3TDGA

Structural and functional characterization of helicobacter pylori dsbg
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
232
structure length
232
Chain Sequence
b'QDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTKVENTTKKIFESGVIKGVPFLYHY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and functional characterization of Helicobacter pylori DsbG
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 77
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18257 DsbG_N Disulfide isomerase DsbG N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.520 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3tdgA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tdgA02
3QD9A 4IJIA 4QQ7A 5LD0A 1X5EA 2HI7A 3GX0A 2LJKA 3P7XA 2XHFA 2FWHA 4JEDA 4EKZA 4HJMA 3ERFA 4HOJA 2FWGA 4IBPA 1UVZA 1V40A 2M46A 1GNEA 1ERUA 2HRFA 2VCQA 3H1NA 2H19A 1QGVA 3UL3A 1X5DA 3TRQA 4BPYA 3NOFA 4PNFA 3APSA 4POLA 2OE1A 2L4CA 4POMA 5CAXA 1THOA 3AY8A 2GLRA 3C71A 2DIYA 1H75A 4K7IA 2LSTA 1V2AA 4K1FA 1ERWA 1DBYA 1R26A 2CVBA 1ON4A 1SK1A 1GLQA 3DVXA 1EV9A 2YOIA 2I81A 3RHBA 2B7JA 1Z7RA 2FA4A 1RK4A 1GSEA 1XOAA 5HFKA 3DIEA 5JCWA 4RQRA 2A4VA 3FR3A 4MJCA 1AIUA 5J41A 4WETA 2VL3A 2C80A 3KTLA 2DJJA 4CHSA 3GKXA 2H72A 8GSSA 3D22A 3ZIJA 2NBSA 1PKZA 3QMXA 1T00A 1VF3A 4HI7A 1SL0B 1GSFA 1X9WB 4NV5A 5G1KA 1GSSA 2EIOA 5F8BA 4EDYA 3KCMA 5CREA 2I4AA 5F07A 3ERGA 3GX8A 1O7UA 4F9ZA 3KH7A 5CP1A 2GS3A 4XS4A 3CSIA 3OR5A 1GSYA 5EVOA 1XWBA 2C0GA 1EOGA 3W8JA 5DBQA 1J08A 1B48A 2B7KA 3IBHA 3TCOA 2GSTA 4TVEA 3FY7A 2DBCA 2LRTA 3CRTA 3MSZA 2B1LA 2V41A 3KMOA 4OFMA 4J56E 3LG6A 3WYWA 5DAKB 3N5OA 5L71A 4RQXA 1BQ7A 3KP8A 4TKYA 1QFNA 4J57E 4OO5A 1GUHA 1PL1A 1PQNA 1SK0A 2AUVA 2CX3A 3KTBA 1TK5B 2OBKA 3HA9A 5INYA 6GSWA 1V98A 2H30A 1WMJA 2L57A 1XWKA 3GH9A 3GTUB 3ZYWA 3HD5A 4IS0A 4L5OA 5B6NA 1U88A 6GSTA 4KUNA 1H4OA 3M9JA 3LFLA 5G1LA 2PGTA 2BMXA 5IPGA 2V32A 5J5NA 4K9ZA 2QSIA 4TXVA 3LEFA 3FR6A 1OE8A 3F6FA 4Q5NA 5DQYA 2IWTA 1K0CA 1TRUA 2MMZA 2FHEA 3PGTA 3L78A 4Z7XA 1VRSD 4ML6A 2VCWA 4J2FA 4FO5A 1F6MC 1O6JA 2HSYA 2NPBA 4IHUA 4TR0A 3LXTA 3GNJA 3HJMA 1GWCA 3M9KA 4TRXA 2L6CA 1G0TA 4TR3A 2H1AA 4GF0A 2WDUA 3GURA 5F0GA 4XRAA 2YPMA 1NHYA 3NZNA 2I9HA 5ECHB 3QAVA 5GSSA 2OKAA 1BX9A 4EE0A 3VWVA 2EC4A 2B5YA 2O7KA 2LNTA 2MBSA 2E7PA 4ZBAA 4OCEA 2FWEA 2CT6A 3QDNA 1Z6NA 3W6GA 2F9SA 2IFQA 2HNLA 1PRXA 3BOAA 1GL8A 1O8WA 4ML1A 4E8HA 4O92A 3GKNA 4NPBA 3F3QA 2OADA 2VOCA 4F2IA 1K0OA 1DE2A 4CDOA 3Q19A 1ABAA 1TXXA 3PH9A 4PNGA 1SJZA 3ME8A 3BCKA 2LEGA 2GGTA 1M9BA 2A2RA 3IV4A 10GSA 2C3QA 2ZUPA 2VD0A 3IPZA 1HNBA 1XOBA 4IKHA 1JLVA 2HFDA 4X1UA 4ECCA 1GRXA 3IHQA 5F05A 3UJ1A 5LCZA 3I6AA 2GZZA 2YZHA 5ELGA 4TR1B 1PD21 2C3TA 4HU9A 3GL3A 4MJAA 3P90A 1WIKA 3I9V2 5G2ZA 3IC4A 1W89A 11GSA 3J7Yb 2I1UA 2H1BA 3IDVA 3DVWA 4D73A 2LNSA 3KZQA 3TJJA 3QOUA 5D96A 5A5KA 2GQLA 4WXTA 1GTUA 4FIWA 1TRVA 1UA5A 4MF6A 2QKEA 1Q4JA 3VFIA 1QK8A 4BL7A 3F4TA 2H1DA 3GKKA 2CAQA 2H76A 1FW1A 1X9SB 3F0IA 4AJ8A 2LUSA 3KXOA 2JADA 4WR4A 1A2LA 6GSVA 2L5OA 3DMLA 2JZTA 2K18A 1FO5A 4OO4A 1ILOA 2NTOA 1HQOA 1SJ6A 1PGTA 3FHKA 5JCGA 4POBA 4XS1A 5AIVA 1OE7A 1T4YA 2WCIA 2GZYA 1A8YA 2LKUA 5HR0A 2IN3A 1YKCA 4WR5A 3O6TA 4HQSA 5B7CA 5HFIA 5IMCA 4DSRA 2PVQA 5ECPB 5DJLA 2RM5A 2CQ9A 1ST9A 5D9WA 4FYBA 4MZCA 1TK0B 3H79A 2WRTA 1WRYA 4BWSA 1TOFA 5J4UA 2P31A 1TRWA 2FD3A 4ACSA 4WF5A 2KHPA 4F0BA 4HDEA 3L4NA 1Z9HA 3C8EA 5IMDA 1JLWA 2RLIA 1TKDB 4IP1A 4ZBDA 4KX4A 1JZWA 1GH2A 3CMIA 3IOSA 3EC3A 3HHVA 3HZ8A 5CYYA 3P8WA 1F3AA 2KUCA 3EMXA 3HCZA 4AGSA 3TKQA 1EOHA 4XS4B 1OYJA 4OD7A 5IPHA 1ZCPA 3I69A 3M3MA 4HZ2A 3GMFA 4ZB8A 1AAZA 4ZL7A 1AUCA 1SENA 2VLTA 3HJPA 3HDCA 3V1WA 3UVHA 5G5FA 5HFGA 1M9AA 1WP0A 4IP6A 3RDWA 2ES7A 20GSA 2P5QA 1JZOA 1MD3A 3DEXA 3WGXA 3VLNA 3GKMA 5DQSA 4EL1A 5IIZA 3GN3A 5HQPA 3CRUA 2H6ZA 4ECIA 5B6MA 3GUSA 5IMFA 2YCDA 2OBIA 4V1Ag 5CRHA 2FUG2 4K7OA 1XVQA 2IL3A 4HU7A 1N8JA 3VWUA 4PQHA 2YJHA 5ECKB 2MMAA 2VCVA 4IQAA 2H73A 1J9BA 1J0FA 2X64A 1VGLA 2VCZA 1Q98A 3K8NA 1EEMA 4HJ2A 5DALA 4I8BA 4KH7A 1AQWA 4HZ4A 3FR9A 4I97A 4F82A 4GCIA 1YZXA 5G31A 3EINA 2KP2A 2N5FA 1YJ6A 4KA0A 3N9JA 3LJRA 2C4JA 3TJKA 2XPEA 1G6YA 3VWXA 3LYKA 2HRNA 5E59A 1FG4A 3EVIA 3CXGA 4G9HA 1PL2A 2IFQB 3IA1A 1XPVA 3GFKA 5ECIB 3ZITA 2WZ9A 4BVYA 1ZL9A 2KLXA 5G5EA 1AQVA 4NMUA 16GSA 4IJ3A 4JRRA 2GSRA 4CW9A 2O89A 2DC5A 2GQMA 2F3MA 2I3YA 3UVTA 3LYPA 3M1GA 3WT1A 4MK3A 3FZAA 2JSZA 1SD8A 4GRFA 1MTCA 5COHA 1TDIA 4WEYA 2YV9A 2LJAA 4G19A 1BEDA 1YQ1A 1XVWA 1ZZYA 3C7MA 2HXKA 1U3AA 4NHWA 2OE3A 1MDKA 2E2GA 1WOUA 5D9VA 3TKSA 3A2VA 3Q18A 1XFLA 5KN0A 1GUKA 4I2TA 1DE1A 5D8IA 2TIRA 5AN1A 1HNAA 3HXSA 3VI5A 2XC2A 4D73B 1VF1A 1G7OA 3DWVA 3D5JA 2R5GA 1FVJA 3DXBA 3G7IA 2JACA 2R4VA 5GZZB 6GSYA 1YKAA 2O87A 4PQIA 3FK8A 2NDOA 3TKRA 5EY6A 3ZVJA 4GSSA 2JSYA 1DSBA 2E0QA 1XWCA 2LRCA 2ZNMA 3BBYA 3RBTA 2G2QA 4ZILA 1T4ZA 3WD6A 2R2JA 1K0DA 5EPFA 2PU9C 3IK9A 4MDCA 3QR6A 2H01A 4V1Ap 3JCML 1GULA 5J9BA 3GYKA 2CZ2A 2IMIA 1C72A 5AISA 2IMEA 1GSUA 1EZKA 2HZFA 4DVCA 1U6TA 4MH3A 3VPQA 1SKRB 4MF5A 3HZ4A 4MZWA 1EWXA 4F0CA 1OC9A 2H0IA 2YP6A 2FCHA 4N0VA 2QGVA 2IIYA 5A4UA 12GSA 3QCPA 18GSA 1NSWA 4X43A 3FZ4A 2B5EA 2VLVA 4XCSA 1THXA 1ZOFA 3IXRA 1FB6A 3WGEA 4POKA 2LQQA 3IE3A 5A4VA 4NWYA 3D21A 3GL5A 4DSSA 1S3CA 4MF7A 3FEUA 3LWAA 4ILFA 4NXIA 4GQFA 2B1KA 3FYGA 3H93A 2VM1A 1X0RA 2H71A 1M2DA 4PXOA 3IR4A 1GLPA 2DJ0A 4PQ1A 5C04A 3U6VA 1K0MA 2M80A 3FZ9A 4TOPA 1Z5YE 2J9HA 1VF4A 1OKDA 3P2AA 4LA1A 4E8EA 2FY6A 4YQVA 3HY2A 2DMLA 2VCTA 1KTEA 2JU5A 4I2UA 1TP9A 1EP8A 1EGRA 2HZEA 5AGYA 4AJ7A 1MDJA 5FHIA 2K6VA 3RPNA 5DCHA 2GQKA 3TJFA 2L6DA 3RPPA 3MWHA 3DGQA 1WPIA 1GTAA 4LL1B 1GP1A 4FYCA 5H5SA 4K6XA 3EU3A 1TJDA 4MPFA 3Q6OA 1O8XA 3LQ7A 1YEPA 3SWLA 2H74A 1AQXA 2VUPA 5J9CA 3C73A 4L8EA 3UARA 1R5AA 2WS2A 2PVOC 1G7EA 2Z9SA 5ECQB 3GRXA 1FVKA 3C1RA 1K3YA 1PSQA 2MZCA 2X99A 3BCIA 1M2BA 4G2EA 1EP7A 3EURA 5ECOB 1K0AA 5GAPD 1JZDA 4FH8A 2V6KA 2LQOA 2MMNA 4ZB9A 5IQYA 3TKPA 4GWRA 2VL2A 5DALB 2H8LA 1TTZA 3J7Yk 3VURA 4V2LA 2C0DA 2H75A 4Q5RA 5FT3A 3W8SA 5KN2A 2GSQA 1CQGA 4K2DA 4GTUA 4ZB6A 17GSA 2ON7A 2HSHA 5IMAA 1ZMAA 3F8UA 1RQMA 4WKWA 1A8LA 1CQHA 4JBBA 2CVKA 2FWFA 4K0GA 4YAPA 3TRPA 3MAKA 2IMDA 3L9SA 4MLYA 5CO3A 2TRXA 1SYXA 4MJBA 1U3IA 1NW2A 1BAYA 4MMMA 1OC3A 4HUAA 3Q74A 3E0UA 5A4WA 2PN8A 3L9VA 2PUKC 2LV3A 4IN0A 2YWMA 3SBCA 3TJGA 1SKWB 4KGIA 3NIVA 4PGTA 3R2QA 14GSA 5HR1A 3QAGA 2B6MA 3PINA 1QXHA 2PMTA 2VCXA 2OACA 4ISDA 6GSSA 2B5XA 3A5WA 2RM6A 5HR3A 2VAFA 4TXOA 1V57A 5D93A 1JFUA 5JWRB 5ABRA 1JZRA 1T1VA 3BD2A 3BJ5A 3D0ZA 4MPGA 1T8EB 3F6DA 4QL7A 4EVMA 1V58A 5KN3A 2MMOA 3HKRA 4GSTA 3TDGA 3ED3A 1R7HA 1K3OA 1XCCA 4MH2A 2C0FA 5IOWA 1URMA 1RW1A 3H4KA 4TN8A 3UMAA 3F63A 3ME7A 5B8BA 5ECLB 4ID0A 1ZGNA 1XWAA 1K0NA 1LJRA 1F37A 3QFBC 1YEXA 5ID2A 2V1MA 3TOUA 3KEBA 2CA8A 3F4RA 4OFTA 5GAND 2HYXA 1XWGA 4KDUA 4GLTA 1SL2B 1GUMA 2OJLA 4KCEA 3H8QA 2JL4A 4MA9A 1Y25A 2GZPA 3UBKA 3APQA 1MD4A 2DLXA 4YQMA 1K3LA 4O32A 4RI7A 1E6BA 3TRXA 2O85A 1NHOA 4ZL9A 2B3SA 3DYRA 3KJYA 2RUFA 4BVXA 1ERTA 1WWJA 2XPDA 3ZL5A 3CSJA 1T3BA 5CNWA 1OC9B 2LRNA 3CSHA 1E2YA 4KCAA 4KDYA 2LJRA 2PERA 3HYPA 1K0BA 4PX1A 3F4SA 2MYGA 1W4VA 4N10A 5IMZA 5ECNB 2DJ3A 4AF2A 4HEA2 2O8VB 3DRNA 4XHMA 4IVFA 2M72A 2H66A 5D73A 1U87A 1A24A 1XIYA 4YAVA 2GVPA 1SL1B 3ZIVA 2YJ7A 4YQUA 22GSA 2VD1A 4LMVA 2DMMA 3UEMA 3E3EA 3ZFBA 4HQZA 4EO3A 3D4TA 2JZSA 4DSSB 5ENUA 2DSAA 2X8GA 1XZOA 4MZBA 5IMVA 2XBQA 1F2EA 2YV7A 2CZ3A 4WBRD 4X0XA 4LMWA 4DSQA 3F9UA 3ZTLA 1EEJA 2L59A 3UOMA 1X9MB 3UAPA 4KE3A 3FZ5A 3LSZA 2BJXA 3D4MA 4HS1A 4V2NA 2YZUA 4H86A 2CAIA 4AJ6A 2HLSA 3ZFLA 2VM2A 9GSSA 4KSOA 3O76A 3KH9A 1SKSB 4K0NA 4OFNA 1LU4A 2DJKA 1PX6A 3FRCA 1YF0A 3GSSA 2OA7A 3DD3A 2PWJA 1KBNA 3GV1A 3EYTA 4RI6A 2HZEB 3ZREA 1Z3EA 2HT9A 3WGDA 1A2JA 1ZYEA 1SK2A 1IYIA 2YANA 2YN1A 2YWNA 6GSUA 3MNGA 2GT6A 3KGKA 3G7JA 3HVVA 2CVDA 1F3BA 1X5CA 1M7TA 2VL2C 2V2GA 2DIZA 2X8CA 1I9DA 3ZZXA 4EC0A 1Z6MA 3HVSA 3LORA 3RAZA 5H5QA 4DEJA 2LS5A 4BA7A 5CRGA 3MDKA 3RHCA 3VWWA 3KIJA 3IAM2 3QAWA 2FLSA 1MDIA 5H5RA 1WJKA 3HVXA 5IO2A 3E9JB 4EXJA 3PR8A 2KP1A 2RUEA 1KEBA 2C3NA 3EE2A 3KD0A 4ZBBA 4ZIJA 5D9TA 5C00A 2AJQB 4L0WA 1Y6EA 2NVLA 5EL8A 1SD9A 2DJ1A 3TUEA 3EU4A 1GTBA 4ECBA 4EUYA 1OVNA 2CV4A 1OC8A 1AXDA 5ELAA 4KNDA 5KEJA 4RUVA 1FHEA 1FOVA 4GQCA 3US3A 3GHAA 1USBA 3VK9A 2IPAA 2WJUA 2IMKA 4O5RA 5JCUA 2E2MA 3ZMKA 2PBJA 5DDLA 1OAZA 1QUWA 5KN1A 4IQ1A 2L5LA 1GSDA 4OWYA 1PMTA 2K8SA 1AC1A 5LNKe 2YNXA 4XS6A 1XW5A 5JWQB 1A0RP 2AAWA 1JHBA 1PN9A 1TU8A 2WGRA 4LL4B 1G6WA 3IRAA 2AV4A 1IYHA 2EIQA 1YY7A 4NHZA 3HJOA 2R37A 4JZQA 5ECRB 2VLUA 2F8AA 4PUFC 1F9MA 1B9XC 4JE1A 4NV2A 4KAEA 3GSTA 4Q5FA 1AW9A 1A0FA 4V2MA 3G7YA 3CTFA 4MP4A 4IELA 3GA4A 1O81A 2H70A 1S3AA 2A2SA 2BTOT 4XRDA 2OE0A 2P0GA 3ISOA 4PURA 4ECJA 4TXOB 19GSA 2ZCTA 3DKSA 4K7NA 4MJEA 4KSMA 1KNGA 13GSA 1BYEA 2PPTA 3LGCA 1BG5A 4O7HA 5GSTA 4TR4A 4GSNA 1MEKA 2H0HA 1GTIA 1TI3A 2WB9A 4WBJA 1PX7A 1ZYQB 4ULXA 1SU9A 2AYTA 2C8UA 2VIMA 1ERVA 2TRCP 5JWOB 5DCGA 3EMPA 2WFCA 1PA3A 3ERWA 3FW2A 4JR4A 1UC7A 3IAS2 4MABA 4BWQA 5CRWA 3TB2A 1OKTA 2P5RA 1TI1A 2WULA 3KP9A 2GDRA 5ID2B 4PUAA 3UBLA 2N5BA 3A2XA 4OCFA 2VL9A 5DAKA 2H0GA 3GIXA 1YDKA 1EGOA 4KB3A 1GNWA 2IJYA 1M0UA 2FNOA 2HE3A 1YF1A 1PKWA 2YWIA 4QL9A 1LBKA 1ML6A 2VO4A 1B4PA 1HD2A 4L5LA 2K8VA 4GXZA 2R6KA 3TKSE 2FA8A 3KM6A 3L9UA 6GSXA 2F8FA 3IK7A 1HYUA 4IGJA 2ON5A 5F06A 4JU5A 3GTUA 4WF4A 1DUGA 4ZXGA 5IOXA 4N30A 1VF2A 5HR2A 2L4QA 3I43A 3TOTA 3VI7A 1M2AA 4G10A 1WE0A 7GSSA 2K9FA 4F03A 2LTKA 1QQ2A 2C0EA 1QMVA 1NM3A 4MCUA 3CBUA 2YWOA 4NAXA 2J23A 4N11A 1Z7PA 5IM9A 2G0FA 4IW9A 2X8HA 2RIIA 5E4WA 3M0FA 4I6XA 3G9BA 3M8NA 3F3RA 2JZRA 3KMNA 2CX4A 2H6YA 3ZLPA 3TKSC 3L0HA 4ZL8A 3CTGA 4N0ZA 1A23A 5FWGA 2EIRA 2REMA 1B9YC 2GT5A 4K8MA 4Q5QA 3WT2A 2IMFA 3QPMA 2H6XA 1T7PB 2QC7A 4I5QA 2KOKA 3VPTA 1N2AA 3EWLA 4L0UA 1O85A 1TRSA 1UN2A 1SYRA 3GH6A 3ZVJD 1S3DA 4JR6A 4KDXA 3A3TA 2XBIA 3CYNA 2H1GA 2D2ZA 1XXUA 1SJIA 5B8AA 2AB6A 5AIXA 3A2WA 4TW5A 1B8XA 1FB0A 1FAAA 1I5GA 1GSQA 3APOA 2FGXA 3O3TA 1A2MA 2AHEA 1ACVA 4EF0A 3U5RE 5D9XA 2MBTA 1R5PA 4KW6A 3ZMLA 2R3XA 3UIWA 1M99A 5G30A 2N5AA 2F51A 4EDZA 1EV4A 2GTUA 1R4WA 1TK8B 1XBSA 2ALBA 2C1YA 4FYUA 3QFAC 3S9FA 3C1SA 3D6IA 5J3RA 5IO0A 3FKFA 5CRDA 1O73A 1BJXA 4YH2A 2V6OA 4XTSA 5ECMB 2GSSA 5ECSA 1HNCA 3LXZA 4TR1A 4P3YB 4LLRA 1V9WA 1B4QA 1XW6A 4OMVA 4XIHA 1TU7A 5DVBA 1TW9A 3TGZA 2DJ2A 3ZRDA 5DJMA 3TJBA 1XW9A
chains in the Genus database with same CATH superfamily
2FXTA 1CQSA 3FKAA 1O7NB 1MWTA 3QD9A 3G0KA 4IJIA 4X2HA 4QQ7A 5LD0A 1UCIA 3HZPA 1X5EA 2HI7A 3GX0A 2LJKA 3P7XA 2UX0A 3BU4A 1GY7A 2XHFA 2FWHA 4JEDA 4EKZA 2CFKA 4HJMA 3ERFA 4HOJA 2FWGA 3GZXB 3S67A 4IBPA 1UVZA 1V40A 1IVVA 2M46A 1GNEA 2P38A 1L5GB 1ERUA 2HOHA 2HRFA 3ECFA 5KP3A 2VCQA 1LNHA 4J5GA 3H1NA 5EQLA 1VQM3 2H19A 4CY8A 1QGVA 5AEWB 3UL3A 1X5DA 3LW9A 3HOHA 5M18A 1X1UA 3NHXA 5D81A 1B20A 1WMOA 3TRQA 3HIIA 4BPYA 3NOFA 4PNFA 2OTJ3 4HJLB 3APSA 4POLA 2OE1A 3DY5A 1CYVA 5IEOA 2L4CA 4POMA 5CAXA 1OHSA 1THOA 3G6E3 5A0OB 3AY8A 2GLRA 3C71A 2DIYA 1H75A 4K7IA 4BIKA 2LSTA 1V2AA 4K1FA 1ERWA 1DBYA 1IDPA 1I3FA 2QA1A 1R26A 3KCHA 1ON4A 2CVBA 1SK1A 4R4KA 1GLQA 3DVXA 3JUOA 1EV9A 5CK6A 4KT3B 2YOIA 1BSEA 1YI23 2I81A 4BU4A 3RHBA 2B7JA 1Z7RA 2FA4A 4K2XA 1RK4A 1GSEA 1XOAA 5HFKA 3CC23 3DIEA 5JCWA 4RQRA 2A4VA 2Z77A 5KP4A 3FR3A 4MJCA 4NHFA 1AIUA 1CYUA 5J41A 4WETA 4J9AA 2GBWB 4HZ9B 2VL3A 2C80A 1TUHA 3KTLA 8CHOA 2DJJA 4CHSA 1Q40A 3GKXA 2H72A 8GSSA 3D22A 3ZIJA 1GYBA 5D83A 1PKZA 2NBSA 3QMXA 1T00A 1GY5A 1DMNA 1VF3A 1GOYA 1YJ93 4HI7A 1SL0B 1ULJB 1GSFA 1X9WB 4NV5A 3NBRA 3AMOA 5G1KA 1GSSA 1UI8A 2EIOA 4HM6B 5F8BA 4HAAA 3X41A 4EDYA 3KCMA 3R3EA 2K3DA 1JJ22 5CREA 3EBTA 1BNRA 2I4AA 5F07A 1IYYA 3ERGA 1I2GA 3WMDA 1N9EA 3GX8A 3SEDA 1O7UA 4F9ZA 4N6LA 3SX1A 3KH7A 1I0VA 5CP1A 2GS3A 3LTCA 4XS4A 3CSIA 3OR5A 4FCZA 1GSYA 5EVOA 1XWBA 4MMXB 2O3OA 3SVAA 2C0GA 2YFJB 1EOGA 3W8JA 5DBQA 1W6YA 1J08A 1B48A 2B7KA 3IBHA 3TCOA 2GSTA 1FA3A 4TVEA 3FY7A 2DBCA 3KIIA 2LRTA 3CRTA 3MSZA 2B1LA 2V41A 3KMOA 3EF8A 2V1LA 4OFMA 4J56E 4AEQA 1W2B2 4BTYA 3LG6A 3WYWA 3Q90A 5DAKB 5KOXA 3N5OA 5L71A 4RQXA 1BQ7A 3KP8A 4TKYA 1QFNA 4J57E 4OO5A 3A5EA 1GUHA 1PL1A 1PQNA 1SK0A 2OTL3 2AUVA 3DMCA 2CX3A 3KTBA 1TK5B 2OBKA 3HA9A 1X1YA 3DH2A 5INYA 1T2HA 1VQ83 6GSWA 1V98A 3STDA 2H30A 1WMJA 1Z1SA 3HI7A 3IJEB 2A4HA 2L57A 4FMBA 3T0UA 1XWKA 3GH9A 3GTUB 3ZYWA 3HD5A 4IS0A 4L5OA 1JB5A 4N6OB 5B6NA 1U88A 6GSTA 4KUNA 1H4OA 3M9JA 3LFLA 1RTUA 4HZBB 5G1LA 2PGTA 2BMXA 5IPGA 2V32A 1KSIA 5J5NA 4K9ZA 2QSIA 4TXVA 3LEFA 3FR6A 3CPW2 1OE8A 3F6FA 4Q5NA 5DQYA 4H3UA 4G0KA 3PYJA 2IWTA 1K0CA 6RNTA 1OUNA 1QAFA 1TRUA 4WWUC 2MMZA 1MWSA 3CCR3 2KF6A 2FHEA 3PGTA 1IK3A 3L78A 4Z7XA 2KF5A 1VRSD 2OOVA 2CX1A 4HOHA 3AHWA 2GU3A 4ML6A 2VCWA 4FCMA 4J2FA 4FO5A 4HM4B 1EUIC 1O6JA 1F6MC 2HSYA 2NPBA 4IHUA 4TR0A 3LXTA 3GNJA 2YX9A 3HJMA 2FNQA 1GWCA 3M9KA 1GMQA 4TRXA 2L6CA 1UUVB 1G0TA 4TR3A 1M1K4 2H1AA 4GF0A 2WDUA 3X3ZA 1RGEA 3GURA 5F0GA 4XRAA 2YPMA 1NHYA 1JBSA 4KZ1A 3NZNA 1O7PB 2W9PA 2I9HA 5ECHB 3QAVA 5GSSA 1Q814 5AIGA 1F8NA 2OKAA 2I9WA 1BX9A 1Y4KA 2CC3A 2XGLA 4EE0A 3VWVA 3CNXA 5M19A 2EC4A 2B5YA 4O02B 4CCVA 1K8A4 2O7KA 2LNTA 2MBSA 2E7PA 4ZBAA 4OCEA 4L8OA 2FWEA 2UZ8A 2CT6A 2MC8A 3QDNA 1Z6NA 3W6GA 4CY6A 2F9SA 2IFQA 3FG1A 2RCDA 1N9JA 2HNLA 1W00A 2ZL8A 1PRXA 3BOAA 1GL8A 1O8WA 4ML1A 3EQQB 4E8HA 4O92A 1IT7A 4X2OA 4EIQA 3GKNA 4NPBA 3F3QA 2OADA 1O7GB 2Y74A 3WOFB 2D42A 3ZFZA 2VOCA 1K0OA 4F2IA 1DE2A 1OF5B 4KFDA 4CDOA 1A2KA 2CWVA 3Q19A 4O5QA 1IV9A 1RGAA 1ABAA 3UL6A 3NX0A 1TXXA 3PH9A 4PNGA 1SJZA 1LNIA 2CKFB 2O9UX 3ME8A 3BCKA 2LEGA 5AIIA 2GGTA 4RNTA 1M9BA 2A2RA 4CPKA 2CWTA 3IV4A 2C3QA 10GSA 2ZUPA 2VD0A 3CQFA 3IPZA 1HNBA 1VQP3 1XOBA 4IKHA 3FF2A 3OWSA 3N9HA 5GSPA 2B24B 1RGCA 1JLVA 2HFDA 4X1UA 4ECCA 1LRAA 1GRXA 3IHQA 5F05A 3UJ1A 2INXA 5LCZA 3I6AA 2GZZA 4O2HA 2YZHA 2F99A 5ELGA 4TR1B 1RLSA 1PD21 1X1WA 1M904 2C3TA 4HU9A 3K9MC 2YFIB 4Z2RA 3GL3A 1VQ63 5AYRB 4N6V0 4MJAA 3P90A 1WIKA 3I9V2 5STDA 1RGKA 5G2ZA 3IC4A 1YJW3 1W89A 11GSA 3J7Yb 2FGTA 2I1UA 3Q3FA 1YGWA 2H1BA 3IDVA 3DVWA 4D73A 3LZAA 3GAXA 2LNSA 3KZQA 3K7CA 3TJJA 3QOUA 5D96A 5A5KA 1GMPA 2GQLA 4HSCX 3F14A 4RZMA 4WXTA 3BNEA 1GTUA 4FIWA 1NDOB 3MYTA 1TRVA 4ICYA 1UA5A 4MF6A 3OX9A 3WODG 2QKEA 1Q4JA 2M7OA 1C54A 3VFIA 1QK8A 2D1WA 4IPBA 4BL7A 1FGOA 3F4TA 2Z7AA 2H1DA 3GKKA 2CAQA 1UUWB 1FW1A 2H76A 3EBYA 1X9SB 3F0IA 4AJ8A 2LUSA 3IC8A 3KXOA 2JADA 4WR4A 1A2LA 4DKIA 6GSVA 2ZDJA 2L5OA 3DMLA 4Z2TA 2JZTA 2RFRA 2K18A 1FO5A 4OO4A 1ILOA 1VQ93 2NTOA 1HQOA 1SJ6A 1PGTA 3FHKA 5JCGA 1SARA 2GXFA 4POBA 2XF3A 4XS1A 5AIVA 3LTAA 1OE7A 1T4YA 2WCIA 2GZYA 2RSXA 1A8YA 3FCSB 2LKUA 5HR0A 1OCVA 1KD14 3Q2PA 2IN3A 1YKCA 1NWWA 3EX9A 4WR5A 3O6TA 1TP6A 4HQSA 5B7CA 4LGQA 5HFIA 5IW9A 3DXOA 5IMCA 1K28A 4DSRA 2KAAA 4YKGA 2PVQA 5ECPB 5DJLA 2RM5A 3QK9A 2CQ9A 1VQN3 1ST9A 5D9WA 4FYBA 1RNTA 2UGIA 1VQQA 4I4KA 4MZCA 1TK0B 3H79A 2WRTA 3FF0A 1TRPA 1WRYA 4BWSA 1Q40B 1TOFA 5J4UA 2P31A 1TRWA 1IV7A 2FD3A 4N6MA 4ACSA 3OWUA 4WF5A 2KHPA 1YNVX 1BSCA 4F0BA 1DVCA 3BB9A 2CG1A 4HDEA 3F8XA 4GL6A 3SXXA 3AMOB 2WGQA 3L4NA 3NQYA 1Z9HA 3C8EA 1IT8A 1GOVA 5IMDA 1JLWA 3NQZA 2RLIA 1TKDB 4IP1A 1RRLA 4ZBDA 4KX4A 1JZWA 5JPUA 1GH2A 3CMIA 3IOSA 3EC3A 1BRGA 3LTDA 3HHVA 2F4YA 3HZ8A 5CYYA 3P8WA 1MGWA 3CCS3 1F3AA 7STDA 1US1A 3RGAA 2KUCA 3EMXA 6GSPA 3HCZA 4AGSA 3TKQA 1EOHA 4XS4B 4ORLA 1OYJA 1TIJA 4O3VA 4OD7A 3CCM3 5IPHA 1ZCPA 1BNSA 4XM4A 3I69A 3M3MA 1RGGA 4HZ2A 3V98A 3GMFA 2CW9A 4ZB8A 2IUKA 2GEXA 1AAZA 4ZL7A 1K41A 1AUCA 1SENA 1FUSA 2VLTA 2HMJB 5EEOA 1JNQA 2DKHA 4NREA 3HJPA 4GB5A 3LMLA 3HDCA 3V1WA 3UVHA 5G5FA 5IERA 5HFGA 1M9AA 1WP0A 4IP6A 3RDWA 2ES7A 3X3XA 20GSA 2P5QA 1JZOA 1MD3A 1M3JA 1I2EA 3WA3A 2RGQA 3O8YA 1OPYA 3DEXA 3S5CA 3WGXA 3VLNA 3VSYA 3GKMA 4QWTA 5DQSA 4EL1A 5IIZA 3GN3A 4LZIA 5HQPA 3CRUA 2H6ZA 3SOAA 4ECIA 4STDA 1LQGC 1K734 5B6MA 3GUSA 1M3IA 1B2XA 5IMFA 3DGLA 3JVCA 2YCDA 2OBIA 4V1Ag 3CME3 5CRHA 1O7HB 2FUG2 4K7OA 1XVQA 5IG3A 2BT3A 2IL3A 1E3VA 4GHOA 4N6TA 4HU7A 3N8BA 1I8VA 1W02A 1TFOA 1N8JA 3VWUA 4PQHA 6STDA 2YJHA 5ECKB 2MMAA 2VCVA 1W6GA 1VQK3 4EV2A 4IQAA 1SIIA 2OQEA 2H73A 3MHEA 4FR9A 1J9BA 1J0FA 2X64A 1VGLA 2VCZA 1Q98A 1VQ73 4N6NB 3K8NA 1BNIA 1EKMA 1EEMA 4HJ2A 4I8BA 4KH7A 5DALA 1AQWA 1GY6A 3KN4A 3GWRA 4HZ4A 1NU3A 3FR9A 3MIXA 4I97A 4F82A 3D9RA 4GCIA 1YZXA 2Z76A 2XH9A 4HM7B 5G31A 3EINA 2JQ5A 2KP2A 1EG9B 2N5FA 1YJ6A 4KA0A 3G713 3N9JA 3LJRA 5AI1A 2C4JA 3TJKA 2PZVA 2XPEA 2BIRA 3M8CA 1G6YA 3VWXA 3LYKA 2KF4A 2HRNA 5E59A 1FG4A 1I0XA 3EVIA 3CXGA 4G9HA 1PL2A 2IFQB 3IA1A 3A5IA 1XPVA 3GFKA 1HKXA 3NBBA 5ECIB 4MMZB 3ZITA 2WZ9A 3EB8A 4KVHA 3FSDA 4BVYA 2IY2A 3G4S3 2XGNA 1SJWA 3ROBA 1ZL9A 2KLXA 2HRKA 2BO9B 1AQVA 5G5EA 4NMUA 16GSA 4IJ3A 2KXGA 4JRRA 2L1SA 2GSRA 4CW9A 2MF7A 2O89A 1OHOA 1B2MA 1E3RA 2DC5A 2GQMA 2JDIH 2F3MA 2I3YA 3UVTA 3LYPA 3M1GA 3WT1A 4MK3A 3FZAA 1C7HA 2JSZA 1YIT3 1SQWA 1SD8A 4GRFA 4USSA 3DM8A 1MTCA 1TRQA 5COHA 1TDIA 1D6YA 1I70A 3ZG0A 1JBRA 4WEYA 4EW5A 2LJAA 2YV9A 4XB5A 4G19A 1W01A 1BEDA 1YQ1A 1IVWA 1XVWA 2BU4A 1ZZYA 3CCL3 2HXKA 3C7MA 1U3AA 4NHWA 2WOFA 2OE3A 1MDKA 2E2GA 1WOUA 5D9VA 3TKSA 4WHAA 3A2VA 3Q18A 4OVMA 1XFLA 2CHCA 2CFGA 2W2CA 5KN0A 3B8LA 1N8QA 1GUKA 4I2TA 3L0RA 4IIAA 1IQ8A 1DE1A 3HIGA 1GS3A 4K90B 1YVBI 5D8IA 2TIRA 4JRFA 5AN1A 1HNAA 1Q9EA 3LH4A 3HXSA 3VI5A 2XC2A 2IUJA 4D73B 1IU7A 1VF1A 4K5SA 1G7OA 3PCRA 3DWVA 3D5JA 1LXEA 2R5GA 1FVJA 2P0XA 3DXBA 2AADA 3BIRA 3FLJA 3V99A 3G7IA 2JACA 2XFSA 2HMNB 2XR8B 4X4JA 2F98A 1T2IA 2R4VA 5GZZB 1YVSA 6GSYA 1YKAA 3JUQA 2O87A 4PQIA 3FK8A 2NDOA 3TKRA 5EY6A 3ZVJA 4GSSA 2JSYA 4BL7B 3GZBA 5G2GA 1GMRA 1DSBA 2E0QA 1XWCA 2LRCA 2ZNMA 3BBYA 3RBTA 2G2QA 4ZILA 1BIRA 1GD3A 1T4ZA 4L8PA 3WD6A 2R2JA 1K0DA 5EPFA 2PU9C 3IK9A 4J8TA 4MDCA 3QR6A 2H01A 1RNBA 4V1Ap 3JCML 1GULA 4XBTA 5J9BA 2E2TA 3GYKA 2CZ2A 4HM0B 2DKIA 1I2FA 2IMIA 1BNGA 1AV4A 1C72A 5AISA 2IMEA 1VQ43 1GSUA 4RNZA 1EZKA 5TGNA 2HZFA 4DVCA 1ROAA 1U6TA 4MH3A 3VPQA 1SKRB 4MF5A 1YJN3 1JB4A 3HZ4A 4MZWA 1EWXA 4F0CA 1OC9A 1DETA 2H0IA 1IVUA 2YP6A 3NBJA 2FCHA 4N0VA 2QGVA 4TX4A 2IIYA 5A4UA 12GSA 3QCPA 18GSA 2W56A 1FUWA 4XBYA 2X4AA 1NSWA 4X43A 3FZ4A 1V74A 2B5EA 2VLVA 4XCSA 3CMA3 1ROVA 1THXA 1ZOFA 3IXRA 3K0ZA 1FB6A 3WGEA 4POKA 1PU4A 3CCE3 5CF2A 2LQQA 3IE3A 1STDA 5A4VA 1G02A 3AGNA 4EYCA 4FMAA 1W6CA 3KSPA 4NWYA 2J8XB 3D21A 3GL5A 4DSSA 1S3CA 1EQKA 2R0CA 4MF7A 2BNGA 2QA43 3FEUA 2BMOB 1Q42A 3BLZA 3LWAA 4EC6A 4ILFA 2CFWA 1IQXA 1DE3A 1B2SA 4GQFA 2B1KA 4AKYA 4NXIA 3FYGA 3CC73 2Z6BA 3H93A 2VM1A 1X0RA 4PTSA 2H71A 1UGIA 2RBIA 1M2DA 4PXOA 1QJGA 3IR4A 3EN8A 1A90A 1GLPA 2DJ0A 4HYZA 4PQ1A 1VQO3 5C04A 4HM2B 1OHPA 3T8NA 3U6VA 1K0MA 2M80A 3FZ9A 4TOPA 3D5IA 1Z5YE 3MKIA 3D4AA 2J9HA 1VF4A 1OKDA 1M9GA 3P2AA 4LA1A 5HOHA 2IYJA 4E8EA 2FY6A 4YQVA 1PN0A 1PFOA 3HY2A 2DMLA 2VCTA 3WHOA 1KTEA 2JU5A 1FGRA 1U8CB 4I2UA 1TP9A 1YHQ3 2W04A 1EP8A 1EGRA 2HZEA 5AGYA 4AJ7A 5IEPA 1MDJA 5FHIA 2K6VA 3RPNA 5DCHA 2GQKA 3TJFA 1TFKA 3DUKA 2L6DA 3UL5A 3RPPA 5JPPA 3MWHA 3DGQA 3I553 1WPIA 3OV4A 1B3SA 4O8SA 2F86B 1GTAA 5FGOA 4LL1B 1GP1A 4FYCA 5H5SA 2CWUA 1HZ1A 4K6XA 3EU3A 1TJDA 1ULIB 4MPFA 5AYSC 3Q6OA 1O8XA 1RGHA 3LQ7A 1YEPA 3SWLA 1N5PA 1HU9A 1WNHA 2H74A 1AQXA 3FMWA 2VUPA 5J9CA 2GSPA 3C73A 4L8EA 4JF8A 3UARA 1BGSA 1R5AA 2WS2A 2PVOC 2XEPA 3IHGA 1G7EA 3SYUA 5IG5A 2Z9SA 5ECQB 3GRXA 1S5AA 1FVKA 3C1RA 1RCKA 1K3YA 4G1MB 2SARA 4HKVB 1PSQA 2MZCA 2X99A 5IG4A 3BCIA 1M2BA 4G2EA 4CDLA 1EP7A 3EURA 2STDA 5ECOB 5FW5A 3BNCA 1K0AA 5GAPD 3E99A 1UCJA 1JZDA 3LT9A 4FH8A 1TU5A 3J7Yd 2V6KA 5BVBA 2LQOA 2MMNA 4ZB9A 5IQYA 3TKPA 3DGNA 2QIYA 2AAEA 1A2PA 4GWRA 2VL2A 3WOEB 3T8UA 5DALB 2H8LA 1TTZA 2HMLB 5IF6A 3J7Yk 3VURA 4V2LA 2C0DA 2H75A 4Q5RA 5FT3A 3W8SA 5KN2A 1FOHA 2GSQA 1BAOA 1CQGA 4K2DA 4GTUA 4ZB6A 17GSA 2ON7A 2HSHA 5IMAA 1ZMAA 4N6UA 4KF9A 3F8UA 1RQMA 3NV0A 4WKWA 1A8LA 3WDGB 1CQHA 3KFQC 1RKYA 4JBBA 2CVKA 3D5GA 2FWFA 1W4NA 4K0GA 4YAPA 3TRPA 3MAKA 4HM5B 2IMJA 2IMDA 3L9SA 4MLYA 2XSHB 1LOVA 1B2UA 3LTBA 5CO3A 1A67A 2TRXA 1SYXA 4MJBA 1BNEA 1NW2A 1U3IA 1BAYA 4MMMA 1OC3A 2HMMB 4HUAA 1YIJ3 3Q74A 3E0UA 5A4WA 4PEJA 3I0YA 2PN8A 4BVYB 1FGTA 1RN4A 3L9VA 1HYFA 2PUKC 2LV3A 4IN0A 2RNTA 2YWMA 3MSOA 2HRAA 3SBCA 3TJGA 1SKWB 1DMQA 3EE1A 4KGIA 3NIVA 4PGTA 3R2QA 3G8ZA 3X40A 14GSA 5HR1A 1BRIA 2F5MA 2UUGC 2XSOB 3GZRA 4EV5A 2B6MA 3QAGA 5BXQA 2C10A 1UW1A 4BL3A 1QXHA 2PMTA 4WYKA 3PINA 1KC84 1Q7Y4 2VCXA 2OACA 4ISDA 6GSSA 2B5XA 3RGRA 1LOXA 3A5WA 4EIPA 5AIFA 4WP5A 2RM6A 5HR3A 2VAFA 4TXOA 1MOLA 3RDEA 1V57A 1BU4A 5D93A 1JFUA 5JWRB 5ABRA 1JZRA 1T1VA 3BD2A 4Z2UA 2P05A 1D6UA 3BJ5A 1S723 3D0ZA 4MPGA 3EC9A 1T8EB 3F6DA 2KCDA 2ZHXB 4QL7A 4EVMA 1V58A 1SPUA 5KN3A 2MMOA 3HKRA 5KP1A 4GSTA 3TDGA 2CK3H 1BRNL 3ED3A 1R7HA 3OW22 3VGNA 3B4PA 3HVNA 1AY7A 1GSPA 1K3OA 1XCCA 1ASKA 3S27A 2P0MA 3PZWA 2OOVC 3CCU3 1N8R4 2W0QA 4MH2A 1BANA 2C0FA 5IOWA 1URMA 2K54A 1ISKA 1RW1A 3H4KA 4TN8A 1Q824 3ER7A 2Q07A 1Q864 3UMAA 2GBXB 1JV2B 3F63A 4IT7A 3ME7A 3D79A 3SLUA 5ECLB 5B8BA 1LOYA 4ID0A 2CH9A 4FMCA 1RN1A 5IG0A 1ZGNA 1XWAA 1K0NA 2ZA4A 1LJRA 1W7CA 1F37A 3QFBC 1DMMA 1YEXA 5ID2A 2V1MA 1AR0A 2A2PA 3TOUA 2BMRB 3KEBA 1N5HA 2CA8A 3IMAB 3F4RA 3NM7A 4OFTA 4K61A 3LOYA 1WMNA 5GAND 1MNLA 2HYXA 1XWGA 4KDUA 1ZGXA 4GLTA 1SL2B 2R0GA 4HM1B 2E2VA 4HM8B 1GUMA 2OJLA 4KCEA 3LT8A 3H8QA 2JL4A 4MA9A 1LQMB 1U5OA 1Y25A 2GZPA 3UBKA 1WTHA 3APQA 1UDII 1MD4A 2DLXA 4YQMA 2IA7A 1K3LA 4O32A 4RI7A 1E6BA 3TRXA 2F56A 2O85A 1NHOA 1O7MB 4ZL9A 1O7WB 2B3SA 3DYRA 3F40A 3KJYA 2RUFA 4BVXA 1ERTA 2W9QA 1WWJA 2XPDA 4R9LA 3ZL5A 3CSJA 1T3BA 3Q1CA 5BMUA 5CNWA 1OC9B 2B1XB 1PYLA 2LRNA 3CSHA 1E2YA 4KCAA 4H61A 4KDYA 2LJRA 2PERA 3HYPA 1K0BA 1B21A 1K9M4 4PX1A 3F4SA 2MYGA 4G0LA 1W4VA 4N10A 5IMZA 1YGEA 5ECNB 1BVIA 2LYXA 2DJ3A 2W56B 4AF2A 1IVXA 3MG2A 4HEA2 5I97A 2O8VB 3DRNA 4XHMA 1ZYNA 3RNTA 2QA2A 1B27A 4IVFA 2M72A 5CLKA 2H66A 2C4BA 4L7KA 3MYDA 5D73A 1BNFA 1U87A 1A24A 1XIYA 4YAVA 1NB5I 2GVPA 1SL1B 1UCLA 2YJ7A 3ZIVA 4YQUA 22GSA 2BHMA 2VD1A 4LMVA 2DMMA 3UEMA 3E3EA 3S29A 3JUNA 3ZFBA 3LXUX 4HQZA 2F5WA 3D4TA 2JZSA 4EO3A 5IENA 1JKGA 1JN5A 5ENUA 4DSSB 1Q7HA 2DSAA 2X8GA 1XZOA 4MZBA 5IMVA 3S28A 2XBQA 3EHCA 1F2EA 2YV7A 1PFPA 3B4OA 4HBRA 2CZ3A 4WBRD 4X0XA 4LMWA 1OGXA 4DSQA 3F9UA 3ZTLA 1EA2A 1W5ZA 5CF1A 1EEJA 3NUVA 2L59A 3UOMA 4MNNA 1X9MB 3UB1A 2XRXB 4KE3A 3UAPA 3FZ5A 3LSZA 2BJXA 4MEIA 3D4MA 1B2ZA 4HS1A 4V2NA 3WR2A 1RN7A 9RNTA 2YZUA 4H86A 2KF3A 3H51A 2CIUA 2CAIA 4AJ6A 2HLSA 3ZFLA 2CG0A 1FW7A 2VM2A 9GSSA 2P09A 4KSOA 3O76A 1KQS2 5AIHA 3KH9A 1SKSB 2L4VA 4K0NA 4OFNA 1LU4A 2DJKA 1PX6A 2HMKB 2KRTA 2CX0A 4LEHA 3UNLA 1YF0A 3FRCA 3GSSA 2OA7A 1G96A 1BRHA 3DD3A 2PWJA 1KBNA 3GV1A 2YFLB 3MPHA 3EYTA 3V92A 5M1AA 4RI6A 2HZEB 3ZREA 1Z3EA 2HT9A 3EN1B 1VQL3 3WGDA 3G16A 1A2JA 2XFTA 1ZYEA 1SK2A 1IYIA 2YANA 2YN1A 3MG3A 2YWNA 6GSUA 3OXAA 2X49A 3MNGA 2GT6A 3KE7A 3G7JA 3HVVA 3KGKA 2CVDA 1F3BA 1X5CA 1JB2A 1M7TA 2VL2C 3PS8A 2V2GA 2OCTA 3BNDA 2DIZA 2X8CA 4GSPA 1I9DA 3ZZXA 4EC0A 4J5KA 1Z6MA 3HVSA 3LORA 3RAZA 3MG1A 5H5QA 4K1UA 4DEJA 1STFI 3X3YA 2LS5A 4BA7A 1UUGB 1BSBA 5CRGA 3MDKA 3RHCA 3VWWA 3KIJA 3IAM2 3QAWA 2FLSA 3HK4A 1MDIA 5H5RA 5CXOA 1WJKA 3HVXA 5IO2A 1RSNA 3E9JB 4EXJA 3BNBA 3PR8A 1X1XA 2KP1A 2RUEA 4OK0A 1KEBA 2C3NA 4FCJA 5AEUB 3EE2A 3KD0A 4ZBBA 1A2VA 4ZIJA 5D9TA 5C00A 2AJQB 4L0WA 1ZS7A 1Y6EA 5EVHA 2NVLA 1JRQA 1OGZA 3PGBA 5EL8A 1SD9A 2DJ1A 1J2BA 3TUEA 3EU4A 1GTBA 4ECBA 2R4IA 4EUYA 3K5TA 1OVNA 7GSPA 2QGUA 2CV4A 1OC8A 1D6ZA 1AXDA 1XG8A 4KNDA 5ELAA 2GU1A 3GSPA 5KEJA 4RUVA 1FHEA 1FOVA 2CFLA 4GQCA 4MJDA 3CCV3 1M1XB 3US3A 3GHAA 1USBA 4LMIA 3VK9A 2IPAA 2SBLA 4KFFA 3DGOA 2WJUA 1QVG2 2IMKA 4O5RA 2R0PA 1R4CA 5JCUA 2E2MA 4ZM8A 3ZMKA 2PBJA 4RNYA 2HSMA 1WMPA 5DDLA 1OAZA 1LVNA 1QUWA 5KN1A 4IQ1A 2L5LA 1QVF2 4XDWA 1GSDA 4OWYA 3NV0B 1PMTA 2K8SA 1AC1A 5LNKe 2YNXA 4XS6A 3UJMA 1XW5A 4FQUA 5JWQB 1A0RP 2AAWA 1JHBA 1PN9A 1TU8A 1NNVA 4R1KA 2WGRA 4LL4B 1G6WA 3IRAA 2AV4A 1GOUA 1IYHA 1QAKA 2EIQA 1YY7A 4NHZA 3HJOA 1BRKA 2R37A 1NJI4 4JZQA 5ECRB 3JUMA 2VLUA 2F8AA 4PUFC 1F9MA 3LYGA 4BTWA 5KOWA 1B9XC 3CPOA 4JE1A 4NV2A 3AHSA 4KAEA 5LC7A 3GSTA 7RNTA 4Q5FA 1W2ZA 3JUPA 1AW9A 5BRTA 1BUJA 1A0FA 4V2MA 4YKFA 3PPUA 3G7YA 1CH0A 3CTFA 1OACA 4MP4A 4EBGA 1MWRA 3KSED 4IELA 4WYKB 3K63A 3GA4A 1O81A 2H70A 3CCJ3 1RRHA 1S3AA 3AGOA 2A2SA 3X42A 2BTOT 4XRDA 2OE0A 3VF1A 1RGFA 2P0GA 1NB3I 3ISOA 3A76A 4PURA 4ECJA 4TXOB 1DYUA 19GSA 2ZCTA 4HM3B 3DKSA 4K7NA 4XDVA 4MJEA 4KSMA 1KNGA 13GSA 1BYEA 2PPTA 4BL2A 2LQVA 1BG5A 2ML6A 4FMDA 3LGCA 4O7HA 5GSTA 3KKGA 3PCSA 4TR4A 4GSNA 1FGQA 3PXMA 1BUQA 1MEKA 2H0HA 5BU4A 1GTIA 1TI3A 2WB9A 4WBJA 4LSOA 3F7SA 1PX7A 1ZYQB 4ULXA 1SU9A 1RDSA 2AYTA 2C8UA 2VIMA 1ERVA 2TRCP 2Y73A 2GEYA 5JWOB 4N3VA 5DCGA 3EMPA 2WFCA 1PA3A 3ERWA 3FW2A 4JR4A 1UC7A 3IAS2 2OQEC 3MWZA 1IQYA 2BMQB 4A5PA 3FH1A 5JBSA 4MABA 4BWQA 5CRWA 3TB2A 5D82A 4XBXA 1OKTA 2P5RA 1TI1A 2WULA 3KP9A 5LC6A 2WGOA 1QALA 4CJNA 2GDRA 5ID2B 4PUAA 3OWYA 2K0MA 3UBLA 2W03A 3U1WA 2N5BA 3A2XA 4OCFA 2VL9A 5DAKA 2H0GA 3GIXA 1YDKA 1EGOA 4KB3A 1GNWA 2IJYA 1M0UA 2FNOA 2HE3A 3SOYA 1DVDA 1GD4A 1YF1A 1PKWA 2YWIA 4QL9A 1LBKA 1LOWA 1ML6A 2VO4A 1B4PA 1HD2A 4L5LA 2K8VA 4GXZA 2R6KA 3TKSE 3EJVA 1KWIA 1S3RA 2FA8A 3KM6A 3L9UA 5DREA 2A15A 2R41A 3DGYA 6GSXA 4BTXA 2ML5A 2F8FA 3IK7A 4KFEA 1HYUA 4IGJA 2ON5A 4JU5A 5F06A 3GTUA 4WF4A 1DUGA 3DZLA 4ZXGA 4BVXB 5IOXA 3CCQ3 4N30A 1VF2A 5HR2A 4U13A 2L4QA 3I43A 3TOTA 1BRSA 1AVLA 3VI7A 3CC43 1M2AA 3GRDA 1WE0A 4G10A 3CXC2 7GSSA 4K5RA 2K9FA 4F03A 5DRVA 1ZX2A 2LTKA 1TTOA 1JBTA 1VZZA 1QQ2A 3F7XA 2C0EA 1FYSA 3U97A 1QMVA 1NM3A 4MCUA 3CBUA 3WA2X 2YWOA 4NAXA 8RNTA 2J23A 4N11A 1Z7PA 5IM9A 2G0FA 4IW9A 2X8HA 1I3IA 2C11A 4RBNA 2RIIA 5E4WA 3HX8A 3M0FA 4I6XA 3G9BA 3FG3A 2PNCA 3M8NA 1RCLA 1VQ53 3F3RA 2JZRA 5ELUA 3ZG5A 2CX4A 3KMNA 2H6YA 1JKGB 1JN5B 3TKSC 3ZLPA 3L0HA 4ZL8A 4Q53A 3CTGA 3ALAA 4N0ZA 1A23A 5FWGA 2EIRA 2REMA 1B9YC 2GT5A 4K8MA 4Q5QA 3IPTA 3WT2A 2IMFA 3DGMA 4HVNA 3QPMA 2H6XA 1T7PB 2QC7A 1E97A 4I5QA 1RJOA 3CU3A 2KOKA 3VPTA 1N2AA 3EPTA 3EWLA 4L0UA 1O85A 1UI7A 3CD63 1ZO2A 1UCKA 1TRSA 1UN2A 1T5YA 3NXJA 3I563 1RHLA 1SYRA 3GH6A 1BSDA 3ZVJD 1S3DA 4LYLB 4JR6A 1ZYPA 3A3TA 4KDXA 2XBIA 1R4YA 3CYNA 2H1GA 2D2ZA 1XXUA 4R9KA 3H3HA 3FZWA 1SJIA 5B8AA 1MGRA 4WFOA 2AB6A 1FUTA 5AIXA 3A2WA 1CEWI 4TW5A 3CNMA 1B8XA 4BIRA 2CFDA 1FB0A 1FAAA 2W6JH 1OH0A 3GZYB 1GSQA 1I5GA 3APOA 4O5UA 2FGXA 3O3TA 1A2MA 2AHEA 1ACVA 4EF0A 3U5RE 5ELJA 5D9XA 2MBTA 1R5PA 2QEX3 2WO0A 4KW6A 3ZMLA 2R3XA 3UIWA 1M99A 5G30A 4R80A 2N5AA 1OF5A 2F51A 4EDZA 1EV4A 2GTUA 1WQLB 4MMYB 1R4WA 1BRJA 3F8HA 1XBSA 1TK8B 5RNTA 5BIRA 2ALBA 2C1YA 4FYUA 3FG4A 1AQZA 3QFAC 4G0IA 3S9FA 1NO3A 3C1SA 3D6IA 5J3RA 5IO0A 3FKFA 5CRDA 3N54B 1O73A 3KZTA 1BNJA 3URPA 1BJXA 4YH2A 4AKZA 2V6OA 4XTSA 1UGHI 5ECMB 1RMSA 1SIHA 1BOXA 2GSSA 1FGMA 4OUQA 1QMAA 5ECSA 2E2UA 1HNCA 1PY3A 3LXZA 4TR1A 4P3YB 4LLRA 3B7CA 1V9WA 1B4QA 1XW6A 4OMVA 4XIHA 5HGRA 1TU7A 1MWUA 5DVBA 3QRDA 1AVKA 2OWPA 3D3LA 3F9SA 1TW9A 3TGZA 2HMOB 3NM2A 2DJ2A 3ZRDA 1RGLA 5DJMA 2WOHA 1BSAA 3TJBA 3FGYA 1XW9A 4EXRA 1FZUA 4K1VA
chains in the Genus database with same CATH topology
2FXTA 1CQSA 3FKAA 1O7NB 3QD9A 3G0KA 4IJIA 4X2HA 4QQ7A 5LD0A 3HZPA 1X5EA 2HI7A 3GX0A 2LJKA 3P7XA 2UX0A 1GY7A 2XHFA 2FWHA 4JEDA 4EKZA 2CFKA 4HJMA 3ERFA 4HOJA 2FWGA 3GZXB 3S67A 4IBPA 1UVZA 1V40A 1IVVA 2M46A 1GNEA 2P38A 1L5GB 1ERUA 2HRFA 3ECFA 5KP3A 2VCQA 1LNHA 3H1NA 5EQLA 1VQM3 2H19A 4CY8A 1QGVA 5AEWB 3UL3A 1X5DA 3LW9A 3NHXA 5D81A 1WMOA 3TRQA 3HIIA 4BPYA 3NOFA 4PNFA 2OTJ3 4HJLB 3APSA 4POLA 2OE1A 3DY5A 1CYVA 5IEOA 2L4CA 4POMA 5CAXA 1OHSA 1THOA 3G6E3 5A0OB 3AY8A 2GLRA 3C71A 2DIYA 1H75A 4K7IA 2LSTA 1V2AA 4K1FA 1ERWA 1DBYA 1IDPA 2QA1A 1R26A 2CVBA 1ON4A 1SK1A 4R4KA 1GLQA 3DVXA 3JUOA 1EV9A 5CK6A 2YOIA 1YI23 2I81A 3RHBA 2B7JA 1Z7RA 2FA4A 4K2XA 1RK4A 1GSEA 1XOAA 5HFKA 3CC23 3DIEA 5JCWA 4RQRA 2A4VA 2Z77A 5KP4A 3FR3A 4MJCA 4NHFA 1AIUA 1CYUA 5J41A 4WETA 4J9AA 2GBWB 4HZ9B 2VL3A 2C80A 1TUHA 3KTLA 8CHOA 2DJJA 4CHSA 1Q40A 3GKXA 2H72A 8GSSA 3D22A 3ZIJA 1GYBA 5D83A 1PKZA 2NBSA 3QMXA 1T00A 1GY5A 1DMNA 1VF3A 1YJ93 4HI7A 1SL0B 1ULJB 1GSFA 1X9WB 4NV5A 3NBRA 3AMOA 5G1KA 1GSSA 1UI8A 2EIOA 4HM6B 5F8BA 3X41A 4EDYA 3KCMA 3R3EA 1JJ22 5CREA 3EBTA 2I4AA 5F07A 3ERGA 3WMDA 1N9EA 3GX8A 3SEDA 1O7UA 4F9ZA 4N6LA 3SX1A 3KH7A 5CP1A 2GS3A 3LTCA 4XS4A 3CSIA 3OR5A 4FCZA 1GSYA 5EVOA 1XWBA 4MMXB 2O3OA 3SVAA 2C0GA 2YFJB 1EOGA 3W8JA 5DBQA 1W6YA 1J08A 1B48A 2B7KA 3IBHA 3TCOA 2GSTA 1FA3A 4TVEA 3FY7A 2DBCA 3KIIA 2LRTA 3CRTA 3MSZA 2B1LA 2V41A 3KMOA 3EF8A 2V1LA 4OFMA 4J56E 4AEQA 1W2B2 4BTYA 3LG6A 3WYWA 3Q90A 5DAKB 5KOXA 3N5OA 5L71A 4RQXA 1BQ7A 3KP8A 4TKYA 1QFNA 4J57E 4OO5A 1GUHA 1PL1A 1PQNA 1SK0A 2OTL3 2AUVA 3DMCA 2CX3A 3KTBA 1TK5B 2OBKA 3HA9A 5INYA 1VQ83 6GSWA 1V98A 3STDA 2H30A 1WMJA 1Z1SA 3HI7A 3IJEB 2A4HA 2L57A 4FMBA 3T0UA 1XWKA 3GH9A 3GTUB 3ZYWA 3HD5A 4IS0A 4L5OA 1JB5A 4N6OB 5B6NA 1U88A 6GSTA 4KUNA 1H4OA 3M9JA 3LFLA 4HZBB 5G1LA 2PGTA 2BMXA 5IPGA 2V32A 1KSIA 5J5NA 4K9ZA 2QSIA 4TXVA 3LEFA 3FR6A 3CPW2 1OE8A 3F6FA 4Q5NA 5DQYA 4H3UA 4G0KA 3PYJA 2IWTA 1K0CA 1OUNA 1QAFA 1TRUA 4WWUC 2MMZA 3CCR3 2FHEA 3PGTA 1IK3A 3L78A 4Z7XA 1VRSD 2OOVA 2GU3A 4ML6A 2VCWA 4FCMA 4J2FA 4FO5A 4HM4B 1F6MC 1O6JA 2HSYA 2NPBA 4IHUA 4TR0A 3LXTA 3GNJA 2YX9A 3HJMA 2FNQA 1GWCA 3M9KA 4TRXA 2L6CA 1UUVB 1G0TA 4TR3A 1M1K4 2H1AA 4GF0A 2WDUA 3X3ZA 3GURA 5F0GA 4XRAA 2YPMA 1NHYA 4KZ1A 3NZNA 1O7PB 2W9PA 2I9HA 5ECHB 3QAVA 5GSSA 1Q814 5AIGA 1F8NA 2OKAA 2I9WA 1BX9A 1Y4KA 2CC3A 2XGLA 4EE0A 3VWVA 3CNXA 2EC4A 2B5YA 4O02B 4CCVA 1K8A4 2O7KA 2LNTA 2MBSA 2E7PA 4ZBAA 4OCEA 4L8OA 2FWEA 2UZ8A 2CT6A 2MC8A 3QDNA 1Z6NA 3W6GA 4CY6A 2F9SA 2IFQA 3FG1A 2RCDA 1N9JA 2HNLA 1W00A 2ZL8A 1PRXA 3BOAA 1GL8A 1O8WA 4ML1A 3EQQB 4E8HA 4O92A 1IT7A 4X2OA 4EIQA 3GKNA 4NPBA 3F3QA 2OADA 1O7GB 2Y74A 3WOFB 2D42A 2VOCA 4F2IA 1K0OA 1DE2A 1OF5B 4KFDA 4CDOA 1A2KA 2CWVA 3Q19A 4O5QA 1IV9A 1ABAA 3UL6A 3NX0A 1TXXA 3PH9A 4PNGA 2O9UX 2CKFB 1SJZA 3ME8A 3BCKA 2LEGA 5AIIA 2GGTA 1M9BA 2A2RA 2CWTA 3IV4A 2C3QA 10GSA 2ZUPA 2VD0A 3IPZA 1HNBA 1VQP3 1XOBA 4IKHA 3FF2A 3OWSA 3N9HA 2B24B 1JLVA 2HFDA 4X1UA 4ECCA 1GRXA 3IHQA 5F05A 3UJ1A 2INXA 5LCZA 3I6AA 2GZZA 4O2HA 2YZHA 2F99A 5ELGA 4TR1B 1PD21 2C3TA 1M904 4HU9A 3K9MC 2YFIB 4Z2RA 3GL3A 1VQ63 5AYRB 4N6V0 4MJAA 3P90A 1WIKA 3I9V2 5STDA 5G2ZA 3IC4A 1YJW3 1W89A 11GSA 3J7Yb 2FGTA 2I1UA 2H1BA 3IDVA 3DVWA 4D73A 3LZAA 3GAXA 2LNSA 3KZQA 3K7CA 3TJJA 3QOUA 5D96A 5A5KA 2GQLA 3F14A 4RZMA 4WXTA 3BNEA 1GTUA 4FIWA 1NDOB 3MYTA 1TRVA 4ICYA 1UA5A 4MF6A 3OX9A 3WODG 2QKEA 1Q4JA 2M7OA 3VFIA 1QK8A 2D1WA 4IPBA 4BL7A 1FGOA 3F4TA 2Z7AA 2H1DA 3GKKA 2CAQA 1UUWB 1FW1A 2H76A 3EBYA 1X9SB 3F0IA 4AJ8A 2LUSA 3IC8A 3KXOA 2JADA 4WR4A 1A2LA 6GSVA 2ZDJA 2L5OA 3DMLA 4Z2TA 2JZTA 2RFRA 2K18A 1FO5A 4OO4A 1ILOA 1VQ93 2NTOA 1HQOA 1SJ6A 1PGTA 3FHKA 5JCGA 2GXFA 4POBA 2XF3A 4XS1A 5AIVA 3LTAA 1OE7A 1T4YA 2WCIA 2GZYA 2RSXA 1A8YA 3FCSB 2LKUA 5HR0A 1OCVA 1KD14 3Q2PA 2IN3A 1YKCA 1NWWA 3EX9A 4WR5A 3O6TA 1TP6A 4HQSA 5B7CA 4LGQA 5HFIA 5IW9A 3DXOA 5IMCA 1K28A 4DSRA 4YKGA 2PVQA 5ECPB 5DJLA 2RM5A 3QK9A 2CQ9A 1VQN3 1ST9A 5D9WA 4FYBA 4MZCA 4I4KA 1TK0B 3H79A 2WRTA 3FF0A 1WRYA 4BWSA 1Q40B 1TOFA 5J4UA 2P31A 1TRWA 1IV7A 2FD3A 4N6MA 4ACSA 3OWUA 4WF5A 2KHPA 4F0BA 1DVCA 3BB9A 2CG1A 4HDEA 3F8XA 4GL6A 3SXXA 3AMOB 2WGQA 3L4NA 3NQYA 1Z9HA 3C8EA 1IT8A 5IMDA 1JLWA 3NQZA 2RLIA 1TKDB 4IP1A 1RRLA 4ZBDA 4KX4A 1JZWA 5JPUA 1GH2A 3CMIA 3IOSA 3EC3A 3LTDA 3HHVA 3HZ8A 5CYYA 3P8WA 3CCS3 1F3AA 7STDA 1US1A 3RGAA 2KUCA 3EMXA 3HCZA 4AGSA 3TKQA 1EOHA 4XS4B 4ORLA 1OYJA 1TIJA 4O3VA 4OD7A 3CCM3 5IPHA 1ZCPA 4XM4A 3I69A 3M3MA 4HZ2A 3V98A 3GMFA 2CW9A 4ZB8A 2IUKA 2GEXA 1AAZA 4ZL7A 1K41A 1AUCA 1SENA 2VLTA 2HMJB 5EEOA 1JNQA 2DKHA 4NREA 3HJPA 4GB5A 3LMLA 3HDCA 3V1WA 3UVHA 5G5FA 5IERA 5HFGA 1M9AA 1WP0A 4IP6A 3RDWA 2ES7A 3X3XA 20GSA 2P5QA 1JZOA 1MD3A 3WA3A 2RGQA 3O8YA 1OPYA 3DEXA 3S5CA 3WGXA 3VLNA 3VSYA 3GKMA 4QWTA 5DQSA 4EL1A 5IIZA 3GN3A 4LZIA 5HQPA 3CRUA 2H6ZA 3SOAA 4ECIA 4STDA 5B6MA 1K734 3GUSA 5IMFA 3DGLA 3JVCA 2YCDA 2OBIA 4V1Ag 3CME3 5CRHA 1O7HB 2FUG2 4K7OA 1XVQA 5IG3A 2BT3A 2IL3A 1E3VA 4N6TA 4HU7A 3N8BA 1W02A 1TFOA 1N8JA 3VWUA 4PQHA 6STDA 2YJHA 5ECKB 2MMAA 2VCVA 1W6GA 1VQK3 4EV2A 4IQAA 1SIIA 2OQEA 2H73A 3MHEA 4FR9A 1J9BA 1J0FA 2X64A 1VGLA 2VCZA 1Q98A 1VQ73 4N6NB 3K8NA 1EKMA 1EEMA 4HJ2A 4I8BA 4KH7A 5DALA 1AQWA 1GY6A 3KN4A 3GWRA 4HZ4A 1NU3A 3FR9A 3MIXA 4I97A 4F82A 3D9RA 4GCIA 1YZXA 2Z76A 2XH9A 4HM7B 5G31A 3EINA 2JQ5A 2KP2A 1EG9B 2N5FA 1YJ6A 4KA0A 3G713 3N9JA 3LJRA 5AI1A 2C4JA 3TJKA 2PZVA 2XPEA 3M8CA 1G6YA 3VWXA 3LYKA 2HRNA 5E59A 1FG4A 3EVIA 3CXGA 4G9HA 1PL2A 2IFQB 3IA1A 3A5IA 1XPVA 3GFKA 1HKXA 3NBBA 5ECIB 4MMZB 3ZITA 2WZ9A 3EB8A 4KVHA 3FSDA 4BVYA 3G4S3 2XGNA 1SJWA 3ROBA 1ZL9A 2KLXA 2HRKA 2BO9B 1AQVA 5G5EA 4NMUA 16GSA 4IJ3A 2KXGA 4JRRA 2GSRA 4CW9A 2MF7A 2O89A 1OHOA 1E3RA 2DC5A 2GQMA 2JDIH 2F3MA 2I3YA 3UVTA 3LYPA 3M1GA 3WT1A 4MK3A 3FZAA 1C7HA 2JSZA 1YIT3 1SQWA 1SD8A 4GRFA 4USSA 3DM8A 1MTCA 5COHA 1TDIA 1D6YA 4WEYA 2YV9A 2LJAA 4XB5A 4G19A 1W01A 1BEDA 1YQ1A 1IVWA 1XVWA 1ZZYA 3C7MA 3CCL3 2HXKA 1U3AA 4NHWA 2WOFA 2OE3A 1MDKA 2E2GA 1WOUA 5D9VA 3TKSA 4WHAA 3A2VA 3Q18A 4OVMA 1XFLA 2CHCA 2CFGA 2W2CA 5KN0A 3B8LA 1N8QA 1GUKA 4I2TA 3L0RA 4IIAA 1IQ8A 1DE1A 3HIGA 1GS3A 4K90B 1YVBI 5D8IA 2TIRA 4JRFA 5AN1A 1HNAA 3LH4A 3HXSA 3VI5A 2XC2A 2IUJA 4D73B 1IU7A 1VF1A 4K5SA 1G7OA 3PCRA 3DWVA 3D5JA 1LXEA 2R5GA 1FVJA 2P0XA 3DXBA 3FLJA 3V99A 3G7IA 2JACA 2XFSA 2HMNB 2XR8B 4X4JA 2F98A 2R4VA 5GZZB 6GSYA 1YKAA 3JUQA 2O87A 4PQIA 3FK8A 2NDOA 3TKRA 5EY6A 3ZVJA 4GSSA 2JSYA 4BL7B 3GZBA 5G2GA 1DSBA 2E0QA 1XWCA 2LRCA 2ZNMA 3BBYA 3RBTA 2G2QA 4ZILA 1GD3A 1T4ZA 4L8PA 3WD6A 2R2JA 1K0DA 5EPFA 2PU9C 3IK9A 4J8TA 4MDCA 3QR6A 2H01A 4V1Ap 3JCML 1GULA 4XBTA 5J9BA 2E2TA 3GYKA 2CZ2A 4HM0B 2DKIA 2IMIA 1AV4A 1C72A 5AISA 2IMEA 1VQ43 1GSUA 4RNZA 1EZKA 5TGNA 2HZFA 4DVCA 1ROAA 1U6TA 4MH3A 3VPQA 1SKRB 4MF5A 1YJN3 1JB4A 3HZ4A 4MZWA 1EWXA 4F0CA 1OC9A 2H0IA 1IVUA 2YP6A 3NBJA 2FCHA 4N0VA 2QGVA 4TX4A 2IIYA 5A4UA 12GSA 3QCPA 18GSA 2W56A 1FUWA 4XBYA 2X4AA 1NSWA 4X43A 3FZ4A 1V74A 2B5EA 2VLVA 4XCSA 3CMA3 1ROVA 1THXA 1ZOFA 3IXRA 3K0ZA 1FB6A 3WGEA 4POKA 1PU4A 3CCE3 5CF2A 2LQQA 3IE3A 1STDA 5A4VA 4EYCA 4FMAA 1W6CA 3KSPA 4NWYA 3D21A 3GL5A 4DSSA 1S3CA 1EQKA 2R0CA 4MF7A 2BNGA 2QA43 3FEUA 2BMOB 1Q42A 3BLZA 3LWAA 4EC6A 4ILFA 2CFWA 1IQXA 4NXIA 4GQFA 2B1KA 4AKYA 3FYGA 3CC73 2Z6BA 3H93A 2VM1A 1X0RA 4PTSA 2H71A 1M2DA 4PXOA 1QJGA 3IR4A 3EN8A 1A90A 1GLPA 2DJ0A 4HYZA 4PQ1A 1VQO3 5C04A 4HM2B 1OHPA 3T8NA 3U6VA 1K0MA 2M80A 3FZ9A 4TOPA 1Z5YE 3MKIA 2J9HA 1VF4A 1OKDA 1M9GA 3P2AA 4LA1A 4E8EA 2FY6A 4YQVA 1PN0A 3HY2A 2DMLA 2VCTA 1KTEA 2JU5A 1FGRA 1U8CB 4I2UA 1TP9A 1YHQ3 2W04A 1EP8A 1EGRA 2HZEA 5AGYA 4AJ7A 5IEPA 1MDJA 5FHIA 2K6VA 3RPNA 5DCHA 2GQKA 3TJFA 1TFKA 3DUKA 2L6DA 3UL5A 3RPPA 5JPPA 3MWHA 3DGQA 3I553 1WPIA 3OV4A 4O8SA 2F86B 1GTAA 5FGOA 4LL1B 1GP1A 4FYCA 5H5SA 2CWUA 4K6XA 3EU3A 1TJDA 1ULIB 4MPFA 5AYSC 3Q6OA 1O8XA 3LQ7A 1YEPA 3SWLA 1N5PA 1HU9A 1WNHA 2H74A 1AQXA 3FMWA 2VUPA 5J9CA 3C73A 4L8EA 4JF8A 3UARA 1R5AA 2WS2A 2PVOC 2XEPA 3IHGA 1G7EA 5IG5A 2Z9SA 5ECQB 3GRXA 1S5AA 1FVKA 3C1RA 1K3YA 4G1MB 4HKVB 1PSQA 2MZCA 2X99A 5IG4A 3BCIA 1M2BA 4G2EA 4CDLA 1EP7A 3EURA 2STDA 5ECOB 5FW5A 3BNCA 1K0AA 5GAPD 3E99A 1JZDA 3LT9A 4FH8A 1TU5A 3J7Yd 2V6KA 5BVBA 2LQOA 2MMNA 4ZB9A 5IQYA 3TKPA 3DGNA 2QIYA 4GWRA 2VL2A 3WOEB 3T8UA 5DALB 2H8LA 1TTZA 2HMLB 5IF6A 3J7Yk 3VURA 4V2LA 2C0DA 2H75A 4Q5RA 5FT3A 3W8SA 5KN2A 1FOHA 2GSQA 1CQGA 4K2DA 4GTUA 4ZB6A 17GSA 2ON7A 2HSHA 5IMAA 1ZMAA 4N6UA 4KF9A 3F8UA 1RQMA 3NV0A 4WKWA 1A8LA 3WDGB 1CQHA 3KFQC 1RKYA 4JBBA 2CVKA 2FWFA 1W4NA 4K0GA 4YAPA 3TRPA 3MAKA 4HM5B 2IMJA 2IMDA 3L9SA 4MLYA 2XSHB 3LTBA 5CO3A 1A67A 2TRXA 1SYXA 4MJBA 1U3IA 1NW2A 1BAYA 4MMMA 1OC3A 2HMMB 4HUAA 1YIJ3 3Q74A 3E0UA 5A4WA 4PEJA 3I0YA 2PN8A 4BVYB 1FGTA 3L9VA 2PUKC 2LV3A 4IN0A 2YWMA 3MSOA 2HRAA 3SBCA 3TJGA 1SKWB 1DMQA 3EE1A 4KGIA 3NIVA 4PGTA 3R2QA 3G8ZA 3X40A 14GSA 5HR1A 2XSOB 3GZRA 4EV5A 2B6MA 3QAGA 5BXQA 2C10A 1UW1A 3PINA 1QXHA 2PMTA 4WYKA 1KC84 1Q7Y4 2VCXA 2OACA 4ISDA 6GSSA 2B5XA 3RGRA 1LOXA 3A5WA 4EIPA 5AIFA 4WP5A 2RM6A 5HR3A 2VAFA 4TXOA 1MOLA 3RDEA 1V57A 5D93A 1JFUA 5JWRB 5ABRA 1JZRA 1T1VA 3BD2A 4Z2UA 2P05A 1D6UA 3BJ5A 1S723 3D0ZA 4MPGA 3EC9A 1T8EB 3F6DA 2KCDA 4QL7A 4EVMA 1V58A 1SPUA 5KN3A 2MMOA 3HKRA 5KP1A 4GSTA 3TDGA 2CK3H 3ED3A 1R7HA 3OW22 3VGNA 3B4PA 1K3OA 1XCCA 1ASKA 3S27A 2P0MA 3PZWA 2OOVC 3CCU3 1N8R4 2W0QA 4MH2A 2C0FA 5IOWA 1URMA 2K54A 1ISKA 1RW1A 3H4KA 4TN8A 1Q824 3ER7A 2Q07A 1Q864 3UMAA 2GBXB 1JV2B 3F63A 4IT7A 3ME7A 3SLUA 5B8BA 5ECLB 4ID0A 2CH9A 4FMCA 5IG0A 1ZGNA 1XWAA 1K0NA 1LJRA 1W7CA 1F37A 3QFBC 1DMMA 1YEXA 5ID2A 2V1MA 1AR0A 2A2PA 3TOUA 2BMRB 3KEBA 1N5HA 2CA8A 3IMAB 3F4RA 3NM7A 4OFTA 4K61A 3LOYA 1WMNA 5GAND 1MNLA 2HYXA 1XWGA 4KDUA 4GLTA 1SL2B 2R0GA 4HM1B 2E2VA 4HM8B 1GUMA 2OJLA 4KCEA 3LT8A 3H8QA 2JL4A 4MA9A 1U5OA 1Y25A 2GZPA 3UBKA 1WTHA 3APQA 1MD4A 2DLXA 4YQMA 2IA7A 1K3LA 4O32A 4RI7A 1E6BA 3TRXA 2O85A 1NHOA 1O7MB 4ZL9A 1O7WB 2B3SA 3DYRA 3F40A 3KJYA 2RUFA 4BVXA 1ERTA 2W9QA 1WWJA 2XPDA 4R9LA 3ZL5A 3CSJA 1T3BA 3Q1CA 5BMUA 5CNWA 1OC9B 2B1XB 2LRNA 3CSHA 1E2YA 4KCAA 4H61A 4KDYA 2LJRA 2PERA 3HYPA 1K0BA 1K9M4 4PX1A 3F4SA 2MYGA 4G0LA 1W4VA 4N10A 5IMZA 1YGEA 5ECNB 2LYXA 2DJ3A 2W56B 4AF2A 1IVXA 3MG2A 4HEA2 5I97A 2O8VB 3DRNA 4XHMA 1ZYNA 2QA2A 4IVFA 2M72A 5CLKA 2H66A 4L7KA 3MYDA 5D73A 1U87A 1A24A 1XIYA 4YAVA 1NB5I 2GVPA 1SL1B 3ZIVA 2YJ7A 4YQUA 22GSA 2BHMA 2VD1A 4LMVA 2DMMA 3UEMA 3E3EA 3S29A 3JUNA 3ZFBA 3LXUX 4HQZA 4EO3A 3D4TA 2JZSA 5IENA 1JKGA 1JN5A 5ENUA 4DSSB 2DSAA 2X8GA 1XZOA 4MZBA 5IMVA 3S28A 2XBQA 3EHCA 1F2EA 2YV7A 1PFPA 3B4OA 4HBRA 2CZ3A 4WBRD 4X0XA 4LMWA 1OGXA 4DSQA 3F9UA 3ZTLA 1EA2A 1W5ZA 5CF1A 1EEJA 3NUVA 2L59A 3UOMA 4MNNA 1X9MB 3UB1A 2XRXB 4KE3A 3UAPA 3FZ5A 3LSZA 2BJXA 4MEIA 3D4MA 4HS1A 4V2NA 1RN7A 2YZUA 4H86A 3H51A 2CIUA 2CAIA 4AJ6A 2HLSA 3ZFLA 2CG0A 2VM2A 9GSSA 2P09A 4KSOA 3O76A 1KQS2 5AIHA 3KH9A 1SKSB 2L4VA 4K0NA 4OFNA 1LU4A 2DJKA 1PX6A 2HMKB 2KRTA 4LEHA 3UNLA 1YF0A 3FRCA 3GSSA 2OA7A 1G96A 3DD3A 2PWJA 1KBNA 3GV1A 2YFLB 3MPHA 3EYTA 3V92A 4RI6A 2HZEB 3ZREA 1Z3EA 2HT9A 3EN1B 1VQL3 3WGDA 3G16A 1A2JA 2XFTA 1ZYEA 1SK2A 1IYIA 2YANA 2YN1A 3MG3A 2YWNA 6GSUA 3OXAA 2X49A 3MNGA 2GT6A 3KE7A 3G7JA 3HVVA 3KGKA 2CVDA 1F3BA 1X5CA 1JB2A 1M7TA 2VL2C 3PS8A 2V2GA 2OCTA 3BNDA 2DIZA 2X8CA 1I9DA 3ZZXA 4EC0A 1Z6MA 3HVSA 3LORA 3RAZA 3MG1A 5H5QA 4K1UA 4DEJA 1STFI 3X3YA 2LS5A 4BA7A 5CRGA 3MDKA 3RHCA 3VWWA 3KIJA 3IAM2 3QAWA 2FLSA 3HK4A 1MDIA 5H5RA 5CXOA 1WJKA 3HVXA 5IO2A 3E9JB 4EXJA 3BNBA 3PR8A 2KP1A 2RUEA 4OK0A 1KEBA 2C3NA 4FCJA 5AEUB 3EE2A 3KD0A 4ZBBA 1A2VA 4ZIJA 5D9TA 5C00A 2AJQB 4L0WA 1Y6EA 5EVHA 2NVLA 1JRQA 1OGZA 3PGBA 5EL8A 1SD9A 2DJ1A 1J2BA 3TUEA 3EU4A 1GTBA 4ECBA 2R4IA 4EUYA 3K5TA 1OVNA 2CV4A 2QGUA 1OC8A 1D6ZA 1AXDA 5ELAA 4KNDA 2GU1A 5KEJA 4RUVA 1FHEA 1FOVA 2CFLA 4GQCA 4MJDA 3CCV3 1M1XB 3US3A 3GHAA 1USBA 4LMIA 3VK9A 2IPAA 2SBLA 4KFFA 3DGOA 2WJUA 1QVG2 2IMKA 4O5RA 2R0PA 1R4CA 5JCUA 2E2MA 4ZM8A 3ZMKA 2PBJA 4RNYA 2HSMA 1WMPA 5DDLA 1OAZA 1LVNA 1QUWA 5KN1A 4IQ1A 2L5LA 1QVF2 4XDWA 1GSDA 4OWYA 3NV0B 1PMTA 2K8SA 1AC1A 5LNKe 2YNXA 4XS6A 3UJMA 1XW5A 4FQUA 5JWQB 1A0RP 2AAWA 1JHBA 1PN9A 1TU8A 4R1KA 2WGRA 4LL4B 1G6WA 3IRAA 2AV4A 1IYHA 1QAKA 2EIQA 1YY7A 4NHZA 3HJOA 2R37A 1NJI4 4JZQA 5ECRB 3JUMA 2VLUA 2F8AA 4PUFC 1F9MA 3LYGA 4BTWA 5KOWA 1B9XC 3CPOA 4JE1A 4NV2A 4KAEA 5LC7A 3GSTA 4Q5FA 1W2ZA 3JUPA 1AW9A 5BRTA 1A0FA 4V2MA 4YKFA 3PPUA 3G7YA 3CTFA 1OACA 4MP4A 4EBGA 3KSED 4IELA 4WYKB 3K63A 3GA4A 1O81A 2H70A 3CCJ3 1RRHA 1S3AA 2A2SA 3X42A 2BTOT 4XRDA 2OE0A 3VF1A 2P0GA 1NB3I 3ISOA 3A76A 4PURA 4ECJA 4TXOB 1DYUA 19GSA 2ZCTA 4HM3B 3DKSA 4K7NA 4XDVA 4MJEA 4KSMA 1KNGA 13GSA 1BYEA 2PPTA 3LGCA 2LQVA 1BG5A 2ML6A 4FMDA 4O7HA 5GSTA 3KKGA 3PCSA 4TR4A 4GSNA 1FGQA 3PXMA 1BUQA 1MEKA 2H0HA 1GTIA 1TI3A 2WB9A 4WBJA 4LSOA 3F7SA 1PX7A 1ZYQB 4ULXA 1SU9A 2AYTA 2C8UA 2VIMA 1ERVA 2TRCP 2Y73A 2GEYA 5JWOB 4N3VA 5DCGA 3EMPA 2WFCA 1PA3A 3ERWA 3FW2A 4JR4A 1UC7A 3IAS2 2OQEC 3MWZA 1IQYA 2BMQB 4A5PA 3FH1A 5JBSA 4MABA 4BWQA 5CRWA 3TB2A 5D82A 4XBXA 1OKTA 2P5RA 1TI1A 2WULA 3KP9A 5LC6A 2WGOA 1QALA 2GDRA 5ID2B 4PUAA 3OWYA 2K0MA 3UBLA 2W03A 3U1WA 2N5BA 3A2XA 4OCFA 2VL9A 5DAKA 2H0GA 3GIXA 1YDKA 1EGOA 4KB3A 1GNWA 2IJYA 1M0UA 2FNOA 2HE3A 3SOYA 1DVDA 1GD4A 1YF1A 1PKWA 2YWIA 4QL9A 1LBKA 1ML6A 2VO4A 1B4PA 1HD2A 4L5LA 2K8VA 4GXZA 2R6KA 3TKSE 3EJVA 1KWIA 2FA8A 3KM6A 3L9UA 5DREA 2A15A 6GSXA 4BTXA 2ML5A 2F8FA 3IK7A 4KFEA 1HYUA 4IGJA 2ON5A 4JU5A 5F06A 3GTUA 4WF4A 1DUGA 3DZLA 4ZXGA 4BVXB 5IOXA 3CCQ3 4N30A 1VF2A 5HR2A 4U13A 2L4QA 3I43A 3TOTA 1AVLA 3VI7A 3CC43 1M2AA 3GRDA 1WE0A 4G10A 3CXC2 7GSSA 4K5RA 2K9FA 4F03A 5DRVA 1ZX2A 2LTKA 1VZZA 1QQ2A 3F7XA 2C0EA 3U97A 1QMVA 1NM3A 4MCUA 3CBUA 3WA2X 2YWOA 4NAXA 2J23A 4N11A 1Z7PA 5IM9A 2G0FA 4IW9A 2X8HA 2C11A 4RBNA 2RIIA 5E4WA 3HX8A 3M0FA 4I6XA 3G9BA 3FG3A 2PNCA 3M8NA 1VQ53 3F3RA 2JZRA 5ELUA 3KMNA 2CX4A 2H6YA 1JKGB 1JN5B 3TKSC 3ZLPA 3L0HA 4ZL8A 4Q53A 3CTGA 3ALAA 4N0ZA 1A23A 5FWGA 2EIRA 2REMA 1B9YC 2GT5A 4K8MA 4Q5QA 3IPTA 3WT2A 2IMFA 3DGMA 4HVNA 3QPMA 2H6XA 1T7PB 2QC7A 1E97A 4I5QA 1RJOA 3CU3A 2KOKA 3VPTA 1N2AA 3EPTA 3EWLA 4L0UA 1O85A 1UI7A 3CD63 1ZO2A 1TRSA 1UN2A 1T5YA 3NXJA 3I563 1SYRA 3GH6A 3ZVJD 1S3DA 4JR6A 1ZYPA 3A3TA 4KDXA 2XBIA 3CYNA 2H1GA 2D2ZA 1XXUA 4R9KA 3H3HA 3FZWA 1SJIA 5B8AA 4WFOA 2AB6A 5AIXA 3A2WA 1CEWI 4TW5A 3CNMA 1B8XA 2CFDA