3TDGA

Structural and functional characterization of helicobacter pylori dsbg
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
232
structure length
232
Chain Sequence
QDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTKVENTTKKIFESGVIKGVPFLYHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title Structural and functional characterization of Helicobacter pylori DsbG
pubmed doi rcsb
source organism Helicobacter pylori
total genus 77
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18257 DsbG_N Disulfide isomerase DsbG N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.520 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3tdgA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tdgA02
4WEYA 2PMTA 3UIWA 2L57A 1PL1A 1U3AA 4WETA 1G7OA 5J5NA 1SYRA 5CRHA 4O92A 4EXJA 1XXUA 1XFLA 2H30A 4N11A 3KH9A 3IA1A 1Q98A 1OKDA 1K0OA 1E6BA 2OBIA 4L5LA 2O87A 3LJRA 2OKAA 1A24A 3DKSA 2CV4A 4G2EA 2LSTA 2P5QA 1GTBA 1A2MA 1SKSB 2NPBA 3F63A 1TI1A 3EINA 3GH6A 1EOHA 3GUSA 1TK8B 3HVVA 3LORA 1M2AA 2NVLA 2RLIA 2H0HA 4GQCA 5J3RA 3KZQA 5ID2A 2LNTA 2H1GA 4MZBA 4YQMA 2JSZA 4JEDA 3HCZA 1XWKA 2YV7A 4E8HA 1LBKA 4L0WA 2YNXA 4HZ4A 1XWBA 1EGOA 2CZ3A 2KOKA 1OKTA 1X5CA 1AUCA 5LCZA 3IV4A 3KMNA 3HD5A 4NV2A 4FIWA 1E2YA 2HSHA 5IO0A 5GSSA 1G0TA 1NW2A 4AF2A 4ZBDA 5HFGA 5AGYA 2YWNA 2PUKC 5A4WA 1NM3A 5DQYA 2PU9C 2KUCA 4GSNA 3IHQA 2HNLA 4BWSA 2PVOC 4ID0A 1K0BA 2ES7A 1JLVA 1TRVA 3CMIA 1MEKA 4OWYA 4DSSA 1URMA 4KAEA 2NDOA 2GDRA 1R26A 3VURA 4AJ7A 1AIUA 1FO5A 2A2RA 3HDCA 1JZWA 2TRCP 3KP9A 2H1BA 1AXDA 4P3YB 3BCKA 3PH9A 2PVQA 4IQ1A 3D5JA 1TK5B 2B5YA 3ZIVA 1HD2A 1U88A 2VAFA 3FYGA 4GSSA 4EC0A 3TJBA 3A3TA 4TR3A 2H1DA 4IS0A 1V98A 3EWLA 3MWHA 4X0XA 2L6DA 1VF2A 1ZMAA 5KN3A 5AISA 2GZYA 1WMJA 2FWEA 2LRNA 1HNAA 10GSA 2LQOA 4TKYA 5DCGA 4G9HA 4XS4A 20GSA 5A5KA 3DEXA 1K3LA 3GN3A 5IO2A 2R4VA 2RM5A 3FW2A 2RUFA 3TB2A 3QD9A 2VCQA 4MJEA 2AV4A 3ZFLA 1M9AA 3HZ8A 1OAZA 3TJFA 2O89A 3E3EA 2DLXA 12GSA 2LTKA 4WF5A 1LJRA 5IOXA 1SD8A 4V1Ag 4I97A 4MP4A 1TJDA 2VIMA 1S3DA 4NHWA 2L6CA 3KP8A 3KMOA 4BPYA 4YAVA 5F8BA 2IN3A 1KTEA 2LRTA 5IMDA 4F2IA 5H5SA 4HU7A 5CAXA 1ERWA 2VM2A 1SK1A 4QQ7A 4F0CA 1THXA 4CHSA 1YQ1A 3D0ZA 2JACA 1W89A 5ECRB 3I9V2 3AY8A 2PGTA 2OBKA 1QK8A 3L9SA 3CRUA 1N2AA 1FOVA 2XHFA 3BD2A 5GZZB 1XZOA 5DALA 4ECCA 1O6JA 4F03A 2JZRA 1G7EA 4MF7A 3GKKA 1W4VA 1F3AA 4J57E 4IW9A 3O3TA 4PUFC 1AC1A 4GF0A 3TKRA 3U5RE 1EV4A 2L5OA 2P0GA 1R7HA 1PA3A 2OJLA 2AYTA 6GSWA 2GLRA 3SWLA 2X8GA 5EL8A 1ST9A 1F37A 1JLWA 4MF6A 1TXXA 2WB9A 4ECJA 3ZVJD 2XPEA 3IDVA 5DVBA 1M9BA 1TTZA 4QL9A 2C8UA 2DJ0A 2WULA 1NHYA 1XWCA 3E0UA 5HFKA 4PQIA 2HSYA 3ZMLA 2LRCA 3R2QA 4MZCA 4TR1B 4XS4B 3QOUA 1V9WA 4F82A 1K0DA 2FGXA 1YEPA 2IMFA 2YJ7A 1Y6EA 1JFUA 3DXBA 4OCFA 4JBBA 2O8VB 4XS1A 2JL4A 3W6GA 3L0HA 2XPDA 1SKRB 1TW9A 1T7PB 2GSQA 1JHBA 1DBYA 5CRDA 1I9DA 4JU5A 1AW9A 3GX0A 1IYIA 5JWQB 5HFIA 1T1VA 3M0FA 1A2JA 1ACVA 4TXOA 2H72A 3UBKA 4HJMA 3G7YA 3UAPA 2L5LA 1R5AA 2FY6A 1SJIA 1AQWA 3P8WA 2FWHA 3CXGA 2DIZA 1C72A 3M8NA 4F9ZA 2K9FA 3QDNA 1X5DA 3HJPA 3VI5A 2FA8A 3TKSC 1ZZYA 14GSA 4KW6A 2REMA 4KB3A 3IAM2 1YEXA 4EL1A 2KP2A 3D21A 3IXRA 3QAGA 4PURA 4I5QA 1O7UA 1SJ6A 1WRYA 3DGQA 1BX9A 2X64A 2MMAA 4XHMA 2BMXA 3EU4A 2CZ2A 1EEMA 3TRPA 3TKSE 4I8BA 3FEUA 5FWGA 2IIYA 1ERVA 3TRQA 3A2VA 1J9BA 1MD4A 4V2NA 2I9HA 5IMZA 3ZL5A 3FR6A 4NWYA 1BG5A 3GNJA 2VCTA 2R37A 2XC2A 5IMCA 1SENA 2B3SA 2J9HA 3ZIJA 3BCIA 3UOMA 1B9XC 3NZNA 1GUHA 3P2AA 5CNWA 4PNFA 5G30A 2G2QA 1B9YC 1YKCA 1PX7A 4ECBA 2GZZA 3UEMA 2HE3A 2HZEA 4PNGA 2CX4A 1PKZA 1Z3EA 2H6XA 2YJHA 1PL2A 4WR4A 3TCOA 5F07A 4GCIA 4MH2A 1JZDA 3F8UA 1VGLA 2VLTA 3VWXA 2VL9A 5ECKB 3GURA 3Q74A 3FZAA 2B1LA 2F3MA 3GYKA 1RQMA 2KHPA 1TU8A 1ZL9A 1ZCPA 1HQOA 2LS5A 3US3A 6GSYA 4TXOB 1BEDA 1BJXA 1PKWA 3A2WA 3OR5A 13GSA 2VLUA 2WDUA 3DMLA 1F2EA 1F9MA 2MYGA 4K7IA 1GSQA 2YWMA 4IVFA 2PPTA 4PUAA 2V41A 1X5EA 1WWJA 4HI7A 5GAPD 1GWCA 4DSRA 4RQXA 5AN1A 4MH3A 4MLYA 5HR0A 2C0DA 1T00A 4POBA 1Z6NA 4KDYA 5ECPB 4WKWA 1PD21 3RDWA 4N0ZA 4MPFA 2N5BA 4PQHA 4IBPA 4HQSA 2X8CA 4PXOA 3ERFA 2DMMA 4K9ZA 2YZHA 3G9BA 5IMAA 1IYHA 4POKA 4RQRA 2EIOA 1YY7A 3F6FA 4KX4A 2D2ZA 1QGVA 1A2LA 1SJZA 3RPPA 2G0FA 1VF4A 4YQVA 4PGTA 3M9JA 1THOA 1S3CA 2LNSA 4IJ3A 3DRNA 5A4VA 1OYJA 5KN1A 4DVCA 3KD0A 4ZB6A 3O76A 3D22A 1XVQA 1HNCA 3ERWA 3IK7A 2H1AA 5C04A 4Q5RA 4JE1A 2DSAA 4YH2A 4GTUA 5EPFA 3DVXA 2IMKA 2VCZA 3H4KA 1FAAA 4V1Ap 3GHAA 4K2DA 2CVKA 2ZUPA 5IM9A 2H8LA 1GL8A 2MMZA 2GQKA 5GAND 2YWOA 3WD6A 3EC3A 3GV1A 3KH7A 5HR2A 3APSA 2H73A 5D8IA 5ECLB 5AIVA 1NHOA 1XW5A 3WT1A 4NPBA 3GMFA 1GNWA 1YDKA 4POMA 4MK3A 1WP0A 3RHCA 1O8WA 3F0IA 1SK0A 3C71A 1J0FA 1T3BA 2L59A 3ZYWA 4ZL9A 4NMUA 2PWJA 3K8NA 1GSYA 1R4WA 1GLPA 4LL4B 2GQMA 2F8FA 5L71A 1HNBA 3QFBC 5G1KA 1SYXA 4FYCA 5H5RA 3JCML 4XRDA 2LJAA 5IOWA 1KBNA 3WYWA 1B4PA 2QC7A 2PN8A 3FZ4A 1FW1A 4ECIA 1GNEA 4GXZA 3F9UA 1XW9A 5EVOA 3Q19A 3G7JA 3RHBA 4D73A 4LMWA 2O85A 2FLSA 2M46A 3WGDA 5IQYA 5B8BA 2AUVA 1T8EB 3VI7A 3HKRA 3GA4A 4BL7A 1M99A 1MD3A 3KCMA 3VWUA 2MZCA 1Z7PA 2FA4A 1K0NA 2QKEA 3FZ9A 4N0VA 2WGRA 3FHKA 3RPNA 1X9WB 4TN8A 2E2MA 4ISDA 1GSFA 2JZSA 4LLRA 3M9KA 4K7OA 2HLSA 3UVTA 1SKWB 4QL7A 1XPVA 3HVSA 3ISOA 1K0AA 2F51A 1V58A 1ABAA 2O7KA 1GTIA 3DVWA 3J7Yk 5ID2B 1O8XA 3C1RA 3GTUA 5CRGA 3HJOA 3Q6OA 2YZUA 5E59A 1QMVA 1EWXA 5J4UA 2P5RA 4XIHA 4ZB8A 1AQVA 1ZGNA 3HY2A 1XVWA 4TXVA 2C1YA 1AAZA 1A0FA 4IN0A 2GS3A 1LU4A 5ELAA 4ML6A 4MJCA 1XOBA 2DJKA 2AB6A 2NBSA 1TRSA 3J7Yb 1JZRA 1FHEA 2B7JA 1RK4A 2BJXA 4DSQA 3GFKA 4MA9A 2N5FA 4WR5A 3UMAA 5COHA 3F3RA 5G5FA 3CSIA 4DSSB 4GWRA 4K7NA 2Z9SA 5J9BA 5IPHA 4EO3A 2V32A 4ILFA 2WRTA 5HR3A 3LQ7A 1G6WA 2WJUA 5E4WA 3EE2A 1Z6MA 3DIEA 3D4MA 3NIVA 1ML6A 3PGTA 3FR3A 4MCUA 4D73B 2H76A 4X43A 5ELGA 3EU3A 5ECHB 2M72A 4KA0A 5ECIB 2AAWA 1PN9A 3FK8A 2K6VA 5DDLA 3GRXA 4HZ2A 1YF0A 5CRWA 3IR4A 16GSA 3EMPA 5LNKe 2IJYA 2ON7A 1GLQA 1WE0A 6GSUA 3TJGA 17GSA 2TRXA 1GUMA 3ZTLA 3TKQA 2VL2A 1ILOA 8GSSA 3LYKA 4Q5NA 1GP1A 2H01A 1XW6A 4EDYA 2QGVA 2JSYA 2QSIA 2R6KA 4RI6A 3QR6A 3G7IA 2AJQB 3QAVA 5ECQB 1PMTA 6GSXA 19GSA 2H74A 4POLA 2V6OA 4KNDA 5C00A 3APOA 5D9TA 4JRRA 3GTUB 2LQQA 4AJ8A 3CTFA 3FZ5A 2MMOA 4IELA 1PGTA 4TVEA 2VLVA 5ENUA 2H6ZA 1B8XA 4ZL7A 1USBA 1CQGA 2L4QA 3GIXA 2HRFA 3FY7A 5F05A 4DEJA 2IPAA 5G2ZA 2J23A 2JZTA 4EDZA 3GL5A 2PBJA 4BVXA 1H75A 3ED3A 1T4ZA 4KSMA 4ZL8A 2DJ3A 5DALB 3W8SA 5DAKA 4IP6A 3TUEA 5DQSA 5G5EA 2YANA 3TKPA 4HU9A 11GSA 1R5PA 3LWAA 3V1WA 2KLXA 3LXZA 3H1NA 3M3MA 3O6TA 3L4NA 1K3OA 2KP1A 2NTOA 4HS1A 3TDGA 2GVPA 2YV9A 1DSBA 1T4YA 4OD7A 3QPMA 2V6KA 2C4JA 2IMIA 4FO5A 2FWFA 4ULXA 2B5EA 5INYA 1RW1A 1TP9A 4I2UA 4MF5A 2XBQA 1EP7A 3PINA 3EMXA 2E7PA 2GSSA 1TU7A 3HXSA 2VOCA 4V2LA 1UVZA 2HT9A 5JCWA 3TJKA 1TRUA 3ZZXA 4PX1A 2R2JA 1ERUA 1UN2A 5KN0A 1XBSA 1A8YA 5IMVA 1ZOFA 1YZXA 5JCUA 4TR0A 1EGRA 4GQFA 2JADA 4YQUA 2IMEA 1F3BA 2YP6A 1MDJA 5CYYA 5CREA 3WT2A 1SL2B 2H19A 4KDXA 2CAQA 4WXTA 1BAYA 2HXKA 3Q18A 2WS2A 1BQ7A 2HRNA 4JR6A 1GUKA 3UBLA 1M7TA 2CAIA 5J41A 4Q5FA 4HDEA 3IAS2 2VD0A 3IE3A 2N5AA 6GSVA 4BA7A 5FHIA 1TKDB 3F4TA 4HJ2A 2DJ2A 5HQPA 1EOGA 2B6MA 3RBTA 9GSSA 4KH7A 1Q4JA 3C8EA 3GSTA 2IFQA 1EP8A 2GZPA 4IJIA 3FRCA 4IP1A 6GSTA 1N8JA 4ZB9A 3CSHA 2C0GA 2HFDA 1K0MA 2FNOA 2C3TA 2WZ9A 4H86A 4LA1A 5D96A 2DJ1A 3I6AA 4OFMA 1A23A 1GSDA 5F0GA 1OE8A 4N10A 1AQXA 2FHEA 3DD3A 3SBCA 4IQAA 1XIYA 4ZIJA 3L9UA 1GSSA 2FWGA 3ZREA 1SU9A 5D9XA 4IHUA 3A2XA 4HOJA 4TRXA 3CRTA 2MMNA 3S9FA 1M2DA 5D9WA 2I3YA 4ACSA 4EE0A 4OO4A 3F4SA 4K0NA 3GL3A 3HZ4A 4L8EA 1O85A 3WGEA 1FB0A 2HZEB 2C3QA 2H71A 3W8JA 3C73A 1V57A 2RM6A 3KM6A 3LEFA 3M1GA 2FCHA 1SL0B 1WOUA 4G19A 4XS6A 4GSTA 2CVBA 3LG6A 2FD3A 1EEJA 1A8LA 3BOAA 3IC4A 2B7KA 5DJLA 4K6XA 3BBYA 3DWVA 4BWQA 4XRAA 3P90A 7GSSA 2X8HA 3D6IA 1TI3A 3LXTA 1ERTA 2AHEA 1GSEA 2VO4A 3CSJA 4KE3A 3GH9A 4V2MA 3EYTA 2P31A 3IRAA 1GULA 1XCCA 4FYBA 2RIIA 3FR9A 4ZBBA 4JR4A 1XWAA 2GGTA 3HVXA 1PQNA 3N5OA 5F06A 5FT3A 1S3AA 5JCGA 3F6DA 1QQ2A 1OC9A 2DMLA 4ZILA 3HA9A 3ZITA 3GKNA 3CTGA 3VWVA 2IFQB 3F4RA 4KUNA 3LGCA 1M2BA 1PX6A 1JZOA 2CX3A 5ABRA 3LFLA 2YPMA 4KCEA 1DE2A 4ML1A 1FB6A 2V2GA 4MZWA 3HYPA 2H75A 3E9JB 3FKFA 1CQHA 4PQ1A 2YWIA 1GTUA 3PR8A 1V40A 1YJ6A 3ZFBA 4JZQA 3H8QA 1MTCA 2RUEA 1QFNA 1MDIA 2VCWA 3KIJA 2OE1A 3H79A 4AJ6A 2K8SA 4NXIA 1OE7A 4IGJA 1I5GA 5EY6A 5D73A 4G10A 2H66A 2LJKA 4MPGA 4MMMA 5DCHA 3RAZA 2GT6A 2R5GA 3VLNA 3KTLA 2OE0A 3LSZA 2DBCA 4KSOA 2VD1A 4TR1A 4NAXA 1O81A 5B8AA 4ZBAA 1OC8A 2HI7A 2ZNMA 4KGIA 3C1SA 2C0FA 3A5WA 4K8MA 5JWOB 1TK0B 2CT6A 3L9VA 2GT5A 5DBQA 5A4UA 3KXOA 4WBRD 1B4QA 2E2GA 5ECMB 2B5XA 1QXHA 1PRXA 4K1FA 5H5QA 5J9CA 1TDIA 3MDKA 2LEGA 4MJBA 3I69A 2R3XA 3QFAC 3APQA 5GSTA 1U6TA 1U3IA 2OACA 4GRFA 4KCAA 3WGXA 3TKSA 1ZYEA 3MNGA 2OA7A 1M0UA 4MABA 2LJRA 5B7CA 1YKAA 1OC9B 4N30A 4RUVA 2K18A 4MDCA 3D4TA 2B1KA 1TRWA 2YN1A 3QAWA 3CBUA 4TR4A 1HYUA 5KEJA 2LUSA 4XTSA 3HHVA 3ERGA 1DE1A 2GTUA 1PSQA 1FVKA 3U6VA 4FYUA 4EKZA 2IWTA 3ZVJA 1Z5YE 4TOPA 5D93A 2VCXA 1EZKA 3N9JA 2IL3A 1VF1A 1X9MB 1B48A 4O5RA 3VK9A 1Z9HA 3VPTA 4WF4A 5IPGA 2H0GA 1X9SB 3UARA 1F6MC 2DC5A 4OFTA 1G6YA 1H4OA 2XBIA 3CYNA 2CVDA 3TJJA 4EVMA 5ECNB 2DJJA 3ZLPA 1FG4A 1KNGA 5G1LA 3VPQA 3KJYA 5ECSA 3NOFA 4O7HA 1A0RP 5ECOB 4OCEA 4OO5A 1KEBA 1BYEA 2YCDA 5CO3A 3GX8A 3I43A 22GSA 2A4VA 1WPIA 1WIKA 3VFIA 1Z7RA 1EV9A 2E0QA 2OADA 4HQZA 2WFCA 3P7XA 2VM1A 5IIZA 1SD9A 3UJ1A 3QMXA 2VCVA 4WBJA 1TOFA 18GSA 1V2AA 5B6NA 2H6YA 3GKMA 3VWWA 5JWRB 3QCPA 2MBTA 2C80A 3IBHA 3C7MA 2CA8A 3UVHA 4E8EA 4I2TA 4LMVA 1O73A 4K0GA 1GH2A 1ON4A 3BJ5A 3MAKA 3ZRDA 2C0EA 4I6XA 2K8VA 3IOSA 1OC3A 2A2SA 2C3NA 3TGZA 1VRSD 3ZMKA 1OVNA 2EC4A 3MSZA 4L0UA 1VF3A 5D9VA 4CW9A 2M80A 4CDOA 2EIQA 4AGSA 3KEBA 3EVIA 2L4CA 2H70A 3HJMA 1QUWA 2X99A 4IKHA 3H93A 5G31A 2OE3A 2ZCTA 1X0RA 4KDUA 3F3QA 4RI7A 4YAPA 1K0CA 1XWGA 2HZFA 2MBSA 1K3YA 2CQ9A 2JU5A 4Z7XA 1UA5A 5AIXA 3TRXA 1SK2A 4X1UA 2WCIA 1ZYQB 1U87A 2HYXA 1YF1A 4NV5A 4XCSA 2TIRA 2F8AA 2IMDA 4NHZA 4LL1B 4OFNA 2DIYA 5IMFA 1GSUA 3ME8A 5DJMA 2I81A 3EURA 4EF0A 3LYPA 3UL3A 2F9SA 5HR1A 3TOTA 1FVJA 5CP1A 2YOIA 4GLTA 2VL2C 4O32A 2I4AA 3GKXA 4BVYA 1UC7A 2EIRA 3GSSA 4HEA2 3L78A 3TOUA 5KN2A 3DYRA 1NSWA 2LKUA 2ON5A 2VL3A 4TW5A 2PERA 1MDKA 4FH8A 3KTBA 4F0BA 1XOAA 1GRXA 4J56E 4EUYA 1SL1B 2GSRA 2I1UA 4J2FA 1Y25A 2GSTA 2LV3A 2V1MA 2VUPA 4MJAA 2FUG2 2GQLA 6GSSA 3IK9A 3IPZA 4Q5QA 2BTOT 4L5OA 5B6MA 4HUAA 3KGKA 4OMVA 5DAKB 2H0IA 1GTAA 1WJKA 4ZXGA 1J08A 5LD0A 1DUGA 2ALBA 3ME7A
chains in the Genus database with same CATH superfamily
1SARA 4WEYA 1MWRA 2F86B 4HM5B 1OF5B 2PMTA 3UIWA 2L57A 5D82A 1PL1A 1M1K4 1U3AA 4WETA 1G7OA 4H3UA 5J5NA 2HMNB 1SYRA 5CRHA 4O92A 1M3JA 4EXJA 1RTUA 3FSDA 1XXUA 4DKIA 1XFLA 3EF8A 5M19A 1STFI 2H30A 4N11A 3KH9A 3IA1A 1Q98A 1OKDA 1K0OA 3AMOB 4G0LA 1E6BA 2OBIA 2GEXA 4L5LA 2CX1A 2O87A 3LJRA 1UDII 2OKAA 1A24A 3DUKA 5IG0A 1FUWA 3DKSA 2CV4A 2XFTA 4G2EA 3H51A 1NU3A 2LSTA 2P5QA 2ML5A 2BIRA 1GTBA 3PGBA 3B8LA 1A2MA 1SKSB 2NPBA 3F63A 4X2OA 3GZYB 1TRQA 1W6YA 1TI1A 4RBNA 3EINA 3GH6A 2OOVC 1EOHA 2Z76A 3GUSA 1TK8B 1YJN3 3HVVA 5KOWA 3LORA 3MSOA 1M2AA 2NVLA 2CWUA 4BVYB 2YFJB 2RLIA 2H0HA 4U13A 4GQCA 2BMQB 5J3RA 3KZQA 1RGHA 2RCDA 5ID2A 3A5IA 2LNTA 2H1GA 4MZBA 4YQMA 1AVLA 2JSZA 4JEDA 2PNCA 3X41A 3HCZA 3GRDA 1XWKA 2YV7A 4E8HA 1LBKA 4L0WA 2YNXA 1TFOA 4HZ4A 1XWBA 1EGOA 1DMNA 2CZ3A 2RFRA 2KOKA 1OKTA 1JKGA 2WGQA 1AUCA 1X5CA 5LCZA 3IV4A 3KMNA 3Q90A 3HD5A 1ZS7A 4NV2A 4FIWA 1E2YA 2HSHA 5IO0A 5GSSA 3JUNA 1G0TA 3CCE3 3V92A 1NW2A 4AF2A 3KSED 3LOYA 3SXXA 4ZBDA 5HFGA 5AGYA 2YWNA 1BVIA 3CCV3 3MG2A 2PUKC 5A4WA 1NM3A 3DH2A 7STDA 5DQYA 1B2SA 2PU9C 2HRKA 2KUCA 4GSNA 5IW9A 1HYFA 3IHQA 5FGOA 1HKXA 1X1WA 2P0XA 2HNLA 4BWSA 4BIKA 2PVOC 4ID0A 2L4VA 1B3SA 1K0BA 2ES7A 1JLVA 1TRVA 1R4YA 4K2XA 3CMIA 5M18A 1MEKA 4OWYA 4DSSA 1URMA 3CCS3 2K54A 2NDOA 2GDRA 4KAEA 1R26A 3VURA 4AJ7A 1AIUA 1BSAA 1FO5A 1VQ73 2A2RA 4XM4A 6GSPA 3HDCA 1JZWA 2TRCP 3KP9A 2CWTA 5CF1A 2H1BA 1AXDA 1UI7A 4P3YB 3BCKA 3PH9A 2PVQA 3MG3A 4IQ1A 3D5JA 1TK5B 2B5YA 3ZIVA 3Q3FA 1HD2A 1U88A 2VAFA 3FYGA 4GSSA 4EC0A 1X1XA 3TJBA 4L8OA 3A3TA 3OWYA 2OQEC 4TR3A 2H1DA 4IS0A 1V98A 3EWLA 4N3VA 3JVCA 4O5QA 3MWHA 4X0XA 4NREA 2L6DA 1VF2A 3G8ZA 1ZMAA 5KN3A 3BLZA 5AISA 2GZYA 3FH1A 1WMJA 1KQS2 2FWEA 1PYLA 2LRNA 3NBJA 3O8YA 3GWRA 4G0IA 2XFSA 3EN1B 1HNAA 1IV9A 2CIUA 10GSA 2LQOA 4TKYA 2QA2A 4G9HA 4XS4A 20GSA 5DCGA 5A5KA 3DEXA 1JB2A 1K3LA 3GN3A 5IO2A 2R4VA 2RM5A 3FW2A 2R41A 4LMIA 2RUFA 1QVF2 3N9HA 3TB2A 3QD9A 1SQWA 2VCQA 4FCJA 2A2PA 2FNQA 3IHGA 2AV4A 4MJEA 3NM7A 1E3VA 3ZFLA 3BNBA 3B4OA 1M9AA 3HZ8A 3EBYA 1OAZA 1LQMB 1Y4KA 3TJFA 2O89A 3E3EA 2DLXA 12GSA 3EHCA 2LTKA 4WF5A 1LJRA 3FG4A 5IOXA 4HM6B 4BIRA 1OHOA 1SD8A 2ML6A 4V1Ag 1BRGA 4I97A 6STDA 4MP4A 1TJDA 2VIMA 1S3DA 2R4IA 1O7PB 1YVSA 3OW22 1PU4A 4NHWA 2L6CA 3KP8A 3KMOA 4N6MA 4BPYA 3MPHA 4YAVA 1JKGB 2FGTA 5F8BA 2IN3A 1KTEA 2LRTA 5IMDA 4F2IA 1A2KA 5H5SA 3X3ZA 4HU7A 5CAXA 2YFIB 2MC8A 1BRHA 4HM1B 1TP6A 3CD63 1ERWA 3I0YA 2VM2A 4N6NB 1OPYA 1TTOA 1SK1A 4QQ7A 4F0CA 1IVWA 1THXA 4CHSA 1YQ1A 5CF2A 3D0ZA 1IYYA 2JACA 1W89A 4HM2B 5ECRB 4K90B 3I9V2 3AY8A 2PGTA 1N5PA 2OBKA 1IQXA 1PFOA 1QK8A 4BTYA 3EPTA 3L9SA 3LXUX 3BNCA 3CRUA 1N2AA 1FOVA 2XHFA 3BD2A 5GZZB 1XZOA 5DALA 4ECCA 1O6JA 4F03A 1DE3A 5JPPA 2JZRA 4GSPA 1JV2B 3DGOA 3GKKA 4MF7A 1W4VA 1G7EA 1F3AA 4J57E 4IW9A 5KP4A 3O3TA 4PUFC 1AC1A 4GF0A 3TKRA 1E3RA 3U5RE 1EV4A 2L5OA 2P0GA 1R7HA 1RSNA 1LOXA 3PCSA 4HOHA 1PA3A 2OTL3 3KE7A 2OJLA 2F56A 2AYTA 6GSWA 3G6E3 2GLRA 3WA2X 3SWLA 1LOWA 2X8GA 5EL8A 4KVHA 3DGMA 1ST9A 2CC3A 1F37A 3BNEA 5JPUA 2E2VA 1JLWA 3DGYA 4MF6A 1TXXA 5AIFA 2WB9A 4ECJA 3ZVJD 5I97A 5ELJA 1STDA 2XPEA 1VQ63 3IDVA 5DVBA 1M9BA 1YI23 1TTZA 4QL9A 5LC6A 3IC8A 2C8UA 2DJ0A 2WULA 1NHYA 1XWCA 3E0UA 5HFKA 3N8BA 4PQIA 2IUKA 2HSYA 3ZMLA 2LRCA 3R2QA 4MZCA 4TR1B 4K61A 3SOYA 4XS4B 3Q1CA 4FQUA 1RNTA 3QOUA 1V9WA 4F82A 4N6LA 1K0DA 5BIRA 2FGXA 3F9SA 1YEPA 2IMFA 2YJ7A 1Y6EA 1JFUA 1K41A 3DXBA 4OCFA 4JBBA 2O8VB 4XS1A 2JL4A 2W0QA 4CY6A 3W6GA 4HSCX 3L0HA 2XPDA 3MYDA 3M8CA 1SKRB 1TW9A 3F40A 1T7PB 3WR2A 3AHSA 1K28A 2GSQA 5EVHA 4EYCA 1BIRA 1KWIA 1DVCA 1RGFA 3CCR3 2C11A 1JHBA 1DBYA 5CRDA 1I9DA 4JU5A 1AW9A 3GX0A 3EJVA 3NXJA 1IYIA 5JWQB 2INXA 4FCMA 5HFIA 1T1VA 3HK4A 3SOAA 3MIXA 3M0FA 1A2JA 1ACVA 4TXOA 2H72A 4MNNA 1RN7A 4WYKB 3UBKA 3UJMA 4HJMA 3G7YA 3UAPA 2L5LA 1R5AA 1OACA 2FY6A 1SJIA 1AQWA 3P8WA 1DETA 2FWHA 3CXGA 3CU3A 3MKIA 2DIZA 1C72A 3M8NA 1VQO3 4F9ZA 2K9FA 3QDNA 1X5DA 3HJPA 3VI5A 2FA8A 2UZ8A 3TKSC 4HJLB 1ZZYA 14GSA 2O9UX 4KW6A 2REMA 4KB3A 5AIGA 1VQ43 1KC84 1LOYA 3IAM2 1YEXA 1GS3A 4EL1A 5CK6A 1ZO2A 3LH4A 2KP2A 3D21A 1RGKA 3IXRA 3QAGA 4PURA 4I5QA 1O7UA 4IPBA 4ZM8A 4XBYA 1SJ6A 1WRYA 3DGQA 1NNVA 1BX9A 2X64A 2MMAA 4XHMA 2BMXA 3EU4A 2IMJA 2CZ2A 2W56A 1VQL3 1EEMA 3TRPA 4R9KA 3TKSE 3CQFA 4I8BA 3FEUA 1W6GA 2IIYA 1ERVA 5FWGA 3TRQA 3A2VA 4LGQA 1J9BA 1MD4A 1K8A4 4V2NA 2I9HA 3NUVA 5IMZA 3CCM3 3ZL5A 3FR6A 3A5EA 4NWYA 1BG5A 3GNJA 1M9GA 3EBTA 4HM0B 2VCTA 2R37A 2XC2A 3OXAA 1SENA 2B3SA 5IMCA 2J9HA 3ZIJA 3J7Yd 3BCIA 4HBRA 5LC7A 3UOMA 1B9XC 3NZNA 4O5UA 2JDIH 3RGRA 1GUHA 3P2AA 8RNTA 1LNHA 5CNWA 1VQ83 4K1VA 4PNFA 5G30A 5KOXA 2G2QA 1B9YC 1YKCA 1PX7A 4ECBA 2GZZA 2E2UA 3UEMA 5AEUB 3NX0A 2HE3A 2HZEA 3HOHA 4PNGA 4BTXA 1W02A 2CX4A 1PKZA 1Z3EA 1BSCA 2H6XA 2YJHA 1PL2A 4WR4A 2XSHB 3TCOA 5F07A 4GCIA 1UUWB 4MH2A 1EUIC 1FUSA 2GSPA 3WDGB 1JZDA 3JUMA 1IV7A 3F8UA 1JBRA 1VGLA 2VLTA 1NO3A 3VWXA 2VL9A 1RMSA 5ECKB 3GURA 5G2GA 3Q74A 3FG1A 1UW1A 3FZAA 2B1LA 2F3MA 3GYKA 2J8XB 3EC9A 1RQMA 2KHPA 1TU8A 1ZL9A 4KT3B 1IQ8A 5DREA 1EG9B 1ZCPA 1HQOA 2LS5A 3WODG 3US3A 6GSYA 4TXOB 3D3LA 1BEDA 1BJXA 3NQZA 1GOVA 1PKWA 3A2WA 3G0KA 3CMA3 3OR5A 1GOUA 5TGNA 13GSA 2VLUA 2WDUA 3DMLA 1F2EA 1F9MA 2MYGA 4K7IA 1EA2A 1GSQA 2YWMA 1ZYNA 1HZ1A 5D81A 4IVFA 1GSPA 2PPTA 1B20A 4PUAA 2V41A 1X5EA 2F99A 1WWJA 2XRXB 4RZMA 4HI7A 1TIJA 5GAPD 1GWCA 4DSRA 4RQXA 5AN1A 3STDA 3DM8A 4MH3A 4MLYA 5HR0A 2C0DA 1DVDA 1T00A 4POBA 4AKZA 1Z6NA 1T5YA 4KDYA 5ECPB 4WKWA 1PD21 3RDWA 3OWUA 7GSPA 4N0ZA 4MPFA 2N5BA 4PQHA 4IBPA 4HQSA 4J5GA 2X8CA 4PXOA 3ERFA 1IU7A 2DMMA 1ULIB 1Q824 4K9ZA 2YZHA 3G9BA 5IMAA 1IYHA 4POKA 4RQRA 2EIOA 1YY7A 3F6FA 4KX4A 1W2ZA 2D2ZA 1QGVA 1A2LA 1SJZA 2Q07A 1RRHA 1O7HB 3JUQA 3RPPA 2G0FA 2W56B 1JBSA 1VF4A 2ZDJA 4YQVA 3Q2PA 3M9JA 4PGTA 1BAOA 1THOA 2OWPA 1S3CA 2LNSA 3KIIA 2KRTA 4IJ3A 3DRNA 4J5KA 4Z2TA 5A4VA 4HVNA 1WQLB 3OWSA 3FF0A 1OYJA 5KN1A 4EIPA 4DVCA 3KD0A 4ZB6A 1W4NA 3O76A 3D22A 1XVQA 1QALA 1VQM3 1HNCA 4HM7B 3ERWA 5AYSC 3IK7A 2H1AA 5C04A 4Q5RA 4JE1A 4BL2A 3R3EA 2DSAA 4YH2A 4GTUA 2HOHA 1LVNA 2WGOA 5EPFA 3DVXA 1BNSA 2IMKA 1B21A 3LW9A 5KP1A 2VCZA 3H4KA 1FAAA 3PPUA 4V1Ap 1WMPA 1VQN3 3GHAA 1AQZA 1RGEA 4K2DA 1OHSA 2CVKA 2ZUPA 5IM9A 2H8LA 1GL8A 2MMZA 1JN5B 2GQKA 5GAND 3S67A 4BTWA 2YWOA 3WD6A 2ZHXB 3PXMA 1QVG2 3EC3A 3GV1A 3KH7A 5IEPA 5BXQA 5HR2A 3APSA 2I9WA 3LZAA 2H73A 5D8IA 5ECLB 5AIVA 1NHOA 1XW5A 2IUJA 4JF8A 4NPBA 3GMFA 3WT1A 1GNWA 1YDKA 4POMA 3GZBA 4MK3A 1WP0A 3RHCA 1O8WA 3F0IA 1SK0A 3C71A 1BANA 1J0FA 2CFGA 1T3BA 2L59A 3EE1A 3ZYWA 4ZL9A 3K5TA 4NMUA 3DGLA 3G16A 2PWJA 3K8NA 1GSYA 1R4WA 1GLPA 4LL4B 2GQMA 3CNXA 2F8FA 5L71A 4N6UA 1JRQA 1UCIA 1HNBA 4XDVA 3QFBC 5G1KA 1SYXA 3RDEA 4FYCA 4XB5A 2O3OA 5H5RA 3JCML 4XRDA 2LJAA 5IOWA 1KBNA 3WYWA 2XH9A 1B4PA 2QC7A 2PN8A 3FZ4A 1RNBA 1FW1A 4ECIA 4KFDA 1GNEA 2CFWA 2MF7A 4GXZA 3F9UA 2X49A 1XW9A 5IG4A 5EVOA 3Q19A 1VZZA 3LTAA 3G7JA 1I0VA 3RHBA 4D73A 3SYUA 4LMWA 3NV0A 5A0OB 2O85A 2FLSA 2M46A 3WGDA 1BOXA 1QAKA 5IQYA 5B8BA 1YIT3 2AUVA 1T8EB 1VQP3 3VI7A 3HKRA 3GA4A 4BL7A 1M99A 1MD3A 3KCMA 2Z6BA 4PEJA 2LYXA 3DXOA 4XBXA 1WTHA 2MZCA 3VWUA 1BNIA 1Z7PA 5DRVA 2FA4A 1K0NA 2QKEA 3FZ9A 1A67A 4N0VA 2WGRA 3FHKA 3RPNA 3URPA 1X9WB 1CH0A 3D9RA 3LT9A 4TN8A 2E2MA 4ISDA 1GSFA 2JZSA 4FMCA 4O02B 4LLRA 3M9KA 3FCSB 4K7OA 2HLSA 3UVTA 1SKWB 2B1XB 1RRLA 4QL7A 1XPVA 3HVSA 4IIAA 3ISOA 1UUGB 5GSPA 2D1WA 1K0AA 1FGTA 3AGNA 5FW5A 2F51A 3AGOA 3NM2A 1V58A 1ABAA 2O7KA 1ISKA 1MWSA 2CKFB 1GTIA 3DVWA 1MOLA 3LTCA 3J7Yk 4X4JA 5ID2B 3K7CA 3EQQB 4X2HA 1RDSA 1O8XA 1RJOA 3C1RA 1A2PA 4BL3A 4USSA 3GTUA 1WMOA 5CRGA 2WOHA 3HJOA 3Q6OA 3S29A 1JB4A 1O7NB 4N6OB 2YZUA 5E59A 1QMVA 1LNIA 1EWXA 1A90A 3V99A 1N9JA 5J4UA 2F98A 2P5RA 3NBRA 4XIHA 4ZB8A 1AQVA 1ZGNA 3HY2A 1XVWA 1BSEA 4TXVA 2XF3A 3FLJA 3K9MC 3CNMA 3RNTA 5IG5A 4O3VA 3V98A 2C1YA 1AAZA 1A0FA 4IN0A 2GS3A 1LU4A 5ELAA 4ML6A 3UL6A 3CCL3 4MJCA 1XOBA 2UX0A 2DJKA 1RKYA 1HU9A 4KF9A 2AB6A 2NBSA 2CFDA 1TRSA 3J7Yb 1JZRA 1FHEA 1IVUA 5BVBA 1GMPA 3FF2A 2B7JA 4WFOA 3UB1A 1RK4A 2BJXA 1E97A 1N8QA 4DSQA 1FZUA 2Y74A 3GFKA 4MA9A 2N5FA 4WR5A 3UMAA 5COHA 3F3RA 5G5FA 3LMLA 3CSIA 4DSSB 4GWRA 4K7NA 2Z9SA 5J9BA 5IPHA 4EO3A 1MGWA 2V32A 4ILFA 2WRTA 2GBWB 3LQ7A 5HR3A 1G6WA 2WJUA 1I0XA 5E4WA 3EE2A 3D5GA 1Z6MA 3DIEA 3F7SA 3D4MA 3FMWA 3NIVA 2P38A 1ML6A 3PS8A 3PGTA 3FR3A 2P05A 4MCUA 3DY5A 1PFPA 4D73B 2H76A 4X43A 3NV0B 5ELGA 1OGZA 1FA3A 3EU3A 5ECHB 2M72A 4KA0A 5ECIB 2AAWA 1PN9A 3FK8A 1RGAA 1IVVA 2K6VA 5DDLA 3GRXA 4R9LA 4HZ2A 1YF0A 4FMDA 3IR4A 5CRWA 16GSA 1B2MA 3PZWA 3F8XA 5AEWB 2GEYA 1BRJA 3EMPA 5LNKe 2ZL8A 1ROVA 5IEOA 2IJYA 1GLQA 2ON7A 2CG1A 1GY7A 1WE0A 4PTSA 3TJGA 6GSUA 17GSA 2KF6A 4R1KA 2TRXA 1GUMA 3ZTLA 3TKQA 2VL2A 1ILOA 1UI8A 1MWUA 3FGYA 4CCVA 8GSSA 3LYKA 4KZ1A 3CC43 4Q5NA 1GP1A 2H01A 1TRPA 4BU4A 1XW6A 4EDYA 2QGVA 4FMBA 2JSYA 2QSIA 2R6KA 4RI6A 4AEQA 3QR6A 3G7IA 2AJQB 3QAVA 4LZIA 1CEWI 5ECQB 1PMTA 1SPUA 1O7WB 6GSXA 19GSA 2H74A 1MNLA 2HMKB 1W7CA 4POLA 2V6OA 4KNDA 5C00A 1QMAA 3APOA 3HX8A 5D9TA 4JRRA 3GTUB 3A76A 4EC6A 3ZFZA 2LQQA 2STDA 4AJ8A 1BNFA 9RNTA 6RNTA 3CTFA 3ER7A 3U1WA 3LTBA 3FZ5A 2MMOA 4IELA 4Q53A 1PGTA 4GHOA 4TVEA 3MG1A 2VLVA 1U5OA 2A4HA 1EQKA 5ENUA 1F8NA 2H6ZA 1B8XA 4MMYB 4ZL7A 1I8VA 1USBA 1CQGA 2L4QA 3GIXA 2HRFA 3FY7A 3ALAA 5F05A 1I2GA 4DEJA 4XDWA 1OGXA 3B4PA 3S27A 2CWVA 1RGLA 1OCVA 2Z7AA 2IPAA 5G2ZA 3WMDA 2J23A 2JZTA 4EDZA 3GL5A 2PBJA 1EKMA 4BVXA 1SJWA 1H75A 3ED3A 1T4ZA 4KSMA 1W01A 4ZL8A 2Y73A 2DJ3A 5DALB 3W8SA 5DAKA 4IP6A 3TUEA 2WOFA 5DQSA 1NDOB 5G5EA 4R4KA 2YANA 3TKPA 4HU9A 11GSA 1R5PA 3LWAA 3V1WA 2KLXA 3LXZA 2F4YA 3H1NA 3M3MA 4HM3B 3O6TA 3L4NA 1K3OA 2KP1A 2NTOA 2SARA 1OF5A 5IENA 4GB5A 4HAAA 1ZYPA 4OVMA 3E99A 2CX0A 4HS1A 4MJDA 3TDGA 2GVPA 2YV9A 4HKVB 1DSBA 1WMNA 3T0UA 1T4YA 4OD7A 3QPMA 2GU3A 2V6KA 2C4JA 4R80A 2IMIA 4FO5A 4EBGA 4OK0A 3CC73 1IT7A 2FWFA 4ULXA 1AR0A 2B5EA 1X1YA 5EEOA 5INYA 1RW1A 1TP9A 4I2UA 4MF5A 2XBQA 1EP7A 3PINA 3EMXA 3NHXA 2E7PA 1UCKA 3HZPA 2GSSA 1TU7A 3HXSA 2VOCA 4V2LA 1UVZA 2HT9A 5JCWA 3UNLA 4CJNA 3TJKA 1MGRA 1YJW3 1TRUA 1FUTA 3ZZXA 3K63A 1RLSA 4PX1A 2R2JA 2OOVA 1ERUA 1RN1A 3OX9A 1UN2A 3U97A 5KN0A 1XBSA 2YX9A 1A8YA 2P0MA 1ZOFA 5IMVA 3KN4A 1YZXA 1OHPA 3UL5A 5JCUA 1NJI4 4TR0A 1EGRA 4GQFA 3EX9A 2JADA 3F8HA 3ECFA 4YQUA 1IDPA 2IMEA 1F3BA 2YP6A 4O2HA 1MDJA 1Q814 5CYYA 5CREA 3WT2A 1SL2B 2H19A 4KDXA 4G1MB 2CAQA 4WXTA 1BAYA 1NWWA 3I553 2HXKA 3Q18A 2WS2A 2B24B 1BQ7A 2HRNA 4JR6A 3S5CA 1GUKA 3UBLA 1M7TA 2CAIA 5AIHA 2DKHA 1Q40A 3SEDA 5J41A 2R0CA 4Q5FA 4HDEA 2DKIA 4I4KA 3IAS2 2VD0A 3IE3A 4EIQA 2N5AA 1VQQA 6GSVA 1D6ZA 4BA7A 1W6CA 3T8UA 5FHIA 1TKDB 4EV2A 1TU5A 3F4TA 4WP5A 4HJ2A 2DJ2A 5HQPA 1V74A 4FMAA 1FYSA 2W9QA 1EOGA 2B6MA 3RBTA 9GSSA 1UGHI 4QWTA 2QEX3 3KFQC 4KH7A 4Z2RA 1Q4JA 3C8EA 3GSTA 2IFQA 1EP8A 3D79A 2OTJ3 2GZPA 1BRKA 4IJIA 3FRCA 4IP1A 1KD14 6GSTA 1R4CA 1N8JA 2BMRB 4ZB9A 3CSHA 1BRNL 2V1LA 3KSPA 2C0GA 3WOEB 4G0KA 2C4BA 3LTDA 2HFDA 1K0MA 2FNOA 3IJEB 2C3TA 2WZ9A 4H86A 4LA1A 2PZVA 5D96A 2OQEA 2DJ1A 1BGSA 4NHFA 3I6AA 4OFMA 1YHQ3 1A23A 1GSDA 5F0GA 1OE8A 1O7GB 4N10A 1AQXA 2FHEA 2XSOB 2KF5A 3DD3A 3SBCA 5AI1A 4IQAA 1XIYA 4ZIJA 3LT8A 3G4S3 1GSSA 3L9UA 2FWGA 3ZREA 1SU9A 5D9XA 3FG3A 1GY6A 4IHUA 3A2XA 4HOJA 4TRXA 2IY2A 4FCZA 1IQYA 3CRTA 1LQGC 2CH9A 2MMNA 3S9FA 1M2DA 5D9WA 2I3YA 4ACSA 4EE0A 4OO4A 1BUQA 4LEHA 3F4SA 2JQ5A 1I70A 4K0NA 3GL3A 3HZ4A 4L8EA 1UCLA 2K0MA 2M7OA 1O85A 3LYGA 3WGEA 1FB0A 3D5IA 2W2CA 4K1UA 5AYRB 2HZEB 2C3QA 1ZX2A 2H71A 3W8JA 2BU4A 4WHAA 1V57A 2RM6A 3C73A 3KM6A 3LEFA 3M1GA 2HMLB 2FCHA 1SL0B 1IK3A 1WOUA 4G19A 3ZG5A 2E2TA 4XS6A 3HVNA 3GZRA 4GSTA 3K0ZA 2CVBA 3LG6A 2FD3A 1EEJA 2L1SA 1A8LA 5ELUA 3BOAA 3IC4A 2B7KA 1US1A 4K6XA 3BBYA 4L8PA 1GMRA 5DJLA 1UCJA 4RNYA 3DWVA 4GL6A 1KSIA 4BWQA 4XRAA 3P90A 7GSSA 2RBIA 2X8HA 3D6IA 1Q40B 1Z1SA 1TI3A 3LXTA 1CYVA 1ERTA 2AHEA 1GSEA 2VO4A 3CSJA 4KE3A 3GH9A 3BB9A 4V2MA 3EYTA 2P31A 3IRAA 2IA7A 1GULA 5HOHA 1XCCA 2C10A 2CHCA 3BIRA 1XG8A 4FYBA 3WHOA 3FKAA 2RIIA 3FR9A 4ZBBA 2CFLA 1A2VA 2HMMB 1CYUA 2P09A 3FZWA 1AVKA 1XWAA 2GGTA 4JR4A 3HVXA 2W04A 1PQNA 1J2BA 3N5OA 5F06A 2UUGC 5FT3A 2RSXA 1YVBI 1Q9EA 2ZA4A 1S3AA 5JCGA 3F6DA 1QQ2A 1ASKA 1OC9A 3X3XA 2DMLA 4ZILA 3HA9A 4J8TA 3ZITA 1GOYA 3GKNA 1BNEA 3CTGA 3VWVA 1DYUA 2IFQB 3F4RA 4KUNA 1AY7A 3LGCA 1M2BA 1PX6A 1JZOA 2CX3A 1M904 5ABRA 3LFLA 2YPMA 4KCEA 4MEIA 1D6UA 1L5GB 3RGAA 1C54A 1DE2A 4ML1A 1RGCA 1FB6A 1S723 1S3RA 2V2GA 1MWTA 4MZWA 3HYPA 2H75A 4EXRA 3E9JB 3FKFA 1BU4A 1CQHA 2A15A 2AADA 4PQ1A 2YWIA 1Q864 3JUPA 1GTUA 3PR8A 1V40A 1BUJA 3JUOA 1YJ6A 1FGQA 1K734 3ZFBA 4JZQA 3H8QA 2KF4A 2W6JH 1O7MB 1QJGA 1MTCA 2RUEA 1QFNA 1I3IA 1YIJ3 1MDIA 2VCWA 4KFEA 1BSDA 3VSYA 3MHEA 3KIJA 4CY8A 2R0PA 2OE1A 3H79A 2XEPA 4AJ6A 1T2HA 2K8SA 4NXIA 1VQK3 1OE7A 1Q7Y4 4STDA 4IGJA 1I5GA 5EY6A 3KKGA 5D73A 4G10A 2BO9B 4EW5A 2H66A 2LJKA 1TUHA 1S5AA 4MPGA 4MMMA 5DCHA 3RAZA 2GT6A 2R5GA 4JRFA 3VLNA 3KTLA 2OE0A 1AV4A 4A5PA 3IPTA 3LSZA 1FGOA 2DBCA 4KSOA 3DGNA 2VD1A 4TR1A 2BT3A 4KFFA 4NAXA 1O81A 4YKGA 5B8AA 4ZBAA 3NBBA 1OC8A 2HMJB 2HI7A 2ZNMA 4KGIA 3PCRA 2QA43 3C1SA 2C0FA 3A5WA 4K8MA 5JWOB 5RNTA 1TK0B 2CT6A 4IT7A 3CME3 3L9VA 2CFKA 1W2B2 4Z2UA 2OCTA 2GT5A 4H61A 5DBQA 5A4UA 3MYTA 3KXOA 4WBRD 1B4QA 2E2GA 5ECMB 2B5XA 3CPW2 1QXHA 5BRTA 1YNVX 1PRXA 4K1FA 4HZBB 5H5QA 5J9CA 1Q42A 1TDIA 2GBXB 3MDKA 2LEGA 4MJBA 3I69A 2R3XA 1K9M4 1GD4A 3HIGA 1RCLA 3APQA 3QFAC 5GSTA 1U6TA 4WYKA 1U3IA 2OACA 4GRFA 4KCAA 1ULJB 3WA3A 4ICYA 2W03A 1X1UA 3WGXA 3TKSA 1ROAA 1ZYEA 3MNGA 3SX1A 2OA7A 1M0UA 3GAXA 4MABA 3H3HA 2LJRA 5B7CA 3NQYA 1YKAA 3KCHA 4RNZA 1OC9B 4N30A 4RUVA 2K18A 2HMOB 4MDCA 1NB3I 3D4TA 2B1KA 1TRWA 2HRAA 1I2FA 2YN1A 3QRDA 1M1XB 1BNRA 3QAWA 3CBUA 4TR4A 5HGRA 3VF1A 1HYUA 5KEJA 2LUSA 2KF3A 4XTSA 3HHVA 3ERGA 1BRSA 1DE1A 2GTUA 1BNGA 1PSQA 1FVKA 1IT8A 1FOHA 3U6VA 4FYUA 4EKZA 2IWTA 4K5RA 3ZVJA 1Z5YE 4TOPA 5D93A 5STDA 2WO0A 2VCXA 4LYLB 3QK9A 3ROBA 1RHLA 3CC23 1EZKA 3N9JA 4L7KA 2IL3A 3G713 4BL7B 2SBLA 3VGNA 3OV4A 4MMZB 1VF1A 1C7HA 1X9MB 3HIIA 1UGIA 1JJ22 1B48A 4O5RA 3VK9A 1Z9HA 1BSBA 3MWZA 1T2IA 3VPTA 5M1AA 4WF4A 1GYBA 1I2EA 2QGUA 4N6TA 3X42A 5IPGA 2H0GA 1SIHA 1BRIA 1X9SB 3UARA 1FW7A 1F6MC 2DC5A 2KXGA 3SVAA 5CXOA 4OFTA 1G6YA 2QA1A 2FXTA 1H4OA 2XBIA 3CYNA 2CVDA 3TJJA 1JB5A 4EVMA 2CK3H 5ECNB 2X4AA 2DJJA 3ZLPA 2IYJA 1FG4A 1KNGA 3GZXB 5G1LA 3VPQA 1OH0A 3KJYA 2UGIA 4HZ9B 1FGMA 5ECSA 3NOFA 4HYZA 4O7HA 1N5HA 1A0RP 2R0GA 1WNHA 5ECOB 4OCEA 4OO5A 1KEBA 3X3YA 1BYEA 2YCDA 5CO3A 3GX8A 2BMOB 3I43A 22GSA 4CDLA 2A4VA 1WPIA 1WIKA 3VFIA 1Z7RA 1EV9A 2E0QA 2OADA 4HQZA 2K3DA 2WFCA 3PYJA 3P7XA 2XGNA 2XGLA 2VM1A 4LSOA 5IIZA 1SD9A 1YGEA 3UJ1A 3EN8A 3QMXA 2VCVA 4WBJA 1Q7HA 1TOFA 4K5SA 1I3FA 4RNTA 1B2XA 1QAFA 18GSA 3CCU3 1V2AA 5B6NA 2H6YA 3GKMA 3VWWA 5JWRB 3QCPA 2MBTA 2KAAA 2C80A 4HM4B 1GY5A 3AHWA 3IBHA 1B2UA 3C7MA 2CA8A 1JNQA 1RCKA 3UVHA 1RGGA 3CCQ3 4E8EA 4I2TA 4LMVA 1O73A 2CW9A 2BHMA 2GXFA 1NB5I 4K0GA 2CG0A 1GH2A 5EQLA 1ON4A 1DMMA 3BJ5A 3MAKA 3ZRDA 2C0EA 4I6XA 2K8VA 3IOSA 1OC3A 2A2SA 2QIYA 2C3NA 3CCJ3 3TGZA 1B2ZA 4OUQA 1BNJA 1VRSD 3ZMKA 1OVNA 3B7CA 2EC4A 2D42A 3MSZA 4L0UA 2RGQA 1VF3A 5D9VA 5BMUA 5KP3A 4CW9A 3T8NA 1FGRA 4N6V0 5AIIA 2M80A 1VQ53 4CDOA 2W9PA 3CPOA 2EIQA 1U8CB 4AGSA 3GSPA 3KEBA 3IMAB 3EVIA 2L4CA 2H70A 2RNTA 3HJMA 1N9EA 1QUWA 2X99A 4IKHA 2F5MA 3SLUA 2Z77A 3H93A 5G31A 2OE3A 3F14A 2ZCTA 1VQ93 1X0RA 3L0RA 1GD3A 1LOVA 4KDUA 3F3QA 3ZG0A 4RI7A 4YAPA 1K0CA 1XWGA 2HZFA 2MBSA 1K3YA 4FR9A 2CQ9A 2JU5A 1GMQA 3AMOA 4ORLA 4Z7XA 1UA5A 5AIXA 2LQVA 4YKFA 5CLKA 3TRXA 1OUNA 1IVXA 8CHOA 1SK2A 4X1UA 2WCIA 2HSMA 1ZYQB 2GU1A 1U87A 2HYXA 1UUVB 3BNDA 1YF1A 4NV5A 4XCSA 2F5WA 1JBTA 2TIRA 2F8AA 2IMDA 4NHZA 1RN4A 2XR8B 3CXC2 1W00A 4LL1B 1YJ93 4OFNA 3DZLA 2DIYA 5IMFA 1GSUA 3ME8A 1LRAA 5DJMA 2I81A 1YGWA 5IF6A 3EURA 2BNGA 1N8R4 4EF0A 3I563 3LYPA 3UL3A 2F9SA 5HR1A 3HI7A 3TOTA 1FVJA 5CP1A 2YOIA 3EB8A 1PN0A 4GLTA 2VL2C 4O32A 2I4AA 3GKXA 4CPKA 4BVYA 1PY3A 1UC7A 2EIRA 5IG3A 3GSSA 3L78A 4HEA2 3TOUA 1LXEA 1NSWA 3DYRA 5KN2A 2LKUA 1G02A 2ON5A 2VL3A 4TW5A 1DMQA 2PERA 1MDKA 4O8SA 1JN5A 3WOFB 3KTBA 4FH8A 4F0BA 1W5ZA 1XOAA 5BU4A 1GRXA 4J56E 4EUYA 1SL1B 7RNTA 5D83A 3N54B 3D4AA 4MMXB 4WWUC 5IERA 5JBSA 2GSRA 2I1UA 1ZGXA 4J2FA 3F7XA 2YFLB 1Y25A 2GSTA 2AAEA 3BU4A 3X40A 2LV3A 2V1MA 2VUPA 4MJAA 4HM8B 2FUG2 2GQLA 6GSSA 3IK9A 1G96A 4XBTA 1B27A 1CQSA 4TX4A 3IPZA 4Q5QA 2BTOT 4L5OA 4BVXB 5B6MA 4HUAA 3KGKA 3S28A 4OMVA 5DAKB 2H0IA 4AKYA 1TFKA 2KCDA 1GTAA 4EV5A 4J9AA 1WJKA 4ZXGA 1J08A 1D6YA 5LD0A 1DUGA 2ALBA 1SIIA 3KZTA 1M3IA 3DMCA 3ME7A
chains in the Genus database with same CATH topology
4WEYA 2F86B 4HM5B 1OF5B 2PMTA 3UIWA 2L57A 5D82A 1PL1A 1M1K4 1U3AA 4WETA 1G7OA 4H3UA 5J5NA 2HMNB 1SYRA 5CRHA 4O92A 4EXJA 3FSDA 1XXUA 1XFLA 3EF8A 1STFI 2H30A 4N11A 3KH9A 3IA1A 1Q98A 1OKDA 1K0OA 3AMOB 4G0LA 1E6BA 2OBIA 2GEXA 4L5LA 2O87A 3LJRA 2OKAA 1A24A 3DUKA 5IG0A 1FUWA 3DKSA 2CV4A 2XFTA 4G2EA 3H51A 1NU3A 2LSTA 2P5QA 2ML5A 1GTBA 3PGBA 3B8LA 1A2MA 1SKSB 2NPBA 3F63A 4X2OA 3GZYB 1W6YA 1TI1A 4RBNA 3EINA 3GH6A 2OOVC 1EOHA 2Z76A 3GUSA 1TK8B 1YJN3 3HVVA 5KOWA 3LORA 3MSOA 1M2AA 2NVLA 2CWUA 4BVYB 2YFJB 2RLIA 2H0HA 4U13A 4GQCA 2BMQB 5J3RA 3KZQA 2RCDA 5ID2A 3A5IA 2LNTA 2H1GA 4MZBA 4YQMA 1AVLA 2JSZA 4JEDA 2PNCA 3X41A 3HCZA 3GRDA 1XWKA 2YV7A 4E8HA 1LBKA 4L0WA 2YNXA 1TFOA 4HZ4A 1XWBA 1EGOA 1DMNA 2CZ3A 2RFRA 2KOKA 1OKTA 1JKGA 2WGQA 1AUCA 1X5CA 5LCZA 3IV4A 3KMNA 3Q90A 3HD5A 4NV2A 4FIWA 1E2YA 2HSHA 5IO0A 5GSSA 3JUNA 1G0TA 3CCE3 3V92A 1NW2A 4AF2A 3KSED 3LOYA 3SXXA 4ZBDA 5HFGA 5AGYA 2YWNA 3CCV3 3MG2A 2PUKC 5A4WA 1NM3A 7STDA 5DQYA 2PU9C 2HRKA 2KUCA 4GSNA 5IW9A 3IHQA 5FGOA 1HKXA 2P0XA 2HNLA 4BWSA 2PVOC 4ID0A 2L4VA 1K0BA 2ES7A 1JLVA 1TRVA 4K2XA 3CMIA 1MEKA 4OWYA 4DSSA 1URMA 3CCS3 2K54A 2NDOA 2GDRA 4KAEA 1R26A 3VURA 4AJ7A 1AIUA 1FO5A 1VQ73 2A2RA 4XM4A 3HDCA 1JZWA 2TRCP 3KP9A 2CWTA 5CF1A 2H1BA 1AXDA 1UI7A 4P3YB 3BCKA 3PH9A 2PVQA 3MG3A 4IQ1A 3D5JA 1TK5B 2B5YA 3ZIVA 1HD2A 1U88A 2VAFA 3FYGA 4GSSA 4EC0A 3TJBA 4L8OA 3A3TA 3OWYA 2OQEC 4TR3A 2H1DA 4IS0A 1V98A 3EWLA 4N3VA 3JVCA 4O5QA 3MWHA 4X0XA 4NREA 2L6DA 1VF2A 3G8ZA 1ZMAA 5KN3A 3BLZA 5AISA 2GZYA 3FH1A 1WMJA 1KQS2 2FWEA 2LRNA 3NBJA 3O8YA 3GWRA 4G0IA 2XFSA 3EN1B 1HNAA 1IV9A 2CIUA 10GSA 2LQOA 4TKYA 2QA2A 4G9HA 4XS4A 20GSA 5DCGA 5A5KA 3DEXA 1JB2A 1K3LA 3GN3A 5IO2A 2R4VA 2RM5A 3FW2A 4LMIA 2RUFA 1QVF2 3N9HA 3TB2A 3QD9A 1SQWA 2VCQA 4FCJA 2A2PA 2FNQA 3IHGA 2AV4A 4MJEA 3NM7A 1E3VA 3ZFLA 3BNBA 3B4OA 1M9AA 3HZ8A 3EBYA 1OAZA 1Y4KA 3TJFA 2O89A 3E3EA 2DLXA 12GSA 3EHCA 2LTKA 4WF5A 1LJRA 3FG4A 5IOXA 4HM6B 1OHOA 1SD8A 2ML6A 4V1Ag 4I97A 6STDA 4MP4A 1TJDA 2VIMA 1S3DA 2R4IA 1O7PB 3OW22 4NHWA 1PU4A 2L6CA 3KP8A 3KMOA 4N6MA 4BPYA 3MPHA 4YAVA 1JKGB 2FGTA 5F8BA 2IN3A 1KTEA 2LRTA 5IMDA 4F2IA 1A2KA 5H5SA 3X3ZA 4HU7A 5CAXA 2YFIB 2MC8A 4HM1B 3CD63 1TP6A 1ERWA 3I0YA 2VM2A 4N6NB 1OPYA 1SK1A 4QQ7A 4F0CA 1IVWA 1THXA 4CHSA 1YQ1A 5CF2A 3D0ZA 2JACA 1W89A 4HM2B 5ECRB 4K90B 3I9V2 3AY8A 2PGTA 1N5PA 2OBKA 1IQXA 1QK8A 4BTYA 3EPTA 3L9SA 3LXUX 3BNCA 3CRUA 1N2AA 1FOVA 2XHFA 3BD2A 5GZZB 1XZOA 5DALA 4ECCA 1O6JA 4F03A 5JPPA 2JZRA 1G7EA 1JV2B 3DGOA 3GKKA 4MF7A 1W4VA 1F3AA 4J57E 4IW9A 5KP4A 3O3TA 4PUFC 1AC1A 4GF0A 3TKRA 1E3RA 3U5RE 1EV4A 2L5OA 2P0GA 1R7HA 1LOXA 3PCSA 1PA3A 2OTL3 3KE7A 2OJLA 2AYTA 6GSWA 3G6E3 2GLRA 3WA2X 3SWLA 2X8GA 5EL8A 4KVHA 3DGMA 1ST9A 2CC3A 1F37A 3BNEA 5JPUA 2E2VA 1JLWA 4MF6A 1TXXA 5AIFA 2WB9A 4ECJA 3ZVJD 5I97A 5ELJA 1STDA 2XPEA 1VQ63 3IDVA 5DVBA 1M9BA 1YI23 1TTZA 4QL9A 5LC6A 3IC8A 2C8UA 2DJ0A 2WULA 1NHYA 1XWCA 3E0UA 5HFKA 3N8BA 4PQIA 2IUKA 2HSYA 3ZMLA 2LRCA 3R2QA 4MZCA 4TR1B 4K61A 3SOYA 4XS4B 3Q1CA 4FQUA 3QOUA 1V9WA 4F82A 4N6LA 1K0DA 2FGXA 3F9SA 1YEPA 2IMFA 2YJ7A 1Y6EA 1JFUA 1K41A 3DXBA 4OCFA 4JBBA 2O8VB 4XS1A 2JL4A 2W0QA 4CY6A 3W6GA 3L0HA 2XPDA 3MYDA 3M8CA 1SKRB 1TW9A 3F40A 1T7PB 1K28A 2GSQA 5EVHA 4EYCA 1KWIA 1DVCA 3CCR3 2C11A 1JHBA 1DBYA 5CRDA 1I9DA 4JU5A 1AW9A 3GX0A 3EJVA 3NXJA 1IYIA 5JWQB 2INXA 4FCMA 5HFIA 1T1VA 3HK4A 3SOAA 3MIXA 3M0FA 1A2JA 1ACVA 4TXOA 2H72A 4MNNA 1RN7A 4WYKB 3UBKA 3UJMA 4HJMA 3G7YA 3UAPA 2L5LA 1R5AA 1OACA 2FY6A 1SJIA 1AQWA 3P8WA 2FWHA 3CXGA 3CU3A 3MKIA 2DIZA 1C72A 3M8NA 1VQO3 4F9ZA 2K9FA 3QDNA 1X5DA 3HJPA 3VI5A 2FA8A 2UZ8A 3TKSC 4HJLB 1ZZYA 14GSA 2O9UX 4KW6A 2REMA 4KB3A 5AIGA 1VQ43 1KC84 3IAM2 1YEXA 1GS3A 4EL1A 5CK6A 1ZO2A 3LH4A 2KP2A 3D21A 3IXRA 3QAGA 4PURA 4I5QA 1O7UA 4IPBA 4ZM8A 4XBYA 1SJ6A 1WRYA 3DGQA 1BX9A 2X64A 2MMAA 4XHMA 2BMXA 3EU4A 2IMJA 2CZ2A 2W56A 1VQL3 1EEMA 3TRPA 4R9KA 3TKSE 4I8BA 3FEUA 1W6GA 2IIYA 1ERVA 5FWGA 3TRQA 3A2VA 4LGQA 1J9BA 1MD4A 1K8A4 4V2NA 2I9HA 3NUVA 5IMZA 3CCM3 3ZL5A 3FR6A 4NWYA 1BG5A 3GNJA 1M9GA 3EBTA 4HM0B 2VCTA 2R37A 2XC2A 3OXAA 1SENA 2B3SA 5IMCA 2J9HA 3ZIJA 3J7Yd 3BCIA 4HBRA 5LC7A 3UOMA 1B9XC 3NZNA 4O5UA 2JDIH 3RGRA 1GUHA 3P2AA 1LNHA 5CNWA 1VQ83 4K1VA 4PNFA 5G30A 5KOXA 2G2QA 1B9YC 1YKCA 1PX7A 4ECBA 2GZZA 2E2UA 3UEMA 5AEUB 3NX0A 2HE3A 2HZEA 4PNGA 4BTXA 1W02A 2CX4A 1PKZA 1Z3EA 2H6XA 2YJHA 1PL2A 4WR4A 2XSHB 3TCOA 5F07A 4GCIA 1UUWB 4MH2A 3WDGB 1JZDA 3JUMA 1IV7A 3F8UA 1VGLA 2VLTA 1NO3A 3VWXA 2VL9A 5ECKB 3GURA 5G2GA 3Q74A 3FG1A 1UW1A 3FZAA 2B1LA 2F3MA 3GYKA 3EC9A 1RQMA 2KHPA 1TU8A 1ZL9A 1IQ8A 5DREA 1EG9B 1ZCPA 1HQOA 2LS5A 3WODG 3US3A 6GSYA 4TXOB 3D3LA 1BEDA 1BJXA 3NQZA 1PKWA 3A2WA 3G0KA 3CMA3 3OR5A 13GSA 5TGNA 2VLUA 2WDUA 3DMLA 1F2EA 1F9MA 2MYGA 4K7IA 1EA2A 1GSQA 2YWMA 1ZYNA 5D81A 4IVFA 2PPTA 4PUAA 2V41A 1X5EA 2F99A 1WWJA 2XRXB 4RZMA 4HI7A 1TIJA 5GAPD 1GWCA 4DSRA 4RQXA 5AN1A 3STDA 3DM8A 4MH3A 4MLYA 5HR0A 2C0DA 1DVDA 1T00A 4POBA 4AKZA 1Z6NA 1T5YA 4KDYA 5ECPB 4WKWA 1PD21 3RDWA 3OWUA 4N0ZA 4MPFA 2N5BA 4PQHA 4IBPA 4HQSA 2X8CA 4PXOA 3ERFA 1IU7A 2DMMA 1ULIB 1Q824 4K9ZA 2YZHA 3G9BA 5IMAA 1IYHA 4POKA 4RQRA 2EIOA 1YY7A 3F6FA 4KX4A 1W2ZA 2D2ZA 1QGVA 1A2LA 1SJZA 2Q07A 1RRHA 1O7HB 3JUQA 3RPPA 2G0FA 2W56B 1VF4A 2ZDJA 4YQVA 3Q2PA 3M9JA 4PGTA 1THOA 2OWPA 1S3CA 2LNSA 3KIIA 2KRTA 4IJ3A 3DRNA 4Z2TA 5A4VA 4HVNA 1WQLB 3OWSA 3FF0A 1OYJA 5KN1A 4EIPA 4DVCA 3KD0A 4ZB6A 1W4NA 3O76A 3D22A 1XVQA 1QALA 1VQM3 1HNCA 4HM7B 3ERWA 5AYSC 3IK7A 2H1AA 5C04A 4Q5RA 4JE1A 3R3EA 2DSAA 4YH2A 4GTUA 1LVNA 2WGOA 5EPFA 3DVXA 2IMKA 3LW9A 5KP1A 2VCZA 3H4KA 1FAAA 3PPUA 4V1Ap 1WMPA 1VQN3 3GHAA 4K2DA 1OHSA 2CVKA 2ZUPA 5IM9A 2H8LA 1GL8A 2MMZA 1JN5B 2GQKA 5GAND 3S67A 4BTWA 2YWOA 3WD6A 3PXMA 1QVG2 3EC3A 3GV1A 3KH7A 5IEPA 5BXQA 5HR2A 3APSA 2I9WA 3LZAA 2H73A 5D8IA 5ECLB 5AIVA 1NHOA 1XW5A 2IUJA 4JF8A 4NPBA 3GMFA 3WT1A 1GNWA 1YDKA 4POMA 3GZBA 4MK3A 1WP0A 3RHCA 1O8WA 3F0IA 1SK0A 3C71A 1J0FA 2CFGA 1T3BA 2L59A 3EE1A 3ZYWA 4ZL9A 3K5TA 4NMUA 3DGLA 3G16A 2PWJA 3K8NA 1GSYA 1R4WA 1GLPA 4LL4B 2GQMA 3CNXA 2F8FA 5L71A 4N6UA 1JRQA 1HNBA 4XDVA 3QFBC 5G1KA 1SYXA 3RDEA 4FYCA 4XB5A 2O3OA 5H5RA 3JCML 4XRDA 2LJAA 5IOWA 1KBNA 3WYWA 2XH9A 1B4PA 2QC7A 2PN8A 3FZ4A 1FW1A 4ECIA 4KFDA 1GNEA 2CFWA 2MF7A 4GXZA 3F9UA 2X49A 1XW9A 5IG4A 5EVOA 3Q19A 1VZZA 3LTAA 3G7JA 3RHBA 4D73A 4LMWA 3NV0A 5A0OB 2O85A 2FLSA 2M46A 3WGDA 1QAKA 5IQYA 5B8BA 1YIT3 2AUVA 1T8EB 1VQP3 3VI7A 3HKRA 3GA4A 4BL7A 1M99A 1MD3A 3KCMA 2Z6BA 4PEJA 2LYXA 3DXOA 4XBXA 1WTHA 2MZCA 3VWUA 1Z7PA 5DRVA 2FA4A 1K0NA 2QKEA 3FZ9A 1A67A 4N0VA 2WGRA 3FHKA 3RPNA 1X9WB 3D9RA 3LT9A 4TN8A 2E2MA 4ISDA 1GSFA 2JZSA 4FMCA 4O02B 4LLRA 3M9KA 3FCSB 4K7OA 2HLSA 3UVTA 1SKWB 2B1XB 1RRLA 4QL7A 1XPVA 3HVSA 4IIAA 3ISOA 2D1WA 1K0AA 1FGTA 5FW5A 2F51A 3NM2A 1V58A 1ABAA 2O7KA 1ISKA 2CKFB 1GTIA 3DVWA 1MOLA 3LTCA 3J7Yk 4X4JA 5ID2B 3K7CA 3EQQB 4X2HA 1O8XA 1RJOA 3C1RA 4USSA 3GTUA 1WMOA 5CRGA 2WOHA 3HJOA 3Q6OA 3S29A 1JB4A 1O7NB 4N6OB 2YZUA 5E59A 1QMVA 1EWXA 1A90A 3V99A 1N9JA 5J4UA 2F98A 2P5RA 3NBRA 4XIHA 4ZB8A 1AQVA 1ZGNA 3HY2A 1XVWA 4TXVA 2XF3A 3FLJA 3K9MC 3CNMA 5IG5A 4O3VA 3V98A 2C1YA 1AAZA 1A0FA 4IN0A 2GS3A 1LU4A 5ELAA 4ML6A 3UL6A 3CCL3 4MJCA 1XOBA 2UX0A 2DJKA 1RKYA 1HU9A 4KF9A 2AB6A 2NBSA 2CFDA 1TRSA 3J7Yb 1JZRA 1FHEA 1IVUA 5BVBA 3FF2A 2B7JA 4WFOA 3UB1A 1RK4A 2BJXA 1E97A 1N8QA 4DSQA 2Y74A 3GFKA 4MA9A 2N5FA 4WR5A 3UMAA 5COHA 3F3RA 5G5FA 3LMLA 3CSIA 4DSSB 4GWRA 4K7NA 2Z9SA 5J9BA 5IPHA 4EO3A 2V32A 4ILFA 2WRTA 2GBWB 3LQ7A 5HR3A 1G6WA 2WJUA 5E4WA 3EE2A 1Z6MA 3DIEA 3F7SA 3D4MA 3FMWA 3NIVA 2P38A 1ML6A 3PS8A 3PGTA 3FR3A 2P05A 4MCUA 3DY5A 1PFPA 4D73B 2H76A 4X43A 3NV0B 5ELGA 1OGZA 1FA3A 3EU3A 5ECHB 2M72A 4KA0A 5ECIB 2AAWA 1PN9A 3FK8A 1IVVA 2K6VA 5DDLA 3GRXA 4R9LA 4HZ2A 1YF0A 4FMDA 3IR4A 5CRWA 16GSA 3PZWA 3F8XA 5AEWB 2GEYA 3EMPA 5LNKe 2ZL8A 1ROVA 5IEOA 2IJYA 1GLQA 2ON7A 2CG1A 1GY7A 1WE0A 4PTSA 3TJGA 6GSUA 17GSA 4R1KA 2TRXA 1GUMA 3ZTLA 3TKQA 2VL2A 1ILOA 1UI8A 3FGYA 4CCVA 8GSSA 3LYKA 4KZ1A 3CC43 4Q5NA 1GP1A 2H01A 1XW6A 4EDYA 2QGVA 4FMBA 2JSYA 2QSIA 2R6KA 4RI6A 4AEQA 3QR6A 3G7IA 2AJQB 3QAVA 4LZIA 1CEWI 5ECQB 1PMTA 1SPUA 1O7WB 6GSXA 19GSA 2H74A 1MNLA 2HMKB 1W7CA 4POLA 2V6OA 4KNDA 5C00A 1QMAA 3APOA 3HX8A 5D9TA 4JRRA 3GTUB 3A76A 4EC6A 2LQQA 2STDA 4AJ8A 3CTFA 3ER7A 3U1WA 3LTBA 3FZ5A 2MMOA 4IELA 4Q53A 1PGTA 4TVEA 3MG1A 2VLVA 1U5OA 2A4HA 1EQKA 5ENUA 1F8NA 2H6ZA 1B8XA 4MMYB 4ZL7A 1USBA 1CQGA 2L4QA 3GIXA 2HRFA 3FY7A 3ALAA 5F05A 4DEJA 4XDWA 1OGXA 3B4PA 3S27A 2CWVA 1OCVA 2Z7AA 2IPAA 5G2ZA 3WMDA 2J23A 2JZTA 4EDZA 3GL5A 2PBJA 1EKMA 4BVXA 1SJWA 1H75A 3ED3A 1T4ZA 4KSMA 1W01A 4ZL8A 2Y73A 2DJ3A 5DALB 3W8SA 5DAKA 4IP6A 3TUEA 2WOFA 5DQSA 1NDOB 5G5EA 4R4KA 2YANA 3TKPA 4HU9A 11GSA 1R5PA 3LWAA 3V1WA 2KLXA 3LXZA 3H1NA 3M3MA 4HM3B 3O6TA 3L4NA 1K3OA 2KP1A 2NTOA 1OF5A 5IENA 4GB5A 1ZYPA 4OVMA 3E99A 4HS1A 4MJDA 3TDGA 2GVPA 2YV9A 4HKVB 1DSBA 1WMNA 3T0UA 1T4YA 4OD7A 3QPMA 2GU3A 2V6KA 2C4JA 4R80A 2IMIA 4FO5A 4EBGA 4OK0A 3CC73 1IT7A 2FWFA 4ULXA 1AR0A 2B5EA 5EEOA 5INYA 1RW1A 1TP9A 4I2UA 4MF5A 2XBQA 1EP7A 3PINA 3EMXA 3NHXA 2E7PA 3HZPA 2GSSA 1TU7A 3HXSA 2VOCA 4V2LA 1UVZA 2HT9A 5JCWA 3UNLA 3TJKA 1YJW3 1TRUA 3ZZXA 3K63A 4PX1A 2R2JA 2OOVA 1ERUA 3OX9A 1UN2A 3U97A 5KN0A 1XBSA 2YX9A 1A8YA 2P0MA 1ZOFA 5IMVA 3KN4A 1YZXA 1OHPA 3UL5A 5JCUA 1NJI4 4TR0A 1EGRA 4GQFA 3EX9A 2JADA 3F8HA 3ECFA 4YQUA 1IDPA 2IMEA 1F3BA 2YP6A 4O2HA 1MDJA 1Q814 5CYYA 5CREA 3WT2A 1SL2B 2H19A 4KDXA 4G1MB 2CAQA 4WXTA 1BAYA 1NWWA 3I553 2HXKA 3Q18A 2WS2A 2B24B 1BQ7A 2HRNA 4JR6A 3S5CA 1GUKA 3UBLA 2CAIA 1M7TA 5AIHA 2DKHA 1Q40A 3SEDA 5J41A 2R0CA 4Q5FA 4HDEA 2DKIA 4I4KA 3IAS2 2VD0A 3IE3A 4EIQA 2N5AA 6GSVA 1D6ZA 4BA7A 1W6CA 3T8UA 5FHIA 1TKDB 4EV2A 1TU5A 3F4TA 4WP5A 4HJ2A 2DJ2A 5HQPA 1V74A 4FMAA 2W9QA 1EOGA 2B6MA 3RBTA 9GSSA 4QWTA 2QEX3 3KFQC 4KH7A 4Z2RA 1Q4JA 3C8EA 3GSTA 2IFQA 1EP8A 2OTJ3 2GZPA 4IJIA 3FRCA 4IP1A 1KD14 6GSTA 1R4CA 1N8JA 2BMRB 4ZB9A 3CSHA 2V1LA 3KSPA 2C0GA 3WOEB 4G0KA 3LTDA 2HFDA 1K0MA 2FNOA 3IJEB 2C3TA 2WZ9A 4H86A 4LA1A 2PZVA 5D96A 2OQEA 2DJ1A 4NHFA 3I6AA 4OFMA 1YHQ3 1A23A 1GSDA 5F0GA 1OE8A 1O7GB 4N10A 1AQXA 2FHEA 2XSOB 3DD3A 3SBCA 5AI1A 4IQAA 1XIYA 4ZIJA 3LT8A 3G4S3 1GSSA 3L9UA 2FWGA 3ZREA 1SU9A 5D9XA 3FG3A 1GY6A 4IHUA 3A2XA 4HOJA 4TRXA 4FCZA 1IQYA 3CRTA 2CH9A 2MMNA 3S9FA 1M2DA 5D9WA 2I3YA 4ACSA 4EE0A 4OO4A 1BUQA 4LEHA 3F4SA 2JQ5A 4K0NA 3GL3A 3HZ4A 4L8EA 2K0MA 2M7OA 1O85A 3LYGA 3WGEA 1FB0A 2W2CA 4K1UA 5AYRB 2HZEB 2C3QA 1ZX2A 2H71A 3W8JA 4WHAA 1V57A 2RM6A 3C73A 3KM6A 3LEFA 3M1GA 2HMLB 2FCHA 1SL0B 1IK3A 1WOUA 4G19A 2E2TA 4XS6A 3GZRA 4GSTA 3K0ZA 2CVBA 3LG6A 2FD3A 1EEJA 1A8LA 5ELUA 3BOAA 3IC4A 2B7KA 1US1A 4K6XA 3BBYA 4L8PA 5DJLA 4RNYA 3DWVA 4GL6A 1KSIA 4BWQA 4XRAA 3P90A 7GSSA 2X8HA 3D6IA 1Q40B 1Z1SA 1TI3A 3LXTA 1CYVA 1ERTA 2AHEA 1GSEA 2VO4A 3CSJA 4KE3A 3GH9A 3BB9A 4V2MA 3EYTA 2P31A 3IRAA 2IA7A 1GULA 1XCCA 4FYBA 2C10A 2CHCA 3FKAA 2RIIA 3FR9A 4ZBBA 2CFLA 1A2VA 2HMMB 1CYUA 2P09A 3FZWA 2GGTA 1AVKA 1XWAA 4JR4A 3HVXA 2W04A 1PQNA 1J2BA 3N5OA 5F06A 5FT3A 2RSXA 1YVBI 1S3AA 5JCGA 3F6DA 1QQ2A 1ASKA 1OC9A 3X3XA 2DMLA 4ZILA 3HA9A 4J8TA 3ZITA 3GKNA 3CTGA 3VWVA 1DYUA 2IFQB 3F4RA 4KUNA 3LGCA 1M2BA 1PX6A 1JZOA 2CX3A 1M904 5ABRA 3LFLA 2YPMA 4KCEA 4MEIA 1D6UA 1L5GB 3RGAA 1DE2A 4ML1A 1FB6A 1S723 2V2GA 4MZWA 3HYPA 2H75A 4EXRA 3E9JB 3FKFA 1CQHA 2A15A 4PQ1A 2YWIA 1Q864 3JUPA 1GTUA 3PR8A 1V40A 3JUOA 1YJ6A 1FGQA 1K734 3ZFBA 4JZQA 3H8QA 2W6JH 1O7MB 1QJGA 1MTCA 2RUEA 1QFNA 1MDIA 1YIJ3 2VCWA 4KFEA 3VSYA 3MHEA 3KIJA 4CY8A 2R0PA 2OE1A 3H79A 2XEPA 4AJ6A 2K8SA 4NXIA 1VQK3 1OE7A 1Q7Y4 4STDA 4IGJA 1I5GA 5EY6A 3KKGA 5D73A 4G10A 2BO9B 2H66A 2LJKA 1TUHA 1S5AA 4MPGA 4MMMA 5DCHA 3RAZA 2GT6A 2R5GA 4JRFA 3VLNA 3KTLA 2OE0A 1AV4A 4A5PA 3IPTA 3LSZA 1FGOA 2DBCA 4KSOA 3DGNA 2VD1A 4TR1A 2BT3A 4KFFA 4NAXA 1O81A 4YKGA 5B8AA 4ZBAA 3NBBA 1OC8A 2HMJB 2HI7A 2ZNMA 4KGIA 3PCRA 2QA43 3C1SA 2C0FA 3A5WA 4K8MA 5JWOB 1TK0B 2CT6A 4IT7A 3CME3 3L9VA 2CFKA 1W2B2 4Z2UA 2OCTA 2GT5A 4H61A 5DBQA 5A4UA 3MYTA 3KXOA 4WBRD 1B4QA 2E2GA 5ECMB 2B5XA 3CPW2 1QXHA 5BRTA 1PRXA 4K1FA 4HZBB 5H5QA 5J9CA 1Q42A 1TDIA 2GBXB 3MDKA 2LEGA 4MJBA 3I69A 2R3XA 1K9M4 1GD4A 3HIGA 3QFAC 3APQA 5GSTA 1U6TA 4WYKA 1U3IA 2OACA 4GRFA 4KCAA 1ULJB 3WA3A 4ICYA 2W03A 3WGXA 3TKSA 1ROAA 1ZYEA 3MNGA 3SX1A 2OA7A 1M0UA 3GAXA 4MABA 3H3HA 2LJRA 5B7CA 3NQYA 1YKAA 4RNZA 1OC9B 4N30A 4RUVA 2K18A 2HMOB 4MDCA 1NB3I 3D4TA 2B1KA 1TRWA 2HRAA 2YN1A 3QRDA 1M1XB 3QAWA 3CBUA 4TR4A 5HGRA 3VF1A 1HYUA 5KEJA 2LUSA 4XTSA 3HHVA 3ERGA 1DE1A 2GTUA 1PSQA 1FVKA 1IT8A 1FOHA 3U6VA 4FYUA 4EKZA 2IWTA 4K5RA 3ZVJA 1Z5YE 4TOPA 5D93A 5STDA 2WO0A 2VCXA 3QK9A 3ROBA 3CC23 1EZKA 3N9JA 4L7KA 2IL3A 3G713 4BL7B 2SBLA 3VGNA 3OV4A 4MMZB 1VF1A 1C7HA 1X9MB 3HIIA 1JJ22 1B48A 4O5RA 3VK9A 1Z9HA 3MWZA 3VPTA 4WF4A 1GYBA 2QGUA 3X42A 4N6TA 5IPGA 2H0GA 1SIHA 1X9SB 3UARA 1F6MC 2DC5A 2KXGA 3SVAA 5CXOA 4OFTA 1G6YA 2QA1A 2FXTA 1H4OA 2XBIA 3CYNA 2CVDA 3TJJA 1JB5A 4EVMA 2CK3H 5ECNB 2X4AA 2DJJA 3ZLPA 1FG4A 1KNGA 3GZXB 5G1LA 3VPQA 1OH0A 3KJYA 4HZ9B 1FGMA 5ECSA 3NOFA 4HYZA 4O7HA 1N5HA 1A0RP 2R0GA 1WNHA 5ECOB 4OCEA 4OO5A 1KEBA 3X3YA 1BYEA 2YCDA 5CO3A 3GX8A 2BMOB 3I43A 22GSA 4CDLA 2A4VA 1WPIA 1WIKA 3VFIA 1Z7RA 1EV9A 2E0QA 2OADA 4HQZA 2WFCA 3PYJA 3P7XA 2XGNA 2XGLA 2VM1A 4LSOA 5IIZA 1SD9A 1YGEA 3UJ1A 3EN8A 3QMXA 2VCVA 4WBJA 1TOFA 4K5SA 1QAFA 18GSA 3CCU3 1V2AA 5B6NA 2H6YA 3GKMA 3VWWA 5JWRB 3QCPA 2MBTA 2C80A 4HM4B 1GY5A 3IBHA 3C7MA 2CA8A 1JNQA 3UVHA 3CCQ3 4E8EA 4I2TA 4LMVA 1O73A 2CW9A 2BHMA 2GXFA 1NB5I 4K0GA 2CG0A 1GH2A 5EQLA 1ON4A 1DMMA 3BJ5A 3MAKA 3ZRDA 2C0EA 4I6XA 2K8VA 3IOSA 1OC3A 2A2SA 2QIYA 2C3NA 3CCJ3 3TGZA 4OUQA 1VRSD 3ZMKA 1OVNA 3B7CA 2EC4A 2D42A 3MSZA 4L0UA 2RGQA 1VF3A 5D9VA 5BMUA 5KP3A 4CW9A 3T8NA 1FGRA 4N6V0 5AIIA 2M80A 1VQ53 4CDOA 2W9PA 3CPOA 2EIQA 1U8CB 4AGSA 3KEBA 3IMAB 3EVIA 2L4CA 2H70A 3HJMA 1N9EA 1QUWA 2X99A 4IKHA 3SLUA 2Z77A 3H93A 5G31A 2OE3A 3F14A 2ZCTA 1VQ93 1X0RA 3L0RA 1GD3A 4KDUA 3F3QA 4RI7A 4YAPA 1K0CA 1XWGA 2HZFA 2MBSA 1K3YA 4FR9A 2CQ9A 2JU5A 3AMOA 4ORLA 4Z7XA 1UA5A 5AIXA 2LQVA 4YKFA 5CLKA 3TRXA 1OUNA 1IVXA 8CHOA 1SK2A 4X1UA 2WCIA 2HSMA 1ZYQB 2GU1A 1U87A 2HYXA 1UUVB 3BNDA 1YF1A 4NV5A 4XCSA 2TIRA 2F8AA 2IMDA 4NHZA 2XR8B 3CXC2 1W00A 4LL1B 1YJ93 4OFNA 3DZLA 2DIYA 5IMFA 1GSUA 3ME8A 5DJMA 2I81A 5IF6A 3EURA 2BNGA 1N8R4 4EF0A 3I563