1BNGA

Barnase s85c/h102c disulfide mutant
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNCDRILYSSDWLIYKTTDCYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Disulfide mutants of barnase. I: Changes in stability and structure assessed by biophysical methods and X-ray crystallography.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bngA00
1RGAA 1BNSA 1BRGA 2ZA4A 2GSPA 1RTUA 2KF6A 1A2PA 1BSEA 1YNVX 5RNTA 1RDSA 1RGLA 1I3FA 1PY3A 1UCJA 1X1UA 1UCKA 1BSAA 1X1WA 3D5GA 3DGYA 1BRHA 1RGEA 7GSPA 1Q9EA 1RN1A 1BUJA 2AAEA 1BSDA 1UCIA 3RNTA 2C4BA 4HOHA 2F4YA 1BRJA 1SARA 1LNIA 3KCHA 2BU4A 4HAAA 1B2ZA 2KF3A 1B2SA 1BGSA 3URPA 1BOXA 3BIRA 4GSPA 4J5KA 1BIRA 4GHOA 1BNFA 3AGOA 1BRNL 1RGGA 1FW7A 4BIRA 1YGWA 1BNJA 1RNTA 3DH2A 1JBRA 1FYSA 1TTOA 2HOHA 1RLSA 1I70A 1YVSA 3AHWA 1RSNA 1PYLA 5HOHA 3Q3FA 1AY7A 1LOWA 5GSPA 1X1YA 1AQZA 3HOHA 1RMSA 3D4AA 4RNTA 4J5GA 2F56A 1MGRA 3WHOA 1FUSA 1I2EA 1LOVA 2SARA 6RNTA 2KAAA 3BU4A 1C54A 3GSPA 1B2XA 1LRAA 1GMPA 2RBIA 1BRIA 1B3SA 1ZGXA 7RNTA 1BSCA 1UCLA 1BANA 1RGFA 1T2HA 1BNEA 1GSPA 1RGCA 2AADA 3AHSA 3WR2A 1FUTA 2BIRA 1RCKA 9RNTA 3SYUA 1X1XA 5BU4A 2RNTA 2KF4A 3AGNA 1BRSA 1GOYA 4BU4A 1B21A 1RN4A 1JBSA 1LOYA 1IYYA 1BU4A 8RNTA 1BRKA 1RGHA 3D5IA 1BAOA 1I0VA 1B27A 1DETA 1HZ1A 3A5EA 1MGWA 5BIRA 1HYFA 1I8VA 1TRPA 1CH0A 6GSPA 1GMQA 1RHLA 1BSBA 1RGKA 2KF5A 1GOUA 1B2MA 1I3IA 1RCLA 1R4YA 1BNGA 1GMRA 1B20A 1RNBA 2F5MA 1GOVA 1I2FA 1T2IA 1JBTA 1TRQA 1G02A 1BNRA 1I2GA 1DE3A 2F5WA 1BNIA 1BVIA 1FZUA 1I0XA 1B2UA
chains in the Genus database with same CATH superfamily
4BL3A 4FR9A 3B8LA 3FF2A 1JZOA 1VQ63 1V58A 2GSPA 3HIIA 3T8UA 2KF6A 1YNVX 5KP1A 3NUVA 4XBTA 1I3FA 2OTL3 3BNEA 1NNVA 4K1UA 5A0OB 4G1MB 3CME3 1WQLB 1X1WA 3JUMA 1MWSA 3D5GA 4N6V0 3DGYA 1RGEA 3GAXA 2KXGA 1CEWI 1BUJA 5G1KA 1FGQA 5JBSA 2XFSA 3RNTA 1OHOA 2P09A 4XBXA 4HOHA 1BRJA 2OOVA 1LNIA 1GY7A 3LT9A 2F98A 1PU4A 1YI23 1IQXA 2KF3A 3MPHA 5HGRA 2RCDA 3ROBA 3CC43 3RGRA 3K63A 3LT8A 1OHPA 2YFLB 3ZG5A 1JB5A 3S28A 5FGOA 1W4NA 2OOVC 4GHOA 2WOHA 2K54A 3JUPA 1BRNL 4ILFA 2CFDA 1SIIA 1JJ22 1BNJA 2IA7A 2XH9A 3I0YA 3DH2A 3HX8A 1OACA 1I70A 3B4OA 3LZAA 5AYRB 5CLKA 4R80A 3KZTA 2IY2A 4HKVB 5CF1A 1UI8A 1HKXA 1AY7A 3GZBA 1LOWA 1X1YA 2P0MA 1UDII 2WGQA 4NREA 3GRDA 4HM3B 1RMSA 5AEWB 4ZM8A 2Z77A 4RNTA 5BXQA 1MGRA 1GY5A 1OUNA 3BU4A 3IMAB 1CYUA 4EYCA 3U97A 1DYUA 5DRVA 4CPKA 4H3UA 3GSPA 3MG2A 1RKYA 1VQ83 2SBLA 5LC7A 2QGUA 2Z6BA 3FF0A 3JUQA 4MJDA 3CNXA 5KP4A 1ULJB 5EVHA 2RSXA 3G6E3 4O8SA 1ZGXA 2GBXB 1BSCA 1BANA 1RGFA 3V92A 1GSPA 1WNHA 2E2TA 3EF8A 1N8QA 1OF5A 4HM0B 1RCKA 2BO9B 3QK9A 1FUWA 1X1XA 5BU4A 3GWRA 4IIAA 4AKYA 3EX9A 4HZ9B 4BTYA 1TFKA 3D3LA 1EUIC 5D83A 4BU4A 3KN4A 2LYXA 3WDGB 1JKGA 2FXTA 3Q1CA 1S5AA 1QVF2 1JBSA 3NM7A 4L8OA 5IW9A 4FMAA 5M1AA 2XSOB 1VQL3 3D5IA 3GZYB 5LC6A 1I0VA 1Q7Y4 1WMOA 1HZ1A 5CK6A 3BNBA 3CCJ3 3DUKA 1MGWA 4FMBA 5BIRA 1N8R4 3UNLA 1OF5B 1GD3A 2L1SA 2R4IA 1I8VA 3F8HA 3UJMA 1GMQA 1BSBA 3UL5A 2QA43 2CWUA 1O7PB 1UUWB 1V74A 3PXMA 4KFFA 1KC84 3CD63 1E97A 5AIGA 1WMNA 2OCTA 2RGQA 1JKGB 1Q7HA 1GYBA 1IDPA 3JUOA 3X40A 2FNQA 3S67A 1N9JA 4PEJA 3NHXA 2UX0A 3SLUA 4O02B 3ER7A 1OH0A 1T3BA 3FGYA 2WGOA 5IG0A 5IF6A 1EKMA 1TRQA 3MSOA 1JBTA 1AVKA 2CX0A 3WMDA 3AMOA 1B2UA 3FH1A 1RGAA 1BNSA 1BRGA 1JNQA 1NO3A 3NQYA 3OV4A 2ZA4A 4MMZB 1PFPA 2GU1A 2Z76A 1OHSA 3PCRA 1IQ8A 2B1XB 1ULIB 1US1A 1TUHA 3OWUA 5CF2A 2MC8A 1A2PA 2ML6A 1FGOA 1JB2A 2XGLA 3DGMA 1ISKA 1UCJA 1X1UA 2BT3A 3PGBA 3FZWA 3WA3A 4IPBA 4EV5A 1TFOA 7GSPA 3F40A 1GD4A 2AAEA 4BTXA 2OTJ3 1KWIA 3DXOA 1BSDA 2W9QA 1CYVA 3KE7A 3VF1A 3X3XA 3OWYA 1K41A 1HU9A 3AMOB 1VZZA 3EN1B 3I553 2BU4A 3HK4A 3K7CA 1MNLA 1BUQA 3PS8A 3DM8A 3PCSA 1B2SA 2W0QA 3HIGA 3URPA 1YIJ3 4JRFA 2L4VA 2CG0A 2UUGC 2J8XB 4TX4A 1BNFA 2CX1A 3AGOA 2CH9A 1RNTA 1SQWA 1ZX2A 2P05A 4O2HA 3LTCA 1RLSA 3AHWA 1QAFA 1FGTA 2H0HA 3DGLA 2XSHB 1PYLA 2PZVA 1W6YA 3EE1A 1UUVB 1TP6A 3Q3FA 2YFIB 3HOHA 1M1XB 1NB3I 3MYTA 4GB5A 3X42A 3S27A 1Q42A 3LTAA 4HM7B 2K3DA 4K1VA 1QVG2 2GU3A 3G713 3FSDA 1C54A 3WOEB 4R9KA 2SARA 2HMOB 4FCMA 4RBNA 5FW5A 2CFWA 3F8XA 3V99A 1GMPA 4HM5B 4N6TA 1JV2B 5IG4A 4WYKA 2C11A 5JPUA 4EV2A 5D82A 4EW5A 5ELJA 4R1KA 4FCZA 3DMCA 4CDLA 2CKFB 4DKIA 3WOFB 3CNMA 2AADA 1RGCA 1W7CA 1NB5I 2BIRA 3F14A 3X3ZA 2RNTA 3U1WA 3LTBA 3G16A 2KF4A 4Q53A 3FG1A 2D1WA 1MWUA 3NBRA 3HI7A 1GS3A 2E2VA 8CHOA 4MMXB 4HVNA 3QRDA 4LGQA 8RNTA 3CCL3 2KRTA 1GY6A 1JZDA 7STDA 1IVUA 5BVBA 3FLJA 1Q40A 3A5EA 4BTWA 3BLZA 4J8TA 1VQ93 1VQP3 1IT8A 2PNCA 6GSPA 3CCQ3 1KD14 3GZRA 3V98A 2R41A 4IT7A 1EG9B 1RGKA 2KF5A 1YJ93 1W2ZA 3MWZA 1RCLA 1QAKA 1VQO3 3NV0A 1IVWA 4LMIA 3SOAA 2XFTA 1TU5A 3PZWA 3EC9A 4RNYA 1IK3A 1IU7A 2F5MA 1DMMA 3KFQC 2CFKA 5G2GA 1YJN3 1Q40B 1QMAA 1T2IA 3SVAA 2I9WA 1DE3A 3KSED 3L0RA 3M8CA 4N6MA 3Q90A 1LNHA 1I0XA 5AIIA 4HM8B 4KFDA 2HMJB 3MHEA 1VQ43 1IVVA 1NWWA 2ML5A 5AIHA 1RTUA 4NHFA 3NV0B 2RFRA 4XB5A 1BSEA 5ELUA 3X3YA 1R4CA 1RDSA 1RGLA 2H0GA 1PY3A 5M19A 2CFGA 1UCKA 2IUJA 4HM6B 1BSAA 3BNCA 1FA3A 3H3HA 1LQGC 3DGOA 2QIYA 2Y74A 1J2BA 1RN1A 3B4PA 2C4BA 2XR8B 4LYLB 2GBWB 4J9AA 1DMNA 2O9UX 1Y4KA 4FCJA 4HAAA 1N5PA 2D42A 1K28A 1W02A 4FMCA 1BGSA 1VQ73 3CPOA 1IT7A 4GSPA 3BIRA 2FGTA 2HMNB 3WODG 1DVDA 4EXRA 1BIRA 1QALA 3STDA 3LXUX 2GEYA 3OXAA 2C10A 4QWTA 1L5GB 4X2OA 3S29A 1JBRA 4NPBA 3ALAA 1FYSA 1TTOA 2HMKB 2HOHA 2JQ5A 1YVSA 2W04A 3G0KA 4LZIA 5DREA 4X2HA 1RSNA 2M7OA 4AEQA 5HOHA 1YVBI 2HMMB 4N3VA 3CC73 2Q07A 3CMA3 4R9LA 4WWUC 3CCR3 4N6NB 5JPPA 1Q824 3LOYA 3EBTA 3UB1A 3T8NA 2F56A 2W6JH 3WHOA 3IPTA 1I2EA 6RNTA 1ROAA 2KAAA 3ZG0A 3BNDA 1M904 3D9RA 1IV9A 4RZMA 4HYZA 1O7WB 3O8YA 3MG3A 1B2XA 1LRAA 1UW1A 1IV7A 4LSOA 3EN8A 1E3VA 1W00A 1A2VA 5AIFA 4WFOA 4AKZA 3KIIA 1ZS7A 1B3SA 3K5TA 2W9PA 3H51A 1UCLA 2HMLB 1V57A 3WR2A 2P0XA 2XF3A 3K0ZA 4R4KA 6STDA 4EC6A 1VQK3 1Q814 2A15A 3SYUA 2XEPA 3VSYA 2MF7A 1N9EA 3CCV3 5EQLA 4CCVA 3CPW2 1GOYA 5M18A 1B21A 1K9M4 1JRQA 4HZBB 4KVHA 3EBYA 4N6LA 2V1LA 3CXC2 1M1K4 2CW9A 2XRXB 4I5QA 3KSPA 1AVLA 3PYJA 1LOYA 1BU4A 1D6UA 1OGXA 2B24B 1MWRA 1BRKA 5IENA 3G8ZA 1B27A 1DETA 1WTHA 3OWSA 2W56A 3NBBA 2H0IA 3HZPA 3A76A 5AEUB 1TRPA 1CH0A 1RJOA 2CWTA 3CU3A 4KFEA 3CCE3 1B2MA 4CJNA 1M9GA 3SXXA 1CQSA 2UGIA 4XDVA 1BNGA 1GMRA 3JUNA 1B20A 4XDWA 2BHMA 3Q2PA 2GEXA 3DZLA 3EQQB 1GOVA 3N54B 1I2FA 3F7XA 4FMDA 3I563 1SPUA 3NXJA 4HBRA 2ZHXB 5KP3A 2W56B 3DY5A 3JVCA 4EBGA 1BNRA 2YFJB 4WYKB 1JB4A 3FG4A 3SX1A 3FCSB 2BMOB 1KQS2 1W6GA 1YGEA 3ZFZA 3TDGA 3T0UA 1W2B2 2WO0A 1UUGB 3X41A 2XGNA 5RNTA 1RN7A 5I97A 3LMLA 1W5ZA 4GL6A 5AI1A 4HJLB 3NX0A 2OWPA 1TIJA 3F9SA 3CCS3 1DVCA 4N6UA 5IEPA 1YIT3 1BRHA 3CC23 1Q9EA 2CG1A 3S5CA 5IERA 1UCIA 3RGAA 3J7Yd 2CIUA 1LQMB 1FGRA 1WMPA 2F4YA 1SARA 4O3VA 4HM2B 3ECFA 3KCHA 1UI7A 4OK0A 1A2KA 4U13A 1B2ZA 2OQEA 3OW22 1W01A 3DGNA 1AR0A 2O3OA 1TJDA 1BOXA 1IQYA 2CK3H 2STDA 3NBJA 4J5KA 4L7KA 4XBYA 1D6ZA 4KT3B 2WOFA 5EEOA 3OX9A 5STDA 3D79A 4ORLA 3MKIA 1OCVA 1VQM3 3K9MC 1RGGA 1FW7A 2OQEC 3NQZA 4BIRA 1YGWA 1C7HA 5AYSC 1Q864 1LXEA 1YHQ3 1N5HA 3EB8A 1RRHA 1G0TA 1LOXA 1SJWA 5CXOA 1A90A 3VGNA 3F7SA 1OGZA 1UGHI 3RDEA 1ASKA 1ROVA 2LQVA 3G4S3 5GSPA 2E2UA 2F86B 4L8PA 1NDOB 5G1LA 1AQZA 1NJI4 1A67A 4BL2A 2JDIH 3D4AA 3SOYA 3IJEB 1LVNA 4J5GA 3CCM3 3SEDA 1FUSA 1LOVA 4STDA 2ZDJA 4MMYB 1ZO2A 4JF8A 1SIHA 2P38A 1JN5A 2K0MA 4H61A 4WP5A 1Z1SA 2RBIA 4OVMA 2ZL8A 4LEHA 4I4KA 2QEX3 1K734 1EQKA 1T5YA 3FG3A 1VQN3 1S723 1BRIA 1DMQA 3EJVA 4N6OB 2IUKA 1W6CA 7RNTA 2BMQB 1T2HA 1BNEA 3AHSA 1RRLA 1FUTA 1U5OA 2CHCA 3NM2A 9RNTA 3FKAA 2W2CA 1MOLA 1K8A4 1O7MB 3BB9A 3LH4A 3AGNA 1BRSA 1NU3A 1STDA 3LTDA 3N8BA 1RN4A 1JN5B 3CCU3 2YX9A 3E99A 4HM1B 1AV4A 1QJGA 1EA2A 3B7CA 1IYYA 1STFI 1KSIA 3KKGA 1U8CB 3WA2X 2IMJA 1RGHA 1BAOA 5IG5A 2Z7AA 2CWVA 2Y73A 3N9HA 2IYJA 1EEJA 1HYFA 2BNGA 4RNZA 4WHAA 2BMRB 4K61A 1RHLA 4HM4B 2W03A 1GOUA 3LYGA 4K90B 1I3IA 1G96A 1R4YA 5IEOA 3MG1A 1O7GB 4OUQA 2F99A 1YJW3 5TGNA 1VQ53 1F8NA 1OPYA 1RNBA 5IG3A 2INXA 3UL6A 1O7NB 4MEIA 1O7HB 4XM4A 1VQQA 2CFLA 1D6YA 1FGMA 1MWTA 1G02A 2GXFA 1I2GA 4KZ1A 2F5WA 1BNIA 1IVXA 1BVIA 1FZUA 1E3RA 3EHCA 5D81A 2KCDA 2CC3A 1UGIA 3GZXB
chains in the Genus database with same CATH topology
1RGAA 1BNSA 1BRGA 2ZA4A 2GSPA 1RTUA 2KF6A 1A2PA 1BSEA 1YNVX 5RNTA 1RDSA 1RGLA 1I3FA 1PY3A 1UCJA 1X1UA 1UCKA 1BSAA 1X1WA 3D5GA 3DGYA 1BRHA 1RGEA 7GSPA 1Q9EA 1RN1A 1BUJA 2AAEA 1BSDA 1UCIA 3RNTA 2C4BA 4HOHA 2F4YA 1BRJA 1SARA 1LNIA 3KCHA 2BU4A 4HAAA 1B2ZA 2KF3A 1B2SA 1BGSA 3URPA 1BOXA 3BIRA 4GSPA 4J5KA 1BIRA 4GHOA 1BNFA 3AGOA 1BRNL 1RGGA 1FW7A 4BIRA 1YGWA 1BNJA 1RNTA 3DH2A 1JBRA 1FYSA 1TTOA 2HOHA 1RLSA 1I70A 1YVSA 3AHWA 1RSNA 1PYLA 5HOHA 3Q3FA 1AY7A 1LOWA 5GSPA 1X1YA 1AQZA 3HOHA 1RMSA 3D4AA 4RNTA 4J5GA 2F56A 1MGRA 3WHOA 1FUSA 1I2EA 1LOVA 2SARA 6RNTA 2KAAA 3BU4A 1C54A 3GSPA 1B2XA 1LRAA 1GMPA 2RBIA 1BRIA 1B3SA 1ZGXA 7RNTA 1BSCA 1UCLA 1BANA 1RGFA 1T2HA 1BNEA 1GSPA 1RGCA 2AADA 3AHSA 3WR2A 1FUTA 2BIRA 1RCKA 9RNTA 3SYUA 1X1XA 5BU4A 2RNTA 2KF4A 3AGNA 1BRSA 1GOYA 4BU4A 1B21A 1RN4A 1JBSA 1LOYA 1IYYA 1BU4A 8RNTA 1BRKA 1RGHA 3D5IA 1BAOA 1I0VA 1B27A 1DETA 1HZ1A 3A5EA 1MGWA 5BIRA 1HYFA 1I8VA 1TRPA 1CH0A 6GSPA 1GMQA 1RHLA 1BSBA 1RGKA 2KF5A 1GOUA 1B2MA 1I3IA 1RCLA 1R4YA 1BNGA 1GMRA 1B20A 1RNBA 2F5MA 1GOVA 1I2FA 1T2IA 1JBTA 1TRQA 1G02A 1BNRA 1I2GA 1DE3A 2F5WA 1BNIA 1BVIA 1FZUA 1I0XA 1B2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGA A;  1BNS A;  1BRG A;  2ZA4 A;  2GSP A;  1RTU A;  2KF6 A;  1A2P A;  1BSE A;  1YNV X;  5RNT A;  1RDS A;  1RGL A;  1I3F A;  1PY3 A;  1UCJ A;  1X1U A;  1UCK A;  1BSA A;  1X1W A;  3D5G A;  3DGY A;  1BRH A;  1RGE A;  7GSP A;  1Q9E A;  1RN1 A;  1BUJ A;  2AAE A;  1BSD A;  1UCI A;  3RNT A;  2C4B A;  4HOH A;  2F4Y A;  1BRJ A;  1SAR A;  1LNI A;  3KCH A;  2BU4 A;  4HAA A;  1B2Z A;  2KF3 A;  1B2S A;  1BGS A;  3URP A;  1BOX A;  3BIR A;  4GSP A;  4J5K A;  1BIR A;  4GHO A;  1BNF A;  3AGO A;  1BRN L;  1RGG A;  1FW7 A;  4BIR A;  1YGW A;  1BNJ A;  1RNT A;  3DH2 A;  1JBR A;  1FYS A;  1TTO A;  2HOH A;  1RLS A;  1I70 A;  1YVS A;  3AHW A;  1RSN A;  1PYL A;  5HOH A;  3Q3F A;  1AY7 A;  1LOW A;  5GSP A;  1X1Y A;  1AQZ A;  3HOH A;  1RMS A;  3D4A A;  4RNT A;  4J5G A;  2F56 A;  1MGR A;  3WHO A;  1FUS A;  1I2E A;  1LOV A;  2SAR A;  6RNT A;  2KAA A;  3BU4 A;  1C54 A;  3GSP A;  1B2X A;  1LRA A;  1GMP A;  2RBI A;  1BRI A;  1B3S A;  1ZGX A;  7RNT A;  1BSC A;  1UCL A;  1BAN A;  1RGF A;  1T2H A;  1BNE A;  1GSP A;  1RGC A;  2AAD A;  3AHS A;  3WR2 A;  1FUT A;  2BIR A;  1RCK A;  9RNT A;  3SYU A;  1X1X A;  5BU4 A;  2RNT A;  2KF4 A;  3AGN A;  1BRS A;  1GOY A;  4BU4 A;  1B21 A;  1RN4 A;  1JBS A;  1LOY A;  1IYY A;  1BU4 A;  8RNT A;  1BRK A;  1RGH A;  3D5I A;  1BAO A;  1I0V A;  1B27 A;  1DET A;  1HZ1 A;  3A5E A;  1MGW A;  5BIR A;  1HYF A;  1I8V A;  1TRP A;  1CH0 A;  6GSP A;  1GMQ A;  1RHL A;  1BSB A;  1RGK A;  2KF5 A;  1GOU A;  1B2M A;  1I3I A;  1RCL A;  1R4Y A;  1BNG A;  1GMR A;  1B20 A;  1RNB A;  2F5M A;  1GOV A;  1I2F A;  1T2I A;  1JBT A;  1TRQ A;  1G02 A;  1BNR A;  1I2G A;  1DE3 A;  2F5W A;  1BNI A;  1BVI A;  1FZU A;  1I0X A;  1B2U A; 
#chains in the Genus database with same CATH topology
 4BL3 A;  4FR9 A;  3B8L A;  3FF2 A;  1JZO A;  1VQ6 3;  1V58 A;  2GSP A;  3HII A;  3T8U A;  2KF6 A;  1YNV X;  5KP1 A;  3NUV A;  4XBT A;  1I3F A;  2OTL 3;  3BNE A;  1NNV A;  4K1U A;  5A0O B;  4G1M B;  3CME 3;  1WQL B;  1X1W A;  3JUM A;  1MWS A;  3D5G A;  4N6V 0;  3DGY A;  1RGE A;  3GAX A;  2KXG A;  1CEW I;  1BUJ A;  5G1K A;  1FGQ A;  5JBS A;  2XFS A;  3RNT A;  1OHO A;  2P09 A;  4XBX A;  4HOH A;  1BRJ A;  2OOV A;  1LNI A;  1GY7 A;  3LT9 A;  2F98 A;  1PU4 A;  1YI2 3;  1IQX A;  2KF3 A;  3MPH A;  5HGR A;  2RCD A;  3ROB A;  3CC4 3;  3RGR A;  3K63 A;  3LT8 A;  1OHP A;  2YFL B;  3ZG5 A;  1JB5 A;  3S28 A;  5FGO A;  1W4N A;  2OOV C;  4GHO A;  2WOH A;  2K54 A;  3JUP A;  1BRN L;  4ILF A;  2CFD A;  1SII A;  1JJ2 2;  1BNJ A;  2IA7 A;  2XH9 A;  3I0Y A;  3DH2 A;  3HX8 A;  1OAC A;  1I70 A;  3B4O A;  3LZA A;  5AYR B;  5CLK A;  4R80 A;  3KZT A;  2IY2 A;  4HKV B;  5CF1 A;  1UI8 A;  1HKX A;  1AY7 A;  3GZB A;  1LOW A;  1X1Y A;  2P0M A;  1UDI I;  2WGQ A;  4NRE A;  3GRD A;  4HM3 B;  1RMS A;  5AEW B;  4ZM8 A;  2Z77 A;  4RNT A;  5BXQ A;  1MGR A;  1GY5 A;  1OUN A;  3BU4 A;  3IMA B;  1CYU A;  4EYC A;  3U97 A;  1DYU A;  5DRV A;  4CPK A;  4H3U A;  3GSP A;  3MG2 A;  1RKY A;  1VQ8 3;  2SBL A;  5LC7 A;  2QGU A;  2Z6B A;  3FF0 A;  3JUQ A;  4MJD A;  3CNX A;  5KP4 A;  1ULJ B;  5EVH A;  2RSX A;  3G6E 3;  4O8S A;  1ZGX A;  2GBX B;  1BSC A;  1BAN A;  1RGF A;  3V92 A;  1GSP A;  1WNH A;  2E2T A;  3EF8 A;  1N8Q A;  1OF5 A;  4HM0 B;  1RCK A;  2BO9 B;  3QK9 A;  1FUW A;  1X1X A;  5BU4 A;  3GWR A;  4IIA A;  4AKY A;  3EX9 A;  4HZ9 B;  4BTY A;  1TFK A;  3D3L A;  1EUI C;  5D83 A;  4BU4 A;  3KN4 A;  2LYX A;  3WDG B;  1JKG A;  2FXT A;  3Q1C A;  1S5A A;  1QVF 2;  1JBS A;  3NM7 A;  4L8O A;  5IW9 A;  4FMA A;  5M1A A;  2XSO B;  1VQL 3;  3D5I A;  3GZY B;  5LC6 A;  1I0V A;  1Q7Y 4;  1WMO A;  1HZ1 A;  5CK6 A;  3BNB A;  3CCJ 3;  3DUK A;  1MGW A;  4FMB A;  5BIR A;  1N8R 4;  3UNL A;  1OF5 B;  1GD3 A;  2L1S A;  2R4I A;  1I8V A;  3F8H A;  3UJM A;  1GMQ A;  1BSB A;  3UL5 A;  2QA4 3;  2CWU A;  1O7P B;  1UUW B;  1V74 A;  3PXM A;  4KFF A;  1KC8 4;  3CD6 3;  1E97 A;  5AIG A;  1WMN A;  2OCT A;  2RGQ A;  1JKG B;  1Q7H A;  1GYB A;  1IDP A;  3JUO A;  3X40 A;  2FNQ A;  3S67 A;  1N9J A;  4PEJ A;  3NHX A;  2UX0 A;  3SLU A;  4O02 B;  3ER7 A;  1OH0 A;  1T3B A;  3FGY A;  2WGO A;  5IG0 A;  5IF6 A;  1EKM A;  1TRQ A;  3MSO A;  1JBT A;  1AVK A;  2CX0 A;  3WMD A;  3AMO A;  1B2U A;  3FH1 A;  1RGA A;  1BNS A;  1BRG A;  1JNQ A;  1NO3 A;  3NQY A;  3OV4 A;  2ZA4 A;  4MMZ B;  1PFP A;  2GU1 A;  2Z76 A;  1OHS A;  3PCR A;  1IQ8 A;  2B1X B;  1ULI B;  1US1 A;  1TUH A;  3OWU A;  5CF2 A;  2MC8 A;  1A2P A;  2ML6 A;  1FGO A;  1JB2 A;  2XGL A;  3DGM A;  1ISK A;  1UCJ A;  1X1U A;  2BT3 A;  3PGB A;  3FZW A;  3WA3 A;  4IPB A;  4EV5 A;  1TFO A;  7GSP A;  3F40 A;  1GD4 A;  2AAE A;  4BTX A;  2OTJ 3;  1KWI A;  3DXO A;  1BSD A;  2W9Q A;  1CYV A;  3KE7 A;  3VF1 A;  3X3X A;  3OWY A;  1K41 A;  1HU9 A;  3AMO B;  1VZZ A;  3EN1 B;  3I55 3;  2BU4 A;  3HK4 A;  3K7C A;  1MNL A;  1BUQ A;  3PS8 A;  3DM8 A;  3PCS A;  1B2S A;  2W0Q A;  3HIG A;  3URP A;  1YIJ 3;  4JRF A;  2L4V A;  2CG0 A;  2UUG C;  2J8X B;  4TX4 A;  1BNF A;  2CX1 A;  3AGO A;  2CH9 A;  1RNT A;  1SQW A;  1ZX2 A;  2P05 A;  4O2H A;  3LTC A;  1RLS A;  3AHW A;  1QAF A;  1FGT A;  2H0H A;  3DGL A;  2XSH B;  1PYL A;  2PZV A;  1W6Y A;  3EE1 A;  1UUV B;  1TP6 A;  3Q3F A;  2YFI B;  3HOH A;  1M1X B;  1NB3 I;  3MYT A;  4GB5 A;  3X42 A;  3S27 A;  1Q42 A;  3LTA A;  4HM7 B;  2K3D A;  4K1V A;  1QVG 2;  2GU3 A;  3G71 3;  3FSD A;  1C54 A;  3WOE B;  4R9K A;  2SAR A;  2HMO B;  4FCM A;  4RBN A;  5FW5 A;  2CFW A;  3F8X A;  3V99 A;  1GMP A;  4HM5 B;  4N6T A;  1JV2 B;  5IG4 A;  4WYK A;  2C11 A;  5JPU A;  4EV2 A;  5D82 A;  4EW5 A;  5ELJ A;  4R1K A;  4FCZ A;  3DMC A;  4CDL A;  2CKF B;  4DKI A;  3WOF B;  3CNM A;  2AAD A;  1RGC A;  1W7C A;  1NB5 I;  2BIR A;  3F14 A;  3X3Z A;  2RNT A;  3U1W A;  3LTB A;  3G16 A;  2KF4 A;  4Q53 A;  3FG1 A;  2D1W A;  1MWU A;  3NBR A;  3HI7 A;  1GS3 A;  2E2V A;  8CHO A;  4MMX B;  4HVN A;  3QRD A;  4LGQ A;  8RNT A;  3CCL 3;  2KRT A;  1GY6 A;  1JZD A;  7STD A;  1IVU A;  5BVB A;  3FLJ A;  1Q40 A;  3A5E A;  4BTW A;  3BLZ A;  4J8T A;  1VQ9 3;  1VQP 3;  1IT8 A;  2PNC A;  6GSP A;  3CCQ 3;  1KD1 4;  3GZR A;  3V98 A;  2R41 A;  4IT7 A;  1EG9 B;  1RGK A;  2KF5 A;  1YJ9 3;  1W2Z A;  3MWZ A;  1RCL A;  1QAK A;  1VQO 3;  3NV0 A;  1IVW A;  4LMI A;  3SOA A;  2XFT A;  1TU5 A;  3PZW A;  3EC9 A;  4RNY A;  1IK3 A;  1IU7 A;  2F5M A;  1DMM A;  3KFQ C;  2CFK A;  5G2G A;  1YJN 3;  1Q40 B;  1QMA A;  1T2I A;  3SVA A;  2I9W A;  1DE3 A;  3KSE D;  3L0R A;  3M8C A;  4N6M A;  3Q90 A;  1LNH A;  1I0X A;  5AII A;  4HM8 B;  4KFD A;  2HMJ B;  3MHE A;  1VQ4 3;  1IVV A;  1NWW A;  2ML5 A;  5AIH A;  1RTU A;  4NHF A;  3NV0 B;  2RFR A;  4XB5 A;  1BSE A;  5ELU A;  3X3Y A;  1R4C A;  1RDS A;  1RGL A;  2H0G A;  1PY3 A;  5M19 A;  2CFG A;  1UCK A;  2IUJ A;  4HM6 B;  1BSA A;  3BNC A;  1FA3 A;  3H3H A;  1LQG C;  3DGO A;  2QIY A;  2Y74 A;  1J2B A;  1RN1 A;  3B4P A;  2C4B A;  2XR8 B;  4LYL B;  2GBW B;  4J9A A;  1DMN A;  2O9U X;  1Y4K A;  4FCJ A;  4HAA A;  1N5P A;  2D42 A;  1K28 A;  1W02 A;  4FMC A;  1BGS A;  1VQ7 3;  3CPO A;  1IT7 A;  4GSP A;  3BIR A;  2FGT A;  2HMN B;  3WOD G;  1DVD A;  4EXR A;  1BIR A;  1QAL A;  3STD A;  3LXU X;  2GEY A;  3OXA A;  2C10 A;  4QWT A;  1L5G B;  4X2O A;  3S29 A;  1JBR A;  4NPB A;  3ALA A;  1FYS A;  1TTO A;  2HMK B;  2HOH A;  2JQ5 A;  1YVS A;  2W04 A;  3G0K A;  4LZI A;  5DRE A;  4X2H A;  1RSN A;  2M7O A;  4AEQ A;  5HOH A;  1YVB I;  2HMM B;  4N3V A;  3CC7 3;  2Q07 A;  3CMA 3;  4R9L A;  4WWU C;  3CCR 3;  4N6N B;  5JPP A;  1Q82 4;  3LOY A;  3EBT A;  3UB1 A;  3T8N A;  2F56 A;  2W6J H;  3WHO A;  3IPT A;  1I2E A;  6RNT A;  1ROA A;  2KAA A;  3ZG0 A;  3BND A;  1M90 4;  3D9R A;  1IV9 A;  4RZM A;  4HYZ A;  1O7W B;  3O8Y A;  3MG3 A;  1B2X A;  1LRA A;  1UW1 A;  1IV7 A;  4LSO A;  3EN8 A;  1E3V A;  1W00 A;  1A2V A;  5AIF A;  4WFO A;  4AKZ A;  3KII A;  1ZS7 A;  1B3S A;  3K5T A;  2W9P A;  3H51 A;  1UCL A;  2HML B;  1V57 A;  3WR2 A;  2P0X A;  2XF3 A;  3K0Z A;  4R4K A;  6STD A;  4EC6 A;  1VQK 3;  1Q81 4;  2A15 A;  3SYU A;  2XEP A;  3VSY A;  2MF7 A;  1N9E A;  3CCV 3;  5EQL A;  4CCV A;  3CPW 2;  1GOY A;  5M18 A;  1B21 A;  1K9M 4;  1JRQ A;  4HZB B;  4KVH A;  3EBY A;  4N6L A;  2V1L A;  3CXC 2;  1M1K 4;  2CW9 A;  2XRX B;  4I5Q A;  3KSP A;  1AVL A;  3PYJ A;  1LOY A;  1BU4 A;  1D6U A;  1OGX A;  2B24 B;  1MWR A;  1BRK A;  5IEN A;  3G8Z A;  1B27 A;  1DET A;  1WTH A;  3OWS A;  2W56 A;  3NBB A;  2H0I A;  3HZP A;  3A76 A;  5AEU B;  1TRP A;  1CH0 A;  1RJO A;  2CWT A;  3CU3 A;  4KFE A;  3CCE 3;  1B2M A;  4CJN A;  1M9G A;  3SXX A;  1CQS A;  2UGI A;  4XDV A;  1BNG A;  1GMR A;  3JUN A;  1B20 A;  4XDW A;  2BHM A;  3Q2P A;  2GEX A;  3DZL A;  3EQQ B;  1GOV A;  3N54 B;  1I2F A;  3F7X A;  4FMD A;  3I56 3;  1SPU A;  3NXJ A;  4HBR A;  2ZHX B;  5KP3 A;  2W56 B;  3DY5 A;  3JVC A;  4EBG A;  1BNR A;  2YFJ B;  4WYK B;  1JB4 A;  3FG4 A;  3SX1 A;  3FCS B;  2BMO B;  1KQS 2;  1W6G A;  1YGE A;  3ZFZ A;  3TDG A;  3T0U A;  1W2B 2;  2WO0 A;  1UUG B;  3X41 A;  2XGN A;  5RNT A;  1RN7 A;  5I97 A;  3LML A;  1W5Z A;  4GL6 A;  5AI1 A;  4HJL B;  3NX0 A;  2OWP A;  1TIJ A;  3F9S A;  3CCS 3;  1DVC A;  4N6U A;  5IEP A;  1YIT 3;  1BRH A;  3CC2 3;  1Q9E A;  2CG1 A;  3S5C A;  5IER A;  1UCI A;  3RGA A;  3J7Y d;  2CIU A;  1LQM B;  1FGR A;  1WMP A;  2F4Y A;  1SAR A;  4O3V A;  4HM2 B;  3ECF A;  3KCH A;  1UI7 A;  4OK0 A;  1A2K A;  4U13 A;  1B2Z A;  2OQE A;  3OW2 2;  1W01 A;  3DGN A;  1AR0 A;  2O3O A;  1TJD A;  1BOX A;  1IQY A;  2CK3 H;  2STD A;  3NBJ A;  4J5K A;  4L7K A;  4XBY A;  1D6Z A;  4KT3 B;  2WOF A;  5EEO A;  3OX9 A;  5STD A;  3D79 A;  4ORL A;  3MKI A;  1OCV A;  1VQM 3;  3K9M C;  1RGG A;  1FW7 A;  2OQE C;  3NQZ A;  4BIR A;  1YGW A;  1C7H A;  5AYS C;  1Q86 4;  1LXE A;  1YHQ 3;  1N5H A;  3EB8 A;  1RRH A;  1G0T A;  1LOX A;  1SJW A;  5CXO A;  1A90 A;  3VGN A;  3F7S A;  1OGZ A;  1UGH I;  3RDE A;  1ASK A;  1ROV A;  2LQV A;  3G4S 3;  5GSP A;  2E2U A;  2F86 B;  4L8P A;  1NDO B;  5G1L A;  1AQZ A;  1NJI 4;  1A67 A;  4BL2 A;  2JDI H;  3D4A A;  3SOY A;  3IJE B;  1LVN A;  4J5G A;  3CCM 3;  3SED A;  1FUS A;  1LOV A;  4STD A;  2ZDJ A;  4MMY B;  1ZO2 A;  4JF8 A;  1SIH A;  2P38 A;  1JN5 A;  2K0M A;  4H61 A;  4WP5 A;  1Z1S A;  2RBI A;  4OVM A;  2ZL8 A;  4LEH A;  4I4K A;  2QEX 3;  1K73 4;  1EQK A;  1T5Y A;  3FG3 A;  1VQN 3;  1S72 3;  1BRI A;  1DMQ A;  3EJV A;  4N6O B;  2IUK A;  1W6C A;  7RNT A;  2BMQ B;  1T2H A;  1BNE A;  3AHS A;  1RRL A;  1FUT A;  1U5O A;  2CHC A;  3NM2 A;  9RNT A;  3FKA A;  2W2C A;  1MOL A;  1K8A 4;  1O7M B;  3BB9 A;  3LH4 A;  3AGN A;  1BRS A;  1NU3 A;  1STD A;  3LTD A;  3N8B A;  1RN4 A;  1JN5 B;  3CCU 3;  2YX9 A;  3E99 A;  4HM1 B;  1AV4 A;  1QJG A;  1EA2 A;  3B7C A;  1IYY A;  1STF I;  1KSI A;  3KKG A;  1U8C B;  3WA2 X;  2IMJ A;  1RGH A;  1BAO A;  5IG5 A;  2Z7A A;  2CWV A;  2Y73 A;  3N9H A;  2IYJ A;  1EEJ A;  1HYF A;  2BNG A;  4RNZ A;  4WHA A;  2BMR B;  4K61 A;  1RHL A;  4HM4 B;  2W03 A;  1GOU A;  3LYG A;  4K90 B;  1I3I A;  1G96 A;  1R4Y A;  5IEO A;  3MG1 A;  1O7G B;  4OUQ A;  2F99 A;  1YJW 3;  5TGN A;  1VQ5 3;  1F8N A;  1OPY A;  1RNB A;  5IG3 A;  2INX A;  3UL6 A;  1O7N B;  4MEI A;  1O7H B;  4XM4 A;  1VQQ A;  2CFL A;  1D6Y A;  1FGM A;  1MWT A;  1G02 A;  2GXF A;  1I2G A;  4KZ1 A;  2F5W A;  1BNI A;  1IVX A;  1BVI A;  1FZU A;  1E3R A;  3EHC A;  5D81 A;  2KCD A;  2CC3 A;  1UGI A;  3GZX B; 
#chains in the Genus database with same CATH homology
 1RGA A;  1BNS A;  1BRG A;  2ZA4 A;  2GSP A;  1RTU A;  2KF6 A;  1A2P A;  1BSE A;  1YNV X;  5RNT A;  1RDS A;  1RGL A;  1I3F A;  1PY3 A;  1UCJ A;  1X1U A;  1UCK A;  1BSA A;  1X1W A;  3D5G A;  3DGY A;  1BRH A;  1RGE A;  7GSP A;  1Q9E A;  1RN1 A;  1BUJ A;  2AAE A;  1BSD A;  1UCI A;  3RNT A;  2C4B A;  4HOH A;  2F4Y A;  1BRJ A;  1SAR A;  1LNI A;  3KCH A;  2BU4 A;  4HAA A;  1B2Z A;  2KF3 A;  1B2S A;  1BGS A;  3URP A;  1BOX A;  3BIR A;  4GSP A;  4J5K A;  1BIR A;  4GHO A;  1BNF A;  3AGO A;  1BRN L;  1RGG A;  1FW7 A;  4BIR A;  1YGW A;  1BNJ A;  1RNT A;  3DH2 A;  1JBR A;  1FYS A;  1TTO A;  2HOH A;  1RLS A;  1I70 A;  1YVS A;  3AHW A;  1RSN A;  1PYL A;  5HOH A;  3Q3F A;  1AY7 A;  1LOW A;  5GSP A;  1X1Y A;  1AQZ A;  3HOH A;  1RMS A;  3D4A A;  4RNT A;  4J5G A;  2F56 A;  1MGR A;  3WHO A;  1FUS A;  1I2E A;  1LOV A;  2SAR A;  6RNT A;  2KAA A;  3BU4 A;  1C54 A;  3GSP A;  1B2X A;  1LRA A;  1GMP A;  2RBI A;  1BRI A;  1B3S A;  1ZGX A;  7RNT A;  1BSC A;  1UCL A;  1BAN A;  1RGF A;  1T2H A;  1BNE A;  1GSP A;  1RGC A;  2AAD A;  3AHS A;  3WR2 A;  1FUT A;  2BIR A;  1RCK A;  9RNT A;  3SYU A;  1X1X A;  5BU4 A;  2RNT A;  2KF4 A;  3AGN A;  1BRS A;  1GOY A;  4BU4 A;  1B21 A;  1RN4 A;  1JBS A;  1LOY A;  1IYY A;  1BU4 A;  8RNT A;  1BRK A;  1RGH A;  3D5I A;  1BAO A;  1I0V A;  1B27 A;  1DET A;  1HZ1 A;  3A5E A;  1MGW A;  5BIR A;  1HYF A;  1I8V A;  1TRP A;  1CH0 A;  6GSP A;  1GMQ A;  1RHL A;  1BSB A;  1RGK A;  2KF5 A;  1GOU A;  1B2M A;  1I3I A;  1RCL A;  1R4Y A;  1BNG A;  1GMR A;  1B20 A;  1RNB A;  2F5M A;  1GOV A;  1I2F A;  1T2I A;  1JBT A;  1TRQ A;  1G02 A;  1BNR A;  1I2G A;  1DE3 A;  2F5W A;  1BNI A;  1BVI A;  1FZU A;  1I0X A;  1B2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...