3TDGA

Structural and functional characterization of helicobacter pylori dsbg
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
232
structure length
232
Chain Sequence
QDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTKVENTTKKIFESGVIKGVPFLYHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and functional characterization of Helicobacter pylori DsbG
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 77
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18257 DsbG_N Disulfide isomerase DsbG N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.520 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3tdgA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tdgA02
5HR1A 3O3TA 2GZPA 1Q98A 2WGRA 3GNJA 5D9WA 1HYUA 1EEMA 3O76A 2VLVA 2B1LA 5IIZA 1UA5A 1H75A 2HXKA 2M72A 5ECIB 5G5FA 4BA7A 4ZIJA 4K6XA 1SKWB 4DSSB 2GSTA 1F9MA 2YN1A 3EYTA 4KA0A 2V6OA 3IAS2 4K7NA 2FY6A 2FD3A 5HR2A 1BG5A 3WGDA 1YJ6A 1THOA 3ED3A 1PL1A 3ISOA 4N10A 5HFIA 2GZZA 3GA4A 2H70A 2L57A 5HQPA 4HUAA 1VGLA 2FNOA 2L5LA 3MAKA 1ABAA 2LRNA 3KIJA 2MMZA 3GSSA 1ERUA 3QAWA 4L0WA 5F06A 1XWBA 4GTUA 5DDLA 4EL1A 2YV7A 2IPAA 3WGXA 1PMTA 2RM5A 22GSA 3HDCA 5B7CA 1GULA 2CX4A 5DALB 3HKRA 3NOFA 3F6DA 3GN3A 4N0ZA 4GLTA 1ACVA 1M7TA 3HVSA 5DJMA 2FA8A 2RUEA 3HYPA 3IC4A 5A4WA 1R5AA 2KP2A 4PXOA 4POMA 5G1KA 2QKEA 3KGKA 1I5GA 2HYXA 3MNGA 3CTGA 1TXXA 3A5WA 3RPNA 4OWYA 4V2NA 3ERFA 13GSA 4N11A 3ZMKA 3D4MA 5AISA 1RK4A 3CXGA 1A2LA 3GMFA 2AB6A 3N5OA 4JE1A 4PURA 3KM6A 3CRUA 3G7IA 1Q4JA 2G0FA 2OACA 3NZNA 4NHZA 3RPPA 3C71A 3RHCA 4EKZA 3FY7A 3VK9A 2A2SA 1YKCA 3Q19A 4KDUA 4MF7A 4RQRA 1SU9A 3H8QA 4N0VA 1ON4A 5FHIA 4MF5A 4DEJA 4G2EA 1M0UA 4TW5A 4IJ3A 3KZQA 2VCWA 1B8XA 3FW2A 4IS0A 4JBBA 2OE3A 1NHYA 2PERA 4TN8A 1X9MB 5F8BA 3CSHA 2X64A 4XIHA 1NHOA 2BMXA 4I6XA 2YNXA 3IAM2 2IMEA 4CW9A 3D21A 2CAQA 1ERTA 2C3TA 4NMUA 4PNGA 5D9TA 1N2AA 2QGVA 4OFNA 1VF1A 1G6YA 3L4NA 2L4QA 3QPMA 1A23A 4XTSA 2HSHA 3S9FA 4NV2A 4QL9A 2H1DA 2YWNA 2LEGA 1XXUA 3WT1A 3ZRDA 4MP4A 1GUMA 2VAFA 1K0DA 4WBJA 3VPTA 1XPVA 4IVFA 2YCDA 4GSNA 5CP1A 1AW9A 2K18A 1TOFA 3TJFA 4MDCA 2C0DA 2PGTA 4OD7A 2V1MA 3GX0A 3EMPA 1Z5YE 3A2WA 3J7Yk 2DBCA 5J3RA 3HJOA 3F3QA 1PKZA 4HU7A 1X0RA 2P5RA 2IN3A 5G5EA 1ZOFA 2MBTA 4IW9A 1TK8B 2XC2A 1XOBA 1V40A 2N5AA 2O87A 3HA9A 3QFAC 2JU5A 4HJ2A 4ECCA 3PR8A 2D2ZA 1SYXA 1U87A 3C73A 5LCZA 2NPBA 1IYIA 1TU8A 3APOA 2E2GA 1W4VA 3HJPA 3TUEA 3ZVJD 1GLQA 4GXZA 2PWJA 2XPEA 2LRTA 1PX7A 3HY2A 2P31A 1V98A 1SK0A 3ERGA 9GSSA 4HZ2A 1J9BA 5DCHA 1N8JA 1QQ2A 4IHUA 1MEKA 1BJXA 3P90A 2IWTA 2B1KA 1M9AA 4O7HA 4IBPA 2VCTA 4OCFA 2WZ9A 2BJXA 2GSQA 2YOIA 4BWSA 2JADA 4XS1A 3QR6A 5CRWA 1XVQA 3KP8A 1EP7A 4GRFA 4HS1A 5AIXA 2C0GA 2WFCA 5A5KA 2EIOA 1PSQA 1SD8A 4N30A 1O85A 1GTUA 2J9HA 2CZ2A 4F03A 1BYEA 3GTUA 2I9HA 3H1NA 1M2BA 1AQWA 3GKMA 3ZLPA 3DEXA 3E3EA 1OVNA 1YY7A 3LWAA 2H8LA 1ML6A 5H5SA 4Q5RA 3TKSA 3Q18A 4QQ7A 1QMVA 5D93A 3FZAA 2K8VA 1GNEA 5IO2A 4BPYA 2XBIA 2VCZA 4DSRA 1T00A 4PX1A 5G31A 1Z9HA 1GP1A 3KH9A 3KTBA 2H6YA 4Q5NA 3PINA 3A2XA 5EVOA 3TRPA 4NWYA 1JZDA 2IL3A 4ACSA 6GSXA 1K0OA 3US3A 4FYUA 3F3RA 1ZYQB 4GWRA 4XCSA 1DE1A 1R26A 2IFQA 3D4TA 4HQSA 3M3MA 3QCPA 2X8HA 3W6GA 2FWEA 4LLRA 4AJ6A 1O73A 1E6BA 5JWOB 3D0ZA 2NBSA 3LORA 2V2GA 4MPFA 2QC7A 1DUGA 4KW6A 3UBKA 3K8NA 3EWLA 2I3YA 5IPGA 4LMWA 4RI7A 4RI6A 2B5EA 5J4UA 5IQYA 4XS4A 3KJYA 3LXTA 1W89A 6GSSA 1TW9A 1YKAA 2FLSA 4CDOA 1U88A 4IJIA 4FO5A 2KP1A 4MZWA 3FZ4A 4LA1A 2LJKA 2VOCA 4TRXA 2I81A 2RIIA 5ECKB 5DQSA 12GSA 4F0BA 2L6DA 3KMOA 5E4WA 4RUVA 5G1LA 3DGQA 4TVEA 3TKRA 3R2QA 4WBRD 2PUKC 4JZQA 4GSSA 1MDIA 2WS2A 1O6JA 2ES7A 3QAGA 1B9XC 3EMXA 1X5EA 2J23A 3F6FA 2H73A 4X43A 1EOGA 3GIXA 2R5GA 3P7XA 4PUFC 3O6TA 1M99A 5CNWA 1FOVA 3FZ5A 1GSSA 1QFNA 1S3CA 1JZRA 5EY6A 1EOHA 3PH9A 4EVMA 2ZNMA 1IYHA 4K0NA 1TI3A 3E0UA 2B7JA 1LJRA 2JSZA 3I43A 2JL4A 4BWQA 3TJKA 1XWGA 4EDYA 1X5DA 2TIRA 5ECLB 4IP6A 7GSSA 1JZWA 2AJQB 4ML1A 4L5OA 1B48A 1PL2A 2ON7A 3QAVA 5ECNB 1X9WB 3TKSE 5A4VA 2MMOA 2GSRA 1KNGA 4ID0A 6GSVA 1OC9B 3IXRA 2DJJA 1BQ7A 4D73B 4AGSA 1XFLA 2MZCA 4OFMA 4DVCA 3ZVJA 1HNBA 3GL3A 2L5OA 4WF4A 3TRXA 4KB3A 3F63A 1S3AA 5HFKA 2GSSA 1JLWA 4ECBA 4X0XA 5INYA 3KD0A 5KN2A 4MJBA 4WXTA 2PN8A 1SKSB 1WP0A 1PX6A 1QUWA 1SENA 5COHA 4DSSA 3BCKA 4WF5A 2JSYA 5EPFA 4TKYA 2LQQA 2V32A 3TKSC 1A2JA 3LSZA 4I2TA 3ZREA 4KSOA 2HRNA 2FA4A 2LNSA 3WYWA 3DWVA 4POBA 4JRRA 3DIEA 3C7MA 1JHBA 1YEXA 2OJLA 5B6NA 4LL4B 1YQ1A 4WKWA 4Q5FA 5A4UA 2YJHA 1GNWA 3TDGA 3LYKA 2LV3A 3ERWA 1K0AA 1G6WA 4WEYA 2FGXA 2KOKA 4WETA 4AJ8A 4KNDA 2VD1A 2B5XA 5CRHA 2FWFA 4KE3A 1TU7A 3TGZA 2WDUA 1PRXA 2GZYA 5DALA 2OADA 3UMAA 1ZL9A 2CX3A 1UN2A 2VM2A 2OBKA 4YQMA 3GHAA 5G30A 2R3XA 4EDZA 2RLIA 4JR6A 1KTEA 4KAEA 4JR4A 2X99A 1TRUA 2CZ3A 3IDVA 2F8FA 5DJLA 11GSA 1LBKA 3L78A 3GKNA 4JEDA 1WOUA 5IMDA 2DJ0A 1XWKA 1J08A 1ZGNA 5IMFA 2L4CA 3APQA 4MJCA 3F9UA 3I69A 4OO4A 1GSDA 2H1AA 2YV9A 3A2VA 2C1YA 4V1Ap 3M1GA 3W8JA 3DMLA 5KN3A 2OKAA 1EWXA 3LGCA 1A8YA 2IJYA 3CSIA 3ZFBA 5EL8A 4K1FA 1O8WA 1U3IA 2B7KA 5B8BA 1GUKA 3F4TA 2XHFA 3MDKA 4ZB6A 2H71A 5CAXA 2F3MA 1ZCPA 4TOPA 2P5QA 3QD9A 2H76A 2RM6A 2F9SA 5DCGA 3F4SA 3EVIA 1OC3A 3F4RA 2H0IA 1T3BA 2QSIA 1SK2A 1NSWA 3ME8A 1FAAA 4ML6A 5D9VA 4WR4A 1WIKA 4MPGA 3UL3A 5AIVA 1EEJA 3M9JA 3TKQA 3HVXA 1EP8A 1TK0B 5DQYA 5GAPD 2H0HA 4TXOB 4NPBA 1OC8A 1TKDB 3HCZA 1XZOA 1SJIA 2VL2A 2VD0A 2DMLA 2R6KA 3ZITA 4ZILA 3G7YA 4TR1B 4ISDA 1XWCA 2NTOA 2KHPA 3Q74A 1OKTA 3IHQA 5JCWA 4TXOA 1KEBA 4I97A 4MJAA 3L9VA 5J5NA 2WB9A 3WGEA 2AV4A 3EU3A 5J9CA 1ERWA 1U3AA 3HXSA 3HD5A 2OE0A 4NXIA 3DKSA 4GCIA 3G7JA 3GX8A 1THXA 4K0GA 3LJRA 4OFTA 1NW2A 3KEBA 1FW1A 3IK7A 1AXDA 2OA7A 19GSA 3WT2A 4ZL9A 4K7IA 4ECIA 4KCAA 4ZB9A 2PVOC 1V2AA 1WE0A 4K9ZA 4CHSA 1URMA 2GGTA 1B4QA 4E8EA 5D9XA 5C00A 3TCOA 4EO3A 4OCEA 1GSUA 2REMA 3I9V2 4HEA2 4E8HA 2LNTA 3LEFA 1HNCA 4ZBDA 2HZFA 4XRAA 1OE8A 1K3LA 2DJ1A 5KN1A 1E2YA 1G0TA 3U5RE 1A0FA 4IELA 3ZIJA 1XW6A 1VF4A 4ZB8A 4ZL8A 1T4ZA 3IRAA 4KH7A 3GFKA 1MDJA 2FWGA 3ZTLA 1O7UA 2CT6A 2G2QA 3D5JA 2WJUA 5ECQB 1Z3EA 1XCCA 1DE2A 2R4VA 4AJ7A 4HQZA 3M9KA 5GAND 4MJEA 3LYPA 6GSUA 3TJJA 1B9YC 4HI7A 2CA8A 4EUYA 3HVVA 1TRSA 2B5YA 2HSYA 1AC1A 3IV4A 3FYGA 3SWLA 3VPQA 4ZXGA 2N5FA 1T4YA 3BOAA 2CV4A 2H66A 5ECSA 1PN9A 2B3SA 2KUCA 4FYCA 1XW5A 1XOAA 4HDEA 4MZBA 3P2AA 1V57A 2R37A 3WD6A 5H5RA 1MDKA 4POLA 1XIYA 1OYJA 1GH2A 2WCIA 1XWAA 3LFLA 2VIMA 5J9BA 2HI7A 3A3TA 5ID2B 17GSA 4GF0A 5JCGA 2JACA 3FKFA 4O32A 1PQNA 5ECRB 1ST9A 2HE3A 2IIYA 2HT9A 3TB2A 4PQ1A 4MH2A 2WRTA 3GKXA 2GTUA 1SYRA 4NAXA 3VWWA 3HZ4A 4F0CA 2PMTA 1M2DA 4L0UA 2GT6A 1MTCA 2L59A 1TRVA 4KSMA 2HZEB 2OBIA 3ZYWA 5IMCA 3D6IA 1O8XA 2GQMA 2YJ7A 3VWUA 3IPZA 10GSA 3APSA 1EGRA 3J7Yb 3H93A 1CQGA 3VI5A 3N9JA 2HZEA 2DJKA 2A4VA 5CRDA 2VL2C 3FK8A 2EIRA 2YANA 4BL7A 2LQOA 1G7OA 3TJBA 4YQUA 5ECPB 4MK3A 4O5RA 1WMJA 2IMDA 4K2DA 3PGTA 1R5PA 5F0GA 1YF0A 1FVKA 2WULA 3HHVA 2IMFA 8GSSA 2MYGA 3H79A 4MF6A 2HRFA 4ECJA 3LG6A 1A24A 4EXJA 2XPDA 2PU9C 4BVXA 4V2MA 1VF3A 2VL9A 2HNLA 5CRGA 2JZTA 4TR0A 3UVTA 3FR3A 4P3YB 3GYKA 4FH8A 2PPTA 4L5LA 4ZBBA 1TP9A 3ME7A 1X9SB 1Z7PA 4JU5A 4KGIA 4F9ZA 3FRCA 1RQMA 2H75A 3BBYA 3IE3A 4J2FA 1YZXA 4I8BA 3VURA 1X5CA 2AYTA 3HZ8A 4MABA 3GUSA 3DYRA 2BTOT 1K0MA 1GWCA 3IA1A 1LU4A 3EU4A 1GSQA 2VO4A 2L6CA 3U6VA 1OE7A 1OC9A 1MD4A 1ILOA 2GQKA 4D73A 2JZRA 1CQHA 1EV9A 1ZYEA 3DVXA 3VWXA 2TRCP 1Z6MA 3IOSA 1DBYA 4V1Ag 1SD9A 2C80A 6GSWA 4J56E 3MSZA 4ZBAA 4IN0A 4PQHA 2K8SA 1O81A 3CSJA 2AHEA 4HOJA 4O92A 5LD0A 1J0FA 3TKPA 1A0RP 2VCQA 2C3NA 4OO5A 2YP6A 3VFIA 1HQOA 5CYYA 1GRXA 5B8AA 3E9JB 2CVBA 3C8EA 3TOUA 4EE0A 4EF0A 3UARA 1GSFA 4PNFA 5IOXA 2LJAA 4HJMA 4XRDA 3OR5A 2H01A 3ZL5A 4L8EA 2A2RA 4GQFA 5ELGA 3UOMA 2H6ZA 2VM1A 1WJKA 1I9DA 3GRXA 2GDRA 3KXOA 1TK5B 3L0HA 3FEUA 2LSTA 2GQLA 5J41A 1QXHA 2YWIA 1AQXA 4IKHA 1B4PA 2NDOA 3QMXA 4IQAA 5D96A 2K6VA 1C72A 5IOWA 3ZIVA 2H6XA 1TI1A 2CQ9A 2DJ3A 1F2EA 4LL1B 3CMIA 2LRCA 5JCUA 2KLXA 1USBA 3QFBC 2VL3A 3UEMA 1XVWA 3BD2A 1F6MC 4OMVA 2V41A 2IMKA 5H5QA 5IMAA 2H72A 2ZCTA 1XBSA 4KX4A 1TJDA 5ELAA 1K3OA 18GSA 2DMMA 1SK1A 1VRSD 4TXVA 3W8SA 1OAZA 1PKWA 2EC4A 1K0BA 4RQXA 3GSTA 4HU9A 2VLUA 5E59A 1GSEA 4ZL7A 5D8IA 3TRQA 4YH2A 3QDNA 3FR6A 1TDIA 5DVBA 2TRXA 5L71A 3UAPA 1AUCA 4IQ1A 5ECOB 4PUAA 3D22A 4K8MA 1R7HA 4MZCA 2FCHA 2DIYA 1FHEA 2PBJA 3UVHA 5CO3A 3RHBA 3CRTA 2DIZA 1RW1A 2H1BA 3JCML 2X8CA 4YQVA 4MH3A 2HLSA 2VUPA 3ZMLA 4YAVA 5IPHA 3FR9A 1WRYA 2XBQA 20GSA 4G10A 3KCMA 4PQIA 16GSA 5CREA 1H4OA 4GSTA 4J57E 2ALBA 1DSBA 1PD21 3KMNA 1JZOA 1T7PB 1F37A 3I6AA 3TJGA 14GSA 3GH9A 2GT5A 2N5BA 1SL1B 4IP1A 4FIWA 2Z9SA 4HZ4A 2P0GA 4TR1A 2LJRA 2DLXA 3TOTA 2K9FA 3MWHA 1T8EB 3G9BA 3M8NA 1K0NA 1GLPA 1JFUA 2VCXA 5DBQA 4X1UA 3GL5A 3GKKA 5IMVA 4ILFA 1EV4A 4DSQA 1BX9A 2GVPA 3IK9A 3UIWA 3F8UA 1GL8A 3DVWA 3IR4A 2YZHA 3KH7A 5ABRA 3L9SA 5LNKe 1GUHA 3KTLA 5G2ZA 1FB0A 4F82A 2MMNA 1M2AA 1YEPA 4AF2A 2OE1A 1ZZYA 5JWQB 1BAYA 1M9BA 3Q6OA 1HD2A 4POKA 5IM9A 4XHMA 2M46A 3SBCA 2H74A 1YDKA 2EIQA 5AGYA 2F8AA 2IMIA 5IMZA 3GTUB 2YPMA 2H30A 3RDWA 4TR4A 3FZ9A 4PGTA 3EURA 3EC3A 3V1WA 1Y6EA 4K7OA 3CTFA 1GSYA 1V58A 4WR5A 3VI7A 3DXBA 2FWHA 1V9WA 1ZMAA 2MMAA 1PGTA 1MD3A 1Z7RA 1G7EA 1JLVA 4Q5QA 1S3DA 5GSSA 3CYNA 4GQCA 2C0FA 3KP9A 1TRWA 1GTAA 4KDYA 2DJ2A 4YAPA 1WWJA 2H19A 2DC5A 2C4JA 2YWOA 2PVQA 5C04A 4FYBA 5JWRB 5GZZB 5DAKB 2I1UA 5HR0A 5KN0A 2HFDA 2IFQB 1Y25A 1WPIA 3ZFLA 4BVYA 4KUNA 4MCUA 5F07A 3EINA 5AN1A 2B6MA 2NVLA 2E0QA 1QK8A 2FUG2 5B6MA 4TR3A 4I2UA 2JZSA 5DAKA 4F2IA 2GLRA 2CVKA 4MA9A 2O8VB 5ECHB 2CAIA 5F05A 4IGJA 5ID2A 5HR3A 1XW9A 3F0IA 3QOUA 4KCEA 3DRNA 5ENUA 3AY8A 1ERVA 1KBNA 4XS4B 2YWMA 3FHKA 2MBSA 3NIVA 1K0CA 1Z6NA 1UVZA 3C1RA 1OKDA 3ZZXA 4NV5A 2RUFA 5KEJA 1TTZA 2CVDA 1A8LA 3C1SA 5IO0A 1AIUA 1SJZA 1T1VA 4EC0A 1HNAA 5D73A 4Z7XA 3IBHA 3GH6A 1EGOA 2C3QA 2H0GA 4G19A 3VWVA 3GURA 2R2JA 3DD3A 5FWGA 2M80A 2DSAA 2O7KA 1SL2B 2C8UA 2GS3A 2O85A 3BJ5A 1GTBA 2O89A 4V2LA 2YZUA 3L9UA 3RAZA 1FVJA 2C0EA 3H4KA 4KDXA 5HFGA 2ZUPA 2LS5A 5FT3A 1SL0B 2I4AA 5GSTA 1FO5A 2FHEA 1VF2A 1AAZA 4LMVA 1U6TA 2LKUA 4G9HA 1A2MA 1AQVA 2V6KA 2ON5A 2F51A 1FB6A 3VLNA 3EE2A 6GSYA 1F3AA 3UBLA 3UJ1A 2E2MA 1SJ6A 3HJMA 1FG4A 4H86A 2X8GA 4XS6A 6GSTA 3BCIA 2VCVA 3LXZA 1PA3A 1K3YA 3LQ7A 2H1GA 4ULXA 1GTIA 1BEDA 2E7PA 4MMMA 2VLTA 4MLYA 1R4WA 3RBTA 2AAWA 1EZKA 2LUSA 3P8WA 2AUVA 2LTKA 4NHWA 1F3BA 5ECMB 1UC7A 1SKRB 3GV1A 3CBUA 1NM3A 4I5QA 1QGVA 4QL7A 1YF1A 3M0FA
chains in the Genus database with same CATH superfamily
5HR1A 3O3TA 2GZPA 1Q98A 2WGRA 3GNJA 1BUJA 5D9WA 4WYKB 1HYUA 1EEMA 3O76A 1W7CA 4A5PA 3LT9A 3LT8A 2D42A 2VLVA 2B1LA 2GSPA 5IIZA 1WMPA 2K54A 1UA5A 4N6V0 1H75A 2HXKA 2M72A 5ECIB 2IUJA 5G5FA 3X40A 4BA7A 3CCE3 4ZIJA 4Q53A 1Q42A 4K6XA 1SKWB 4DSSB 2GSTA 1X1UA 1B2UA 1F9MA 3K9MC 2YN1A 3EYTA 4KA0A 2MF7A 3IMAB 2V6OA 4EIQA 3SYUA 1XG8A 3IAS2 1Q7HA 3H51A 4K7NA 1ASKA 2FY6A 1ISKA 2FD3A 5HR2A 4HOHA 1VQ43 1BG5A 3WGDA 1YJ6A 1THOA 3ED3A 3F7SA 1PL1A 3ISOA 4N10A 5HFIA 2GZZA 3GA4A 2H70A 4R9KA 5DREA 2L57A 5HQPA 2R0PA 1T2HA 4HUAA 1D6YA 1VGLA 2FNOA 2L5LA 3MAKA 2B24B 1ABAA 2LRNA 1FW7A 3KIJA 2MMZA 3G6E3 3GSSA 3GZXB 1ERUA 1UCJA 3QAWA 1SIHA 5KP3A 4L0WA 4BTXA 5F06A 1N9JA 1DYUA 1FYSA 4N6MA 1XWBA 4GTUA 1BRSA 5DDLA 3B8LA 1EG9B 1YGEA 2YV7A 1JJ22 4EL1A 2IPAA 3WGXA 1PMTA 2RM5A 22GSA 1PYLA 4FQUA 3HDCA 5B7CA 1GULA 2CX4A 5CXOA 5IERA 5DALB 3D5GA 3HKRA 3NOFA 2MC8A 1A2KA 3F6DA 3GN3A 4N0ZA 4XBYA 1S5AA 4GLTA 2R0GA 1K8A4 1ACVA 1M7TA 3HVSA 5DJMA 2FA8A 2RUEA 3HYPA 3IC4A 5A4WA 3CNMA 3H3HA 2X4AA 1R5AA 2KP2A 4PXOA 3CCL3 5G1KA 4POMA 2QKEA 3KGKA 1FUTA 1I5GA 2HYXA 4HKVB 1N8QA 1EA2A 3MNGA 1YGWA 3CTGA 1TXXA 3UL5A 3A5WA 3RPNA 4OWYA 4V2NA 3ERFA 13GSA 4N11A 2OCTA 3GAXA 3D4MA 3ZMKA 5AISA 3A5EA 5FW5A 2PZVA 1RK4A 1BNRA 3CXGA 2HMOB 3DUKA 1A2LA 3GMFA 1CH0A 2AB6A 1GYBA 3N5OA 4JE1A 2W2CA 1M904 3UL6A 4ICYA 1BVIA 3KM6A 4PURA 1TFKA 3CRUA 3G7IA 1Q4JA 2G0FA 1BSEA 2OACA 1RGLA 3NZNA 4NHZA 3C71A 3RHCA 3RPPA 4EKZA 1FGQA 1WNHA 3FY7A 3VSYA 6RNTA 4GL6A 3VK9A 3JUPA 2A2SA 1YKCA 3Q19A 4KDUA 4MMXB 8RNTA 4MF7A 4RQRA 1SU9A 3H8QA 4N0VA 1X1YA 1ON4A 5FHIA 4O02B 4MF5A 4DEJA 4G2EA 1M0UA 4TW5A 4IJ3A 4HM3B 1B27A 4H3UA 2YFJB 3KZQA 2VCWA 1B8XA 3FW2A 4IS0A 4JBBA 1YI23 4I4KA 2OE3A 1NHYA 1RGHA 2PERA 4R9LA 4TN8A 1X9MB 1MOLA 2Z7AA 5BMUA 4K5SA 5F8BA 1Q814 3CSHA 2X64A 4GB5A 4XIHA 1NHOA 1JNQA 2BMXA 1LQMB 2YNXA 1RSNA 4I6XA 2GU1A 2P09A 3IAM2 1SJWA 2IMEA 4CW9A 2XH9A 3QK9A 3D21A 2CAQA 5BVBA 1ERTA 1YVSA 2X49A 2GXFA 2C3TA 4NMUA 4PNGA 1QAKA 5D9TA 1N2AA 2QGVA 4OFNA 3MG1A 3N8BA 1VF1A 1G6YA 3L4NA 2L4QA 4HYZA 3SVAA 1W02A 1B2MA 1JB5A 3QPMA 1Q9EA 1A23A 2W04A 2HSHA 4XTSA 3S9FA 4NV2A 4FMDA 1M1K4 1K734 4QL9A 1BRNL 2HMJB 2H1DA 2YWNA 2LEGA 1XXUA 3WT1A 1A67A 3FF2A 3ZRDA 1NU3A 5CF2A 4MP4A 1GUMA 2VAFA 1K0DA 4WBJA 3VPTA 3CPOA 1IDPA 1XPVA 4IVFA 1A2VA 2YCDA 4GSNA 5CP1A 1AW9A 2DKIA 2K18A 3CCV3 2FNQA 1TOFA 3TJFA 1BAOA 1BRGA 4MDCA 3WMDA 2C0DA 1QJGA 2PGTA 1U5OA 3QRDA 4OD7A 1GD4A 2V1MA 3GX0A 3CQFA 2KF3A 3EMPA 3SOAA 1Z5YE 3G0KA 2CFWA 5AIGA 2DBCA 3A2WA 3HJOA 5J3RA 3J7Yk 3F3QA 1PKZA 4HU7A 3EX9A 3I553 3DGLA 1X0RA 3OWYA 4HM2B 2P5RA 2IN3A 4OK0A 1ROVA 4N6NB 5G5EA 1ZOFA 2MBTA 4IW9A 1TK8B 4EW5A 3WA3A 3M8CA 2E2TA 2XC2A 1XOBA 1V40A 2N5AA 2BNGA 2O87A 1VQK3 3HA9A 3QFAC 2JU5A 4HJ2A 4ECCA 1RRHA 1VQ83 3PR8A 3KFQC 2D2ZA 1SYXA 1U87A 3C73A 6GSPA 3RNTA 4TX4A 3E99A 3T8UA 5LCZA 3PXMA 2BU4A 2NPBA 3STDA 1IYIA 2OOVC 1TU8A 3APOA 2E2GA 1W4VA 3HJPA 3MG2A 3TUEA 1ULIB 3ZVJD 1AV4A 3SOYA 1GLQA 2OTL3 4GXZA 3S29A 2PWJA 2XPEA 2LRTA 1PX7A 1SARA 3HY2A 3NBJA 5IF6A 2P31A 1V98A 2CC3A 1SK0A 1VZZA 1PY3A 3ERGA 9GSSA 4HZ2A 1J9BA 3NX0A 5DCHA 3MWZA 1N8JA 4MEIA 1QQ2A 1IV7A 4IPBA 4IHUA 1AVKA 3HIGA 1MEKA 1UDII 1BJXA 4U13A 3VGNA 3P90A 1AVLA 3GRDA 2IWTA 2B1KA 4HSCX 1M9AA 4O7HA 3SLUA 2VCTA 1BU4A 4IBPA 3LTCA 4R4KA 2WZ9A 4OCFA 2BJXA 2GSQA 2YOIA 1B2XA 4FMCA 4BWSA 3FH1A 2JADA 4XS1A 4LMIA 3QR6A 5CRWA 1XVQA 3KP8A 1EP7A 4GRFA 4HS1A 5AIXA 2C0GA 2WFCA 5A5KA 2FGTA 2EIOA 1PSQA 4X2HA 1SD8A 4N30A 1O85A 1GTUA 2J9HA 3EHCA 3WDGB 2CZ2A 4F03A 4ORLA 1BYEA 1M1XB 1YJN3 3GTUA 2I9HA 3H1NA 1M2BA 1AQWA 3GKMA 3ZLPA 1O7HB 3DEXA 1BNIA 1FGRA 3E3EA 1OVNA 4J5GA 1YY7A 3X41A 3LWAA 2H8LA 1ML6A 4NREA 2BMRB 1MWRA 1Z1SA 5H5SA 2SARA 4Q5RA 2GU3A 3TKSA 1OCVA 1ULJB 3Q18A 3GWRA 4QQ7A 1QMVA 1TIJA 5D93A 3FZAA 2IYJA 2K8VA 2Y74A 1GNEA 5BRTA 5IO2A 4BPYA 2XGLA 5IEPA 2VCZA 2XBIA 2CW9A 1ZGXA 1K41A 4DSRA 4HM6B 5AEWB 2CWVA 1T00A 4PX1A 1AR0A 5G31A 2LQVA 1Z9HA 1GMQA 3B4PA 1GP1A 2STDA 3KH9A 3KTBA 4K5RA 2H6YA 1YVBI 4Q5NA 3PINA 3A2XA 5EVOA 3TRPA 4NWYA 1JZDA 2IL3A 4ACSA 6GSXA 1K0OA 3US3A 4RNYA 4CCVA 4FYUA 3F3RA 4K2XA 1ZYQB 4GWRA 3ZG5A 4XCSA 1UCLA 1B20A 1DE1A 1R26A 2IFQA 3RDEA 3D4TA 1OACA 4HQSA 4O5UA 3M3MA 3QCPA 2X8HA 3FG1A 3W6GA 2FWEA 4LLRA 4AJ6A 3B4OA 3CMA3 1O73A 1NWWA 1E6BA 3UB1A 5JWOB 3D0ZA 2OQEC 3FF0A 4RBNA 2NBSA 3LORA 2V2GA 4USSA 2YFLB 3CXC2 4MPFA 2QC7A 2XF3A 1DUGA 1BANA 4KW6A 3UBKA 3K8NA 3EWLA 2ML5A 2I3YA 5IPGA 4LMWA 3FG4A 4RI7A 9RNTA 3D5IA 1V74A 4RI6A 3KCHA 2B5EA 5J4UA 5IQYA 4XS4A 3KJYA 2XFSA 3LXTA 1Q40B 1W89A 6GSSA 1TW9A 1YKAA 2HRKA 2Z77A 1RN4A 2FLSA 4CDOA 1W01A 4G0IA 4KF9A 1U88A 3WOFB 3JUQA 4IJIA 4FO5A 4BL7B 1TRQA 2KP1A 4MZWA 3FZ4A 1G96A 4LA1A 2LJKA 2VOCA 4TRXA 2I81A 2RIIA 4N6OB 5ECKB 5DQSA 1DMNA 1RGKA 2P38A 3UNLA 3BLZA 12GSA 4F0BA 2L6DA 3S28A 3KMOA 5E4WA 1OHSA 3K0ZA 2IMJA 3EN1B 3F9SA 4RUVA 2R0CA 5G1LA 3DGQA 4TVEA 4CY6A 3LTAA 3TKRA 3R2QA 1RGFA 4WBRD 2PUKC 3WODG 4JZQA 4GSSA 1LQGC 1MDIA 2WS2A 1DMQA 1O6JA 3OV4A 2ES7A 3QAGA 1B9XC 3EMXA 1X5EA 3D4AA 3I0YA 2J23A 2LYXA 3F6FA 2H73A 4X43A 1EOGA 3T0UA 3GIXA 1U8CB 2R5GA 3P7XA 4PUFC 1RGEA 4BVXB 2F86B 3GSPA 3DY5A 3O6TA 1M99A 5CNWA 1FOVA 5DRVA 3X3ZA 3FZ5A 3MSOA 1GSSA 4GHOA 1QFNA 1S3CA 2A2PA 1JZRA 5EY6A 4WFOA 1EOHA 3PH9A 4EVMA 1B21A 3FCSB 1IVUA 1IYHA 4K0NA 1TI3A 3E0UA 1MGRA 4WWUC 3S67A 1LJRA 2B7JA 2JSZA 3I43A 3NM2A 2JL4A 4BWQA 3TJKA 1XWGA 4EDYA 7GSPA 1X5DA 2TIRA 5ECLB 1UGHI 1BNSA 4IP6A 1UUGB 1JZWA 7GSSA 2AJQB 4ML1A 1JN5B 4L5OA 1IYYA 1GSPA 1B48A 1PL2A 2WGQA 2ON7A 3QAVA 5ECNB 2QIYA 1X9WB 3TKSE 3WHOA 5A4VA 3LZAA 2MMOA 5D81A 1W6GA 4K90B 2GSRA 1KNGA 3PGBA 5EQLA 2UX0A 4ID0A 6GSVA 5KP1A 1IK3A 1OC9B 1RN1A 2WO0A 1NB3I 3IXRA 2M7OA 2DJJA 3LMLA 2F98A 3MHEA 1GOVA 1N9EA 1BQ7A 4D73B 1Q824 4AGSA 2CX0A 4LEHA 1XFLA 2MZCA 3ZG0A 2A4HA 2W9QA 4OFMA 4DVCA 3SXXA 3ZVJA 5CLKA 1HNBA 3GL3A 2L5OA 3IC8A 4L7KA 4WF4A 4BIKA 3TRXA 4KB3A 3K5TA 1IU7A 3URPA 3F63A 3CC73 1S3AA 5HFKA 2GSSA 1RNTA 1JLWA 4CJNA 4ECBA 4HZBB 4HM0B 4FCZA 4WYKA 4X0XA 5INYA 3BU4A 1ZX2A 1S3RA 5RNTA 3KD0A 5I97A 5KN2A 1IT8A 4MJBA 3G713 4WXTA 2PN8A 1ZS7A 1SKSB 2OOVA 1WP0A 3IPTA 3AGNA 1PX6A 1QUWA 1SENA 5COHA 4DSSA 3BCKA 3O8YA 4WHAA 4WF5A 2JSYA 5EPFA 2L4VA 3DGNA 4TKYA 2LQQA 2V32A 5BIRA 3EQQB 2OTJ3 3TKSC 1A2JA 3LSZA 4I2TA 3ZREA 4KSOA 2HRNA 4HVNA 2FA4A 2WOFA 2LNSA 3WYWA 3DWVA 4POBA 4JRRA 4XBXA 3DIEA 3C7MA 1WTHA 4GSPA 1JHBA 1YEXA 2GBXB 2OJLA 4H61A 5B6NA 4EV5A 1YQ1A 4LL4B 4WKWA 5KOWA 1TRPA 4Q5FA 2K3DA 4K1UA 1MGWA 1PFPA 2BIRA 5A4UA 4MMZB 2YJHA 1GNWA 3AHWA 3TDGA 3LYKA 2LV3A 3ERWA 1K0AA 1LOXA 1G6WA 4WEYA 3SX1A 2FGXA 2KOKA 2HMKB 1OHOA 2D1WA 4WETA 3R3EA 4AJ8A 4KNDA 4XDWA 3PS8A 2VD1A 3UJMA 2B5XA 5CRHA 3B7CA 2FWFA 1GY5A 4KE3A 1TU7A 3TGZA 2WDUA 3GZBA 1PRXA 2GZYA 4LZIA 2RCDA 5DALA 2OADA 3UMAA 1VQL3 1ZL9A 3JUNA 2CX3A 1UN2A 1TUHA 2JQ5A 3WA2X 3D3LA 4HJLB 2VM2A 2OBKA 2HSMA 4YQMA 1Q7Y4 1GMPA 3GHAA 2W0QA 2CX1A 5G30A 2R3XA 2PNCA 4EDZA 2RLIA 1BRHA 1YIJ3 4JR6A 1KTEA 4JR4A 4KAEA 2X99A 4Z2UA 1TRUA 2CZ3A 2IY2A 4EC6A 3IDVA 3CCR3 2F8FA 2DKHA 1BNGA 5DJLA 1J2BA 4JRFA 11GSA 1LBKA 2E2VA 3L78A 2ZHXB 1UW1A 3GKNA 4JEDA 5AIIA 1WOUA 5IMDA 3G4S3 2DJ0A 1XWKA 2KF6A 3NHXA 1J08A 2ZDJA 1I2GA 1ZGNA 5IMFA 2L4CA 3S5CA 1C7HA 1OPYA 3MKIA 3APQA 4RNZA 4MJCA 3F9UA 3I69A 1JBTA 4KT3B 4OO4A 1GSDA 2H1AA 2YV9A 3A2VA 2C1YA 4V1Ap 3Q1CA 3M1GA 3W8JA 3F40A 3DMLA 5KN3A 3PCRA 2OKAA 4AKZA 1EWXA 3LGCA 3OW22 5ELJA 1A8YA 2IJYA 3EE1A 3CSIA 3ZFBA 2OQEA 3LH4A 5EL8A 4K1FA 1E97A 1O8WA 3CU3A 1FOHA 1BSAA 5AYSC 1U3IA 3CCS3 2B7KA 5B8BA 1DETA 1GUKA 3F4TA 2XHFA 3MDKA 4ZB6A 2H71A 5CAXA 2F3MA 1ZCPA 2B1XB 4TOPA 2P0MA 5EEOA 2P5QA 2GEXA 3QD9A 1VQO3 1BNFA 2HRAA 2H76A 2RM6A 2F9SA 2KF5A 3EVIA 1OC3A 3F4RA 3F4SA 1LNIA 2QGUA 2H0IA 5DCGA 1T3BA 2QSIA 1BSBA 1O7NB 1SK2A 3KE7A 1NSWA 3ME8A 1FAAA 4ML6A 5D9VA 2ML6A 2KXGA 4WR4A 5KOXA 1JBRA 1W6YA 3DGOA 1W6CA 1WIKA 4MPGA 3UL3A 5AIVA 1EEJA 3M9JA 3TKQA 3HVXA 1K9M4 1EP8A 1TK0B 5DQYA 5GAPD 2H0HA 4TXOB 4NPBA 1OC8A 1TKDB 3HCZA 1XZOA 1SJIA 2VL2A 2VD0A 2DMLA 4O5QA 2R6KA 4XBTA 3ZITA 3LTDA 4ZILA 3G7YA 1BSDA 2L1SA 4TR1B 3U1WA 3PYJA 5AYRB 4ISDA 1RGGA 3EBTA 2RFRA 1S723 1XWCA 2NTOA 2KHPA 3Q74A 1OKTA 3IHQA 5JCWA 4TXOA 1KEBA 4I97A 4MJAA 3L9VA 1SPUA 5J5NA 2WB9A 3WGEA 2AV4A 1YJW3 3EU3A 4CDLA 4BU4A 3V98A 5J9CA 4QWTA 1ERWA 1U3AA 3HXSA 3HD5A 3F14A 4FMAA 4Z2RA 2OE0A 1M9GA 4NXIA 3DKSA 4GCIA 3G7JA 3GX8A 3CNXA 1RLSA 1THXA 4K0GA 3LJRA 4OFTA 5JPPA 1NW2A 3PPUA 3KEBA 1FW1A 3IK7A 3ECFA 6STDA 1QAFA 1AXDA 19GSA 2OA7A 3WT2A 1I2EA 1IVXA 5HOHA 3AHSA 2BMOB 1I0XA 4ZL9A 4K7IA 4ECIA 3KIIA 3RGRA 4KCAA 4ZB9A 2PVOC 1V2AA 4OVMA 1WE0A 2XFTA 4K9ZA 4CHSA 1URMA 1AY7A 2GGTA 1B4QA 4E8EA 5D9XA 4ZM8A 5C00A 3TCOA 4EO3A 4OCEA 1I2FA 1GSUA 1EQKA 2REMA 3I9V2 4O8SA 1MWSA 3DMCA 4HEA2 4E8HA 1OF5B 2LNTA 3LEFA 1HNCA 4ZBDA 2HZFA 4XRAA 1OE8A 1K3LA 2DJ1A 5KN1A 1G0TA 1RGCA 1E2YA 1IVWA 4K1VA 5ELUA 3LW9A 4Z2TA 1UUVB 1UCIA 3U5RE 1A0FA 4IELA 3ZIJA 1XW6A 1VF4A 4ZB8A 4ZL8A 1T4ZA 3IRAA 5BU4A 4KH7A 2HMNB 1O7GB 1IVVA 1TP6A 1PN0A 3GFKA 1MDJA 2FWGA 3ZTLA 1O7UA 3NBBA 2CT6A 2G2QA 3D5JA 5IG0A 2WJUA 5ECQB 1Z3EA 1XCCA 1DE2A 3L0RA 2R4VA 4AJ7A 1I3FA 4HQZA 3M9KA 5GAND 4MJEA 3LYPA 6GSUA 3TJJA 1B9YC 3CCU3 4HI7A 2CFDA 2CA8A 4EUYA 3HVVA 1TRSA 2B5YA 2HSYA 5A0OB 1AC1A 3IV4A 4N3VA 3FYGA 3SWLA 3VPQA 1N5PA 4ZXGA 3HIIA 2N5FA 1JBSA 3ER7A 4L8OA 1T4YA 3F7XA 2W9PA 2CV4A 2H66A 3BOAA 5ECSA 1PN9A 1R4CA 1RMSA 2B3SA 2KUCA 4FYCA 3CD63 1XW5A 1XOAA 4HDEA 4MZBA 3HK4A 3P2AA 4BVYB 4WP5A 1V57A 2R37A 4HM7B 3I563 3WD6A 1MWTA 5H5RA 5CK6A 4R1KA 1MDKA 1Q864 4POLA 1XIYA 1OYJA 1GH2A 4KFDA 2WCIA 1UI7A 1XWAA 1UCKA 1JRQA 3DGYA 3LFLA 2VIMA 5J9BA 4K61A 2XGNA 2HI7A 3A3TA 5ID2B 3GZRA 17GSA 4GF0A 4EBGA 5JCGA 2JACA 3FKFA 4O32A 1PQNA 3BIRA 1BNJA 1E3RA 2A15A 3DZLA 5ECRB 2KCDA 4AKYA 1ST9A 2HE3A 2IIYA 2HT9A 3TB2A 4PQ1A 2CK3H 4MH2A 1FGMA 1LOVA 2WRTA 3GKXA 3NUVA 2GTUA 1N5HA 1NNVA 1SYRA 1IT7A 4NAXA 3VWWA 1MNLA 5LC7A 3HZ4A 4F0CA 3F8HA 2CH9A 1T5YA 2PMTA 1M2DA 4L0UA 2GT6A 1YJ93 1MTCA 2P0XA 2HMMB 1LVNA 2L59A 1TRVA 4KSMA 2HOHA 2HZEB 1HU9A 3N54B 2OBIA 3ZYWA 4CPKA 5IMCA 2CIUA 3D6IA 4STDA 1O8XA 2GQMA 2YJ7A 3VWUA 3IPZA 10GSA 3RGAA 3APSA 1EGRA 2GEYA 3ROBA 3J7Yb 2O3OA 3H93A 2Q07A 3FZWA 1CQGA 3EJVA 4O2HA 3VI5A 1R4YA 2C11A 1Q40A 3N9JA 4LSOA 2HZEA 3KKGA 2DJKA 2Y73A 1QVF2 2A4VA 5CRDA 2RSXA 2VL2C 3FK8A 3CME3 2EIRA 2YANA 3KSPA 4BL7A 2LQOA 1G7OA 3TJBA 4YQUA 5ECPB 1NO3A 3X3YA 4MK3A 3BNBA 1SQWA 4O5RA 1WMJA 1W00A 2AAEA 2IMDA 3DXOA 4K2DA 3PGTA 3WOEB 1GS3A 1R5PA 5F0GA 1YF0A 3KN4A 1FVKA 2WULA 3HHVA 2IMFA 3CC23 2MYGA 3H79A 8GSSA 2BMQB 4MF6A 4IIAA 1LXEA 2HRFA 2AADA 3A5IA 1CEWI 2O9UX 4ECJA 1CYVA 3CPW2 1BSCA 3KSED 1LOYA 1VQM3 3LG6A 1FA3A 1X1XA 8CHOA 5M1AA 1A24A 4EXJA 2XPDA 2CKFB 2PU9C 4BVXA 4V2MA 1VF3A 2VL9A 2HNLA 5CRGA 3PZWA 4HBRA 1T2IA 2WGOA 3AMOB 3G16A 1FGTA 2W03A 4J5KA 2JZTA 4HZ9B 4TR0A 3UVTA 3FR3A 4P3YB 1GY7A 4BTYA 3GYKA 4FH8A 2PPTA 4L5LA 3OXAA 1LNHA 4ZBBA 2CWUA 1TP9A 3ME7A 3LYGA 3BB9A 5GSPA 1X9SB 1Z7PA 4JU5A 4KGIA 4F9ZA 1E3VA 3DM8A 1RQMA 2H75A 3BBYA 1BRJA 3FRCA 3IE3A 4J2FA 1YZXA 1DMMA 4I8BA 3VURA 2Z76A 1X5CA 2AYTA 3HZ8A 1JN5A 4MABA 3GUSA 1MWUA 3DYRA 2BTOT 1K0MA 1GWCA 3IA1A 1LU4A 3EU4A 2ZL8A 5G2GA 1BUQA 1GSQA 2VO4A 2L6CA 1US1A 3IJEB 3U6VA 1OE7A 1OC9A 2HMLB 1WMOA 1VQ73 1MD4A 1ILOA 2GQKA 1OGXA 1NB5I 4D73A 2JZRA 7STDA 1CQHA 4N6LA 1EV9A 2OWPA 3G8ZA 1ZYEA 3DVXA 3VWXA 4AEQA 2TRCP 1Z6MA 3IOSA 4YKFA 1DBYA 4V1Ag 1SD9A 2C80A 6GSWA 4J56E 3MSZA 4ZBAA 1ZYPA 2E2UA 3EF8A 7RNTA 4IN0A 4PQHA 2K8SA 5M19A 3FMWA 1O81A 3CSJA 3FLJA 2AHEA 4HOJA 4O92A 5LD0A 1N8R4 1J0FA 1EKMA 4FR9A 1A0RP 3TKPA 4HM5B 1O7MB 5JBSA 1I3IA 2VCQA 2C3NA 1RDSA 4OO5A 2YP6A 3S27A 3VFIA 1FUSA 1HQOA 3HOHA 5CYYA 1OHPA 1D6UA 2KAAA 5B8AA 1GRXA 3E9JB 3NM7A 2RBIA 4FCMA 2KF4A 2CVBA 3C8EA 3TOUA 4EE0A 2R4IA 4HM4B 4EF0A 3UARA 1GSFA 4PNFA 1DVCA 5IOXA 2I9WA 2LJAA 3OWSA 4HJMA 4XRDA 3OR5A 4RZMA 2H01A 3ZL5A 4BL2A 4L8EA 2A2RA 1CQSA 4GQFA 5ELGA 3UOMA 2H6ZA 2VM1A 1OH0A 1WJKA 1I9DA 3JUOA 3GRXA 2GDRA 3IHGA 2F99A 3MG3A 1X1WA 1BOXA 3KXOA 1QMAA 1TK5B 5IENA 1YHQ3 3EBYA 1GY6A 3NBRA 3FEUA 2BO9B 1G02A 2LSTA 3L0HA 4O3VA 2GQLA 3OWUA 4KFEA 5J41A 1QXHA 1ROAA 2YWIA 1AQXA 2XSOB 4IKHA 4LGQA 1B4PA 4EV2A 2XEPA 5IG4A 2NDOA 1L5GB 3QMXA 4IQAA 5D96A 3N9HA 2K6VA 1C72A 5IOWA 3ZIVA 1DVDA 1W4NA 2H6XA 2CHCA 3WR2A 3F8XA 2JDIH 1TI1A 4KVHA 2CQ9A 3HI7A 2DJ3A 1F2EA 2CFKA 4LL1B 3CMIA 2LRCA 5AIHA 5JCUA 2KLXA 1USBA 3QFBC 2VL3A 3UEMA 1XVWA 1I8VA 3BD2A 3KZTA 1F6MC 3GZYB 2F56A 1M3JA 5EVHA 4OMVA 4XDVA 1HKXA 1K28A 2V41A 2R41A 2IMKA 5H5QA 1RCKA 5IMAA 2H72A 2ZCTA 1XBSA 2CWTA 4KX4A 2WOHA 3CCM3 1KWIA 1TJDA 3PCSA 5ELAA 2UZ8A 1K3OA 3NXJA 1NJI4 18GSA 2DMMA 2SBLA 3ALAA 1C54A 2BT3A 2GBWB 4MMYB 4JF8A 1SK1A 4G1MB 2BHMA 4RNTA 1F8NA 1BGSA 1VRSD 4TXVA 3W8SA 1OAZA 2KRTA 1PKWA 1LRAA 3DGMA 2EC4A 1K0BA 4RQXA 3GSTA 1NDOB 2CG0A 4HU9A 2VLUA 2RNTA 5E59A 1GSEA 1FZUA 4ZL7A 1GD3A 3V99A 3MIXA 5D8IA 3TRQA 4DKIA 3CC43 2XR8B 3X42A 4YH2A 3QDNA 3NQZA 4LYLB 3FR6A 4R80A 3X3XA 1TFOA 1TDIA 5DVBA 2V1LA 2TRXA 2XSHB 5L71A 3UAPA 1AUCA 1BRIA 4KFFA 4IQ1A 5ECOB 4PUAA 1GOUA 3D22A 4K8MA 5IW9A 1RJOA 1R7HA 4MZCA 2FCHA 2DIYA 5HGRA 1FHEA 2PBJA 3UVHA 5CO3A 3RHBA 1GMRA 1RHLA 3CRTA 3Q3FA 2DIZA 3LTBA 1RW1A 3HX8A 2H1BA 3JCML 2X8CA 4YQVA 4MH3A 3ZFZA 5AIFA 3FGYA 2HLSA 2VUPA 1I70A 4EIPA 3MYDA 3ZMLA 2Z6BA 4YAVA 2QA43 5IPHA 3FR9A 1EUIC 1WRYA 5CF1A 2XBQA 2RGQA 20GSA 4G10A 3KCMA 4PQIA 4EYCA 16GSA 2F5MA 5CREA 1H4OA 2C4BA 4GSTA 4J57E 1WMNA 2ALBA 1DSBA 1D6ZA 1PD21 3KMNA 1JZOA 1T7PB 3VF1A 1F37A 3I6AA 3TJGA 14GSA 1KQS2 3GH9A 2GT5A 5JPUA 3MPHA 2N5BA 1SL1B 4HM8B 4IP1A 4FIWA 1KSIA 1YIT3 2Z9SA 2INXA 4HZ4A 2P0GA 1A2PA 2LJRA 4TR1A 2DLXA 1HYFA 3LXUX 2K9FA 3TOTA 1RTUA 2QEX3 3MWHA 2XRXB 1T8EB 3G9BA 3M8NA 3FG3A 1K0NA 1GLPA 2IA7A 1WQLB 1RCLA 1JFUA 2VCXA 5DBQA 4X1UA 3AGOA 3GL5A 3GKKA 4BIRA 4HAAA 5D83A 5IMVA 1PU4A 4ILFA 1B2ZA 1M3IA 1EV4A 4DSQA 1BX9A 5BXQA 2GVPA 1BNEA 3IK9A 1AQZA 1B3SA 3UIWA 3F8UA 1GL8A 1ZYNA 3DVWA 4IT7A 2YZHA 3IR4A 3KH7A 3L9SA 5ABRA 5LNKe 1IQXA 3NQYA 1GUHA 3KTLA 5G2ZA 2QA1A 2C10A 2CFGA 1STFI 3LOYA 1FB0A 2CG1A 4F82A 4X2OA 2MMNA 1M2AA 1UGIA 1YEPA 1W2B2 4AF2A 5IEOA 2OE1A 1ZZYA 5JWQB 2QA2A 1BAYA 1M9BA 3Q6OA 1HD2A 4POKA 2ZA4A 5IM9A 3U97A 3NV0B 4XHMA 2M46A 3SBCA 2H74A 2F4YA 1YDKA 2EIQA 3D9RA 5AGYA 2F8AA 1OF5A 2IMIA 5IMZA 3BNEA 3GTUB 3D79A 1W5ZA 4KZ1A 1SIIA 1TTOA 2YPMA 2H30A 3RDWA 4TR4A 3FZ9A 1VQQA 4PGTA 3EN8A 1I0VA 3EURA 3EC3A 3V1WA 1VQP3 1Y6EA 4K7OA 3CTFA 1V58A 1GSYA 3NV0A 4WR5A 5AI1A 2K0MA 1IQYA 3VI7A 3DXBA 2FWHA 1V9WA 1UUWB 1ZMAA 2MMAA 1PGTA 1MD3A 1Z7RA 1G7EA 2FXTA 1JLVA 4Q5QA 1O7PB 1S3DA 5GSSA 5IG3A 2F5WA 3BNDA 3BNCA 1IV9A 4XB5A 1VQ53 3CYNA 4GQCA 2C0FA 3KP9A 4BL3A 5FGOA 1TRWA 1IQ8A 1GTAA 4KDYA 2DJ2A 2UGIA 4MJDA 4YAPA 1WWJA 2H19A 2DC5A 2C4JA 2P05A 3Q2PA 2YWOA 1RKYA 2PVQA 5C04A 1BIRA 5IG5A 4FYBA 5JWRB 5GZZB 3FSDA 5DAKB 4XM4A 1STDA 2I1UA 5HR0A 5KN0A 2HFDA 1QALA 2IFQB 1Y25A 1WPIA 3ZFLA 4BVYA 2J8XB 3DH2A 1RN7A 4KUNA 4MCUA 5F07A 1RNBA 3EINA 5AN1A 2UUGC 2B6MA 3FKAA 2NVLA 2YX9A 3Q90A 2E0QA 1QK8A 1KC84 2FUG2 5B6MA 1JV2B 1O7WB 1TU5A 1RRLA 2W6JH 4I2UA 4FMBA 4TR3A 2JZSA 5DAKA 5STDA 4F2IA 2GLRA 2CVKA 4MA9A 2O8VB 5ECHB 2CAIA 5F05A 1VQ63 1FUWA 1RGAA 4IGJA 5ID2A 5LC6A 5HR3A 5KP4A 1XW9A 3F0IA 3JUMA 4G0LA 3QOUA 4KCEA 3DRNA 5ENUA 3AY8A 1ERVA 1KBNA 4XS4B 4EXRA 4PEJA 2YWMA 3FHKA 3NIVA 1K0CA 2MBSA 3MYTA 1DE3A 1KD14 5AEUB 1B2SA 2CFLA 4L8PA 3V92A 1Z6NA 4OUQA 1UVZA 3C1RA 1OKDA 3ZZXA 4NV5A 2RUFA 5KEJA 2YFIB 1TTZA 2CVDA 1A8LA 3C1SA 5IO0A 1AIUA 1HZ1A 2IUKA 1SJZA 1A90A 1T1VA 4EC0A 1HNAA 4J9AA 5D73A 1JKGB 3OX9A 4Z7XA 3IBHA 3GH6A 1EGOA 1JB2A 4G0KA 2H0GA 3EC9A 2C3QA 4G19A 3VWVA 5TGNA 3GURA 2R2JA 3CCJ3 3DD3A 5FWGA 5M18A 2M80A 1GOYA 2DSAA 2O7KA 1SL2B 2C8UA 1JB4A 2GS3A 2O85A 3BJ5A 1GTBA 2O89A 4V2LA 3T8NA 2YZUA 3L9UA 3RAZA 1FVJA 2C0EA 1BRKA 1JKGA 1QVG2 3H4KA 4KDXA 4YKGA 5HFGA 3K7CA 2ZUPA 1LOWA 1FGOA 2LS5A 5FT3A 1SL0B 2I4AA 5GSTA 1FO5A 1UI8A 5D82A 2FHEA 4BTWA 1VF2A 1AAZA 4J8TA 4LMVA 3SEDA 1U6TA 4NHFA 3K63A 3A76A 1W2ZA 4PTSA 2LKUA 4G9HA 1Y4KA 1A2MA 1AQVA 1VQN3 2V6KA 2ON5A 2F51A 1FB6A 3VLNA 3EE2A 1OGZA 6GSYA 1F3AA 3UBLA 3HZPA 3UJ1A 2W56B 2E2MA 3HVNA 1SJ6A 1ZO2A 4CY8A 3EB8A 3HJMA 3J7Yd 1FG4A 4H86A 4N6UA 4X4JA 1PFOA 2X8GA 4XS6A 6GSTA 3CCQ3 3BCIA 2VCVA 3LXZA 1PA3A 1K3YA 3LQ7A 2H1GA 4ULXA 1OUNA 1GTIA 1BEDA 2E7PA 1VQ93 4MMMA 2VLTA 4MLYA 1R4WA 3RBTA 2AAWA 2W56A 1EZKA 2LUSA 3AMOA 3P8WA 4N6TA 1CYUA 2AUVA 2LTKA 4HM1B 4NHWA 1F3BA 5ECMB 4FCJA 1UC7A 1SKRB 3JVCA 3GV1A 3CBUA 1NM3A 4I5QA 1QGVA 4QL7A 4MNNA 3M0FA 1YNVX 3EPTA 1YF1A 2ZNMA
chains in the Genus database with same CATH topology
5HR1A 3O3TA 2GZPA 1Q98A 2WGRA 3GNJA 5D9WA 4WYKB 1HYUA 1EEMA 3O76A 1W7CA 4A5PA 3LT9A 3LT8A 2D42A 2VLVA 2B1LA 5IIZA 1WMPA 2K54A 1UA5A 4N6V0 1H75A 2HXKA 2M72A 5ECIB 2IUJA 5G5FA 3X40A 4BA7A 3CCE3 4ZIJA 4Q53A 1Q42A 4K6XA 1SKWB 4DSSB 2GSTA 1F9MA 3K9MC 2YN1A 3EYTA 4KA0A 2MF7A 3IMAB 2V6OA 4EIQA 3IAS2 3H51A 4K7NA 1ASKA 2FY6A 1ISKA 2FD3A 5HR2A 1VQ43 1BG5A 3WGDA 1YJ6A 1THOA 3ED3A 3F7SA 1PL1A 3ISOA 4N10A 5HFIA 2GZZA 3GA4A 2H70A 4R9KA 5DREA 2L57A 5HQPA 2R0PA 4HUAA 1D6YA 1VGLA 2FNOA 2L5LA 3MAKA 2B24B 1ABAA 2LRNA 3KIJA 2MMZA 3G6E3 3GSSA 3GZXB 1ERUA 3QAWA 1SIHA 5KP3A 4L0WA 4BTXA 5F06A 1N9JA 1DYUA 4N6MA 1XWBA 4GTUA 5DDLA 3B8LA 1EG9B 1YGEA 2YV7A 1JJ22 4EL1A 2IPAA 3WGXA 1PMTA 2RM5A 22GSA 4FQUA 3HDCA 5B7CA 1GULA 2CX4A 5CXOA 5IERA 5DALB 3HKRA 3NOFA 2MC8A 1A2KA 3F6DA 3GN3A 4N0ZA 4XBYA 1S5AA 4GLTA 2R0GA 1K8A4 1ACVA 1M7TA 3HVSA 5DJMA 2FA8A 2RUEA 3HYPA 3IC4A 5A4WA 3CNMA 3H3HA 2X4AA 1R5AA 2KP2A 4PXOA 3CCL3 4POMA 5G1KA 2QKEA 3KGKA 1I5GA 2HYXA 4HKVB 1N8QA 1EA2A 3MNGA 3CTGA 1TXXA 3UL5A 3A5WA 3RPNA 4OWYA 4V2NA 3ERFA 13GSA 4N11A 2OCTA 3GAXA 3D4MA 3ZMKA 5AISA 5FW5A 2PZVA 1RK4A 3CXGA 2HMOB 3DUKA 1A2LA 3GMFA 2AB6A 1GYBA 3N5OA 4JE1A 2W2CA 1M904 3UL6A 4ICYA 4PURA 3KM6A 1TFKA 3CRUA 3G7IA 1Q4JA 2G0FA 2OACA 3NZNA 4NHZA 3RPPA 3C71A 3RHCA 4EKZA 1FGQA 1WNHA 3FY7A 3VSYA 4GL6A 3VK9A 3JUPA 2A2SA 1YKCA 3Q19A 4KDUA 4MMXB 4MF7A 4RQRA 1SU9A 3H8QA 4N0VA 1ON4A 5FHIA 4O02B 4MF5A 4DEJA 4G2EA 1M0UA 4TW5A 4IJ3A 4HM3B 4H3UA 2YFJB 3KZQA 2VCWA 1B8XA 3FW2A 4IS0A 4JBBA 1YI23 4I4KA 2OE3A 1NHYA 2PERA 4R9LA 4TN8A 1X9MB 1MOLA 2Z7AA 5BMUA 4K5SA 5F8BA 1Q814 3CSHA 2X64A 4GB5A 4XIHA 1NHOA 1JNQA 2BMXA 4I6XA 2YNXA 2GU1A 2P09A 3IAM2 1SJWA 2IMEA 4CW9A 2XH9A 3QK9A 3D21A 2CAQA 5BVBA 1ERTA 2X49A 2GXFA 2C3TA 4NMUA 4PNGA 1QAKA 5D9TA 1N2AA 2QGVA 4OFNA 3MG1A 3N8BA 1VF1A 1G6YA 3L4NA 2L4QA 4HYZA 3SVAA 1W02A 1JB5A 3QPMA 1A23A 4XTSA 2W04A 2HSHA 3S9FA 4NV2A 4FMDA 1M1K4 1K734 4QL9A 2HMJB 2H1DA 2YWNA 2LEGA 1XXUA 3WT1A 1A67A 3FF2A 3ZRDA 1NU3A 5CF2A 4MP4A 1GUMA 2VAFA 1K0DA 4WBJA 3VPTA 3CPOA 1IDPA 1XPVA 4IVFA 1A2VA 2YCDA 4GSNA 5CP1A 1AW9A 2DKIA 2K18A 3CCV3 2FNQA 1TOFA 3TJFA 4MDCA 3WMDA 2C0DA 1QJGA 2PGTA 1U5OA 3QRDA 4OD7A 1GD4A 2V1MA 3GX0A 3EMPA 3SOAA 1Z5YE 3G0KA 2CFWA 5AIGA 2DBCA 3A2WA 3HJOA 5J3RA 3J7Yk 3F3QA 1PKZA 4HU7A 3EX9A 3I553 3DGLA 1X0RA 3OWYA 4HM2B 2P5RA 2IN3A 4OK0A 1ROVA 4N6NB 5G5EA 1ZOFA 2MBTA 4IW9A 1TK8B 3WA3A 3M8CA 2E2TA 2XC2A 1XOBA 1V40A 2N5AA 2BNGA 2O87A 1VQK3 3HA9A 3QFAC 2JU5A 4HJ2A 4ECCA 1RRHA 1VQ83 3PR8A 3KFQC 2D2ZA 1SYXA 1U87A 3C73A 4TX4A 3E99A 3T8UA 5LCZA 3PXMA 2NPBA 3STDA 1IYIA 2OOVC 1TU8A 3APOA 2E2GA 1W4VA 3HJPA 3MG2A 3TUEA 1ULIB 3ZVJD 1AV4A 3SOYA 1GLQA 2OTL3 4GXZA 3S29A 2PWJA 2XPEA 2LRTA 1PX7A 3HY2A 3NBJA 5IF6A 2P31A 1V98A 2CC3A 1SK0A 1VZZA 3ERGA 9GSSA 4HZ2A 1J9BA 3NX0A 5DCHA 3MWZA 1N8JA 4MEIA 1QQ2A 1IV7A 4IPBA 4IHUA 1AVKA 3HIGA 1MEKA 1BJXA 4U13A 3VGNA 3P90A 1AVLA 3GRDA 2IWTA 2B1KA 1M9AA 4O7HA 3SLUA 2VCTA 4IBPA 4OCFA 3LTCA 4R4KA 2WZ9A 2BJXA 2GSQA 2YOIA 4FMCA 4BWSA 3FH1A 2JADA 4XS1A 4LMIA 3QR6A 5CRWA 1XVQA 3KP8A 1EP7A 4GRFA 4HS1A 5AIXA 2C0GA 2WFCA 5A5KA 2FGTA 2EIOA 1PSQA 4X2HA 1SD8A 4N30A 1O85A 1GTUA 2J9HA 3EHCA 3WDGB 2CZ2A 4F03A 4ORLA 1BYEA 1M1XB 1YJN3 3GTUA 2I9HA 3H1NA 1M2BA 1AQWA 3GKMA 3ZLPA 1O7HB 3DEXA 1FGRA 3E3EA 1OVNA 1YY7A 3X41A 3LWAA 2H8LA 1ML6A 4NREA 2BMRB 1Z1SA 5H5SA 4Q5RA 2GU3A 3TKSA 1OCVA 1ULJB 3Q18A 3GWRA 4QQ7A 1QMVA 1TIJA 5D93A 3FZAA 2K8VA 2Y74A 1GNEA 5BRTA 5IO2A 4BPYA 2XGLA 5IEPA 2VCZA 2XBIA 2CW9A 1K41A 4DSRA 4HM6B 5AEWB 2CWVA 1T00A 4PX1A 1AR0A 5G31A 2LQVA 1Z9HA 3B4PA 1GP1A 2STDA 3KH9A 3KTBA 4K5RA 2H6YA 1YVBI 4Q5NA 3PINA 3A2XA 5EVOA 3TRPA 4NWYA 1JZDA 2IL3A 4ACSA 6GSXA 1K0OA 3US3A 4RNYA 4CCVA 4FYUA 3F3RA 4K2XA 1ZYQB 4GWRA 4XCSA 1DE1A 1R26A 2IFQA 3RDEA 3D4TA 1OACA 4HQSA 4O5UA 3M3MA 3QCPA 2X8HA 3FG1A 3W6GA 2FWEA 4LLRA 4AJ6A 3B4OA 3CMA3 1O73A 1NWWA 1E6BA 3UB1A 5JWOB 3D0ZA 2OQEC 3FF0A 4RBNA 2NBSA 3LORA 2V2GA 4USSA 2YFLB 3CXC2 4MPFA 2QC7A 2XF3A 1DUGA 4KW6A 3UBKA 3K8NA 3EWLA 2ML5A 2I3YA 5IPGA 4LMWA 3FG4A 4RI7A 1V74A 4RI6A 2B5EA 5J4UA 5IQYA 4XS4A 3KJYA 2XFSA 3LXTA 1Q40B 1W89A 6GSSA 1TW9A 1YKAA 2HRKA 2Z77A 2FLSA 4CDOA 1W01A 4G0IA 4KF9A 1U88A 3WOFB 3JUQA 4IJIA 4FO5A 4BL7B 2KP1A 4MZWA 3FZ4A 1G96A 4LA1A 2LJKA 2VOCA 4TRXA 2I81A 2RIIA 4N6OB 5ECKB 5DQSA 1DMNA 2P38A 3UNLA 3BLZA 12GSA 4F0BA 2L6DA 3S28A 3KMOA 5E4WA 1OHSA 3K0ZA 2IMJA 3EN1B 3F9SA 4RUVA 2R0CA 5G1LA 3DGQA 4TVEA 4CY6A 3LTAA 3TKRA 3R2QA 4WBRD 2PUKC 3WODG 4JZQA 4GSSA 1MDIA 2WS2A 1DMQA 1O6JA 3OV4A 2ES7A 3QAGA 1B9XC 3EMXA 1X5EA 3I0YA 2J23A 2LYXA 3F6FA 2H73A 4X43A 1EOGA 3T0UA 3GIXA 1U8CB 2R5GA 3P7XA 4PUFC 4BVXB 2F86B 3DY5A 3O6TA 1M99A 5CNWA 1FOVA 5DRVA 3X3ZA 3FZ5A 3MSOA 1GSSA 1QFNA 1S3CA 2A2PA 1JZRA 5EY6A 4WFOA 1EOHA 3PH9A 4EVMA 3FCSB 1IVUA 1IYHA 4K0NA 1TI3A 3E0UA 4WWUC 3S67A 1LJRA 2B7JA 2JSZA 3I43A 3NM2A 2JL4A 4BWQA 3TJKA 1XWGA 4EDYA 1X5DA 2TIRA 5ECLB 4IP6A 7GSSA 1JZWA 2AJQB 4ML1A 1JN5B 4L5OA 1B48A 1PL2A 2WGQA 2ON7A 3QAVA 5ECNB 2QIYA 1X9WB 3TKSE 5A4VA 3LZAA 2MMOA 5D81A 1W6GA 4K90B 2GSRA 1KNGA 3PGBA 5EQLA 2UX0A 4ID0A 6GSVA 5KP1A 1IK3A 1OC9B 2WO0A 1NB3I 3IXRA 2M7OA 2DJJA 3LMLA 2F98A 3MHEA 1N9EA 1BQ7A 4D73B 1Q824 4AGSA 4LEHA 1XFLA 2MZCA 2A4HA 2W9QA 4OFMA 4DVCA 3SXXA 3ZVJA 5CLKA 1HNBA 3GL3A 2L5OA 3IC8A 4L7KA 4WF4A 3TRXA 4KB3A 3K5TA 1IU7A 3F63A 3CC73 1S3AA 5HFKA 2GSSA 1JLWA 4ECBA 4HZBB 4HM0B 4FCZA 4WYKA 4X0XA 5INYA 1ZX2A 3KD0A 5I97A 5KN2A 1IT8A 4MJBA 3G713 4WXTA 2PN8A 1SKSB 2OOVA 1WP0A 3IPTA 1PX6A 1QUWA 1SENA 5COHA 4DSSA 3BCKA 3O8YA 4WHAA 4WF5A 2JSYA 5EPFA 2L4VA 3DGNA 4TKYA 2LQQA 2V32A 3EQQB 2OTJ3 3TKSC 1A2JA 3LSZA 4I2TA 3ZREA 4KSOA 2HRNA 4HVNA 2FA4A 2WOFA 2LNSA 3WYWA 3DWVA 4POBA 4JRRA 4XBXA 3DIEA 3C7MA 1WTHA 1JHBA 1YEXA 2GBXB 2OJLA 4H61A 5B6NA 4EV5A 1YQ1A 4LL4B 4WKWA 5KOWA 4Q5FA 4K1UA 1PFPA 5A4UA 4MMZB 2YJHA 1GNWA 3TDGA 3LYKA 2LV3A 3ERWA 1K0AA 1LOXA 1G6WA 4WEYA 3SX1A 2FGXA 2KOKA 2HMKB 1OHOA 2D1WA 4WETA 3R3EA 4AJ8A 4KNDA 4XDWA 3PS8A 2VD1A 3UJMA 2B5XA 5CRHA 3B7CA 2FWFA 1GY5A 4KE3A 1TU7A 3TGZA 2WDUA 3GZBA 1PRXA 2GZYA 4LZIA 2RCDA 5DALA 2OADA 3UMAA 1VQL3 1ZL9A 3JUNA 2CX3A 1UN2A 1TUHA 2JQ5A 3WA2X 3D3LA 4HJLB 2VM2A 2OBKA 2HSMA 4YQMA 1Q7Y4 3GHAA 2W0QA 5G30A 2R3XA 2PNCA 4EDZA 2RLIA 1YIJ3 4JR6A 1KTEA 4JR4A 4KAEA 2X99A 4Z2UA 1TRUA 2CZ3A 3IDVA 4EC6A 3CCR3 2F8FA 2DKHA 5DJLA 1J2BA 4JRFA 11GSA 1LBKA 2E2VA 3L78A 1UW1A 3GKNA 4JEDA 5AIIA 1WOUA 5IMDA 3G4S3 2DJ0A 1XWKA 3NHXA 1J08A 2ZDJA 1ZGNA 5IMFA 2L4CA 3S5CA 1C7HA 1OPYA 3MKIA 3APQA 4RNZA 4MJCA 3F9UA 3I69A 4OO4A 1GSDA 2H1AA 2YV9A 3A2VA 2C1YA 4V1Ap 3Q1CA 3M1GA 3W8JA 3F40A 3DMLA 5KN3A 3PCRA 2OKAA 4AKZA 1EWXA 3LGCA 3OW22 5ELJA 1A8YA 2IJYA 3EE1A 3CSIA 3ZFBA 2OQEA 3LH4A 5EL8A 4K1FA 1E97A 1O8WA 3CU3A 1FOHA 5AYSC 1U3IA 3CCS3 2B7KA 5B8BA 1GUKA 3F4TA 2XHFA 3MDKA 4ZB6A 2H71A 5CAXA 2F3MA 1ZCPA 2B1XB 4TOPA 2P0MA 5EEOA 2P5QA 2GEXA 3QD9A 1VQO3 2HRAA 2H76A 2RM6A 2F9SA 3F4SA 3EVIA 1OC3A 3F4RA 5DCGA 2QGUA 2H0IA 1T3BA 2QSIA 1O7NB 1SK2A 3KE7A 1NSWA 3ME8A 1FAAA 4ML6A 5D9VA 2ML6A 2KXGA 4WR4A 5KOXA 1W6YA 3DGOA 1W6CA 1WIKA 4MPGA 3UL3A 5AIVA 1EEJA 3M9JA 3TKQA 3HVXA 1K9M4 1EP8A 1TK0B 5DQYA 5GAPD 2H0HA 4TXOB 4NPBA 1OC8A 1TKDB 3HCZA 1XZOA 1SJIA 2VL2A 2VD0A 2DMLA 4O5QA 2R6KA 4XBTA 3ZITA 3LTDA 4ZILA 3G7YA 4TR1B 3U1WA 3PYJA 5AYRB 4ISDA 3EBTA 2RFRA 1S723 1XWCA 2NTOA 2KHPA 3Q74A 1OKTA 3IHQA 5JCWA 4TXOA 1KEBA 4I97A 4MJAA 3L9VA 1SPUA 5J5NA 2WB9A 3WGEA 2AV4A 1YJW3 3EU3A 4CDLA 3V98A 5J9CA 4QWTA 1ERWA 1U3AA 3HXSA 3HD5A 3F14A 4FMAA 4Z2RA 2OE0A 1M9GA 4NXIA 3DKSA 4GCIA 3G7JA 3GX8A 3CNXA 1THXA 4K0GA 3LJRA 4OFTA 5JPPA 1NW2A 3PPUA 3KEBA 1FW1A 3IK7A 3ECFA 6STDA 1QAFA 1AXDA 19GSA 2OA7A 3WT2A 1IVXA 2BMOB 4ZL9A 4K7IA 4ECIA 3KIIA 3RGRA 4KCAA 4ZB9A 2PVOC 1V2AA 4OVMA 1WE0A 2XFTA 4K9ZA 4CHSA 1URMA 2GGTA 1B4QA 4E8EA 5D9XA 4ZM8A 5C00A 3TCOA 4EO3A 4OCEA 1GSUA 1EQKA 2REMA 3I9V2 4O8SA 3DMCA 4HEA2 4E8HA 1OF5B 2LNTA 3LEFA 1HNCA 4ZBDA 2HZFA 4XRAA 1OE8A 1K3LA 2DJ1A 5KN1A 1E2YA 1G0TA 1IVWA 4K1VA 5ELUA 3LW9A 4Z2TA 1UUVB 3U5RE 1A0FA 4IELA 3ZIJA 1XW6A 1VF4A 4ZB8A 4ZL8A 1T4ZA 3IRAA 4KH7A 2HMNB 1O7GB 1IVVA 1TP6A 1PN0A 3GFKA 1MDJA 2FWGA 3ZTLA 1O7UA 3NBBA 2CT6A 2G2QA 3D5JA 5IG0A 2WJUA 5ECQB 1Z3EA 1XCCA 1DE2A 3L0RA 2R4VA 4AJ7A 4HQZA 3M9KA 5GAND 4MJEA 3LYPA 6GSUA 3TJJA 1B9YC 3CCU3 4HI7A 2CFDA 2CA8A 4EUYA 3HVVA 1TRSA 2B5YA 2HSYA 5A0OB 1AC1A 3IV4A 4N3VA 3FYGA 3SWLA 3VPQA 1N5PA 4ZXGA 3HIIA 2N5FA 3ER7A 4L8OA 1T4YA 3F7XA 2W9PA 2CV4A 2H66A 3BOAA 5ECSA 1PN9A 1R4CA 2B3SA 2KUCA 4FYCA 3CD63 1XW5A 1XOAA 4HDEA 4MZBA 3HK4A 3P2AA 4BVYB 4WP5A 1V57A 2R37A 4HM7B 3I563 3WD6A 5H5RA 5CK6A 4R1KA 1MDKA 1Q864 4POLA 1XIYA 1OYJA 1GH2A 4KFDA 2WCIA 1UI7A 1XWAA 1JRQA 3LFLA 2VIMA 5J9BA 4K61A 2XGNA 2HI7A 3A3TA 5ID2B 3GZRA 17GSA 4GF0A 4EBGA 5JCGA 2JACA 3FKFA 4O32A 1PQNA 1E3RA 2A15A 3DZLA 5ECRB 2KCDA 4AKYA 1ST9A 2HE3A 2IIYA 2HT9A 3TB2A 4PQ1A 2CK3H 4MH2A 1FGMA 2WRTA 3GKXA 3NUVA 2GTUA 1N5HA 1SYRA 1IT7A 4NAXA 3VWWA 1MNLA 5LC7A 3HZ4A 4F0CA 3F8HA 2CH9A 1T5YA 2PMTA 1M2DA 4L0UA 2GT6A 1YJ93 1MTCA 2P0XA 2HMMB 1LVNA 2L59A 1TRVA 4KSMA 2HZEB 1HU9A 3N54B 2OBIA 3ZYWA 5IMCA 2CIUA 3D6IA 4STDA 1O8XA 2GQMA 2YJ7A 3VWUA 3IPZA 10GSA 3RGAA 3APSA 1EGRA 2GEYA 3ROBA 3J7Yb 2O3OA 3H93A 2Q07A 3FZWA 1CQGA 3EJVA 4O2HA 3VI5A 2C11A 1Q40A 3N9JA 4LSOA 2HZEA 3KKGA 2DJKA 2Y73A 1QVF2 2A4VA 5CRDA 2RSXA 2VL2C 3FK8A 3CME3 2EIRA 2YANA 3KSPA 4BL7A 2LQOA 1G7OA 3TJBA 4YQUA 5ECPB 1NO3A 3X3YA 4MK3A 3BNBA 1SQWA 4O5RA 1WMJA 1W00A 2IMDA 3DXOA 4K2DA 3PGTA 3WOEB 1GS3A 1R5PA 5F0GA 1YF0A 3KN4A 1FVKA 2WULA 3HHVA 2IMFA 3CC23 2MYGA 3H79A 8GSSA 2BMQB 4MF6A 4IIAA 1LXEA 2HRFA 3A5IA 1CEWI 2O9UX 4ECJA 1CYVA 3CPW2 3KSED 1VQM3 3LG6A 1FA3A 8CHOA 1A24A 4EXJA 2XPDA 2CKFB 2PU9C 4BVXA 4V2MA 1VF3A 2VL9A 2HNLA 5CRGA 3PZWA 4HBRA 2WGOA 3AMOB 3G16A 1FGTA 2W03A 2JZTA 4HZ9B 4TR0A 3UVTA 3FR3A 4P3YB 1GY7A 4BTYA 3GYKA 4FH8A 2PPTA 4L5LA 3OXAA 1LNHA 4ZBBA 2CWUA 1TP9A 3ME7A 3LYGA 3BB9A 1X9SB 1Z7PA 4JU5A 4KGIA 4F9ZA 1E3VA 3DM8A 1RQMA 2H75A 3BBYA 3FRCA 3IE3A 4J2FA 1YZXA 1DMMA 4I8BA 3VURA 2Z76A 1X5CA 2AYTA 3HZ8A 1JN5A 4MABA 3GUSA 3DYRA 2BTOT 1K0MA 1GWCA 3IA1A 1LU4A 3EU4A 2ZL8A 5G2GA 1BUQA 1GSQA 2VO4A 2L6CA 1US1A 3IJEB 3U6VA 1OE7A 1OC9A 2HMLB 1WMOA 1VQ73 1MD4A 1ILOA 2GQKA 1OGXA 1NB5I 4D73A 2JZRA 7STDA 1CQHA 4N6LA 1EV9A 2OWPA 3G8ZA 1ZYEA 3DVXA 3VWXA 4AEQA 2TRCP 1Z6MA 3IOSA 4YKFA 1DBYA 4V1Ag 1SD9A 2C80A 6GSWA 4J56E 3MSZA 4ZBAA 1ZYPA 2E2UA 3EF8A 4IN0A 4PQHA 2K8SA 3FMWA 1O81A 3CSJA 3FLJA 2AHEA 4HOJA 4O92A 5LD0A 1N8R4 1J0FA 1EKMA 4FR9A 1A0RP 3TKPA 4HM5B 1O7MB 5JBSA 2VCQA 2C3NA 4OO5A 2YP6A 3S27A 3VFIA 1HQOA 5CYYA 1OHPA 1D6UA 1GRXA 5B8AA 3E9JB 3NM7A 4FCMA 2CVBA 3C8EA 3TOUA 4EE0A 2R4IA 4HM4B 4EF0A 3UARA 1GSFA 4PNFA 1DVCA 5IOXA 2I9WA 2LJAA 3OWSA 4HJMA 4XRDA 3OR5A 4RZMA 2H01A 3ZL5A 4L8EA 2A2RA 1CQSA 4GQFA 5ELGA 3UOMA 2H6ZA 2VM1A 1OH0A 1WJKA 1I9DA 3JUOA 3GRXA 2GDRA 3IHGA 2F99A 3MG3A 3KXOA 1QMAA 1TK5B 5IENA 1YHQ3 3EBYA 1GY6A 3NBRA 3FEUA 2BO9B 2LSTA 3L0HA 4O3VA 2GQLA 3OWUA 4KFEA 5J41A 1QXHA 1ROAA 2YWIA 1AQXA 2XSOB 4IKHA 4LGQA 1B4PA 4EV2A 2XEPA 5IG4A 2NDOA 1L5GB 3QMXA 4IQAA 5D96A 3N9HA 2K6VA 1C72A 5IOWA 3ZIVA 1DVDA 1W4NA 2H6XA 2CHCA 3F8XA 2JDIH 1TI1A 4KVHA 2CQ9A 3HI7A 2DJ3A 1F2EA 2CFKA 4LL1B 3CMIA 2LRCA 5AIHA 5JCUA 2KLXA 1USBA 3QFBC 2VL3A 3UEMA 1XVWA 3BD2A 3KZTA 1F6MC 3GZYB 5EVHA 4OMVA 4XDVA 1HKXA 1K28A 2V41A 2IMKA 5H5QA 5IMAA 2H72A 2ZCTA 1XBSA 2CWTA 4KX4A 2WOHA 3CCM3 1KWIA 1TJDA 3PCSA 5ELAA 2UZ8A 1K3OA 3NXJA 1NJI4 18GSA 2DMMA 2SBLA 3ALAA 2BT3A 2GBWB 4MMYB 4JF8A 1SK1A 4G1MB 2BHMA 1F8NA 1VRSD 4TXVA 3W8SA 1OAZA 2KRTA 1PKWA 3DGMA 2EC4A 1K0BA 4RQXA 3GSTA 1NDOB 2CG0A 4HU9A 2VLUA 5E59A 1GSEA 4ZL7A 1GD3A 3V99A 3MIXA 5D8IA 3TRQA 3CC43 2XR8B 3X42A 4YH2A 3QDNA 3NQZA 3FR6A 4R80A 3X3XA 1TFOA 1TDIA 5DVBA 2V1LA 2TRXA 2XSHB 5L71A 3UAPA 1AUCA 4KFFA 4IQ1A 5ECOB 4PUAA 3D22A 4K8MA 5IW9A 1RJOA 1R7HA 4MZCA 2FCHA 2DIYA 5HGRA 1FHEA 2PBJA 3UVHA 5CO3A 3RHBA 3CRTA 2DIZA 3LTBA 1RW1A 3HX8A 2H1BA 3JCML 2X8CA 4YQVA 4MH3A 5AIFA 3FGYA 2HLSA 2VUPA 4EIPA 3MYDA 3ZMLA 2Z6BA 4YAVA 2QA43 5IPHA 3FR9A 1WRYA 5CF1A 2XBQA 2RGQA 20GSA 4G10A 3KCMA 4PQIA 4EYCA 16GSA 5CREA 1H4OA 4GSTA 4J57E 1WMNA 2ALBA 1DSBA 1D6ZA 1PD21 3KMNA 1JZOA 1T7PB 3VF1A 1F37A 3I6AA 3TJGA 14GSA 1KQS2 3GH9A 2GT5A 5JPUA 3MPHA 2N5BA 1SL1B 4HM8B 4IP1A 4FIWA 1KSIA 1YIT3 2Z9SA 2INXA 4HZ4A 2P0GA 4TR1A 2LJRA 2DLXA 3LXUX 2K9FA 3TOTA 2QEX3 3MWHA 2XRXB 1T8EB 3G9BA 3M8NA 3FG3A 1K0NA 1GLPA 2IA7A 1WQLB 1JFUA 2VCXA 5DBQA 4X1UA 3GL5A 3GKKA 5D83A 5IMVA 1PU4A 4ILFA 1EV4A 4DSQA 1BX9A 5BXQA 2GVPA 3IK9A 3UIWA 3F8UA 1GL8A 1ZYNA 3DVWA 4IT7A 2YZHA 3IR4A 3KH7A 3L9SA 5ABRA 5LNKe 1IQXA 3NQYA 1GUHA 3KTLA 5G2ZA 2QA1A 2C10A 2CFGA 1STFI 3LOYA 1FB0A 2CG1A 4F82A 4X2OA 2MMNA 1M2AA 1YEPA 1W2B2 4AF2A 5IEOA 2OE1A 1ZZYA 5JWQB 2QA2A 1BAYA 1M9BA 3Q6OA 1HD2A 4POKA 5IM9A 3U97A 3NV0B 4XHMA 2M46A 3SBCA 2H74A 1YDKA 2EIQA 3D9RA 5AGYA 2F8AA 1OF5A 2IMIA 5IMZA 3BNEA 3GTUB 1W5ZA 4KZ1A 1SIIA 2YPMA 2H30A 3RDWA 4TR4A 3FZ9A 4PGTA 3EN8A 3EURA 3EC3A 3V1WA 1VQP3 1Y6EA 4K7OA 3CTFA 1GSYA 1V58A 3NV0A 4WR5A 5AI1A 2K0MA 1IQYA 3VI7A 3DXBA 2FWHA 1V9WA 1UUWB 1ZMAA 2MMAA 1PGTA 1MD3A 1Z7RA 1G7EA 2FXTA 1JLVA 4Q5QA 1O7PB 1S3DA 5GSSA 5IG3A 3BNDA 3BNCA 1IV9A 4XB5A 1VQ53 3CYNA 4GQCA 2C0FA 3KP9A 5FGOA 1TRWA 1IQ8A 1GTAA 4KDYA 2DJ2A 4MJDA 4YAPA 1WWJA 2H19A 2DC5A 2C4JA 2P05A 3Q2PA 2YWOA 1RKYA 2PVQA 5C04A 5IG5A 4FYBA 5JWRB 5GZZB 3FSDA 5DAKB 4XM4A 1STDA 2I1UA 5HR0A 5KN0A 2HFDA 1QALA 2IFQB 1Y25A 1WPIA 3ZFLA 4BVYA 1RN7A 4KUNA 4MCUA 5F07A 3EINA 5AN1A 2B6MA 3FKAA 2NVLA 2YX9A 3Q90A 2E0QA 1QK8A 1KC84 2FUG2 5B6MA 1JV2B 1O7WB 1TU5A 1RRLA 2W6JH 4I2UA 4FMBA 4TR3A 2JZSA 5DAKA 5STDA 4F2IA 2GLRA 2CVKA 4MA9A 2O8VB 5ECHB 2CAIA 5F05A 1VQ63 1FUWA 4IGJA 5ID2A 5LC6A 5HR3A 5KP4A 1XW9A 3F0IA 3JUMA 4G0LA 3QOUA 4KCEA 3DRNA 5ENUA 3AY8A 1ERVA 1KBNA 4XS4B 4EXRA 4PEJA 2YWMA 3FHKA 3NIVA 1K0CA 2MBSA 3MYTA 1KD14 5AEUB 2CFLA 4L8PA 3V92A 1Z6NA 4OUQA 1UVZA 3C1RA 1OKDA 3ZZXA 4NV5A 2RUFA 5KEJA 2YFIB 1TTZA 2CVDA 1A8LA 3C1SA 5IO0A 1AIUA 2IUKA 1SJZA 1A90A 1T1VA 4EC0A 1HNAA 4J9AA 5D73A 1JKGB 3OX9A 4Z7XA 3IBHA 3GH6A 1EGOA 1JB2A 4G0KA 3EC9A 2C3QA 2H0GA 4G19A 3VWVA 5TGNA 3GURA 2R2JA 3CCJ3 3DD3A 5FWGA 2M80A 2DSAA 2O7KA 1SL2B 2C8UA 1JB4A 2GS3A 2O85A 3BJ5A 1GTBA 2O89A 4V2LA 3T8NA 2YZUA 3L9UA 3RAZA 1FVJA 2C0EA 1JKGA 1QVG2 3H4KA 4KDXA 4YKGA 5HFGA 3K7CA 2ZUPA