3TDGA

Structural and functional characterization of helicobacter pylori dsbg
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
232
structure length
232
Chain Sequence
QDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTKVENTTKKIFESGVIKGVPFLYHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of Helicobacter pylori DsbG
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 77
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18257 DsbG_N Disulfide isomerase DsbG N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.520 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3tdgA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tdgA02
1GSDA 1KTEA 5D9WA 3JCML 2BMXA 1QQ2A 2YWIA 2HYXA 4BPYA 3G7IA 6GSTA 2R37A 1QMVA 3C73A 5CAXA 3MAKA 3LEFA 5DCHA 6GSVA 4OCEA 5KN0A 4V1Ap 2JZTA 4FO5A 4ULXA 1K0OA 1SKSB 2VO4A 2H1GA 3IOSA 3GL5A 4K8MA 1UN2A 3UL3A 1VRSD 2DJ0A 1YEPA 1SL0B 3J7Yk 3EYTA 1QFNA 1PA3A 3H4KA 4N0VA 2OE3A 2RM5A 5LD0A 2KHPA 4MJBA 3DYRA 3L0HA 1YQ1A 1PD21 1R5AA 4EUYA 1AIUA 4RUVA 2FD3A 2L4CA 1SJ6A 2YZHA 3A2VA 1SYRA 5B6MA 1OC9A 2YZUA 4GSNA 3DRNA 2LS5A 4TW5A 1ERUA 1A8YA 3TOTA 2PU9C 4NXIA 2ES7A 1QXHA 1XVQA 1V2AA 2CVDA 3KM6A 4EC0A 3BCIA 1ERWA 2IJYA 3FKFA 1Y6EA 3C1RA 2QC7A 5FT3A 4OMVA 5DALB 4KX4A 1V57A 4TKYA 5AIXA 2NVLA 3LSZA 4IELA 5COHA 5D8IA 3RDWA 2WULA 4TXVA 3F6FA 5HFKA 2V32A 4PUAA 3HHVA 3KMOA 1FVJA 1PSQA 1V9WA 1R26A 2O7KA 2DJ3A 1PRXA 3GA4A 4LL1B 1SK0A 4BWQA 2IL3A 5G5EA 5HR1A 1QGVA 2EC4A 3LWAA 4DSSB 1BQ7A 1GNWA 4PX1A 5IQYA 1OC9B 3GFKA 2O85A 1B48A 1EEJA 2ZNMA 1JZRA 2LNTA 4JE1A 4XS4B 1XOBA 4L5LA 4PXOA 5INYA 1EP8A 1K0BA 1QK8A 1EEMA 2C0EA 4N11A 3ZIVA 4IS0A 1J08A 2WFCA 3FEUA 5ENUA 2WJUA 1R7HA 3LXZA 2VIMA 3EU3A 3RPPA 4ZBAA 3J7Yb 3I6AA 5KN3A 1HNCA 1GUHA 1ERTA 5IMCA 4XCSA 4TR1B 2EIQA 2C1YA 5KN2A 3EVIA 5ECIB 2YP6A 5J41A 2MMNA 4EF0A 1WE0A 2IMIA 2C0GA 2PVQA 3R2QA 3P2AA 3UEMA 3US3A 3EWLA 1GTBA 1ZYQB 3KMNA 2H30A 3K8NA 2L6DA 5AGYA 1M2BA 5EVOA 5L71A 3F4RA 3GKNA 2DMMA 2C3QA 5IMFA 2O8VB 3O3TA 2GLRA 5DBQA 2CX4A 4X43A 4JR4A 3G7JA 5D9VA 3HZ4A 1K0NA 1TK0B 3F3QA 1M2AA 3E0UA 16GSA 4I2TA 5ECRB 4ZB6A 2R2JA 3P7XA 1FVKA 1AC1A 3HJOA 3H8QA 4OD7A 1O85A 3IV4A 4HOJA 5LNKe 5DQYA 4MZBA 1PL2A 3KCMA 4CHSA 2MMAA 2E2MA 2XHFA 2A2RA 2M72A 2AV4A 2AB6A 3P90A 1XBSA 2LJRA 2G0FA 1ZGNA 2F51A 1EGOA 4P3YB 4IP1A 1NHOA 4EXJA 4ZB9A 13GSA 4K0NA 1O81A 20GSA 2OE1A 3TB2A 1NHYA 1CQHA 2VL3A 3TUEA 2B6MA 1YKCA 1VF1A 4BWSA 4XS6A 3KP8A 1G6YA 4XTSA 5IMAA 5GAPD 6GSUA 3ZMLA 2OJLA 2H66A 3UBLA 1VGLA 4K7NA 3ERGA 3UIWA 1B4QA 4GSSA 4EL1A 3EE2A 3TKSA 2H74A 3ERFA 2WGRA 2CVBA 2HI7A 3GRXA 5IMDA 2GTUA 3HJMA 1G0TA 4F0BA 3HA9A 1F9MA 3F3RA 3U6VA 1R5PA 5CNWA 5ECHB 1F3BA 4MMMA 4WKWA 2XPDA 4DSRA 2RM6A 2HFDA 1EOGA 4MH2A 5ID2B 1TI1A 4YH2A 3EC3A 3GUSA 2L57A 3QOUA 4D73B 2MMZA 3WGEA 3D22A 2X8CA 1JLVA 2H0GA 2L59A 3ZRDA 2C4JA 2C3NA 3L9UA 3ZVJA 1UA5A 4YAVA 5H5RA 2CX3A 2V6KA 1TRSA 3GL3A 5EL8A 3HZ8A 2OKAA 4YQVA 2VD1A 2LRCA 4BL7A 1GNEA 5GSTA 1MDIA 1URMA 5ECNB 4Q5NA 3TKPA 3GURA 3GH9A 4YAPA 2REMA 5IMVA 5B6NA 3ZLPA 5ELAA 1XWKA 2ALBA 4ISDA 3TRXA 3CSHA 4NHWA 3PINA 2V1MA 3IR4A 1LU4A 2L4QA 3U5RE 5HR3A 3HJPA 3BBYA 3TRPA 1Z6MA 4F2IA 5E4WA 3VPQA 1Z5YE 4BVXA 1H4OA 1XW5A 1G7EA 4KDXA 3GN3A 1FW1A 3KTLA 1GSYA 2GZPA 3BOAA 3H79A 2E7PA 1JZOA 5G5FA 4GTUA 8GSSA 1G7OA 1HYUA 4E8EA 2RLIA 2HE3A 1A24A 3FZ5A 3MWHA 3BJ5A 4I5QA 1T4ZA 3AY8A 5D96A 5ID2A 1NM3A 1T1VA 4TOPA 4JEDA 3CSIA 2EIOA 5IOXA 1AXDA 2LTKA 7GSSA 3HDCA 1BG5A 1K0AA 4MJAA 1T8EB 4NAXA 5DCGA 2B7KA 2OBKA 3LG6A 3VFIA 3UOMA 3LYPA 4V2LA 1FB0A 2TRCP 5DALA 3F4TA 3TKRA 1SK1A 1OYJA 2WZ9A 2JSYA 1GSUA 3A5WA 4GCIA 5JCUA 2FWHA 2PN8A 2GS3A 3P8WA 2H8LA 1BX9A 2F8AA 1TU7A 2OADA 3G9BA 1Q4JA 1ON4A 4EDZA 2GSRA 4G10A 1LBKA 2HSYA 2H70A 4POBA 2IN3A 2YJ7A 1U6TA 5C00A 2OACA 1XWAA 5F06A 5FWGA 1PKZA 1C72A 3OR5A 3GYKA 5JWOB 5J5NA 1SD9A 4MCUA 1KNGA 3QAGA 2K8SA 4CDOA 1AUCA 2B7JA 2G2QA 2LRNA 1GSEA 1WRYA 2PUKC 4FH8A 4ZILA 5JCGA 2YV9A 2H0IA 3EINA 1M9AA 1DSBA 3O6TA 4MK3A 3DWVA 4YQUA 1XW6A 5JWQB 3HXSA 1EV4A 3W8SA 3H1NA 2H76A 3QDNA 2YJHA 2JZRA 1XFLA 3Q19A 1NSWA 4POLA 4V2NA 4TXOB 3MNGA 1SYXA 4PGTA 1OC3A 3QFAC 2JZSA 3Q6OA 3ME8A 2OBIA 4MLYA 3GSSA 1A8LA 4EE0A 1GH2A 4POKA 1TK5B 2OA7A 1T00A 1WWJA 1K0MA 3APSA 3IPZA 3WT1A 1O8XA 1T4YA 3GTUA 1Z6NA 2VAFA 3FR3A 3LGCA 2I9HA 2FWFA 4IJIA 4G2EA 4JZQA 5J4UA 4D73A 4NV5A 5ECKB 4MABA 1PX6A 5ECSA 2LQOA 3TJBA 3C1SA 5EY6A 4HDEA 2QGVA 1XVWA 3RHCA 1THOA 4CW9A 1PMTA 2FNOA 4MH3A 1IYHA 2L5OA 1TOFA 2R4VA 4ML6A 17GSA 2HT9A 2VD0A 4GQCA 3TOUA 1N8JA 2HRNA 3F6DA 4K9ZA 5IM9A 4I97A 3ZFLA 3C7MA 4ACSA 2CA8A 1GLPA 3TJGA 2H1BA 2JL4A 3F0IA 2HZEB 1MTCA 2DMLA 2IFQA 3HKRA 2LSTA 4LLRA 4AJ8A 1ML6A 2GQLA 4XIHA 4RQRA 5G2ZA 3TJKA 4WBJA 3KP9A 4O5RA 2HSHA 3FZAA 2FLSA 5F07A 1XXUA 4KDYA 4TN8A 2CAQA 4RI7A 2JSZA 3IC4A 4JBBA 3TCOA 5IIZA 4NPBA 5F0GA 2R6KA 3VLNA 1BAYA 2X8HA 2X64A 4YQMA 4IW9A 1GSQA 3IE3A 1W4VA 2K8VA 2JU5A 3CYNA 5HR0A 1QUWA 5DJMA 4ZL7A 5IMZA 4OO5A 4Q5FA 1ERVA 4LA1A 5EPFA 4TR1A 3GKKA 3CRUA 1HD2A 2LV3A 3CTGA 2PMTA 2FHEA 1TTZA 1DBYA 5JWRB 1A0RP 3IK9A 4HQZA 5DDLA 1ZOFA 1E6BA 4N0ZA 4HJ2A 4XHMA 3E3EA 1M9BA 3WGXA 3KIJA 4GSTA 4JR6A 2D2ZA 2HXKA 2TRXA 3GV1A 2WB9A 2JADA 2VCVA 4AF2A 5B8AA 2YWOA 1TW9A 2PBJA 4X0XA 4MZCA 3ME7A 2GGTA 2GSSA 2LRTA 2WDUA 4XRDA 4WXTA 1Z3EA 3C71A 3C8EA 4HU9A 5CRGA 5ECMB 3A2XA 2QSIA 2VCQA 3HY2A 4L5OA 3F4SA 1GSFA 2AHEA 2CZ2A 4WR5A 4HEA2 1T3BA 3EMPA 3PR8A 1X5CA 3D5JA 3KEBA 3GKMA 2TIRA 3APOA 3M1GA 2CVKA 2GSTA 2O89A 4K0GA 4WETA 2VL9A 4GRFA 4TRXA 4FYBA 3IAM2 5AIVA 4FYCA 3IXRA 3UBKA 3M9JA 1TRVA 1A2JA 5ABRA 1YEXA 4F0CA 3WD6A 2H73A 3IA1A 2LNSA 3TJFA 3FZ9A 3TGZA 4F9ZA 1EWXA 1J9BA 1ILOA 2I4AA 1K0DA 3WT2A 2E2GA 1NW2A 4AGSA 1PQNA 2YWNA 4J2FA 4ZBBA 1O73A 1RQMA 2YNXA 3KZQA 4ZL9A 5AISA 2AUVA 4F03A 5DQSA 2H6YA 4Z7XA 1BJXA 5DAKA 3L78A 4GLTA 4PUFC 4JU5A 3BCKA 3NOFA 1XWBA 3G7YA 3GX8A 2C3TA 3EMXA 2DIZA 1X9WB 4MP4A 3EURA 1XIYA 4DVCA 5A5KA 1FB6A 2WS2A 1XOAA 4K2DA 1TP9A 3CMIA 4IQAA 2LQQA 2P5QA 1WOUA 4PQ1A 2YV7A 3LXTA 2FWGA 1Z7PA 5F8BA 2ON7A 1EGRA 4HZ2A 2B1KA 1V40A 1TRUA 1EP7A 2L5LA 4OFTA 2KLXA 1WMJA 2YWMA 1F3AA 3NIVA 1MDKA 2AYTA 1YDKA 2B5EA 2P5RA 3Q74A 2HZEA 3D0ZA 1R4WA 2B5YA 2OE0A 1PGTA 2C0DA 1OKDA 1U3IA 4DEJA 6GSSA 1FG4A 3LYKA 3VPTA 5CREA 4KUNA 4O32A 2PWJA 1A2MA 1MD4A 3I43A 2M46A 5IOWA 1ZYEA 2DBCA 2H72A 3M9KA 3QCPA 5G1LA 1EV9A 3DGQA 3GKXA 1WJKA 1SKRB 5HFGA 3CTFA 5ECOB 5A4VA 3GIXA 3DIEA 2IMKA 4ID0A 4MF7A 3QFBC 4MPGA 2DSAA 4OFMA 4IP6A 4KSMA 3DVXA 2C80A 2LJAA 3I69A 2VUPA 1B4PA 1JHBA 1YZXA 5ELGA 1X0RA 2NTOA 3M0FA 4I2UA 2F3MA 4I8BA 1HNBA 22GSA 1THXA 3A3TA 1HNAA 3FY7A 3ZIJA 1AAZA 4XRAA 2XBIA 4TR3A 3VI5A 2VOCA 1WPIA 1UVZA 2GSQA 1PL1A 2H1AA 1YF1A 1V98A 1SK2A 4KDUA 5IPGA 2NDOA 4MJCA 4N10A 1Y25A 3KGKA 2NBSA 3O76A 2RIIA 4EDYA 4ZBDA 2PVOC 5DJLA 2K6VA 4ECCA 1Q98A 4BVYA 5GAND 2VL2A 3L9VA 3UVHA 5J3RA 3APQA 3GNJA 3GX0A 1U88A 1GP1A 2YOIA 2I1UA 5J9BA 1F37A 5AN1A 1XW9A 1F6MC 1SL1B 3BD2A 4QL7A 4RI6A 2RUFA 1W89A 3ZTLA 3FK8A 2A4VA 4L8EA 4NV2A 4ZB8A 2H01A 3ZMKA 3LJRA 2FGXA 3E9JB 1A2LA 1PN9A 1AW9A 1T7PB 4MPFA 4HS1A 3ZVJD 2YPMA 1YY7A 2MBTA 1U87A 1GSSA 1K3YA 4KH7A 5F05A 3CRTA 1F2EA 4WF5A 2GZZA 1TJDA 2HLSA 1S3DA 4GQFA 3W8JA 1VF4A 3A2WA 4K1FA 4K7IA 4K6XA 3UARA 5CO3A 5HFIA 5E59A 2CV4A 3ISOA 3ZL5A 5CP1A 3W6GA 5IPHA 5KEJA 2MMOA 2LKUA 2IWTA 5DVBA 1GLQA 2H71A 4N30A 1N2AA 1TXXA 4V1Ag 1X5DA 5J9CA 2V2GA 4NHZA 1A23A 3F8UA 2ZUPA 1GUMA 1H75A 2WRTA 2VCXA 4IBPA 1S3AA 5B8BA 2H1DA 1K0CA 3RPNA 2P0GA 2IMFA 5D9XA 1GTUA 1USBA 3NZNA 3CBUA 2LJKA 3RAZA 1GUKA 4TR0A 4OFNA 3FHKA 2VCZA 3VK9A 1ACVA 4KGIA 4F82A 3IBHA 1IYIA 1O6JA 5H5QA 4QL9A 1OE7A 5H5SA 2N5AA 2MYGA 3GTUB 2VLTA 1MD3A 1K3OA 1ZL9A 2KUCA 1KEBA 6GSXA 2K18A 3RHBA 1TK8B 5D73A 1X9SB 4L0WA 3WGDA 5G30A 3KD0A 2V6OA 4G19A 1U3AA 3D4MA 1SU9A 1XWCA 2FA4A 1S3CA 5HR2A 4HU7A 4H86A 1OKTA 3CSJA 2H6XA 19GSA 4EVMA 1V58A 2IPAA 1GTIA 2H0HA 4KW6A 4HQSA 1GL8A 4FIWA 3ZITA 1GWCA 3UJ1A 2GZYA 3UAPA 4V2MA 3GH6A 4IKHA 1O7UA 3ED3A 2FWEA 2E0QA 4NWYA 1M7TA 1JZDA 4EO3A 5GSSA 4PNGA 3TDGA 2LEGA 2H19A 3D21A 5FHIA 3LORA 2B5XA 3FRCA 2IIYA 1B9YC 1FAAA 4LMVA 2PGTA 3DEXA 2FUG2 3DD3A 2GT6A 2AAWA 1I5GA 2JACA 4IVFA 4ZIJA 1I9DA 12GSA 4L0UA 10GSA 3QAWA 5IO0A 3QPMA 5CYYA 2EIRA 3VWWA 2NPBA 3H93A 2XBQA 4KSOA 1FO5A 4IQ1A 4ECBA 3TRQA 3HCZA 1FHEA 4IHUA 1OAZA 3FYGA 1OVNA 3UVTA 1X5EA 4OO4A 2IMEA 3FZ4A 2DC5A 2DJKA 4PQIA 2HNLA 3EU4A 3DMLA 4OCFA 2HRFA 4EKZA 4ML1A 11GSA 3N9JA 4Q5RA 2X99A 4IGJA 3ZREA 14GSA 3GHAA 3F63A 1JLWA 4PNFA 5ECLB 5LCZA 4MA9A 1X9MB 4WR4A 2B3SA 4HI7A 2QKEA 5CRWA 3VWXA 1KBNA 2P31A 1Z7RA 4AJ6A 3CXGA 2VLUA 1WIKA 4J57E 3QD9A 4POMA 1ZCPA 1DE2A 3KH7A 3HVSA 3F9UA 3FW2A 1SL2B 2BTOT 2KP1A 2L6CA 3VWUA 2GQKA 2MZCA 1B9XC 5B7CA 4DSSA 3IK7A 1M2DA 1M0UA 3DVWA 1BYEA 4BA7A 1ZMAA 1M99A 2M80A 4TR4A 5ECPB 4GF0A 1PKWA 2LUSA 4KAEA 4ZL8A 5G31A 4ECIA 2H75A 2VCWA 1WP0A 3N5OA 6GSWA 2V41A 2KP2A 4DSQA 4XS4A 2CQ9A 3SBCA 2VLVA 3QR6A 1JFUA 1PX7A 4LMWA 4X1UA 3TJJA 4WBRD 3HVVA 2YCDA 3D4TA 3VI7A 2PPTA 3LQ7A 4LL4B 1BEDA 1GRXA 5C04A 3VWVA 1FOVA 2C0FA 4PQHA 1ZZYA 1Z9HA 4MZWA 3FR6A 4OWYA 3ZYWA 3HVXA 4HJMA 4RQXA 3MSZA 3L9SA 3QMXA 2BJXA 5A4WA 4HUAA 2MBSA 1TU8A 2CAIA 4J56E 1B8XA 1E2YA 2R5GA 4K7OA 1TRWA 1ABAA 4HZ4A 3S9FA 2IFQB 1EOHA 4KA0A 5GZZB 3DKSA 5DAKB 1J0FA 2RUEA 2VM2A 3IDVA 2H6ZA 3I9V2 2CT6A 2KOKA 4NMUA 4IJ3A 5CRDA 2DIYA 2YANA 4JRRA 3QAVA 2F9SA 3V1WA 1VF3A 2YN1A 1XCCA 4Q5QA 5ECQB 3LFLA 1SD8A 4KB3A 1OE8A 3TKQA 3UMAA 2GT5A 1XPVA 1TKDB 5G1KA 3TKSE 4FYUA 3PH9A 2FCHA 4ILFA 4O92A 3KXOA 9GSSA 1JZWA 1A0FA 1RW1A 2ON5A 4E8HA 2O87A 4XS1A 4O7HA 2VL2C 4GXZA 4ZXGA 2FY6A 2R3XA 1AQXA 2PERA 2ZCTA 1DE1A 4MF5A 6GSYA 2HZFA 2X8GA 2IMDA 1CQGA 5D93A 2DJ1A 1VF2A 2B1LA 2FA8A 4TVEA 1HQOA 2AJQB 1MEKA 2I81A 3VURA 4TXOA 2DJ2A 1OC8A 4KE3A 1RK4A 1G6WA 2XPEA 4KNDA 4QQ7A 3ZFBA 2GDRA 3TKSC 2A2SA 2Z9SA 5IO2A 3KTBA 3L4NA 1DUGA 1GULA 3RBTA 4ECJA 2GQMA 3KH9A 4MF6A 5HQPA 1MDJA 3FR9A 5KN1A 4GWRA 1SJZA 2N5FA 2J9HA 2CZ3A 1O8WA 1YF0A 1SJIA 2I3YA 2J23A 3GSTA 1YJ6A 3IRAA 1EZKA 4G9HA 4WF4A 2GVPA 5D9TA 1UC7A 4MJEA 4KCAA 3HD5A 1AQVA 1SKWB 3WYWA 3D6IA 3KJYA 2K9FA 4MDCA 18GSA 3HYPA 3Q18A 2VCTA 3M3MA 4WEYA 1TI3A 4I6XA 2XC2A 1YKAA 2C8UA 3DXBA 3ZZXA 2VM1A 4PURA 2DLXA 3ERWA 1XZOA 1LJRA 1SENA 3PGTA 2N5BA 4KCEA 3SWLA 3GMFA 3IHQA 4AJ7A 5CRHA 2F8FA 2WCIA 3MDKA 5JCWA 1XWGA 3IAS2 1K3LA 2DJJA 1AQWA 1ST9A 1TDIA 1GTAA 3M8NA 4IN0A 5A4UA
chains in the Genus database with same CATH superfamily
1GSDA 1KTEA 5D9WA 5BU4A 3JCML 2BMXA 1QQ2A 2YWIA 2HYXA 3OX9A 4BPYA 3G7IA 6GSTA 1WMNA 2R37A 3CCU3 1QMVA 2OWPA 3C73A 3BNCA 3MAKA 5CAXA 3LEFA 2F99A 5DCHA 6GSVA 1RGEA 4OCEA 5KN0A 4V1Ap 2JZTA 4FO5A 4ULXA 1K0OA 1SKSB 2VO4A 2H1GA 3HI7A 3IOSA 2BU4A 1ZX2A 3D5GA 4YKGA 3GL5A 4L8PA 5BXQA 4ICYA 4K8MA 1UN2A 3UL3A 1VRSD 2DJ0A 1YEPA 2W9PA 4N6NB 1IK3A 1SL0B 1QJGA 3J7Yk 3EYTA 2A15A 4BL7B 1QFNA 1ROVA 1RGFA 2R0PA 3MWZA 1PA3A 3H4KA 4N0VA 2OE3A 1IQ8A 3FCSB 2RM5A 5LD0A 2KHPA 1HKXA 4MJBA 1QVF2 3EB8A 3DYRA 3L0HA 3HK4A 1KWIA 4XDWA 5IG5A 1YQ1A 1PD21 1R5AA 4EUYA 1AIUA 4RUVA 2FD3A 2L4CA 1WTHA 3G713 1SJ6A 2YZHA 3A2VA 1SYRA 5B6MA 2OQEC 1GS3A 1OC9A 2YZUA 4GSNA 1M1XB 1T2HA 3DRNA 2LS5A 4TW5A 1ERUA 1A8YA 3TOTA 3NM2A 2AAEA 2PU9C 4HM6B 2KAAA 4NXIA 1OGXA 1W6CA 2ES7A 1B2UA 3Q1CA 1QXHA 4BVXB 1E3RA 1V2AA 1XVQA 3AMOA 2CVDA 3KM6A 4EC0A 1Q42A 1FGMA 3BCIA 1ERWA 3AGNA 2IJYA 3FKFA 1Y6EA 2O3OA 3C1RA 2QC7A 3BB9A 5FT3A 4OMVA 5DALB 4FCJA 4KX4A 1V57A 4TKYA 5AIXA 3CCV3 2NVLA 3LSZA 1JKGA 2GU3A 1DMQA 4IELA 3X41A 5COHA 1RN4A 1G02A 1QAKA 3DXOA 5D8IA 3CC73 3STDA 3LTDA 3RDWA 2WULA 3V92A 3KSPA 3F6FA 4TXVA 5HFKA 3K5TA 1BIRA 2V32A 2Z7AA 4PUAA 3HHVA 3KMOA 4BTWA 3DGNA 1FVJA 1PSQA 1V9WA 1R26A 4K1VA 2O7KA 2CWUA 1RGAA 2DJ3A 1BNSA 1W5ZA 1PRXA 3GA4A 4LL1B 1SK0A 3EF8A 2IL3A 4BWQA 1WMOA 5G5EA 3CCJ3 5HR1A 1QGVA 2EC4A 2QIYA 1RSNA 3LWAA 4DSSB 2HMKB 5LC6A 1VQ63 1BQ7A 1GNWA 4PX1A 3EN8A 5IQYA 1OC9B 3GFKA 2O85A 1B48A 1EEJA 3VF1A 2ZNMA 3A5IA 1W2B2 1JZRA 2LNTA 4JE1A 4XS4B 1XOBA 4L5LA 4PXOA 2RCDA 4EV5A 5INYA 1EP8A 1K0BA 3S29A 1W00A 1QK8A 1M3JA 1EEMA 2C0EA 4N11A 1LOVA 3ZIVA 4IS0A 1J08A 2WFCA 3FEUA 5ENUA 4TX4A 3M8CA 3HVNA 2WJUA 1R7HA 3T8UA 3H51A 4BTYA 1VQ73 3LXZA 8RNTA 1KQS2 2VIMA 3EU3A 3RPPA 1ASKA 4ZBAA 3I6AA 5KN3A 3J7Yb 1UGIA 3EHCA 4HAAA 1HNCA 1GUHA 1WQLB 4WHAA 1ERTA 5IMCA 1Y4KA 4XCSA 4TR1B 2EIQA 3RGRA 2C1YA 5KN2A 3EVIA 5ECIB 9RNTA 2YP6A 5J41A 3CQFA 3IPTA 2MMNA 4EF0A 4KFFA 1OACA 1WE0A 2IMIA 1VQN3 3NBBA 2C0GA 2PVQA 3R2QA 3P2AA 3UEMA 1I2FA 3US3A 3EWLA 1GTBA 1QMAA 1BNFA 1ZYQB 3KMNA 1RNTA 2H30A 3K8NA 2L6DA 5AGYA 1NNVA 5FGOA 2IY2A 1M2BA 3ER7A 5EVOA 1UUWB 5L71A 3F4RA 5EEOA 3GKNA 2DMMA 3WR2A 1W02A 2C3QA 4HM7B 1LOWA 3CCQ3 2UX0A 1BSCA 3GRDA 5IMFA 2O8VB 3O3TA 2GLRA 3JUMA 5DBQA 2CX4A 4X43A 4JR4A 5STDA 4J8TA 3G7JA 5D9VA 3HZ4A 1JN5A 1K0NA 1TK0B 1VZZA 3DM8A 3F3QA 1M2AA 2WGQA 3E0UA 16GSA 1S5AA 4LSOA 4OUQA 4I2TA 5ECRB 2W6JH 3T0UA 4ZB6A 3G8ZA 2R2JA 3P7XA 3D5IA 1FVKA 1AC1A 3HJOA 1BGSA 3H8QA 4OD7A 1O85A 5FW5A 3IV4A 2F5WA 4HOJA 1B20A 3CCR3 1YJ93 1EQKA 2RFRA 5LNKe 5CLKA 5DQYA 2PNCA 4MZBA 1PL2A 3KCMA 1BRKA 1SQWA 1O7MB 4K2XA 4CHSA 3G0KA 2MMAA 2CFWA 4N3VA 2E2MA 2XHFA 2A2RA 1AVLA 2M72A 5CK6A 2AV4A 2JQ5A 1BRSA 2AB6A 5CF2A 3P90A 2A4HA 1JRQA 3UJMA 1XBSA 2G0FA 1ZGNA 3V98A 1WNHA 2F51A 2IYJA 2LJRA 3GZYB 1EGOA 4P3YB 1JB2A 4IP1A 1NHOA 3PYJA 3J7Yd 4EXJA 4ZB9A 2GU1A 13GSA 4K0NA 1O81A 4CCVA 20GSA 2OE1A 3TB2A 4EW5A 4LGQA 1NHYA 1BANA 1CQHA 2VL3A 5D82A 2SARA 3TUEA 2B6MA 1GD4A 1YKCA 1VF1A 4BWSA 4XS6A 3KP8A 1G6YA 4XTSA 5IMAA 5GAPD 3AHWA 1U8CB 6GSUA 1TFKA 3ZMLA 2OJLA 2H66A 5DRVA 3UBLA 1VGLA 3FMWA 3X42A 4K7NA 5I97A 3ERGA 3UIWA 3CPW2 1B4QA 1BAOA 1UCLA 4GSSA 4AKZA 4EL1A 3EE2A 3TKSA 2H74A 3ERFA 3EQQB 1OF5A 2WGRA 2CVBA 3GSPA 5IEOA 2HI7A 2R41A 2ZA4A 2Z77A 3GRXA 3CNMA 5IMDA 3S67A 2GTUA 3HJMA 1G0TA 2IUKA 3KE7A 4F0BA 3HA9A 1TIJA 1O7NB 3WMDA 1F9MA 3PXMA 2O9UX 3BIRA 3F3RA 4WFOA 1VQM3 3U6VA 3UL5A 1R5PA 3N9HA 5CNWA 5ECHB 1F3BA 1I3FA 1K9M4 4MMMA 4NREA 4WKWA 2CKFB 2XPDA 4DSRA 4X4JA 2RM6A 2QA43 2IMJA 3FG4A 1IVUA 2HFDA 1NDOB 2KCDA 4RNTA 1EOGA 4MH2A 5ID2B 1B2XA 1TI1A 4YH2A 3S27A 3EC3A 4EYCA 1EUIC 1IVWA 1C54A 3GUSA 1HU9A 2L57A 3QOUA 1SJWA 4D73B 4HM2B 2MMZA 2FGTA 3WGEA 3D22A 2X8CA 4BTXA 1JLVA 2H0GA 2L59A 1W01A 1BU4A 2OOVA 4LZIA 2CFLA 3X40A 2L4VA 3ZRDA 3SEDA 2C4JA 2C3NA 3L9UA 2BMOB 3ZVJA 1UA5A 4YAVA 5H5RA 2CX3A 3V99A 2V6KA 1TRSA 3GL3A 1AY7A 3MG3A 5EL8A 3FF2A 1YVSA 2D1WA 4KFDA 3HZ8A 2OKAA 4YQVA 2VD1A 2LRCA 4BL7A 1GNEA 5GSTA 3KIIA 1MDIA 1URMA 5ECNB 1DVDA 4Q5NA 3KFQC 4HSCX 5D81A 4PEJA 3GZRA 3TKPA 1ULIB 2FXTA 3OV4A 3GH9A 3GURA 2W56B 4X2HA 2REMA 4YAPA 5IMVA 5B6NA 3ZLPA 5ELAA 4HM0B 1XWKA 2ALBA 1IT8A 3D9RA 4ISDA 3TRXA 5M1AA 3URPA 3CSHA 1B2ZA 2YX9A 4OK0A 1RN1A 4NHWA 3PINA 2V1MA 3IR4A 1LU4A 2L4QA 3EX9A 3U5RE 5HR3A 3HJPA 1FGRA 3BBYA 5GSPA 1Q9EA 4FCMA 1RKYA 3TRPA 1Z6MA 2XR8B 4F2IA 5E4WA 3HIGA 3VPQA 1Z5YE 4CY8A 4BVXA 2B24B 1H4OA 1CQSA 1XW5A 1G7EA 4KDXA 3GN3A 1FW1A 3KTLA 1GSYA 2GZPA 3BOAA 3H79A 3HX8A 2E7PA 1FW7A 1JZOA 1N5PA 4MJDA 4GTUA 5G5FA 1I2EA 1IQXA 8GSSA 1G7OA 1HYUA 4E8EA 2RLIA 1E97A 2HE3A 3NBRA 1K28A 1A24A 3FZ5A 1I2GA 3MWHA 4L7KA 3BJ5A 2XGNA 4I5QA 1T4ZA 3AY8A 5D96A 5ID2A 1LNIA 1NM3A 1T1VA 2RSXA 5JPPA 3DH2A 1Z1SA 4TOPA 3OWYA 4O2HA 4JEDA 3CSIA 1RN7A 2EIOA 5IOXA 1AXDA 2CW9A 2LTKA 7GSSA 3HDCA 1BG5A 1K0AA 4MJAA 5EQLA 1T8EB 7STDA 4NAXA 5DCGA 5KP3A 2B7KA 2OBKA 1BOXA 2CC3A 2SBLA 3LG6A 3VFIA 3UOMA 3LYPA 4V2LA 1FB0A 2TRCP 5DALA 1JNQA 3F4TA 4YKFA 3TKRA 4IT7A 1SK1A 2XEPA 1OYJA 2WZ9A 4N6UA 2JSYA 2Y74A 3MYTA 1GSUA 1A2KA 4WWUC 3A5WA 3WA3A 4G1MB 4GCIA 5HOHA 5JCUA 2FWHA 2PN8A 2GS3A 3P8WA 2H8LA 1BX9A 3GZXB 2F8AA 2R0GA 1TU7A 2OADA 3ALAA 3G9BA 1Q4JA 1ON4A 4FMBA 4EDZA 2GSRA 4G10A 2E2TA 5KP1A 2XSHB 1LBKA 2HSYA 2H70A 4POBA 2IN3A 1GY7A 2QA1A 2YJ7A 1U6TA 5C00A 2OACA 1XWAA 3CPOA 5F06A 1N9EA 5FWGA 1PKZA 1O7PB 1EA2A 1C72A 3OR5A 3GYKA 3ZG5A 5JWOB 5J5NA 1SD9A 4WYKA 1VQL3 4MCUA 1KNGA 1R4CA 4LMIA 3QAGA 2K8SA 4CDOA 1AUCA 2B7JA 2G2QA 2LRNA 1GSEA 4G0KA 2KF5A 3X3ZA 1WRYA 2PUKC 4BU4A 4FH8A 4ZILA 1RMSA 3K0ZA 2WOFA 5JPUA 5JCGA 5IG4A 1JB4A 2YV9A 2H0IA 3EINA 4I4KA 1VQ93 1M9AA 1DSBA 3O6TA 4MK3A 3DWVA 3CMA3 4YQUA 1XW6A 4FMAA 5JWQB 3A76A 1Q7Y4 3HXSA 7RNTA 4Z2UA 3CC43 1EV4A 3W8SA 1OHOA 3H1NA 2H76A 1X1UA 3O8YA 3QDNA 2YJHA 1E3VA 3E99A 2JZRA 1GOYA 1XFLA 3Q19A 1O7HB 1NSWA 4POLA 4V2NA 4TXOB 3MNGA 1SYXA 4PGTA 1Q40A 1AR0A 1OC3A 3QFAC 3DGYA 2JZSA 3Q6OA 3ME8A 2OBIA 1TUHA 4MLYA 3GSSA 5KP4A 3H3HA 1BRGA 1A8LA 1GH2A 2BO9B 4POKA 4EE0A 1TK5B 2OA7A 1T00A 1WWJA 1K0MA 3IC8A 3APSA 3IPZA 2YFIB 1UI7A 3SOAA 7GSPA 4HKVB 3WT1A 1O8XA 3SLUA 1HZ1A 1T4YA 3GTUA 1Z6NA 5IG3A 2VAFA 3FR3A 3LGCA 2I9HA 2FWFA 4IJIA 4G2EA 4JZQA 1C7HA 5J4UA 4D73A 4NV5A 5ECKB 4MABA 1PX6A 5ECSA 2KRTA 4IIAA 2LQOA 1JN5B 3AMOB 2STDA 3TJBA 1HYFA 3C1SA 5EY6A 4HDEA 2QGVA 1XVWA 1LOYA 1LXEA 3RHCA 4RBNA 3F14A 1THOA 4CW9A 1XG8A 3LZAA 2F4YA 1PMTA 2FNOA 4MH3A 4H61A 1IYHA 2L5OA 1TOFA 5IG0A 2R4VA 4ML6A 17GSA 1B3SA 1I0VA 1Q864 1VQ83 2HT9A 3K7CA 3WODG 2VD0A 4GQCA 3TOUA 1N8JA 2HRNA 3F6DA 4K9ZA 5IM9A 4I97A 3ZFLA 4K5SA 1O7WB 3C7MA 4CPKA 4ACSA 2CA8A 2W56A 3MG1A 2HMNB 1GLPA 4KZ1A 3TJGA 2HRAA 2H1BA 2JL4A 3F0IA 2BMQB 2HZEB 2GBXB 1MTCA 2DMLA 2L1SA 2IFQA 3HKRA 1OCVA 2LSTA 4LLRA 4AJ8A 3DZLA 1ML6A 2GQLA 3ZG0A 4XIHA 2PZVA 1N8R4 4RQRA 5G2ZA 3BNDA 5IERA 3TJKA 4WBJA 3KP9A 1BSEA 1ZS7A 3EJVA 2HSHA 3FZAA 4O5RA 2FLSA 4KVHA 5F07A 1XXUA 4KDYA 4N6LA 2X49A 4HM5B 2GXFA 4TN8A 2CAQA 2B1XB 4RI7A 1VQO3 2JSZA 4BL3A 3G6E3 3IC4A 1BRIA 4JBBA 3ECFA 3TCOA 5IIZA 4NPBA 5AYRB 2OTJ3 5F0GA 3MHEA 3NBJA 2CWTA 3LH4A 2WGOA 2R6KA 3VLNA 4R9KA 1BAYA 2X8HA 2X64A 4YQMA 3WA2X 4IW9A 1GSQA 3IE3A 1W4VA 1YVBI 3UNLA 4ZM8A 2K8VA 2JU5A 3DMCA 4HZ9B 3CYNA 5HR0A 1I0XA 1QUWA 5DJMA 4ZL7A 4HOHA 3AGOA 1TTOA 3CNXA 5IMZA 2XRXB 3JUQA 2ZDJA 4OO5A 4NHFA 4Q5FA 1ERVA 2AADA 4LA1A 5EPFA 4TR1A 4GB5A 1J2BA 3GKKA 1ROAA 3CRUA 1HD2A 2LV3A 3CTGA 4DKIA 6RNTA 2PMTA 2FHEA 1TTZA 3OWSA 1DBYA 1FOHA 3RGAA 5JWRB 1A0RP 1DVCA 1K41A 3IK9A 4HQZA 1A90A 1GMPA 5DDLA 2BNGA 1YIJ3 1ZOFA 1E6BA 4N0ZA 4HJ2A 4XHMA 3E3EA 1M9BA 3WGXA 1OUNA 1ZGXA 3KIJA 4GSTA 4JR6A 2I9WA 3EC9A 2D2ZA 4N6TA 2HXKA 2TRXA 4USSA 3WDGB 3WHOA 4MMXB 3GV1A 2WB9A 1W6GA 2JADA 1LQMB 2VCVA 4AF2A 2CFDA 5B8AA 2YWOA 1TW9A 2PBJA 4X0XA 4MZCA 1VQP3 3JUOA 2GGTA 2GSSA 2LRTA 1IQYA 2WDUA 3ME7A 4XRDA 4WXTA 1Z3EA 3C71A 3C8EA 4HU9A 5CRGA 1BSDA 5ECMB 3A2XA 1FYSA 2Y73A 2QSIA 3DGLA 2VCQA 1RRHA 3SOYA 3HY2A 4L5OA 3F4SA 1FGTA 1GSFA 3NQZA 2AHEA 2CZ2A 4WR5A 2F56A 4HEA2 1T3BA 3EMPA 1YNVX 1YI23 3PR8A 1X5CA 3D5JA 3KEBA 3GKMA 2E2VA 3HZPA 1Q40B 3RDEA 2TIRA 3APOA 5BVBA 3M1GA 3EBTA 1D6ZA 2CG1A 1JBRA 2CVKA 2GSTA 2O89A 4K0GA 3LYGA 4WETA 2VL9A 1FUSA 4GRFA 4TRXA 4FYBA 3IAM2 2XF3A 1GD3A 5AIVA 4FYCA 1US1A 1W4NA 4AKYA 3IXRA 3UBKA 1DMNA 3M9JA 1TRVA 1A2JA 5ABRA 1YEXA 4F0CA 2X4AA 3WD6A 2H73A 3IA1A 2LNSA 3TJFA 3FZ9A 3TGZA 1K734 2Z6BA 4F9ZA 1EWXA 1J9BA 1ILOA 2I4AA 1K0DA 5IEPA 1NU3A 3WT2A 1SIHA 2F5MA 2E2GA 1NW2A 3GAXA 4AGSA 1PQNA 2YWNA 3I0YA 4J2FA 4ZBBA 4HJLB 5AIHA 1O73A 1RQMA 2GEXA 1G96A 1SPUA 4K61A 3NX0A 2YNXA 3KZQA 4ZL9A 5AISA 1QAFA 2AUVA 4F03A 5DQSA 2H6YA 4Z7XA 1BJXA 5DAKA 3L78A 3X3YA 4GLTA 3FGYA 4PUFC 3L0RA 3Q2PA 3HOHA 4JU5A 1BSAA 3BCKA 3NOFA 1XWBA 3G7YA 2LYXA 1I8VA 3GX8A 2C3TA 4GSPA 2DIZA 3EMXA 3U97A 1X9WB 1NB3I 3SVAA 4MP4A 2P09A 2CHCA 3EURA 1XIYA 5JBSA 4DVCA 5A5KA 1IT7A 3LT8A 1FB6A 1STFI 1YIT3 3ZFZA 1ISKA 2WS2A 1XOAA 4K2DA 3PPUA 1TP9A 4O02B 4EXRA 3CMIA 4IQAA 2LQQA 1UCJA 2P5QA 3FKAA 5CF1A 1WOUA 4PQ1A 5AYSC 2YV7A 4GHOA 3Q3FA 3IMAB 2A2PA 1RGLA 2FWGA 3LXTA 3VSYA 1Z7PA 2BHMA 5F8BA 2ON7A 1EGRA 2FNQA 3G16A 4HZ2A 5M19A 5HGRA 2B1KA 2HOHA 5IENA 3ROBA 4O3VA 1V40A 1TRUA 1EP7A 2CWVA 2L5LA 3LTAA 3EBYA 2KLXA 1WMJA 4OFTA 4A5PA 2YWMA 1F3AA 1U5OA 4XB5A 3NIVA 4EV2A 3AHSA 1MDKA 2AYTA 5AI1A 1YDKA 2B5EA 2P5RA 3Q74A 2HZEA 3D0ZA 1R4WA 1MWTA 2DKHA 3DUKA 2B5YA 2OE0A 4Z2TA 6STDA 1PGTA 2C0DA 1OKDA 1U3IA 2HMJB 4OVMA 5DREA 4DEJA 1BRJA 3LMLA 6GSSA 1UUVB 5KOXA 1FG4A 1O7GB 3BNEA 1ZO2A 1BNEA 3LYKA 3VPTA 5CREA 4KUNA 4PTSA 4O32A 2KXGA 1A2MA 1MD4A 2PWJA 3I43A 2M46A 1SARA 5IOWA 1ZYEA 2DBCA 2H72A 5G1LA 3M9KA 3QCPA 1EV9A 3DGQA 3GKXA 1WJKA 3NUVA 1IVXA 1SKRB 1BNJA 5HFGA 2CK3H 1YHQ3 3FF0A 1RGGA 4GL6A 1L5GB 2WO0A 3CTFA 3U1WA 5ECOB 2BMRB 5A4VA 3GIXA 3DIEA 2IMKA 4ID0A 1GMRA 2CH9A 3PCRA 1MWUA 3SX1A 4MF7A 3QFBC 4MPGA 2DSAA 2P0XA 4HM4B 2OCTA 4OFMA 3FZWA 4IP6A 4R9LA 4KSMA 3DVXA 2C80A 3R3EA 3CU3A 2LJAA 1PY3A 3I69A 2VUPA 1B4PA 1JHBA 1YZXA 5ELGA 1X0RA 2NTOA 3M0FA 4I2UA 2F3MA 4N6V0 4I8BA 1HNBA 1MWRA 1YGEA 22GSA 1LOXA 1IVVA 1THXA 1GOVA 3A3TA 1HNAA 3Q90A 3FY7A 4XDVA 3ZIJA 2W04A 4KT3B 3T8NA 3G4S3 1AAZA 3D79A 1LVNA 4XRAA 2XBIA 4TR3A 3VI5A 2VOCA 1WPIA 1UVZA 2GSQA 1TU5A 3F8HA 1PL1A 3CME3 2H1AA 1YF1A 1V98A 5AIFA 1SK2A 4KDUA 5IPGA 2NDOA 4MJCA 4N10A 1Y25A 3KGKA 1JB5A 6GSPA 2NBSA 3O76A 2RIIA 1B27A 2KF3A 4HVNA 4EDYA 4ZBDA 3UL6A 2PVOC 5DJLA 1SIIA 1MGWA 3PCSA 1NWWA 1WMPA 2K6VA 4ECCA 1TRPA 1UDII 2HMOB 1DYUA 1Q98A 4BVYA 2GBWB 4BL2A 4XM4A 1V74A 5GAND 2VL2A 3L9VA 3FG3A 1Q824 4G0LA 3APQA 1DE3A 3GNJA 3GX0A 3UVHA 5J3RA 1RJOA 1IV9A 1AV4A 1TRQA 1U88A 1GP1A 2YOIA 4ORLA 2I1UA 4J5GA 5J9BA 1F37A 5AN1A 1XW9A 5ELJA 1F6MC 1SL1B 4Q53A 2C10A 3BD2A 4QL7A 4RI6A 2UUGC 2RUFA 1W89A 3QK9A 3ZTLA 5CXOA 2A4VA 3FK8A 4L8EA 4NV2A 4XBYA 4ZB8A 3I553 2H01A 3ZMKA 3LJRA 2FGXA 3E9JB 1A2LA 1EKMA 1PN9A 1AW9A 1T7PB 5D83A 4EC6A 3OW22 4MPFA 1EG9B 2HRKA 4HS1A 1MWSA 3ZVJD 2YPMA 4CJNA 3OWUA 1YY7A 4MMZB 2MBTA 1RHLA 1U87A 2W03A 1D6YA 1GSSA 1K3YA 4KF9A 4KH7A 2P38A 5F05A 2CFKA 3F7XA 5AIIA 3CRTA 1W7CA 3CC23 1F2EA 3CCS3 4WF5A 2GZZA 1TJDA 1RTUA 4WYKB 5EVHA 2HLSA 1S3DA 1LQGC 4GQFA 1S723 3D3LA 3W8JA 1VF4A 3A2WA 4K1FA 4K7IA 4K6XA 3UARA 5CO3A 4BIKA 5HFIA 3S5CA 3KCHA 5E59A 2CV4A 3LOYA 5A0OB 3ISOA 3ZL5A 5CP1A 3W6GA 5IPHA 5KEJA 5G2GA 2MMOA 3N54B 2LKUA 2IWTA 1S3RA 5DVBA 1GLQA 2H71A 2Z76A 4R4KA 2CFGA 3N8BA 5M18A 1JBSA 4N30A 2ZHXB 1N2AA 1TXXA 4V1Ag 1X5DA 2IA7A 3FSDA 4K1UA 2LQVA 1Q814 4EIQA 1T2IA 2V2GA 2W0QA 5J9CA 4NHZA 1A23A 3B8LA 3F8UA 2ZUPA 1RGKA 1X1WA 2QA2A 1GUMA 1TP6A 1H75A 2WRTA 2VCXA 5AIGA 4IBPA 4XBXA 1S3AA 5B8BA 2H1DA 1K0CA 3RPNA 1RCKA 2IUJA 2P0GA 3JUNA 2INXA 2QGUA 2IMFA 2UGIA 3MG2A 2OQEA 1GTUA 2WOHA 5D9XA 1USBA 3NZNA 4K90B 3CBUA 1YJN3 2LJKA 3NM7A 3RAZA 1GUKA 4TR0A 4OFNA 3FHKA 2VCZA 3VK9A 3DGOA 1ACVA 4KGIA 3WOFB 4F82A 3IBHA 1IYIA 1BUJA 1O6JA 5H5QA 4QL9A 2HMMB 1OE7A 3GZBA 5H5SA 2N5AA 2DKIA 3JVCA 1R4YA 2MYGA 3GTUB 1ZYPA 2VLTA 1MD3A 5LC7A 1K3OA 1ZL9A 2KUCA 1KEBA 6GSXA 2MC8A 2K18A 3F9SA 3RHBA 3BNBA 4EBGA 1TK8B 2C4BA 5D73A 2HSMA 1X9SB 4L0WA 3WGDA 5G30A 3KD0A 2V6OA 1RCLA 4J9AA 1MGRA 1N8QA 4G19A 1U3AA 4FMDA 1OH0A 2V1LA 3D4MA 1SU9A 1XWCA 2FA4A 1RNBA 1S3CA 5HR2A 4HU7A 4J5KA 1OHSA 1CYVA 4H86A 1OKTA 3CSJA 2H6XA 19GSA 2RGQA 1PU4A 4EVMA 1V58A 2IPAA 2H0HA 1GTIA 4KW6A 2ML6A 4HQSA 2K0MA 1LRAA 1GL8A 4FIWA 3ZITA 3A5EA 1GWCA 1GOUA 1K8A4 3UJ1A 3D4AA 2GZYA 3UAPA 4V2MA 3GH6A 1FUWA 3PZWA 2C11A 4IKHA 3UB1A 1A2PA 3CXC2 1FGQA 2P05A 1OF5B 4XBTA 1O7UA 4EIPA 3ED3A 2FWEA 1OHPA 4JF8A 2E0QA 4NWYA 1M7TA 1GYBA 1JZDA 4EO3A 5GSSA 2Q07A 4WP5A 3KKGA 1GSPA 4PNGA 3TDGA 1LNHA 3K9MC 1ULJB 2LEGA 3WOEB 3IHGA 2H19A 3D21A 5FHIA 3LORA 2B5XA 3FRCA 2IIYA 1B9YC 1FAAA 4LMVA 2PGTA 4KFEA 1IU7A 3DEXA 4R80A 2FUG2 3DD3A 2GT6A 2AAWA 1I5GA 2JACA 4IVFA 4ZIJA 1I9DA 12GSA 4L0UA 10GSA 3QAWA 5AEUB 1FZUA 3SXXA 4HM3B 5IO0A 1B2MA 3QPMA 5CYYA 2EIRA 3VWWA 3IJEB 2NPBA 3H93A 2XBQA 1OPYA 4KSOA 3EN1B 2M7OA 1FO5A 4IQ1A 4ECBA 3TRQA 3HCZA 1FHEA 4IHUA 4STDA 1OAZA 2YFLB 3NHXA 1OVNA 3FYGA 3UVTA 3MKIA 1X5EA 4OO4A 4BVYB 1TFOA 2KF6A 2IMEA 3FZ4A 2DC5A 1BRHA 2DJKA 4PQIA 2HNLA 3EU4A 3DMLA 4OCFA 2HRFA 4EKZA 4ML1A 1MOLA 1JV2B 4R1KA 3N9JA 11GSA 4Q5RA 2X99A 4IGJA 3ZREA 1JBTA 3GHAA 14GSA 1ZYNA 3B7CA 1JLWA 3F63A 4HM1B 2F98A 1N5HA 1NB5I 3X3XA 4HZBB 4PNFA 4U13A 5ECLB 5LCZA 3LTBA 4MA9A 1X9MB 4WR4A 3EE1A 4H3UA 2B3SA 1QVG2 2QKEA 4HI7A 5CRWA 2CG0A 3VWXA 3NQYA 1KBNA 2P31A 3MYDA 4RNZA 1Z7RA 4AJ6A 1NO3A 3CXGA 2VLUA 1FUTA 1RLSA 1WIKA 4J57E 1GY6A 3QD9A 1RRLA 3LW9A 4POMA 1T5YA 1IYYA 4MEIA 3LT9A 1ZCPA 5BMUA 1DE2A 3KH7A 3HVSA 1FA3A 3F9UA 2GEYA 3FW2A 1SL2B 2BTOT 4RZMA 2KP1A 2L6CA 3VWUA 3KN4A 2GQKA 2MZCA 1B9XC 5B7CA 3F40A 4DSSA 1KC84 3IK7A 2P0MA 3NXJA 1M2DA 1CH0A 1M0UA 2XSOB 3DGMA 3DVWA 1BYEA 4BA7A 1BUQA 1ZMAA 1M99A 2M80A 4TR4A 5ECPB 5AEWB 4GF0A 1IV7A 1PKWA 2LUSA 3LTCA 1VQ43 4KAEA 5G31A 4ZL8A 4ECIA 2H75A 2VCWA 1B2SA 3K63A 1WP0A 3N5OA 6GSWA 2V41A 2KP2A 4DSQA 4XS4A 2CQ9A 3SBCA 2VLVA 3QR6A 3QRDA 1JFUA 1PX7A 4LMWA 4X1UA 1STDA 3TJJA 2CIUA 1BNIA 4WBRD 3HVVA 2YCDA 3MIXA 3B4OA 3D4TA 3VI7A 2PPTA 3LQ7A 4LL4B 4MMYB 1BEDA 5C04A 1GRXA 3VWVA 1FOVA 1OGZA 2C0FA 4PQHA 3FG1A 3LXUX 1ZZYA 1Z9HA 3PS8A 4MZWA 1UI8A 3FR6A 4OWYA 2RNTA 3ZYWA 3HVXA 3KZTA 1B21A 4O5QA 2XH9A 3NV0A 4HJMA 4RQXA 1FGOA 4FQUA 3PGBA 4HBRA 3MSZA 3L9SA 3QMXA 3FLJA 2K54A 2BJXA 1I70A 5A4WA 4IPBA 4HUAA 2MBSA 2KF4A 1TU8A 2CAIA 4FR9A 4J56E 1B8XA 1E2YA 2R5GA 4K7OA 2W2CA 1TRWA 1D6UA 3BU4A 1ABAA 4HZ4A 3F7SA 3S9FA 2IFQB 3HIIA 3S28A 1EOHA 4KA0A 5GZZB 3DKSA 3I563 5DAKB 5BIRA 1J0FA 4MNNA 2RUEA 2VM2A 3IDVA 2H6ZA 4Z2RA 1BNGA 1M904 3I9V2 2QEX3 2CT6A 5KOWA 2HMLB 2KOKA 2OOVC 4NMUA 4IJ3A 5CRDA 3CCE3 1BVIA 2D42A 1IDPA 4LYLB 1Q7HA 1AQZA 2DIYA 2E2UA 4N6OB 2YANA 4JRRA 1DMMA 4O5UA 3QAVA 2F9SA 4CDLA 3V1WA 1VF3A 2YN1A 1GY5A 1UCKA 1VQQA 1XCCA 4Q5QA 2GSPA 5ECQB 3LFLA 5ELUA 4QWTA 1SD8A 4KB3A 3F8XA 4L8OA 4LEHA 1OE8A 5RNTA 3TKQA 3UMAA 2XFSA 2GT5A 1QALA 1XPVA 3EPTA 1TKDB 5G1KA 2R0CA 3SYUA 1NJI4 4FYUA 1M3IA 3TKSE 3PH9A 2FCHA 4ILFA 2MF7A 4O92A 2BT3A 3KXOA 9GSSA 1JZWA 1A0FA 1RW1A 1BRNL 2ON5A 4E8HA 1JKGB 1X1XA 2O87A 1I3IA 4XS1A 4O7HA 2VL2C 4GXZA 4ZXGA 2FY6A 2R3XA 1AQXA 1A67A 2PERA 2ZCTA 1DE1A 4MF5A 2YFJB 6GSYA 2HZFA 2X8GA 2IMDA 1W6YA 1AVKA 1CQGA 5D93A 2DJ1A 1VF2A 2B1LA 3BLZA 2FA8A 4O8SA 1CYUA 1UW1A 4TVEA 1HQOA 2AJQB 1MEKA 2I81A 3VURA 4TXOA 2DJ2A 1OC8A 3OXAA 4KE3A 1VQK3 1RK4A 1G6WA 2XPEA 1MNLA 4KNDA 4QQ7A 4JRFA 3ZFBA 2GDRA 3NV0B 3B4PA 4X2OA 3TKSC 2UZ8A 1A2VA 2A2SA 2BIRA 2Z9SA 1F8NA 5IO2A 3KTBA 3L4NA 1UGHI 1UUGB 1DUGA 1GULA 3RBTA 4ECJA 2GQMA 3KH9A 4MF6A 2ZL8A 2W9QA 3GWRA 4HYZA 5HQPA 1MDJA 2R4IA 3FR9A 1KSIA 5KN1A 2JDIH 4GWRA 1GMQA 1SJZA 3CCL3 2N5FA 2F86B 2J9HA 1DETA 2CZ3A 3DY5A 1O8WA 1W2ZA 3RNTA 1YF0A 1YGWA 1PFOA 4FMCA 1SJIA 2I3YA 2J23A 3GSTA 4N6MA 1YJ6A 3IRAA 1EZKA 4G9HA 1VQ53 4HM8B 4BIRA 4WF4A 3CCM3 2GVPA 1PYLA 2CX0A 3VGNA 5D9TA 1CEWI 1UC7A 4MJEA 4KCAA 8CHOA 2K3DA 2ML5A 3HD5A 1RGHA 2J8XB 1AQVA 1SKWB 2XFTA 2RBIA 1M9GA 5TGNA 3MSOA 3WYWA 3D6IA 4AEQA 3KJYA 2K9FA 4MDCA 1JJ22 18GSA 3HYPA 3Q18A 2VCTA 3M3MA 4WEYA 1TI3A 4I6XA 4CY6A 2XC2A 1PFPA 1YKAA 2C8UA 3DXBA 3ZZXA 1RGCA 2VM1A 4PURA 4K5RA 3CD63 2DLXA 3ERWA 1N9JA 1X1YA 1XZOA 1LJRA 1SENA 3MPHA 2OTL3 1BSBA 2XGLA 4FCZA 2N5BA 4RNYA 3PGTA 4G0IA 4KCEA 3SWLA 3GMFA 5BRTA 3IHQA 3JUPA 1KD14 4AJ7A 1RDSA 5IW9A 5CRHA 5IF6A 3KSED 2F8FA 2WCIA 3MDKA 2CX1A 5JCWA 1XWGA 1UCIA 1YJW3 1M1K4 1PN0A 3IAS2 1K3LA 2DJJA 3FH1A 1BNRA 1AQWA 1ST9A 1TDIA 1GTAA 3M8NA 4IN0A 5A4UA
chains in the Genus database with same CATH topology
1GSDA 1KTEA 5D9WA 3JCML 2BMXA 1QQ2A 2YWIA 2HYXA 3OX9A 4BPYA 3G7IA 6GSTA 1WMNA 2R37A 3CCU3 1QMVA 2OWPA 3C73A 3BNCA 3MAKA 5CAXA 3LEFA 2F99A 5DCHA 6GSVA 4OCEA 5KN0A 4V1Ap 2JZTA 4FO5A 4ULXA 1K0OA 1SKSB 2VO4A 2H1GA 3HI7A 3IOSA 1ZX2A 4YKGA 3GL5A 4L8PA 5BXQA 4ICYA 4K8MA 1UN2A 3UL3A 1VRSD 2DJ0A 1YEPA 2W9PA 4N6NB 1IK3A 1SL0B 1QJGA 3J7Yk 3EYTA 2A15A 4BL7B 1QFNA 1ROVA 2R0PA 3MWZA 1PA3A 3H4KA 4N0VA 2OE3A 1IQ8A 3FCSB 2RM5A 5LD0A 2KHPA 1HKXA 4MJBA 1QVF2 3EB8A 3DYRA 3L0HA 3HK4A 1KWIA 4XDWA 5IG5A 1YQ1A 1PD21 1R5AA 4EUYA 1AIUA 4RUVA 2FD3A 2L4CA 1WTHA 3G713 1SJ6A 2YZHA 3A2VA 1SYRA 5B6MA 2OQEC 1GS3A 1OC9A 2YZUA 4GSNA 1M1XB 3DRNA 2LS5A 4TW5A 1ERUA 1A8YA 3TOTA 3NM2A 2PU9C 4HM6B 4NXIA 1OGXA 1W6CA 2ES7A 3Q1CA 1QXHA 4BVXB 1E3RA 1V2AA 1XVQA 3AMOA 2CVDA 3KM6A 4EC0A 1Q42A 1FGMA 3BCIA 1ERWA 2IJYA 3FKFA 1Y6EA 2O3OA 3C1RA 2QC7A 3BB9A 5FT3A 4OMVA 5DALB 4FCJA 4KX4A 1V57A 4TKYA 5AIXA 3CCV3 2NVLA 3LSZA 1JKGA 2GU3A 1DMQA 4IELA 3X41A 5COHA 1QAKA 3DXOA 5D8IA 3CC73 3STDA 3LTDA 3RDWA 2WULA 3V92A 3KSPA 3F6FA 4TXVA 5HFKA 3K5TA 2V32A 2Z7AA 4PUAA 3HHVA 3KMOA 4BTWA 3DGNA 1FVJA 1PSQA 1V9WA 1R26A 4K1VA 2O7KA 2CWUA 2DJ3A 1W5ZA 1PRXA 3GA4A 4LL1B 1SK0A 3EF8A 2IL3A 4BWQA 1WMOA 5G5EA 3CCJ3 5HR1A 1QGVA 2EC4A 2QIYA 3LWAA 4DSSB 2HMKB 5LC6A 1VQ63 1BQ7A 1GNWA 4PX1A 3EN8A 5IQYA 1OC9B 3GFKA 2O85A 1B48A 3VF1A 1EEJA 2ZNMA 3A5IA 1W2B2 1JZRA 2LNTA 4JE1A 4XS4B 1XOBA 4L5LA 4PXOA 2RCDA 4EV5A 5INYA 1EP8A 1K0BA 3S29A 1W00A 1QK8A 1EEMA 2C0EA 4N11A 3ZIVA 4IS0A 1J08A 2WFCA 3FEUA 5ENUA 4TX4A 3M8CA 2WJUA 1R7HA 3T8UA 3H51A 4BTYA 1VQ73 3LXZA 1KQS2 2VIMA 3EU3A 3RPPA 1ASKA 4ZBAA 3I6AA 5KN3A 3J7Yb 3EHCA 1HNCA 1GUHA 1WQLB 4WHAA 1ERTA 5IMCA 1Y4KA 4XCSA 4TR1B 2EIQA 3RGRA 2C1YA 5KN2A 3EVIA 5ECIB 2YP6A 5J41A 3IPTA 2MMNA 4EF0A 4KFFA 1OACA 1WE0A 2IMIA 1VQN3 3NBBA 2C0GA 2PVQA 3R2QA 3P2AA 3UEMA 3US3A 3EWLA 1GTBA 1QMAA 1ZYQB 3KMNA 2H30A 3K8NA 2L6DA 5AGYA 5FGOA 1M2BA 3ER7A 5EVOA 1UUWB 5L71A 3F4RA 5EEOA 3GKNA 2DMMA 1W02A 2C3QA 4HM7B 3CCQ3 2UX0A 3GRDA 5IMFA 2O8VB 3O3TA 2GLRA 3JUMA 5DBQA 2CX4A 4X43A 4JR4A 5STDA 4J8TA 3G7JA 5D9VA 3HZ4A 1JN5A 1K0NA 1TK0B 1VZZA 3DM8A 3F3QA 2WGQA 1M2AA 3E0UA 16GSA 1S5AA 4LSOA 4OUQA 4I2TA 5ECRB 2W6JH 3T0UA 4ZB6A 3G8ZA 2R2JA 3P7XA 1FVKA 1AC1A 3HJOA 3H8QA 4OD7A 1O85A 5FW5A 3IV4A 4HOJA 3CCR3 1YJ93 1EQKA 2RFRA 5LNKe 5CLKA 5DQYA 2PNCA 4MZBA 1PL2A 3KCMA 1SQWA 1O7MB 4K2XA 4CHSA 3G0KA 2MMAA 2CFWA 4N3VA 2E2MA 2XHFA 2A2RA 1AVLA 2M72A 5CK6A 2AV4A 2JQ5A 2AB6A 5CF2A 3P90A 2A4HA 1JRQA 2LJRA 2G0FA 3UJMA 3V98A 1WNHA 1XBSA 1ZGNA 2F51A 3GZYB 1EGOA 4P3YB 1JB2A 4IP1A 1NHOA 3PYJA 3J7Yd 4EXJA 4ZB9A 2GU1A 13GSA 4K0NA 1O81A 4CCVA 20GSA 2OE1A 3TB2A 4LGQA 1NHYA 1CQHA 2VL3A 5D82A 3TUEA 2B6MA 1GD4A 1YKCA 1VF1A 4BWSA 4XS6A 3KP8A 1G6YA 4XTSA 5IMAA 5GAPD 1U8CB 6GSUA 1TFKA 3ZMLA 2OJLA 2H66A 5DRVA 3UBLA 1VGLA 3FMWA 3X42A 4K7NA 5I97A 3ERGA 3UIWA 3CPW2 1B4QA 4GSSA 4AKZA 4EL1A 3EE2A 3TKSA 2H74A 3ERFA 3EQQB 1OF5A 2WGRA 2CVBA 5IEOA 2HI7A 2Z77A 3GRXA 3CNMA 5IMDA 3S67A 2GTUA 3HJMA 1G0TA 2IUKA 3KE7A 4F0BA 3HA9A 1TIJA 1O7NB 3WMDA 1F9MA 3PXMA 2O9UX 3F3RA 4WFOA 1VQM3 3U6VA 3UL5A 1R5PA 3N9HA 5CNWA 5ECHB 1F3BA 1K9M4 4MMMA 4NREA 4WKWA 2CKFB 2XPDA 4DSRA 4X4JA 2RM6A 2QA43 2IMJA 3FG4A 1IVUA 2HFDA 1NDOB 2KCDA 1EOGA 4MH2A 5ID2B 1TI1A 4YH2A 3S27A 3EC3A 4EYCA 1IVWA 3GUSA 1HU9A 2L57A 3QOUA 1SJWA 4D73B 4HM2B 2MMZA 2FGTA 3WGEA 3D22A 2X8CA 4BTXA 1JLVA 2H0GA 2L59A 1W01A 2OOVA 4LZIA 2CFLA 3X40A 2L4VA 3ZRDA 3SEDA 2C4JA 2C3NA 3L9UA 2BMOB 3ZVJA 1UA5A 4YAVA 5H5RA 2CX3A 3V99A 2V6KA 1TRSA 3GL3A 3MG3A 5EL8A 3FF2A 4KFDA 2D1WA 3HZ8A 2OKAA 4YQVA 2VD1A 2LRCA 4BL7A 1GNEA 5GSTA 3KIIA 1MDIA 1URMA 5ECNB 1DVDA 4Q5NA 3KFQC 5D81A 4PEJA 3GZRA 3TKPA 1ULIB 2FXTA 3OV4A 3GH9A 3GURA 2W56B 4X2HA 2REMA 4YAPA 5IMVA 5B6NA 3ZLPA 5ELAA 4HM0B 1XWKA 2ALBA 1IT8A 3D9RA 4ISDA 3TRXA 3CSHA 4OK0A 2YX9A 4NHWA 3PINA 2V1MA 3IR4A 1LU4A 2L4QA 3EX9A 3U5RE 5HR3A 3HJPA 1FGRA 3BBYA 3TRPA 4FCMA 1RKYA 1Z6MA 2XR8B 4F2IA 5E4WA 3HIGA 3VPQA 1Z5YE 4CY8A 4BVXA 2B24B 1H4OA 1CQSA 1XW5A 1G7EA 4KDXA 3GN3A 1FW1A 3KTLA 1GSYA 2GZPA 3BOAA 3H79A 3HX8A 2E7PA 1JZOA 1N5PA 4MJDA 4GTUA 5G5FA 1IQXA 8GSSA 1G7OA 1HYUA 4E8EA 2RLIA 1E97A 2HE3A 3NBRA 1K28A 1A24A 3FZ5A 3MWHA 4L7KA 3BJ5A 2XGNA 1T4ZA 4I5QA 3AY8A 5D96A 5ID2A 1NM3A 1T1VA 2RSXA 5JPPA 1Z1SA 4TOPA 3OWYA 4O2HA 4JEDA 3CSIA 1RN7A 2EIOA 5IOXA 1AXDA 2CW9A 2LTKA 7GSSA 3HDCA 1BG5A 1K0AA 4MJAA 5EQLA 1T8EB 7STDA 4NAXA 5DCGA 5KP3A 2B7KA 2OBKA 2CC3A 2SBLA 3LG6A 3VFIA 3UOMA 3LYPA 4V2LA 1FB0A 2TRCP 5DALA 1JNQA 3F4TA 4YKFA 3TKRA 4IT7A 1SK1A 2XEPA 1OYJA 2WZ9A 4N6UA 2JSYA 2Y74A 3MYTA 1GSUA 1A2KA 4WWUC 3A5WA 3WA3A 4G1MB 4GCIA 5JCUA 2FWHA 2PN8A 2GS3A 3P8WA 2H8LA 1BX9A 3GZXB 2F8AA 2R0GA 1TU7A 2OADA 3ALAA 3G9BA 1Q4JA 1ON4A 4FMBA 4EDZA 2GSRA 4G10A 2E2TA 5KP1A 2XSHB 1LBKA 2HSYA 2H70A 4POBA 2IN3A 1GY7A 2QA1A 2YJ7A 1U6TA 5C00A 2OACA 1XWAA 3CPOA 5F06A 1N9EA 5FWGA 1PKZA 1O7PB 1EA2A 1C72A 3OR5A 3GYKA 5JWOB 5J5NA 1SD9A 4WYKA 1VQL3 4MCUA 1KNGA 1R4CA 4LMIA 3QAGA 2K8SA 4CDOA 1AUCA 2B7JA 2G2QA 2LRNA 1GSEA 4G0KA 3X3ZA 1WRYA 2PUKC 4FH8A 4ZILA 3K0ZA 2WOFA 5JPUA 5JCGA 5IG4A 1JB4A 2YV9A 2H0IA 3EINA 4I4KA 1VQ93 1M9AA 1DSBA 3O6TA 4MK3A 3DWVA 3CMA3 4YQUA 1XW6A 4FMAA 5JWQB 3A76A 1Q7Y4 3HXSA 4Z2UA 3CC43 1EV4A 3W8SA 1OHOA 3H1NA 2H76A 3O8YA 3QDNA 2YJHA 1E3VA 3E99A 2JZRA 1XFLA 3Q19A 1O7HB 1NSWA 4POLA 4V2NA 4TXOB 3MNGA 1SYXA 4PGTA 1Q40A 1AR0A 1OC3A 3QFAC 2JZSA 3Q6OA 3ME8A 2OBIA 1TUHA 4MLYA 3GSSA 5KP4A 3H3HA 1A8LA 1GH2A 4POKA 2BO9B 4EE0A 1TK5B 2OA7A 1T00A 1WWJA 1K0MA 3IC8A 3APSA 3IPZA 2YFIB 1UI7A 3SOAA 4HKVB 3WT1A 1O8XA 3SLUA 1T4YA 3GTUA 1Z6NA 5IG3A 2VAFA 3FR3A 3LGCA 2I9HA 2FWFA 4IJIA 4G2EA 4JZQA 1C7HA 5J4UA 4D73A 4NV5A 5ECKB 4MABA 1PX6A 5ECSA 2KRTA 2LQOA 4IIAA 1JN5B 3AMOB 2STDA 3TJBA 3C1SA 5EY6A 4HDEA 2QGVA 1XVWA 1LXEA 3RHCA 4RBNA 3F14A 1THOA 4CW9A 3LZAA 1PMTA 2FNOA 4MH3A 4H61A 1IYHA 2L5OA 1TOFA 5IG0A 2R4VA 4ML6A 17GSA 1Q864 1VQ83 2HT9A 3K7CA 3WODG 2VD0A 4GQCA 3TOUA 1N8JA 2HRNA 3F6DA 4K9ZA 5IM9A 4I97A 3ZFLA 4K5SA 1O7WB 3C7MA 4ACSA 2CA8A 2W56A 3MG1A 2HMNB 1GLPA 4KZ1A 3TJGA 2HRAA 2JL4A 2H1BA 3F0IA 2BMQB 2HZEB 2GBXB 1MTCA 2DMLA 2IFQA 3HKRA 1OCVA 2LSTA 4LLRA 4AJ8A 3DZLA 1ML6A 2GQLA 4XIHA 2PZVA 1N8R4 4RQRA 5G2ZA 3BNDA 5IERA 3TJKA 4WBJA 3KP9A 4O5RA 3EJVA 2HSHA 3FZAA 2FLSA 4KVHA 5F07A 1XXUA 4KDYA 4N6LA 2X49A 4HM5B 2GXFA 4TN8A 2CAQA 2B1XB 4RI7A 1VQO3 2JSZA 3IC4A 3G6E3 4JBBA 3ECFA 3TCOA 5IIZA 5AYRB 4NPBA 2OTJ3 5F0GA 3MHEA 3NBJA 2CWTA 3LH4A 2WGOA 2R6KA 3VLNA 4R9KA 1BAYA 2X8HA 2X64A 4YQMA 3WA2X 4IW9A 1GSQA 3IE3A 1W4VA 1YVBI 3UNLA 4ZM8A 2K8VA 2JU5A 3DMCA 4HZ9B 3CYNA 5HR0A 1QUWA 5DJMA 4ZL7A 3CNXA 5IMZA 2XRXB 3JUQA 2ZDJA 4OO5A 4NHFA 4Q5FA 1ERVA 4LA1A 5EPFA 4TR1A 4GB5A 1J2BA 3GKKA 1ROAA 3CRUA 1HD2A 2LV3A 3CTGA 2PMTA 2FHEA 1TTZA 3OWSA 1DBYA 1FOHA 3RGAA 5JWRB 1A0RP 1DVCA 1K41A 3IK9A 4HQZA 1A90A 5DDLA 2BNGA 1YIJ3 1ZOFA 1E6BA 4N0ZA 4HJ2A 4XHMA 3E3EA 1M9BA 3WGXA 1OUNA 3KIJA 4GSTA 4JR6A 2I9WA 3EC9A 2D2ZA 4N6TA 2HXKA 2TRXA 4USSA 3WDGB 4MMXB 3GV1A 2WB9A 1W6GA 2JADA 2VCVA 4AF2A 2CFDA 5B8AA 2YWOA 1TW9A 2PBJA 4X0XA 4MZCA 1VQP3 3JUOA 2LRTA 2GGTA 2GSSA 1IQYA 2WDUA 3ME7A 4XRDA 4WXTA 1Z3EA 3C71A 3C8EA 4HU9A 5CRGA 5ECMB 3A2XA 2Y73A 2QSIA 3DGLA 2VCQA 1RRHA 3SOYA 3HY2A 4L5OA 3F4SA 1FGTA 1GSFA 3NQZA 2AHEA 2CZ2A 4WR5A 4HEA2 1T3BA 3EMPA 1YI23 3PR8A 1X5CA 3D5JA 3KEBA 3GKMA 2E2VA 3HZPA 1Q40B 3RDEA 2TIRA 3APOA 5BVBA 3M1GA 3EBTA 1D6ZA 2CG1A 2CVKA 2GSTA 2O89A 4K0GA 3LYGA 4WETA 2VL9A 4GRFA 4TRXA 4FYBA 3IAM2 2XF3A 1GD3A 5AIVA 4FYCA 1US1A 1W4NA 4AKYA 3IXRA 3UBKA 1DMNA 3M9JA 1TRVA 1A2JA 5ABRA 1YEXA 4F0CA 2X4AA 3WD6A 2H73A 3IA1A 2LNSA 3TJFA 3FZ9A 3TGZA 1K734 2Z6BA 4F9ZA 1EWXA 1J9BA 1ILOA 2I4AA 1K0DA 5IEPA 1NU3A 3WT2A 1SIHA 2E2GA 1NW2A 3GAXA 4AGSA 1PQNA 2YWNA 3I0YA 4J2FA 4ZBBA 4HJLB 5AIHA 1O73A 1RQMA 2GEXA 1G96A 1SPUA 4K61A 3NX0A 2YNXA 3KZQA 4ZL9A 5AISA 1QAFA 2AUVA 4F03A 5DQSA 2H6YA 4Z7XA 1BJXA 5DAKA 3L78A 3X3YA 4GLTA 3FGYA 4PUFC 3L0RA 3Q2PA 4JU5A 3BCKA 3NOFA 1XWBA 3G7YA 2LYXA 3GX8A 2C3TA 3EMXA 2DIZA 3U97A 1X9WB 1NB3I 3SVAA 4MP4A 2P09A 2CHCA 3EURA 1XIYA 5JBSA 4DVCA 5A5KA 1IT7A 3LT8A 1FB6A 1STFI 1YIT3 1ISKA 2WS2A 1XOAA 4K2DA 3PPUA 1TP9A 4O02B 4EXRA 3CMIA 4IQAA 2LQQA 2P5QA 3FKAA 5CF1A 1WOUA 4PQ1A 5AYSC 2YV7A 3IMAB 2A2PA 3LXTA 2FWGA 3VSYA 1Z7PA 2BHMA 5F8BA 2ON7A 1EGRA 2FNQA 3G16A 4HZ2A 5HGRA 2B1KA 5IENA 3ROBA 4O3VA 1V40A 1TRUA 1EP7A 2CWVA 2L5LA 3LTAA 3EBYA 2KLXA 1WMJA 4OFTA 4A5PA 2YWMA 1F3AA 1U5OA 4XB5A 3NIVA 4EV2A 1MDKA 2AYTA 5AI1A 1YDKA 2B5EA 2P5RA 3Q74A 2HZEA 3D0ZA 1R4WA 2DKHA 3DUKA 2B5YA 2OE0A 4Z2TA 6STDA 1PGTA 2C0DA 1OKDA 1U3IA 2HMJB 4OVMA 5DREA 4DEJA 3LMLA 6GSSA 1UUVB 5KOXA 1FG4A 1O7GB 3BNEA 1ZO2A 3LYKA 3VPTA 5CREA 4KUNA 4PTSA 4O32A 2KXGA 1A2MA 1MD4A 2PWJA 3I43A 2M46A 5IOWA 1ZYEA 2DBCA 2H72A 3M9KA 3QCPA 5G1LA 1EV9A 3DGQA 3GKXA 1WJKA 3NUVA 1IVXA 1SKRB 5HFGA 2CK3H 1YHQ3 3FF0A 4GL6A 1L5GB 2WO0A 3CTFA 3U1WA 5ECOB 2BMRB 5A4VA 3GIXA 3DIEA 2IMKA 4ID0A 2CH9A 3PCRA 3SX1A 4MF7A 3QFBC 4MPGA 2DSAA 2P0XA 4HM4B 2OCTA 4OFMA 3FZWA 4IP6A 4R9LA 4KSMA 3DVXA 2C80A 3R3EA 3CU3A 2LJAA 3I69A 2VUPA 1B4PA 1JHBA 1YZXA 5ELGA 1X0RA 2NTOA 3M0FA 4I2UA 2F3MA 4N6V0 4I8BA 1HNBA 1YGEA 22GSA 1LOXA 1IVVA 1THXA 3A3TA 1HNAA 3Q90A 3FY7A 4XDVA 3ZIJA 2W04A 3T8NA 3G4S3 1AAZA 1LVNA 4XRAA 2XBIA 4TR3A 3VI5A 2VOCA 1WPIA 1UVZA 2GSQA 1TU5A 3F8HA 1PL1A 3CME3 2H1AA 1YF1A 1V98A 5AIFA 1SK2A 4KDUA 5IPGA 2NDOA 4MJCA 4N10A 1Y25A 3KGKA 1JB5A 2NBSA 3O76A 2RIIA 4HVNA 4EDYA 4ZBDA 3UL6A 2PVOC 5DJLA 2K6VA 1SIIA 3PCSA 1NWWA 1WMPA 4ECCA 2HMOB 1DYUA 1Q98A 4BVYA 2GBWB 4XM4A 1V74A 5GAND 2VL2A 3L9VA 3FG3A 1Q824 4G0LA 3APQA 3GNJA 3UVHA 3GX0A 5J3RA 1RJOA 1IV9A 1AV4A 1U88A 1GP1A 2YOIA 4ORLA 2I1UA 5J9BA 1F37A 5AN1A 5ELJA 1XW9A 1F6MC 1SL1B 4Q53A 2C10A 3BD2A 4QL7A 4RI6A 2RUFA 1W89A 3QK9A 3ZTLA 5CXOA 2A4VA 3FK8A 4L8EA 4NV2A 4XBYA 4ZB8A 3I553 2H01A 3ZMKA 3LJRA 2FGXA 3E9JB 1A2LA 1EKMA 1PN9A 1AW9A 1T7PB 5D83A 4EC6A 3OW22 4MPFA 1EG9B 2HRKA 4HS1A 3ZVJD 2YPMA 3OWUA 1YY7A 4MMZB 2MBTA 1U87A 2W03A 1D6YA 1GSSA 1K3YA 4KF9A 4KH7A 2P38A 5F05A 2CFKA 3F7XA 5AIIA 3CRTA 1W7CA 3CC23 1F2EA 3CCS3 4WF5A 2GZZA 1TJDA 4WYKB 5EVHA 2HLSA 1S3DA 4GQFA 1S723 3D3LA 3W8JA 1VF4A 3A2WA 4K1FA 4K7IA 4K6XA 3UARA 5CO3A 5HFIA 3S5CA 5E59A 2CV4A 3LOYA 5A0OB 3ISOA 3ZL5A 5CP1A 3W6GA 5IPHA 5KEJA 5G2GA 2MMOA 3N54B 2LKUA 2IWTA 5DVBA 1GLQA 2H71A 2Z76A 4R4KA 2CFGA 3N8BA 4N30A 1N2AA 1TXXA 4V1Ag 1X5DA 2IA7A 3FSDA 4K1UA 2LQVA 1Q814 4EIQA 5J9CA 2V2GA 2W0QA 4NHZA 1A23A 3B8LA 3F8UA 2ZUPA 2QA2A 1GUMA 1TP6A 1H75A 2WRTA 2VCXA 5AIGA 4IBPA 4XBXA 1S3AA 5B8BA 2H1DA 1K0CA 3RPNA 2IUJA 2P0GA 3JUNA 2INXA 2QGUA 2IMFA 3MG2A 2OQEA 1GTUA 5D9XA 2WOHA 1USBA 3NZNA 4K90B 3CBUA 1YJN3 2LJKA 3NM7A 3RAZA 1GUKA 4TR0A 4OFNA 3FHKA 2VCZA 3VK9A 3DGOA 1ACVA 4KGIA 3WOFB 4F82A 3IBHA 1IYIA 1O6JA 5H5QA 4QL9A 2HMMB 1OE7A 3GZBA 5H5SA 2N5AA 2DKIA 3JVCA 2MYGA 3GTUB 1ZYPA 2VLTA 1MD3A 5LC7A 1K3OA 1ZL9A 2KUCA 1KEBA 6GSXA 2MC8A 2K18A 3F9SA 3RHBA 3BNBA 4EBGA 1TK8B 5D73A 2HSMA 1X9SB 4L0WA 3WGDA 5G30A 3KD0A 2V6OA 4J9AA 1N8QA 4G19A 1U3AA 4FMDA 1OH0A 2V1LA 3D4MA 1SU9A 1XWCA 2FA4A 1S3CA 5HR2A 4HU7A 4H86A 1OHSA 1CYVA 1OKTA 3CSJA 2H6XA 19GSA 2RGQA 1PU4A 4EVMA 1V58A 2IPAA 1GTIA 2H0HA 4KW6A 2ML6A 4HQSA 2K0MA 1GL8A 4FIWA 3ZITA 1GWCA 1K8A4 3UJ1A 2GZYA 3UAPA 4V2MA 3GH6A 1FUWA 3PZWA 2C11A 4IKHA 3UB1A 3CXC2 1FGQA 2P05A 1OF5B 4XBTA 1O7UA 4EIPA 3ED3A 2FWEA 1OHPA 4JF8A 2E0QA 4NWYA 1M7TA 1GYBA 1JZDA 4EO3A 5GSSA 2Q07A 4WP5A 3KKGA 4PNGA 3TDGA 1LNHA 3K9MC 1ULJB 2LEGA 3WOEB 3IHGA 2H19A 3D21A 5FHIA 3LORA 2B5XA 3FRCA 2IIYA 1B9YC 1FAAA 4LMVA 2PGTA 4KFEA 1IU7A 3DEXA 4R80A 2FUG2 3DD3A 2GT6A 2AAWA 1I5GA 2JACA 4IVFA 4ZIJA 1I9DA 12GSA 4L0UA 10GSA 3QAWA 5AEUB 3SXXA 4HM3B 5IO0A 3QPMA 5CYYA 2EIRA 3VWWA 3IJEB 2NPBA 3H93A 2XBQA 1OPYA 4KSOA 3EN1B 2M7OA 1FO5A 4IQ1A 4ECBA 3TRQA 3HCZA 1FHEA 4IHUA 4STDA 1OAZA 2YFLB 3NHXA 1OVNA 3FYGA 3UVTA 3MKIA 1X5EA 4OO4A 4BVYB 1TFOA 2IMEA 3FZ4A 2DC5A 2DJKA 4PQIA 2HNLA 3EU4A 3DMLA 4OCFA 2HRFA 4EKZA 4ML1A 1MOLA 1JV2B 4R1KA 3N9JA 11GSA 4Q5RA 2X99A 4IGJA 3ZREA 14GSA 3GHAA 1ZYNA 3B7CA 1JLWA 3F63A 4HM1B 2F98A 1N5HA 1NB5I 3X3XA 4HZBB 4PNFA 4U13A 5ECLB 5LCZA 3LTBA 4MA9A 1X9MB 4WR4A 3EE1A 4H3UA 2B3SA 1QVG2 2QKEA 4HI7A 5CRWA 2CG0A 3VWXA 3NQYA 1KBNA 2P31A 3MYDA 4RNZA 1Z7RA 4AJ6A 1NO3A 3CXGA 2VLUA 1WIKA 4J57E 1GY6A 3QD9A 1RRLA 3LW9A 4POMA 1T5YA 4MEIA 3LT9A 1ZCPA 5BMUA 1DE2A 3KH7A 3HVSA 1FA3A 3F9UA 2GEYA 3FW2A 1SL2B 2BTOT 4RZMA 2KP1A 2L6CA 3VWUA 3KN4A 2GQKA 2MZCA 1B9XC 5B7CA 3F40A 4DSSA 1KC84 3IK7A 2P0MA 3NXJA 1M2DA 1M0UA 2XSOB 3DGMA 3DVWA 1BYEA 4BA7A 1BUQA 1ZMAA 1M99A 2M80A 4TR4A 5ECPB 5AEWB 4GF0A 1IV7A 1PKWA 2LUSA 3LTCA 1VQ43 4KAEA 5G31A 4ZL8A 4ECIA 2H75A 2VCWA 3K63A 1WP0A 3N5OA 6GSWA 2V41A 2KP2A 4DSQA 4XS4A 2CQ9A 3SBCA 2VLVA 3QR6A 3QRDA 1JFUA 1PX7A 4LMWA 4X1UA 1STDA 3TJJA 2CIUA 4WBRD 3HVVA 2YCDA 3MIXA 3B4OA 3D4TA 3VI7A 2PPTA 3LQ7A 4LL4B 4MMYB 1BEDA 5C04A 1GRXA 3VWVA 1FOVA 1OGZA 2C0FA 4PQHA 3FG1A 3LXUX 1ZZYA 1Z9HA 3PS8A 4MZWA 1UI8A 3FR6A 4OWYA 3ZYWA 3HVXA 3KZTA 4O5QA 2XH9A 3NV0A 4HJMA 4RQXA 1FGOA 4FQUA 3PGBA 4HBRA 3MSZA 3L9SA 3QMXA 3FLJA 2K54A 2BJXA 5A4WA 4IPBA 4HUAA 2MBSA 1TU8A 2CAIA 4FR9A 4J56E 1B8XA 1E2YA 2R5GA 4K7OA 2W2CA 1TRWA 1D6UA 1ABAA 4HZ4A 3F7SA 3S9FA 2IFQB 3HIIA 3S28A 1EOHA 4KA0A 5GZZB 3DKSA 3I563 5DAKB 1J0FA 4MNNA 2RUEA 2VM2A 3IDVA 2H6ZA 4Z2RA 1M904 3I9V2 2QEX3 2CT6A 5KOWA 2HMLB 2KOKA 2OOVC 4NMUA 4IJ3A 5CRDA 3CCE3 2D42A 1IDPA 2DIYA 2E2UA 4N6OB 2YANA 4JRRA 1DMMA 4O5UA 3QAVA 2F9SA 4CDLA 3V1WA 1VF3A 2YN1A 1GY5A 1XCCA 4Q5QA 5ECQB 3LFLA 5ELUA 4QWTA 1SD8A 4KB3A 3F8XA 4L8OA 4LEHA 1OE8A 3TKQA 3UMAA 2XFSA 2GT5A 1QALA 1XPVA 3EPTA 1TKDB 5G1KA 2R0CA 1NJI4 3TKSE 4FYUA 3PH9A 2FCHA 4ILFA 2MF7A 4O92A 2BT3A 3KXOA 9GSSA 1JZWA 1A0FA 1RW1A 2ON5A 4E8HA 1JKGB 2O87A 4XS1A 4O7HA 2VL2C 4GXZA 4ZXGA 2FY6A 2R3XA 1AQXA 1A67A 2PERA 2ZCTA 1DE1A 4MF5A 2YFJB 6GSYA 2HZFA 2X8GA 2IMDA 1W6YA 1AVKA 1CQGA 5D93A 2DJ1A 1VF2A 2B1LA 3BLZA 2FA8A 4O8SA 1CYUA 1UW1A 4TVEA 1HQOA 2AJQB 1MEKA 2I81A 3VURA 4TXOA 2DJ2A 1OC8A 3OXAA 4KE3A 1VQK3 1RK4A 1G6WA 2XPEA 1MNLA 4KNDA 4QQ7A 4JRFA 3ZFBA 2GDRA 3NV0B 3B4PA 4X2OA 3TKSC 2UZ8A 1A2VA 2A2SA 2Z9SA 1F8NA 5IO2A 3KTBA 3L4NA 1DUGA 1GULA 3RBTA 4ECJA 2GQMA 3KH9A 4MF6A 2ZL8A 2W9QA 3GWRA 4HYZA 5HQPA 1MDJA 2R4IA 3FR9A 1KSIA 5KN1A 2JDIH 4GWRA 1SJZA 3CCL3 2N5FA 2F86B 2J9HA 2CZ3A 3DY5A 1O8WA