX1 A;  2RFR A;  4GB5 A;  1YVB I;  1FUS A;  1UI7 A;  3EJV A;  4O3V A;  1YHQ 3;  3D9R A;  1RGH A;  1CEW I;  2Z7A A;  3NM7 A;  2BIR A;  2PZV A;  2CFG A;  2HMM B;  5KP1 A;  3JUQ A;  1DMN A;  1STF I;  3HOH A;  5JPU A;  2F5W A;  4GHO A;  2HOH A;  3PS8 A;  5STD A;  3PCR A;  3EC9 A;  1JJ2 2;  1K28 A;  2STD A;  5I97 A;  3V92 A;  3K9M C;  3OXA A;  3SOY A;  1IVU A;  3GWR A;  1Q7Y 4;  1NB3 I;  1STD A;  3IMA B;  2ML6 A;  2HMJ B;  3AHW A;  1JBT A;  1PY3 A;  1U8C B;  1VQ7 3;  1DMQ A;  1RNB A;  1W01 A;  1K41 A;  2BNG A;  2ZDJ A;  2RBI A;  1GOV A;  1O7N B;  3G0K A;  3NV0 A;  3X42 A;  4AEQ A;  2LYX A;  2IYJ A;  1RN4 A;  1EKM A;  1BGS A;  4OK0 A;  5EQL A;  1SQW A;  4LSO A;  1CH0 A;  3GRD A;  4HYZ A;  1NDO B;  4WP5 A;  1QJG A;  1W7C A;  1I2F A;  4MMZ B;  3ALA A;  6STD A;  1D6Z A;  5AIF A; 
#chains in the Genus database with same CATH homology
 1I2G A;  1GMQ A;  1BOX A;  4HOH A;  1GOY A;  2SAR A;  1B20 A;  1B2S A;  1I8V A;  3SYU A;  1FW7 A;  1RGC A;  1C54 A;  1YVS A;  4BU4 A;  2F4Y A;  1HZ1 A;  1T2H A;  2AAD A;  3KCH A;  3A5E A;  4J5K A;  1B2U A;  1GOU A;  1B3S A;  1I0X A;  2KF4 A;  1TRP A;  1X1Y A;  7GSP A;  1BU4 A;  5GSP A;  1FUT A;  4BIR A;  3AHS A;  1JBS A;  1BSC A;  1BNJ A;  1LOW A;  3D5G A;  6GSP A;  1RHL A;  4HAA A;  1BSB A;  1LOY A;  1BNI A;  1LOV A;  1BNS A;  1RGF A;  5HOH A;  1RGK A;  1DE3 A;  1LNI A;  1BAN A;  1BRI A;  3DH2 A;  1G02 A;  3WR2 A;  2F5M A;  1BRH A;  1I2E A;  1BRJ A;  1FYS A;  1BSE A;  1B27 A;  2AAE A;  1MGW A;  1BUJ A;  1UCI A;  3BU4 A;  1FZU A;  1UCK A;  1X1X A;  1BNG A;  4J5G A;  1R4Y A;  2F56 A;  1AY7 A;  2KF5 A;  1Q9E A;  2KAA A;  1RSN A;  3AGO A;  1T2I A;  1GSP A;  1RGL A;  8RNT A;  1RNT A;  1RCL A;  1BSD A;  6RNT A;  3URP A;  1RN1 A;  1I3I A;  1BIR A;  1TTO A;  1UCJ A;  2ZA4 A;  1B2M A;  1UCL A;  1MGR A;  1A2P A;  3GSP A;  1BRS A;  1LRA A;  1RGG A;  1BVI A;  1HYF A;  3DGY A;  1FUS A;  1BAO A;  3Q3F A;  1RGH A;  2BIR A;  2BU4 A;  1GMP A;  1B2X A;  1DET A;  3BIR A;  1SAR A;  1B2Z A;  3AGN A;  2KF3 A;  1YGW A;  1AQZ A;  3HOH A;  2KF6 A;  5RNT A;  1GMR A;  9RNT A;  2F5W A;  4GHO A;  1BRK A;  1RGA A;  2HOH A;  1PYL A;  4GSP A;  1BRN L;  1RDS A;  1B21 A;  3RNT A;  3D4A A;  1BNE A;  1TRQ A;  4RNT A;  1BRG A;  3AHW A;  3D5I A;  1JBT A;  1PY3 A;  1RNB A;  1I70 A;  2C4B A;  1JBR A;  5BIR A;  1RMS A;  3WHO A;  1BNR A;  2RBI A;  7RNT A;  2GSP A;  1GOV A;  1ZGX A;  1X1U A;  1RCK A;  1RN4 A;  1I3F A;  1BGS A;  1RGE A;  2RNT A;  1CH0 A;  1RLS A;  1RTU A;  1X1W A;  1BNF A;  1IYY A;  1I2F A;  5BU4 A;  1YNV X;  1I0V A;  1BSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...