3TDGA

Structural and functional characterization of helicobacter pylori dsbg
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
232
structure length
232
Chain Sequence
QDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTKVENTTKKIFESGVIKGVPFLYHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural and functional characterization of Helicobacter pylori DsbG
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 77
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18257 DsbG_N Disulfide isomerase DsbG N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.520 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3tdgA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tdgA02
3EVIA 3L4NA 4GF0A 3F63A 4KSMA 2IJYA 2P31A 4D73A 1HNCA 4AJ6A 4TR3A 2V6OA 3HZ8A 4ECJA 1VF3A 3MSZA 1W89A 2AAWA 1U88A 5JCGA 3ZMLA 2E2MA 2C3TA 3HVVA 4NMUA 3E3EA 1X5CA 2GZZA 2CX4A 3N9JA 2LKUA 4TN8A 2RIIA 2HT9A 3GX0A 3ZRDA 3GKNA 5ECMB 4K2DA 1SK0A 1U6TA 3ZREA 4KA0A 1TRWA 2OADA 1K0CA 2IMFA 5ECQB 3GKMA 3P90A 2H75A 3GMFA 4TXOA 5J3RA 2LTKA 2BJXA 2F3MA 5LCZA 2VLUA 5IO0A 2JZRA 4OFNA 2EC4A 3F4RA 3HVSA 2M46A 4YAPA 4K8MA 4GSNA 1KNGA 3HCZA 4RUVA 1NHYA 4KW6A 1NM3A 1O81A 1YF0A 2MMNA 1FVKA 4MF6A 1ERVA 5ECLB 3ISOA 2RUEA 2YWMA 5CYYA 3KXOA 1TJDA 1X5DA 1XOAA 4GTUA 4QQ7A 2QGVA 1F3AA 1DUGA 3A2XA 4FIWA 3CRTA 4ZB8A 4HS1A 2X8HA 2XBIA 2YWIA 3RBTA 3Q74A 4XRDA 3ZZXA 2IN3A 3CTFA 2JU5A 1Z6NA 3QFBC 2O89A 1FAAA 1O8XA 5D9XA 1OE7A 1F3BA 2VLTA 2K8VA 2VO4A 1DSBA 3DEXA 3TRPA 1XW9A 2HRNA 3LJRA 3J7Yk 4WBJA 1AIUA 2GZPA 4TOPA 3RDWA 5A4VA 3BJ5A 4CDOA 2JL4A 1J0FA 2GVPA 4KX4A 3TGZA 20GSA 2D2ZA 2Z9SA 4KDXA 2MYGA 3H8QA 2M72A 2GT5A 5JWOB 2KHPA 4ZL8A 2PBJA 3BD2A 2C1YA 1B48A 3GHAA 4K7IA 2N5FA 2C8UA 2PPTA 3IOSA 11GSA 3F3QA 3E9JB 4TKYA 10GSA 2B5YA 2ZNMA 3LORA 5DQSA 1OC8A 1F37A 4JE1A 3DMLA 3LEFA 2DMMA 4GXZA 3GN3A 5IMCA 3A2VA 4Z7XA 5D73A 4I6XA 1A2JA 4ILFA 1ZZYA 1RQMA 1THOA 3HHVA 3RHBA 2C0EA 4ID0A 4MJBA 5HFIA 4DVCA 1YF1A 2H1BA 1ERTA 4YAVA 4CHSA 2IFQA 2IWTA 1YZXA 3G7YA 3G7JA 2MMZA 2R5GA 3PGTA 1QUWA 2HRFA 3H93A 5FT3A 2O7KA 5ENUA 5ECPB 1O7UA 2E7PA 1SJZA 1K0MA 2KOKA 5IIZA 5IQYA 22GSA 1JLWA 2FA8A 2YJHA 5EL8A 1TU8A 4FO5A 4I5QA 2XPDA 5IMFA 5A4UA 2WB9A 1U3AA 3M1GA 3C73A 5F8BA 3ZITA 2ZUPA 4WF5A 1THXA 4MJAA 1XBSA 1PL1A 1VGLA 5CRHA 5JWQB 4D73B 2L6DA 5GSTA 2V2GA 4BVXA 1B4PA 4LMWA 1K0OA 2F9SA 3IRAA 3CSIA 4ML6A 3KH7A 1EV4A 3G7IA 3GSSA 4K6XA 1GULA 9GSSA 3TRXA 1EEJA 3QAGA 1NHOA 2VCTA 2TRCP 3TKSA 1R4WA 4L8EA 2H01A 2VIMA 3FRCA 1GSFA 2H1AA 5DJMA 4KAEA 1Q98A 3I69A 4NHWA 2P5RA 3EURA 3GFKA 4JRRA 3ERGA 1PKWA 4MABA 1WOUA 4IGJA 1SL1B 3A2WA 2MBTA 5GSSA 1ZGNA 4ULXA 4ZXGA 3EE2A 1G7EA 1PMTA 3D4MA 2NDOA 4TXOB 1TRVA 5C04A 4HJ2A 1T4ZA 2VL9A 4IW9A 5IPGA 1XVQA 1T00A 1ERUA 4IN0A 3FW2A 3RAZA 2XBQA 1H75A 3C71A 3BOAA 1FO5A 2OJLA 2GSRA 2OBKA 1QFNA 4HQZA 6GSYA 5DALA 1XWCA 3ZTLA 3HD5A 2K18A 4GQCA 5IOXA 1SKSB 1GNWA 1I9DA 1GSSA 3HXSA 3H4KA 2MBSA 3LGCA 4EE0A 4V2LA 2NTOA 1SJ6A 1EV9A 1GTIA 3ZLPA 1ZYQB 2YZHA 4XHMA 1J9BA 3GKXA 1A24A 1PX7A 2WCIA 2OBIA 5J9BA 2YV7A 4WR4A 3ERWA 3KTBA 4XS4B 4F0CA 2YCDA 2FWEA 3RPPA 1EP8A 4G19A 1U3IA 4MCUA 2VUPA 2BMXA 1BG5A 4F9ZA 1OKDA 2VM2A 4V1Ag 4J2FA 4ZL7A 18GSA 4MJEA 5B8AA 2WFCA 3HY2A 1WMJA 1SENA 3EU3A 4NV2A 3GL5A 4WF4A 2CT6A 1A0RP 2WJUA 1G6WA 1GUMA 4KH7A 2L4QA 2ON7A 4WEYA 4ZBAA 2L4CA 2H1DA 4GRFA 1ZOFA 2O87A 4GSSA 3MNGA 2PU9C 3UVHA 1K0NA 2R3XA 1FB6A 1CQGA 2LEGA 3ZVJA 3VPQA 6GSXA 3FK8A 1F6MC 1X9SB 2C0DA 3LG6A 3F0IA 2LNTA 3KZQA 1T3BA 2DJ0A 4MZWA 2R6KA 3V1WA 3BCIA 1YKCA 3A5WA 4F0BA 2LJKA 5G5FA 3VI7A 1JLVA 2OE3A 3QFAC 5G31A 3WGXA 2FHEA 1S3AA 3GNJA 3MWHA 5F0GA 1FG4A 2IFQB 2H6YA 4ISDA 4MLYA 3VWVA 2HYXA 3DWVA 2CAQA 1OC9A 4I97A 2XPEA 2H0IA 2P5QA 3FR3A 3KTLA 1JZDA 2RUFA 1EGRA 2J23A 3QD9A 2DJJA 4BVYA 2N5BA 4EL1A 4MPGA 3LWAA 3DVXA 1Q4JA 2K9FA 2LRTA 4KNDA 3WYWA 1M2BA 1PGTA 5HFKA 1AC1A 5B7CA 3JCML 5HR0A 2DJ2A 2NVLA 12GSA 3VWWA 3ME7A 3TRQA 5AGYA 4IKHA 2IMKA 1V58A 1R7HA 1JZWA 3Q19A 3VK9A 1ML6A 3UVTA 2OE0A 4JBBA 2X8CA 4G10A 1EP7A 3IBHA 5CRGA 2ON5A 3ZFLA 3GH9A 3KJYA 1G6YA 4NHZA 4TR1A 4IS0A 4HUAA 3F9UA 4XS1A 2LV3A 3GA4A 2H19A 4J57E 4NPBA 3M8NA 1FHEA 4KUNA 3KIJA 3TJFA 2V6KA 1YDKA 4ECBA 3L9UA 3HYPA 4MK3A 5CRWA 4XS6A 4JR6A 4K0NA 3GX8A 1X5EA 5F06A 1EOHA 2VL3A 4P3YB 3NIVA 4HZ2A 5DJLA 2DLXA 1MTCA 3DYRA 5DCHA 2RLIA 3M3MA 2OE1A 5DALB 1R5AA 5DDLA 2WZ9A 3EC3A 1WJKA 3FR9A 2LQOA 4MZCA 4EDYA 4N30A 3C1RA 5AISA 2LJAA 2LS5A 1XWAA 4RQRA 5C00A 1BQ7A 2FD3A 3I43A 4XS4A 1QXHA 6GSUA 5G1LA 3TKPA 1K0AA 1YQ1A 2VCXA 3QDNA 3HKRA 3LFLA 2LSTA 1KTEA 3GUSA 1OYJA 5ID2B 5DAKA 3CYNA 3KP9A 4N0ZA 5ECIB 4LL1B 2FGXA 4YQMA 1XW5A 2WGRA 2OKAA 3WGEA 1ZL9A 4NV5A 2H8LA 2QSIA 4G2EA 2B1KA 2YNXA 4MDCA 4Q5NA 1GSEA 1C72A 1M7TA 3D6IA 3I9V2 1GLPA 1DBYA 1OVNA 1IYHA 2TIRA 2GQLA 3ZIJA 4XIHA 3PR8A 1HNBA 4PNGA 4JEDA 1NW2A 2MMOA 2PWJA 4N11A 1WPIA 1XCCA 3LSZA 1GTUA 1K3OA 3QCPA 2YOIA 1HYUA 3GL3A 2WS2A 4I2TA 3TOUA 2IMDA 3FHKA 1GUHA 1A2LA 4ZL9A 3LQ7A 3SBCA 1V9WA 4V1Ap 4EKZA 1HD2A 2LRNA 1VF4A 3VWUA 3TCOA 1O73A 4WETA 1B9YC 2VL2C 2FWHA 5CP1A 4ECIA 4WBRD 4I2UA 2ALBA 2KUCA 2DIZA 16GSA 4MH3A 2FNOA 4FYUA 2H72A 1MDKA 1ERWA 1A8LA 2TRXA 3IAM2 4ZBBA 3M0FA 2B7JA 2HLSA 1V2AA 3HVXA 1AXDA 3FZ4A 3FR6A 1OC9B 3LYKA 2XHFA 1SD8A 2IPAA 3KM6A 5D9VA 3UJ1A 2L59A 4KCAA 1G7OA 2H1GA 1I5GA 4WKWA 2C0GA 4F82A 4POLA 3IDVA 3CSJA 4I8BA 4IQ1A 5JWRB 3VI5A 5IMDA 2DJ3A 2H6XA 2J9HA 1HNAA 2PERA 2C3QA 2DMLA 1BJXA 2IIYA 1O8WA 2L6CA 5DCGA 3QR6A 4HEA2 1SKRB 1XOBA 2B7KA 4OO5A 2B3SA 4MP4A 3ZVJD 1GSDA 4DSQA 2HI7A 2H66A 3GURA 5CO3A 5HQPA 2GTUA 2I3YA 2VD0A 4L5LA 1PA3A 3HA9A 3O6TA 2KLXA 4ML1A 1XXUA 3MDKA 1TDIA 3M9JA 5DVBA 3UARA 13GSA 2GGTA 1JFUA 2GSTA 1O6JA 3ZIVA 4EVMA 1FOVA 2YJ7A 1S3CA 3QOUA 4ZB9A 5J5NA 3F6FA 3TDGA 4RI7A 1AW9A 2MZCA 5ECKB 3WD6A 3WT1A 3U5RE 2A4VA 4TR1B 5KN0A 2X99A 5B8BA 1RK4A 2REMA 3FY7A 1VF1A 3EMPA 4F2IA 2HZEA 4QL9A 4BWQA 5F07A 4MZBA 1MDIA 6GSWA 3LXTA 3IA1A 3FKFA 3H79A 2JSYA 3AY8A 4OWYA 1U87A 2PGTA 3TOTA 1B4QA 4IVFA 1WWJA 2A2RA 2CQ9A 2PMTA 3GIXA 4DEJA 5FHIA 1TRSA 3S9FA 4KGIA 1SD9A 3WT2A 3CBUA 3O3TA 6GSTA 1G0TA 2NBSA 5GAPD 4WR5A 14GSA 1M0UA 2HXKA 3VWXA 5IMZA 3UBLA 5ECHB 2YANA 5JCWA 1E2YA 1URMA 1SL2B 3P7XA 1TU7A 1X9WB 1ABAA 3J7Yb 3HJOA 2H70A 4K7OA 2HFDA 1PSQA 4PUAA 3VLNA 4XCSA 2R2JA 5ID2A 2VAFA 4MPFA 3D0ZA 4GSTA 5KEJA 1MD4A 5DAKB 3H1NA 1T4YA 4GLTA 2CVBA 4HZ4A 3L9SA 3Q6OA 1B9XC 5H5QA 2F8FA 3SWLA 5D93A 2YWOA 1A2MA 2IL3A 1N2AA 2HSHA 3C7MA 1JZOA 2C4JA 4ZIJA 3Q18A 1Z5YE 1K0BA 5ELGA 2B5XA 3ZFBA 2X64A 1GLQA 4YQUA 2MMAA 2L5OA 1VF2A 3UL3A 1LU4A 1MEKA 3N5OA 3DGQA 2H71A 5E59A 3MAKA 2P0GA 1ZMAA 5A5KA 5HR3A 1A23A 4HOJA 4OCFA 3NZNA 4MF7A 4EF0A 2FLSA 3O76A 4RI6A 5G5EA 5ABRA 2GSQA 1GWCA 3NOFA 2NPBA 5H5RA 3W6GA 2VCQA 1GSYA 2PUKC 1YEPA 2VM1A 2K6VA 3CSHA 1MD3A 2PVOC 3US3A 3DVWA 2N5AA 3FYGA 5D9TA 2YP6A 4MF5A 2ZCTA 1DE1A 2FCHA 4HDEA 3IXRA 4IP1A 2LQQA 3KEBA 1HQOA 2H74A 1SK1A 2H76A 1O85A 2QKEA 1ILOA 5GAND 5DQYA 4OCEA 3KMOA 4LLRA 2C3NA 4BWSA 1Z3EA 5B6MA 4HQSA 4JR4A 2CVDA 1PQNA 2L57A 5CNWA 1F2EA 1GNEA 4O5RA 2VOCA 4JZQA 3DKSA 2CZ2A 3IK7A 3KCMA 1H4OA 4YH2A 4L5OA 4EUYA 3I6AA 4IELA 3CXGA 4KSOA 1R5PA 4E8EA 4OO4A 3IHQA 2OA7A 3TKQA 5AN1A 4IJ3A 6GSSA 1V40A 4KDUA 3GV1A 2O85A 1BYEA 4GCIA 4RQXA 4IBPA 3R2QA 3IV4A 1TI3A 2RM5A 3VURA 1XVWA 2GSSA 1W4VA 2L5LA 5J4UA 2VL2A 3GYKA 2CZ3A 5J41A 1PL2A 5J9CA 1GH2A 2KP2A 4EC0A 1BEDA 1GL8A 4DSRA 1TK8B 2FUG2 1Y6EA 3VFIA 4TR4A 4H86A 4AF2A 3EWLA 2HSYA 1T7PB 1TK0B 1VRSD 1PD21 1TKDB 1KEBA 5CRDA 3G9BA 3F3RA 2HZEB 1FB0A 2IMEA 2VD1A 1WRYA 3HZ4A 4FH8A 1OAZA 4N10A 2E0QA 1K0DA 1K3LA 1Z6MA 1UC7A 2DJKA 3KH9A 2G2QA 5FWGA 5GZZB 3EU4A 4L0WA 2AYTA 4PX1A 4TRXA 4GQFA 1ON4A 1XIYA 2AB6A 3TJBA 1SYRA 2M80A 4KDYA 4K1FA 4XRAA 2WULA 4FYCA 2F8AA 3F4TA 4BA7A 5ECNB 6GSVA 1AQXA 1K3YA 1SK2A 3PINA 4OFMA 1XWBA 3D21A 3K8NA 5F05A 1WP0A 2DC5A 5IMAA 1PKZA 1M9BA 2EIQA 2GZYA 1PN9A 5A4WA 3F4SA 1XW6A 4V2NA 4KCEA 2PN8A 3LYPA 2G0FA 3VPTA 3DRNA 1USBA 3ED3A 3KGKA 1WE0A 2HNLA 3UOMA 1QMVA 5L71A 4PGTA 3GSTA 4OFTA 2XC2A 3D22A 3HDCA 1YJ6A 1AAZA 4O32A 2CV4A 3L78A 3UEMA 1GSUA 5B6NA 4HU9A 1CQHA 1Z7PA 2V32A 1GRXA 4DSSB 1XPVA 1GP1A 1YY7A 3GRXA 1S3DA 4BPYA 5HFGA 1EGOA 17GSA 5E4WA 1AUCA 1GSQA 2O8VB 3TUEA 3BCKA 2CX3A 3DD3A 2K8SA 4QL7A 3TJGA 5IM9A 3PH9A 2WDUA 2RM6A 4WXTA 1SYXA 5LNKe 4L0UA 2GT6A 3QPMA 4IP6A 2VCZA 4POBA 4Q5QA 2DIYA 1AQWA 5IOWA 3IE3A 3CMIA 4BL7A 2V41A 4HI7A 1MDJA 1PRXA 4E8HA 2H0GA 2EIRA 1A0FA 5ELAA 1TRUA 1TI1A 1OC3A 5D9WA 5G30A 1NSWA 2CVKA 4ZILA 3RHCA 3CTGA 3C8EA 1SL0B 4HU7A 1AQVA 1WIKA 4IQAA 2R4VA 5EY6A 1JZRA 5EPFA 1EOGA 5IMVA 1J08A 1PX6A 5H5SA 2LUSA 4AJ8A 4PQ1A 4OD7A 4POKA 1M99A 1B8XA 1GTAA 2DJ1A 2YZUA 2C80A 3HJPA 4YQVA 4XTSA 1T8EB 3HJMA 3L0HA 1UA5A 2OACA 3E0UA 3FZ5A 5ECRB 1BAYA 2A2SA 2AV4A 5D96A 3GTUA 4EXJA 7GSSA 3FEUA 1ZCPA 1XWKA 1JHBA 2DBCA 4IHUA 2F51A 1X0RA 1TXXA 3TJJA 5AIXA 3QAVA 2GDRA 4LA1A 4MH2A 4K0GA 2JZTA 1BX9A 5COHA 3KP8A 1KBNA 3ME8A 3IK9A 2ES7A 5ECOB 2FY6A 5IPHA 2LJRA 2HE3A 4JU5A 4ECCA 4IJIA 4PNFA 5EVOA 5IO2A 1GTBA 2FWFA 2JSZA 2FWGA 3IC4A 2VCWA 4V2MA 2VLVA 4MJCA 4G9HA 4GWRA 3FZ9A 1TTZA 4Q5FA 4PURA 5AIVA 1QQ2A 1UN2A 1V57A 1XFLA 3F8UA 2JZSA 4ZB6A 4ZBDA 2KP1A 3W8JA 3KD0A 3EINA 3P8WA 2LRCA 4Q5RA 1TW9A 5KN3A 4PUFC 3QMXA 3QAWA 1QK8A 3EYTA 2CA8A 3FZAA 4X0XA 1SU9A 1UVZA 3APSA 1TP9A 1SJIA 2AUVA 3UBKA 1M9AA 4J56E 1Z9HA 2CAIA 4TVEA 4K9ZA 1EEMA 4PQHA 4LMVA 4FYBA 3A3TA 2YN1A 1X9MB 2AJQB 1EZKA 3TKSE 1F9MA 1ST9A 1M2DA 2LNSA 2BTOT 1YKAA 5G2ZA 2B1LA 5JCUA 2WRTA 2HZFA 4LL4B 5HR1A 4MA9A 2V1MA 4EO3A 2DSAA 2I9HA 3TKRA 4O92A 2H30A 2YV9A 3IR4A 4DSSA 1V98A 1LBKA 4TR0A 4CW9A 2VCVA 2JACA 1LJRA 5G1KA 1GUKA 5KN1A 5DBQA 3TJKA 4X1UA 19GSA 5INYA 4N0VA 2C0FA 3APQA 2YPMA 1R26A 1M2AA 4PXOA 3C1SA 3UMAA 3ZYWA 4OMVA 3GKKA 2QC7A 4F03A 4O7HA 3CRUA 1XWGA 3EMXA 4KE3A 1OE8A 2H0HA 2R37A 3WGDA 2B5EA 1RW1A 2H6ZA 1XZOA 1IYIA 1E6BA 1YEXA 1FW1A 2AHEA 1TOFA 3KMNA 3OR5A 3ZL5A 3D5JA 1DE2A 4AJ7A 3LXZA 2X8GA 3ERFA 4AGSA 2E2GA 2H73A 1TK5B 2GQKA 2B6MA 1FVJA 5CREA 3DXBA 3F6DA 3TKSC 1ZYEA 2GLRA 4NAXA 8GSSA 3TB2A 4MMMA 3BBYA 4TW5A 1SKWB 5HR2A 3UAPA 3ZMKA 3L9VA 4NXIA 4PQIA 2JADA 1ACVA 2I1UA 3W8SA 1Y25A 1T1VA 3GH6A 3U6VA 2YWNA 3M9KA 2FA4A 2GQMA 4X43A 2EIOA 4NWYA 5KN2A 4K7NA 1OKTA 2I4AA 3D4TA 4TXVA 1QGVA 4KB3A 1N8JA 3IPZA 1A8YA 5CAXA 5LD0A 2GS3A 2PVQA 2I81A 4HJMA 3IAS2 4ACSA 3GTUB 1EWXA 3UIWA 3RPNA 1Z7RA 2IMIA 4POMA 5D8IA 4EDZA 5ECSA 3APOA 3DIEA 3P2AA
chains in the Genus database with same CATH superfamily
3EVIA 3ALAA 3L4NA 4GF0A 2Y74A 3F63A 4KSMA 2IJYA 2P31A 1VQK3 4D73A 1HNCA 1R4CA 3MYTA 4IIAA 4BU4A 4TR3A 4AJ6A 2V6OA 3HZ8A 4ECJA 2HRKA 4N6UA 3HK4A 1VF3A 3MSZA 1W89A 2XGLA 1GY5A 2AAWA 2K0MA 1VQ43 1U88A 5JCGA 3ZMLA 2E2MA 2C3TA 3HVVA 4NMUA 3E3EA 1X5CA 2GZZA 1MNLA 2CX4A 3N9JA 3MWZA 2LKUA 4TN8A 3ECFA 2D42A 2RIIA 1GY7A 2HT9A 3GX0A 3ZRDA 3JUQA 3GKNA 5ECMB 4K2DA 1SK0A 4J5KA 1U6TA 3ZREA 4KA0A 2KAAA 1TRWA 2OADA 1K0CA 8CHOA 5D83A 2IMFA 5ECQB 2HMKB 3GKMA 4MMYB 3P90A 3RGRA 2H75A 3GMFA 1I2EA 4TXOA 5J3RA 3T8NA 2LTKA 1Y4KA 2BJXA 3WR2A 2F3MA 5LCZA 2VLUA 1NJI4 2JZRA 4OFNA 2EC4A 5IO0A 3F4RA 3HVSA 2M46A 4YAPA 1G96A 4K5SA 4K8MA 5AI1A 1BANA 4GSNA 1RNBA 1KNGA 3MG1A 3HCZA 4RUVA 1IDPA 4KFDA 3JUMA 1NHYA 4KW6A 3V99A 1NM3A 1CQSA 1LOYA 2AADA 1YIT3 1O81A 1YF0A 2MMNA 1FVKA 3N8BA 3DZLA 4MF6A 1ERVA 5ECLB 3ISOA 3K0ZA 2RUEA 2YWMA 5CYYA 3S29A 3KXOA 1TJDA 1X5DA 1XOAA 4GTUA 4QQ7A 4MMZB 2QGVA 1F3AA 2WGOA 1DUGA 1UI7A 4FCJA 3A2XA 4FIWA 3CRTA 4ZB8A 1B2SA 1BSBA 4HS1A 2X8HA 4G1MB 2UZ8A 2XBIA 5BRTA 2YWIA 3OWUA 2W04A 3RBTA 3Q74A 1IYYA 2CX1A 1Q7HA 4XRDA 3BLZA 3ZZXA 2IN3A 3LYGA 3CTFA 2JU5A 1Z6NA 3QFBC 2O89A 5M18A 1FAAA 2E2TA 1O8XA 3Q90A 5D9XA 3F9SA 3DGLA 1OE7A 1F3BA 2JQ5A 1BNFA 2K8VA 2VLTA 2VO4A 1DSBA 3DEXA 1IV7A 3TRPA 1XW9A 3S67A 1M3JA 2F98A 2HRNA 3LZAA 3LJRA 3J7Yk 3D79A 4WBJA 1AIUA 2GZPA 4TOPA 2BMOB 3EBYA 1TTOA 3RDWA 3BJ5A 4CDOA 2JL4A 5A4VA 1J0FA 2GVPA 2DKHA 4KX4A 3TGZA 5BVBA 20GSA 2D2ZA 3MG3A 2Z9SA 4KDXA 2MYGA 3DXOA 1HU9A 3H8QA 2MF7A 2M72A 5CLKA 2GT5A 5JWOB 1LXEA 2F5MA 2KHPA 4ZL8A 2PBJA 3BD2A 2C1YA 1B48A 1UUVB 3GHAA 4K7IA 2N5FA 1RRHA 2C8UA 3KN4A 2PPTA 3IOSA 3RGAA 11GSA 3F3QA 3J7Yd 1B2MA 3WOFB 3E9JB 5IERA 1ZYPA 4TKYA 3EC9A 4XBTA 2B5YA 10GSA 2ZNMA 3LORA 5DQSA 1S5AA 1OC8A 1EG9B 1F37A 4JE1A 3DMLA 3LEFA 2DMMA 1OCVA 4GXZA 3GN3A 5IMCA 3A2VA 4Z7XA 5AIHA 5D73A 4Q53A 4I6XA 1A2JA 4ILFA 1ZZYA 1RQMA 1THOA 3HHVA 3EN1B 3RHBA 2C0EA 1LNHA 3OW22 4ID0A 4MJBA 3HZPA 5HFIA 4DVCA 2OQEC 1YF1A 3MSOA 1PFOA 4G0LA 2RNTA 2H1BA 1ERTA 4YAVA 4CHSA 2IFQA 3EB8A 2IWTA 1YZXA 3G7YA 3CCJ3 3G7JA 2MMZA 4CY6A 2R5GA 5BXQA 1VQ53 3PGTA 1QUWA 2HRFA 3H93A 4A5PA 5FT3A 2O7KA 5ENUA 3SOYA 5ECPB 1O7UA 2HMJB 2E7PA 3S28A 3NM7A 1SJZA 1K0MA 1YJW3 2KOKA 5IIZA 5IQYA 1N5HA 22GSA 1JLWA 2FA8A 2OCTA 2QGUA 2YJHA 5EL8A 1TU8A 4FO5A 4KVHA 1B3SA 3D5IA 3FF2A 4I5QA 3X41A 2CG1A 2P0MA 1CYVA 3CCR3 4BVYB 2XPDA 5IMFA 1JN5A 1W6GA 1FGMA 1LVNA 5A4UA 2WB9A 1U3AA 1VQO3 1D6YA 3M1GA 4BL3A 1WNHA 1BNGA 3FLJA 3C73A 3NUVA 5FGOA 1RLSA 5F8BA 3ZITA 2FGTA 2ZUPA 2P05A 2GU3A 4EXRA 1THXA 4WF5A 3GAXA 4O2HA 1CYUA 1XBSA 4MJAA 3FG3A 1PL1A 1VGLA 3CXC2 5CRHA 5JWQB 4D73B 2L6DA 5GSTA 2V2GA 2CFDA 4BVXA 3KE7A 2OOVA 1B4PA 4LMWA 1K0OA 1ZX2A 3CCS3 2F9SA 3IRAA 1MWRA 3ZG0A 3CSIA 3FCSB 4ML6A 3KH7A 1EV4A 3FSDA 3G7IA 3GSSA 4K6XA 1GULA 2GEXA 9GSSA 3TRXA 1EEJA 3QAGA 1NHOA 2VCTA 2TRCP 8RNTA 3TKSA 1R4WA 4L8EA 1DETA 3LT9A 1F8NA 2H01A 3PGBA 2VIMA 3FRCA 1GSFA 2R0GA 3SXXA 2H1AA 1AR0A 1K28A 5DJMA 1ZO2A 3S27A 4KAEA 2XH9A 1Q98A 3I69A 1OH0A 4NHWA 2P5RA 4Z2UA 3EURA 3GFKA 4X4JA 4JRRA 3ERGA 1PKWA 3NM2A 4MABA 4EIQA 2P38A 1Q7Y4 1GD4A 1WOUA 3SYUA 4IGJA 3A2WA 2MBTA 5GSSA 1SL1B 5I97A 5LC6A 1ZGNA 4ULXA 1X1XA 4ZXGA 3EE2A 4CY8A 1G7EA 1PMTA 3D4MA 2NDOA 4TXOB 1TRVA 5C04A 4HJ2A 3WODG 1T4ZA 2VL9A 3E99A 1OUNA 1I3IA 4IW9A 5IPGA 2CKFB 3FG4A 1V74A 1XVQA 1IU7A 1T00A 1ERUA 4IN0A 3FW2A 3RAZA 2XBQA 4N6MA 1H75A 3C71A 1M1XB 3BOAA 1T5YA 1FO5A 2OJLA 4N3VA 2GSRA 2OBKA 2UGIA 1QFNA 4HQZA 6GSYA 5DALA 3CMA3 1XWCA 1NU3A 3K5TA 1W4NA 1C7HA 4PTSA 3ZTLA 2CWTA 3HD5A 2K18A 4GQCA 5IOXA 1SKSB 1GNWA 1I9DA 1K734 1GSSA 2WO0A 1MGRA 2W9QA 3HXSA 3H4KA 3BIRA 2MBSA 3LGCA 3IMAB 3NV0A 4EE0A 4V2LA 4FMCA 1Q9EA 2NTOA 1SJ6A 1EV9A 1GTIA 4IT7A 3ZLPA 1ZYQB 1O7WB 1AQZA 2YZHA 4XHMA 1J9BA 3GKXA 1B2UA 1A24A 4LYLB 1PX7A 2WCIA 3EHCA 2OBIA 5A0OB 5J9BA 4R80A 2YV7A 4WR4A 2LQVA 2F86B 3ERWA 3KTBA 3DM8A 4XS4B 4F0CA 2YCDA 1KQS2 2FWEA 3RPPA 1EP8A 3WMDA 4G19A 1HZ1A 2RFRA 3Q3FA 1B20A 7STDA 4AKYA 1U3IA 1RMSA 4MCUA 2VUPA 4N6OB 4RZMA 1SIIA 5IENA 2SBLA 2BMXA 1BG5A 4F9ZA 1OKDA 2VM2A 4V1Ag 2AAEA 4J2FA 4ZL7A 18GSA 2YFJB 4GL6A 4MJEA 5B8AA 2WFCA 1VZZA 3HY2A 1WMJA 1SENA 3EU3A 3LT8A 3BNCA 4NV2A 3GL5A 3UL6A 4WF4A 1VQQA 1Q864 2CT6A 1A0RP 2WJUA 1G6WA 1GUMA 4KH7A 2L4QA 3OX9A 2ON7A 4WEYA 4ZBAA 2L4CA 2H1DA 4GRFA 3EE1A 1ZOFA 2O87A 4GSSA 1VQ63 3MNGA 2PU9C 3UVHA 1K0NA 2R3XA 1FB6A 1KC84 1CQGA 2LEGA 2F99A 3ZVJA 3Q2PA 3VPQA 6GSXA 3FK8A 1DMQA 5ELJA 1F6MC 1PFPA 1X9SB 1I3FA 1WTHA 2WOFA 4FCZA 1X1UA 2C0DA 3IHGA 3LG6A 3F0IA 2LNTA 3FH1A 3KZQA 1T3BA 1OHPA 2DKIA 2DJ0A 4MZWA 2R6KA 3V1WA 3BCIA 1ZGXA 1I2GA 1YKCA 2L4VA 4K1VA 1UCLA 3A5WA 4F0BA 2LJKA 2ZL8A 5G5FA 3VI7A 2BU4A 3D9RA 1FGQA 1JLVA 4XDVA 1AVLA 3N9HA 2OE3A 3QFAC 3BB9A 5G31A 3WGXA 2FHEA 3STDA 1S3AA 4HYZA 3GNJA 2W6JH 4XM4A 3MWHA 1BNJA 5F0GA 3GWRA 1FG4A 2IFQB 2IUJA 2H6YA 2GBXB 4ISDA 4MLYA 3VWVA 2HYXA 3DWVA 1WQLB 2CAQA 3GZRA 1OC9A 4I97A 1EA2A 2XPEA 2H0IA 2P5QA 1D6ZA 3FR3A 2XSOB 3KTLA 3UL5A 1JZDA 1NDOB 1O7HB 2RUFA 1EGRA 3S5CA 2A15A 2RCDA 2OWPA 2J23A 3QD9A 1FUTA 2C10A 2DJJA 4BVYA 2N5BA 2CFGA 4EL1A 1B2ZA 4R4KA 4MPGA 2D1WA 3LWAA 3DGOA 3DVXA 1JKGB 1Q4JA 3BNBA 1YJN3 2K9FA 2LRTA 4KNDA 4MEIA 3WYWA 5JBSA 1M2BA 1JJ22 2FXTA 1PGTA 3ZFZA 5HFKA 1SPUA 4HVNA 1GMRA 1TP6A 2PZVA 1AC1A 5B7CA 3JCML 5HR0A 1TRQA 1K41A 3DUKA 1YI23 3UJMA 1VQ73 4IPBA 2DJ2A 5D81A 2NVLA 12GSA 3VWWA 3EN8A 3ME7A 3TRQA 5AGYA 4IKHA 2IMKA 1V58A 1W6YA 1R7HA 2ZDJA 1JZWA 3Q19A 3VK9A 1NWWA 4H3UA 1N9JA 1ML6A 3UVTA 4BVXB 5IF6A 2KF6A 2X49A 5CF2A 2OE0A 4L8PA 1IQXA 4JBBA 4JRFA 2X8CA 4G10A 1EP7A 3IBHA 1BRNL 2ON5A 5CRGA 3ZFLA 3GH9A 4N6NB 3F40A 3AGNA 3KJYA 3NQZA 5LC7A 3JUPA 2CG0A 1G6YA 4NHZA 2XRXB 3JUOA 1LQGC 4TR1A 5KP1A 4FR9A 4IS0A 4HUAA 3F9UA 1FGTA 1JB5A 4TX4A 1FW7A 4XS1A 5EEOA 2LV3A 3GA4A 2OQEA 2H19A 4J57E 4NPBA 3M8NA 1W6CA 2K3DA 1FHEA 4KUNA 3KIJA 3TJFA 2V6KA 1YDKA 4ECBA 3G6E3 1AV4A 1YIJ3 1WMOA 3L9UA 3B7CA 3M8CA 3HYPA 4MK3A 1QALA 3CPW2 5CRWA 2WGQA 1DVDA 2HMOB 1W7CA 4XS6A 4JR6A 1NB5I 4K0NA 4YKGA 1M1K4 3GX8A 4J9AA 1X5EA 5F06A 1EOHA 1RHLA 4ICYA 1JV2B 2VL3A 4P3YB 1N8R4 3NIVA 4HZ2A 1I2FA 5DJLA 2DLXA 1YGEA 3VF1A 1SJWA 1TUHA 3I0YA 5ELUA 1MTCA 3DYRA 5DCHA 3NXJA 3OWSA 2RLIA 3M3MA 2OE1A 5DALB 1I8VA 3F7XA 1R5AA 5DDLA 2R0PA 4BTWA 2WZ9A 3EC3A 2IY2A 1US1A 1WJKA 3FR9A 2RGQA 2LQOA 4MZCA 4EDYA 1FUWA 4N30A 3C1RA 5AISA 4KZ1A 2LJAA 1UCIA 3PS8A 3NV0B 1DE3A 2LS5A 1XWAA 4RQRA 5C00A 1BQ7A 2FD3A 5DREA 4BL2A 3T8UA 3I43A 4XS4A 1QXHA 6GSUA 5G1LA 3TKPA 4HM1B 1SARA 1K0AA 1YQ1A 2VCXA 1YGWA 1PU4A 3QDNA 3HKRA 3F8HA 1SQWA 3LFLA 4R9KA 2LSTA 1KTEA 3GUSA 2BMRB 1OYJA 2XEPA 5ID2B 4K5RA 5DAKA 3CYNA 4BTYA 3CME3 3KP9A 4N0ZA 5ECIB 4LL1B 1A2KA 2FGXA 4YQMA 1XW5A 1JNQA 2WGRA 2OKAA 3Q1CA 3WGEA 1N5PA 1ZL9A 4NV5A 2H8LA 2QSIA 4G2EA 2B1KA 2YNXA 4MDCA 3KFQC 1GSEA 3CCQ3 4Q5NA 1C72A 1M7TA 2CK3H 3D6IA 5IG0A 3CPOA 4KF9A 3I9V2 1GLPA 1DBYA 1FGRA 4KFFA 1OVNA 1IYHA 2TIRA 2GQLA 3DGMA 5KP4A 3ZIJA 4XIHA 3LXUX 3PR8A 1HNBA 4PNGA 4JEDA 1MWUA 1NW2A 5GSPA 2MMOA 2PWJA 4N11A 1WPIA 1XCCA 3VSYA 3QK9A 4HM0B 3LSZA 1GTUA 2Z7AA 2CH9A 1K3OA 3QCPA 2YOIA 2KXGA 1HYUA 1IV9A 3GL3A 4BIKA 2WS2A 4I2TA 1BRHA 3TOUA 1RGEA 1O7MB 2IMDA 2KF3A 1WMNA 3FHKA 1GUHA 2R41A 1A2LA 4AEQA 1S3RA 4ZL9A 3LQ7A 3SBCA 1V9WA 4V1Ap 4EKZA 1HD2A 3NBRA 3NHXA 2LRNA 1VF4A 2ZHXB 3VWUA 2V1LA 5IG3A 3QRDA 3TCOA 2IMJA 1O73A 4WETA 1B9YC 2VL2C 2CC3A 2FWHA 1BUJA 4WYKA 2Q07A 5CP1A 1U5OA 4ECIA 4WBRD 4I2UA 2ALBA 2KUCA 2DIZA 5DRVA 3F8XA 2E2VA 3ER7A 16GSA 4MH3A 3DY5A 2FNOA 1QVG2 4FYUA 2H72A 1MDKA 1ERWA 1A8LA 2TRXA 1W2B2 2FNQA 3IAM2 3U1WA 4ZBBA 2HMNB 5AIFA 3M0FA 2HMMB 2B7JA 2HLSA 1V2AA 4KFEA 3HVXA 2BT3A 1AXDA 3FZ4A 3PYJA 3FR6A 1OC9B 3LYKA 1GOYA 1O7NB 2W2CA 2XHFA 2QA43 1SD8A 2X4AA 2IPAA 3KM6A 5D9VA 3UJ1A 2L59A 1JKGA 3LTCA 2WOHA 4N6V0 4KCAA 1BSAA 1G7OA 2H1GA 1I5GA 4WKWA 2C0GA 4F82A 4POLA 3IDVA 2QA2A 1YJ93 3CSJA 4I8BA 4IQ1A 5JWRB 3VI5A 5IMDA 2DJ3A 2H6XA 1UGHI 6STDA 2HRAA 2J9HA 1HNAA 2PERA 2C3QA 2DMLA 1BJXA 2IIYA 1O8WA 2L6CA 5DCGA 3QR6A 4HEA2 1SKRB 1XOBA 3AHWA 2B7KA 3CNXA 4OO5A 2B3SA 4MP4A 3ZVJD 1GSDA 3LMLA 4DSQA 2HI7A 1O7PB 2H66A 3GURA 5CO3A 5HQPA 2GTUA 2I3YA 2VD0A 4L5LA 1PA3A 4K1UA 3X42A 3HA9A 1ZYNA 3O6TA 3K9MC 3AGOA 1A90A 2KLXA 4ML1A 1XXUA 3JVCA 3MDKA 1W2ZA 1TDIA 3M9JA 5DVBA 4JF8A 3UARA 3I553 13GSA 2GGTA 2R4IA 1JFUA 4H61A 2O3OA 2GSTA 1ZS7A 4OUQA 1O6JA 3ZIVA 4EVMA 1FOVA 2YJ7A 1S3CA 3QOUA 4ZB9A 4CPKA 5J5NA 4WFOA 3F6FA 3TDGA 4RI7A 1VQM3 1AW9A 3KIIA 2MZCA 5ECKB 3WD6A 3WT1A 3U5RE 2A4VA 4TR1B 5KN0A 2X99A 4HM2B 5B8BA 4LMIA 2SARA 1RK4A 2REMA 3FY7A 1VF1A 1O7GB 3EMPA 3CQFA 1ULJB 4F2IA 2W9PA 2CFWA 1BSDA 2HZEA 4QL9A 4G0IA 1GYBA 4BWQA 1QJGA 5F07A 3FMWA 4MZBA 1MDIA 6GSWA 3LXTA 1DVCA 3IA1A 2OTL3 3LTDA 4K61A 3FKFA 3H79A 4HM7B 2JSYA 3AY8A 4OWYA 1U87A 2PGTA 1FGOA 1STDA 4I4KA 4EC6A 3TOTA 1B4QA 1A2PA 1A67A 4IVFA 1WWJA 2W0QA 3EF8A 3PPUA 2A2RA 4HZ9B 2CQ9A 2PMTA 3GIXA 4DEJA 1QMAA 5FHIA 1TRSA 3S9FA 2UX0A 1R4YA 2XFSA 4KGIA 2XFTA 3K7CA 3D5GA 4RNTA 2CFLA 1SD9A 3WT2A 3CBUA 3O3TA 5CK6A 1LOWA 6GSTA 1G0TA 2NBSA 5GAPD 4WR5A 14GSA 1G02A 1M0UA 1Q824 2HXKA 3VWXA 5IMZA 1IVUA 3UBLA 1DYUA 5ECHB 1GS3A 2YANA 3KSED 5JCWA 2CIUA 1E2YA 1RGFA 1URMA 1SL2B 2STDA 3P7XA 2KF4A 1TU7A 1B21A 1X9WB 1ABAA 3J7Yb 1EUIC 1NB3I 3JUNA 3H3HA 3HJOA 2H70A 4K7OA 2HFDA 1PSQA 1GY6A 4HBRA 4PUAA 1MWTA 2Z77A 3VLNA 4XCSA 2R2JA 2Z76A 5ID2A 2VAFA 4MPFA 3CD63 2KF5A 1RGKA 3D0ZA 4GSTA 5KEJA 1B27A 2GEYA 3OV4A 4FMAA 2BHMA 2GXFA 1MD4A 5DAKB 3H1NA 1T4YA 4GLTA 2CVBA 1BNRA 4HZ4A 1BU4A 2MC8A 2CFKA 3L9SA 3Q6OA 1BSEA 1B9XC 1NO3A 5H5QA 2F8FA 5JPPA 5D93A 3SWLA 2YWOA 1LQMB 1A2MA 5IG4A 1UW1A 3PCRA 3I563 2IL3A 1N2AA 2HSHA 1OACA 3C7MA 1JZOA 2C4JA 4ZIJA 4RNZA 3X3XA 3Q18A 1Z5YE 4Z2RA 2F4YA 1RNTA 1K0BA 5ELGA 5M1AA 2B5XA 3ZFBA 4HKVB 2X64A 3IC8A 1RGGA 1GLQA 1ROAA 3EJVA 4YQUA 2MMAA 2L5OA 1OF5B 1VF2A 3UL3A 1LU4A 1MEKA 3V98A 1RGLA 1YHQ3 3N5OA 3DGQA 2H71A 5E59A 3MAKA 1FZUA 1ZMAA 2P0GA 4X2HA 1BOXA 5A5KA 1A23A 5HR3A 4HOJA 1KWIA 3NZNA 4OCFA 4MF7A 1BUQA 4EF0A 2FLSA 1FUSA 3G0KA 3O76A 3F14A 3H51A 4RI6A 5G5EA 5ABRA 3FKAA 2GSQA 1GWCA 4LSOA 3NOFA 1JBRA 1GMPA 3AMOA 2NPBA 1Q40A 5H5RA 3W6GA 3MIXA 2VCQA 1RGHA 1GSYA 2YFLB 2PUKC 2IUKA 1YEPA 2VM1A 2K6VA 3CSHA 1YVBI 2GBWB 3CCV3 1MD3A 2PVOC 3B4PA 3US3A 3CNMA 3DVWA 4O5QA 3MG2A 4WYKB 5KP3A 2N5AA 2W56B 3FYGA 1IVVA 3PXMA 3SEDA 5D9TA 2YP6A 4MF5A 2ZCTA 4GB5A 1DE1A 3SVAA 2FCHA 1BNEA 4HDEA 3IXRA 4IP1A 2LQQA 4RNYA 3KEBA 1HQOA 2H74A 3MKIA 1SK1A 2H76A 1O85A 1VQ83 5IEPA 2HOHA 2P0XA 2QKEA 1ILOA 5GAND 1BRKA 2QA1A 2B1XB 5DQYA 4OCEA 3KMOA 4LLRA 2C3NA 4BWSA 2A2PA 1UUWB 1Z3EA 5B6MA 1M9GA 1PN0A 4HQSA 4JR4A 1GOVA 2CVDA 1PQNA 1BGSA 2L57A 3EX9A 3G8ZA 2OTJ3 5CNWA 1F2EA 1GNEA 4O5RA 4RBNA 3K63A 4GSPA 2VOCA 4JZQA 4X2OA 3DKSA 3B8LA 2W03A 2CZ2A 3IK7A 1GOUA 4FMBA 3KCMA 1H4OA 4YH2A 4L5OA 1Z1SA 4STDA 4EUYA 3I6AA 4IELA 3CXGA 2XF3A 4KSOA 1R5PA 1CEWI 3CC43 4E8EA 4OO4A 3IHQA 3WOEB 2OA7A 3KCHA 1B2XA 1BAOA 3WA3A 2QIYA 1E3VA 3TKQA 5AN1A 4IJ3A 6GSSA 1V40A 5BIRA 4KDUA 3GV1A 2PNCA 1C54A 2O85A 1BYEA 4GCIA 3DGYA 1RCLA 4RQXA 4IBPA 3R2QA 3IV4A 1TI3A 4HM3B 4XDWA 2RM5A 1IT8A 2CWUA 3VURA 1VQ93 1XVWA 2GSSA 1W4VA 3OXAA 1YVSA 2L5LA 5J4UA 4O8SA 1W01A 2VL2A 5CF1A 3GYKA 3MYDA 2CZ3A 5J41A 1PL2A 5J9CA 5CXOA 1GH2A 2KP2A 4EC0A 4XB5A 1BEDA 1JBTA 1GL8A 4DSRA 1TK8B 2FUG2 1Y6EA 3VFIA 4TR4A 3SOAA 4H86A 4AF2A 3EWLA 4L8OA 2HSYA 1T7PB 1TK0B 2IA7A 1VRSD 4QWTA 1PD21 4N6LA 1MWSA 1TFOA 1KEBA 1TKDB 5CRDA 1IVXA 2I9WA 3G9BA 3F3RA 2HZEB 1FB0A 5AEWB 2B24B 2IMEA 3UNLA 4AKZA 1BNSA 2VD1A 1AY7A 1WRYA 3HZ4A 2INXA 4FH8A 1OAZA 4N10A 2P09A 2E0QA 3PCSA 1RDSA 1K0DA 1RCKA 1K3LA 1Z6MA 1UC7A 3FG1A 1BIRA 2DJKA 3KH9A 2G2QA 1LOXA 1UGIA 3LTBA 4NREA 5FWGA 5GZZB 1Q42A 3EU4A 4L0WA 2AYTA 4PX1A 4TRXA 4LEHA 4GQFA 1ON4A 1XIYA 2AB6A 2R0CA 1VQL3 3TJBA 1SYRA 1QVF2 3LH4A 4BIRA 2M80A 4GHOA 3WDGB 4KDYA 4K1FA 2IYJA 1LOVA 1I0XA 6GSPA 4XRAA 2WULA 1XG8A 4FYCA 2F8AA 5D82A 3F4TA 4BA7A 5ECNB 6GSVA 1AQXA 3DMCA 1TIJA 1K3YA 1SK2A 3PINA 4DKIA 4OFMA 1XWBA 3D21A 1OGZA 3FF0A 3K8NA 1BRSA 5F05A 1OGXA 3PZWA 4LGQA 1WP0A 2DC5A 5IMAA 1PKZA 1M9BA 2EIQA 2GZYA 1LNIA 1PN9A 1RTUA 5A4WA 3F4SA 2ML5A 5STDA 1AVKA 1XW6A 4V2NA 4KCEA 1BRIA 3HOHA 2PN8A 3LYPA 2G0FA 3HIGA 3VPTA 3DRNA 1USBA 3ED3A 3KGKA 1I0VA 4J5GA 1WE0A 3GRDA 1ULIB 2XSHB 1QMVA 2HNLA 3UOMA 1D6UA 2CWVA 5L71A 4PGTA 3SX1A 3GSTA 2K54A 4OFTA 2KCDA 4EW5A 4PEJA 2XC2A 3D22A 1FYSA 3HDCA 1YJ6A 1AAZA 4EYCA 4O32A 2CV4A 3L78A 3UEMA 1GSUA 4G0KA 5B6NA 3G16A 2XGNA 4HU9A 1CQHA 3KZTA 1Z7PA 1GSPA 2V32A 1GRXA 1OF5A 2GSPA 4DSSB 1XPVA 1GP1A 1YY7A 3GRXA 1S3DA 2F5WA 1L5GB 3WHOA 4BPYA 5HFGA 1EGOA 17GSA 5E4WA 1TFKA 2J8XB 5BU4A 5KOXA 5FW5A 1AUCA 1GSQA 1M904 1BRJA 1M3IA 2KRTA 2O8VB 3TUEA 3A5EA 1ROVA 3NX0A 2UUGC 3BCKA 9RNTA 2CX3A 4MMXB 3DD3A 2K8SA 2BMQB 4QL7A 3TJGA 3GSPA 5IM9A 3PH9A 2WDUA 6RNTA 5M19A 2RM6A 4ORLA 4WXTA 1SYXA 3EQQB 5LNKe 2GU1A 4O3VA 3AMOB 2O9UX 4EV2A 4L0UA 2GT6A 1Q40B 3BNDA 3QPMA 1YNVX 4IP6A 2VCZA 3R3EA 4POBA 1W00A 4Q5QA 2DIYA 1AQWA 5IOWA 2W56A 3HX8A 3IE3A 1KD14 3CMIA 1TU5A 4BL7A 2CX0A 3FZWA 1OHSA 2V41A 1IQ8A 4HI7A 1MOLA 1MDJA 2L1SA 4HM8B 1PRXA 4E8HA 3V92A 2H0GA 2EIRA 4CJNA 1A0FA 3B4OA 5ELAA 1RJOA 1TRPA 2Z6BA 1TRUA 1RGAA 1T2HA 1KSIA 1TI1A 4K2XA 1OC3A 5D9WA 5G30A 1ISKA 1NSWA 2CVKA 3CC73 4ZILA 3RHCA 3CTGA 1PY3A 2LYXA 3C8EA 1SL0B 4HU7A 1AQVA 1WIKA 4IQAA 2R4VA 1JZRA 5EPFA 3MHEA 1EOGA 5EY6A 5AYSC 4NHFA 5IMVA 1GMQA 1RN7A 3A5IA 2A4HA 1J08A 1PX6A 5H5SA 2LUSA 4AJ8A 5TGNA 4PQ1A 4OD7A 4POKA 1M99A 1B8XA 1W02A 5G2GA 1GTAA 1T2IA 3X3ZA 4HM5B 2DJ1A 2YZUA 4HM6B 2C80A 3HJPA 1IT7A 4YQVA 4XTSA 1T8EB 1EKMA 4BTXA 3HJMA 3L0HA 4L7KA 1NNVA 1UA5A 2OACA 3E0UA 3GZBA 3FZ5A 5ECRB 1BAYA 3G4S3 2A2SA 2AV4A 5D96A 3GTUA 4HM4B 4EXJA 7GSSA 3FEUA 1ZCPA 4EV5A 3FGYA 1XWKA 3CCU3 1JHBA 2DBCA 4O5UA 1DMMA 1RKYA 4IHUA 2ZA4A 2F51A 1X0RA 1TXXA 3TJJA 5AYRB 1U8CB 5AIXA 5IW9A 3QAVA 2JDIH 1BNIA 2C11A 1FA3A 4WHAA 2GDRA 4LA1A 4MH2A 4K0GA 2JZTA 1BX9A 5COHA 3KP8A 1UCKA 2BO9B 1Q814 1STFI 1KBNA 3ME8A 3IK9A 2ES7A 1IQYA 1UDII 1OPYA 5BMUA 3NBJA 5ECOB 2FY6A 4HAAA 4CDLA 1JRQA 5IPHA 5AEUB 2LJRA 4YKFA 2M7OA 2HE3A 4JU5A 3HI7A 1RGCA 4ECCA 4IJIA 4PNFA 5EVOA 5IO2A 1GTBA 3D3LA 2FWFA 4R9LA 2JSZA 2FWGA 3O8YA 4N6TA 4OK0A 1JBSA 3IC4A 3LW9A 2VCWA 4V2MA 1N9EA 2VLVA 4MJCA 4G9HA 4GWRA 2BNGA 3EPTA 4U13A 4MNNA 3FZ9A 2BIRA 1X1WA 1TTZA 4Q5FA 3SLUA 1ASKA 1RSNA 4PURA 1UI8A 2C4BA 7RNTA 3HVNA 5AIVA 1QQ2A 1JB4A 1UN2A 1UCJA 1V57A 1CH0A 1RN1A 1XFLA 1SIHA 3F8UA 1BRGA 2JZSA 4ZB6A 2HMLB 4ZBDA 3GZXB 3X3YA 2KP1A 3DH2A 3W8JA 3IPTA 5AIIA 3N54B 3KD0A 3EINA 1X1YA 3P8WA 4WWUC 1IK3A 1BVIA 2LRCA 4Q5RA 1TW9A 5KN3A 4PUFC 3QMXA 4USSA 3QAWA 1QK8A 3EYTA 3IJEB 2CA8A 3FZAA 3AHSA 4X0XA 1SU9A 1UVZA 3APSA 1TP9A 1SJIA 2AUVA 3UBKA 1M9AA 5HGRA 3OWYA 1Z9HA 2CAIA 4J56E 4TVEA 4K9ZA 1EEMA 5JPUA 4XBYA 4PQHA 4LMVA 4FYBA 5KOWA 3A3TA 1HKXA 2YN1A 1OHOA 4WP5A 1X9MB 5RNTA 1EZKA 4EBGA 1I70A 3TKSE 2AJQB 1F9MA 1ST9A 4EIPA 1DMNA 3NQYA 1J2BA 1M2DA 2LNSA 2BTOT 5AIGA 1YKAA 3LTAA 5G2ZA 3DGNA 2B1LA 2RSXA 5JCUA 1IVWA 3X40A 2WRTA 4FQUA 2HZFA 4LL4B 1RN4A 5HR1A 4O02B 1QAKA 4MA9A 2V1MA 4CCVA 4EO3A 2DSAA 2I9HA 3TKRA 4O92A 2H30A 2YV9A 3IR4A 3T0UA 2CHCA 4DSSA 1JB2A 1V98A 3G713 1LBKA 4TR0A 4CW9A 4LZIA 2VCVA 2JACA 1LJRA 5G1KA 1GUKA 5KN1A 5DBQA 3TJKA 1VQN3 5IG5A 3CCL3 4X1UA 19GSA 5INYA 3CC23 4Z2TA 4N0VA 2C0FA 2QEX3 2YPMA 3APQA 1R26A 1M2AA 4PXOA 3C1SA 3UMAA 3ZYWA 3EBTA 4OMVA 3ROBA 4FCMA 3GKKA 1E3RA 1A2VA 2QC7A 4F03A 1FOHA 4ZM8A 1K8A4 3BU4A 3D4AA 2CW9A 4O7HA 3CRUA 1XWGA 4R1KA 3EMXA 4KE3A 1W5ZA 1OE8A 2H0HA 2R37A 3RNTA 1EQKA 3WGDA 2B5EA 1RW1A 2H6ZA 2ML6A 1XZOA 3VGNA 1IYIA 1E6BA 1YEXA 1FW1A 4FMDA 2AHEA 1TOFA 3KMNA 3OR5A 2OOVC 3ZL5A 1RRLA 3HIIA 3CCE3 3D5JA 4HZBB 4AJ7A 3LXZA 1DE2A 2X8GA 5EQLA 1E97A 3ERFA 4AGSA 2E2GA 2H73A 1TK5B 2GQKA 2B6MA 3CU3A 3A76A 1FVJA 5CREA 4HJLB 3DXBA 1K9M4 1GD3A 4BL7B 3F6DA 3TKSC 1ZYEA 3UB1A 2GLRA 4NAXA 8GSSA 3TB2A 3LOYA 4MMMA 2E2UA 3BBYA 2RBIA 2YX9A 3BNEA 4TW5A 1SKWB 5HR2A 1WMPA 3UAPA 1N8QA 3ZMKA 4J8TA 3L9VA 4NXIA 3CCM3 4PQIA 2JADA 1LRAA 1ACVA 2I1UA 3WA2X 3W8SA 4K90B 4OVMA 5IEOA 1S723 1Y25A 1T1VA 2Y73A 3KKGA 3GH6A 3U6VA 2YWNA 3M9KA 2FA4A 2GQMA 4X43A 2EIOA 4NWYA 1PYLA 5KN2A 7GSPA 4K7NA 1OKTA 2I4AA 3D4TA 4TXVA 3KSPA 1QGVA 1QAFA 2YFIB 3L0RA 4KB3A 1BSCA 3ZG5A 1HYFA 3URPA 1N8JA 4HOHA 3IPZA 1A8YA 1UUGB 4HSCX 5CAXA 5LD0A 2GS3A 3MPHA 3NBBA 2HSMA 2F56A 2PVQA 2I81A 4HJMA 4XBXA 3IAS2 4ACSA 5EVHA 3RDEA 3GTUB 1EWXA 3UIWA 2XR8B 3RPNA 3F7SA 4MJDA 1Z7RA 1JN5B 2IMIA 4POMA 3GZYB 4KT3B 5D8IA 1VQP3 3U97A 4EDZA 5ECSA 3APOA 1MGWA 3DIEA 3P2AA 5HOHA
chains in the Genus database with same CATH topology
3EVIA 3ALAA 3L4NA 4GF0A 2Y74A 3F63A 4KSMA 2IJYA 2P31A 1VQK3 4D73A 1HNCA 1R4CA 3MYTA 4IIAA 4AJ6A 4TR3A 2V6OA 3HZ8A 4ECJA 2HRKA 4N6UA 3HK4A 1VF3A 3MSZA 1W89A 2XGLA 1GY5A 2AAWA 2K0MA 1VQ43 1U88A 5JCGA 3ZMLA 2E2MA 2C3TA 3HVVA 4NMUA 3E3EA 1X5CA 2GZZA 1MNLA 2CX4A 3N9JA 3MWZA 2LKUA 4TN8A 3ECFA 2D42A 2RIIA 1GY7A 2HT9A 3GX0A 3ZRDA 3JUQA 3GKNA 5ECMB 4K2DA 1SK0A 1U6TA 3ZREA 4KA0A 1TRWA 2OADA 1K0CA 8CHOA 5D83A 2IMFA 5ECQB 2HMKB 3GKMA 4MMYB 3P90A 3RGRA 2H75A 3GMFA 4TXOA 5J3RA 3T8NA 2LTKA 1Y4KA 2BJXA 2F3MA 5LCZA 2VLUA 1NJI4 2JZRA 4OFNA 2EC4A 5IO0A 3F4RA 3HVSA 2M46A 4YAPA 1G96A 4K5SA 4K8MA 5AI1A 4GSNA 1KNGA 3MG1A 3HCZA 4RUVA 1IDPA 4KFDA 3JUMA 1NHYA 4KW6A 3V99A 1NM3A 1CQSA 1YIT3 1O81A 1YF0A 2MMNA 1FVKA 3N8BA 3DZLA 4MF6A 1ERVA 5ECLB 3ISOA 3K0ZA 2RUEA 2YWMA 5CYYA 3S29A 3KXOA 1TJDA 1X5DA 1XOAA 4GTUA 4QQ7A 4MMZB 2QGVA 1F3AA 2WGOA 1DUGA 1UI7A 4FCJA 3A2XA 4FIWA 3CRTA 4ZB8A 4HS1A 2X8HA 4G1MB 2UZ8A 2XBIA 5BRTA 2YWIA 3OWUA 2W04A 3RBTA 3Q74A 4XRDA 3BLZA 3ZZXA 2IN3A 3LYGA 3CTFA 2JU5A 1Z6NA 3QFBC 2O89A 1FAAA 2E2TA 1O8XA 3Q90A 5D9XA 3F9SA 3DGLA 1OE7A 1F3BA 2JQ5A 2VLTA 2K8VA 2VO4A 1DSBA 3DEXA 1IV7A 3TRPA 1XW9A 3S67A 2F98A 2HRNA 3LZAA 3LJRA 3J7Yk 4WBJA 1AIUA 2GZPA 4TOPA 2BMOB 3EBYA 3RDWA 5A4VA 3BJ5A 4CDOA 2JL4A 1J0FA 2GVPA 2DKHA 4KX4A 3TGZA 5BVBA 20GSA 2D2ZA 3MG3A 2Z9SA 4KDXA 2MYGA 3DXOA 1HU9A 3H8QA 2MF7A 2M72A 5CLKA 2GT5A 5JWOB 1LXEA 2KHPA 4ZL8A 2PBJA 3BD2A 2C1YA 1B48A 1UUVB 3GHAA 4K7IA 2N5FA 1RRHA 2C8UA 3KN4A 2PPTA 3IOSA 3RGAA 11GSA 3F3QA 3J7Yd 3WOFB 3E9JB 5IERA 1ZYPA 4TKYA 3EC9A 4XBTA 2B5YA 10GSA 2ZNMA 3LORA 5DQSA 1S5AA 1OC8A 1EG9B 1F37A 4JE1A 3DMLA 3LEFA 2DMMA 1OCVA 4GXZA 3GN3A 5IMCA 3A2VA 4Z7XA 5AIHA 5D73A 4Q53A 4I6XA 1A2JA 4ILFA 1ZZYA 1RQMA 1THOA 3HHVA 3EN1B 3RHBA 2C0EA 1LNHA 3OW22 4ID0A 4MJBA 3HZPA 5HFIA 4DVCA 2OQEC 1YF1A 3MSOA 4G0LA 2H1BA 1ERTA 4YAVA 4CHSA 2IFQA 3EB8A 2IWTA 1YZXA 3G7YA 3CCJ3 3G7JA 2MMZA 4CY6A 2R5GA 5BXQA 1VQ53 3PGTA 1QUWA 2HRFA 3H93A 4A5PA 5FT3A 2O7KA 5ENUA 3SOYA 5ECPB 1O7UA 2HMJB 2E7PA 3S28A 3NM7A 1SJZA 1K0MA 1YJW3 2KOKA 5IIZA 5IQYA 1N5HA 22GSA 1JLWA 2FA8A 2OCTA 2QGUA 2YJHA 5EL8A 1TU8A 4FO5A 4KVHA 3FF2A 4I5QA 3X41A 2CG1A 2P0MA 1CYVA 3CCR3 4BVYB 2XPDA 5IMFA 1JN5A 1W6GA 1FGMA 1LVNA 5A4UA 2WB9A 1U3AA 1VQO3 1D6YA 3M1GA 1WNHA 3FLJA 3C73A 3NUVA 5FGOA 5F8BA 3ZITA 2FGTA 2ZUPA 2P05A 2GU3A 1THXA 4EXRA 4WF5A 3GAXA 4O2HA 1CYUA 1XBSA 4MJAA 3FG3A 1PL1A 1VGLA 3CXC2 5CRHA 5JWQB 4D73B 2L6DA 5GSTA 2V2GA 2CFDA 4BVXA 3KE7A 2OOVA 1B4PA 4LMWA 1K0OA 1ZX2A 3CCS3 2F9SA 3IRAA 3CSIA 3FCSB 4ML6A 3KH7A 1EV4A 3FSDA 3G7IA 3GSSA 4K6XA 1GULA 2GEXA 9GSSA 3TRXA 1EEJA 3QAGA 1NHOA 2VCTA 2TRCP 3TKSA 1R4WA 4L8EA 3LT9A 1F8NA 2H01A 3PGBA 2VIMA 3FRCA 1GSFA 2R0GA 3SXXA 2H1AA 1AR0A 1K28A 5DJMA 1ZO2A 3S27A 4KAEA 2XH9A 1Q98A 3I69A 1OH0A 4NHWA 2P5RA 4Z2UA 3EURA 3GFKA 4X4JA 4JRRA 3ERGA 1PKWA 3NM2A 4MABA 4EIQA 2P38A 1GD4A 1Q7Y4 1WOUA 4IGJA 1SL1B 3A2WA 2MBTA 5GSSA 5I97A 5LC6A 1ZGNA 4ULXA 4ZXGA 3EE2A 4CY8A 1G7EA 1PMTA 3D4MA 2NDOA 4TXOB 1TRVA 5C04A 4HJ2A 3WODG 1T4ZA 2VL9A 3E99A 1OUNA 4IW9A 5IPGA 2CKFB 3FG4A 1V74A 1XVQA 1IU7A 1T00A 1ERUA 4IN0A 3FW2A 3RAZA 2XBQA 4N6MA 1H75A 3C71A 1M1XB 3BOAA 1T5YA 1FO5A 2OJLA 4N3VA 2GSRA 2OBKA 1QFNA 4HQZA 6GSYA 5DALA 3CMA3 1XWCA 1NU3A 3K5TA 1W4NA 1C7HA 4PTSA 3ZTLA 2CWTA 3HD5A 2K18A 4GQCA 5IOXA 1SKSB 1GNWA 1I9DA 1K734 1GSSA 2WO0A 2W9QA 3HXSA 3H4KA 2MBSA 3LGCA 3IMAB 3NV0A 4EE0A 4V2LA 4FMCA 2NTOA 1SJ6A 1EV9A 1GTIA 4IT7A 3ZLPA 1ZYQB 1O7WB 2YZHA 4XHMA 1J9BA 3GKXA 1A24A 1PX7A 2WCIA 3EHCA 2OBIA 5A0OB 5J9BA 4R80A 2YV7A 4WR4A 2LQVA 2F86B 3ERWA 3KTBA 3DM8A 4XS4B 4F0CA 2YCDA 1KQS2 2FWEA 3RPPA 1EP8A 3WMDA 4G19A 2RFRA 7STDA 4AKYA 1U3IA 4MCUA 2VUPA 4N6OB 4RZMA 1SIIA 5IENA 2SBLA 2BMXA 1BG5A 4F9ZA 1OKDA 2VM2A 4V1Ag 4J2FA 4ZL7A 18GSA 2YFJB 4GL6A 4MJEA 5B8AA 2WFCA 1VZZA 3HY2A 1WMJA 1SENA 3EU3A 3LT8A 3BNCA 4NV2A 3GL5A 3UL6A 4WF4A 1Q864 2CT6A 1A0RP 2WJUA 1G6WA 1GUMA 4KH7A 2L4QA 3OX9A 2ON7A 4WEYA 4ZBAA 2L4CA 2H1DA 4GRFA 3EE1A 1ZOFA 2O87A 4GSSA 1VQ63 3MNGA 2PU9C 3UVHA 1K0NA 2R3XA 1FB6A 1KC84 1CQGA 2LEGA 2F99A 3ZVJA 3Q2PA 3VPQA 6GSXA 3FK8A 1DMQA 5ELJA 1F6MC 1PFPA 1X9SB 1WTHA 2WOFA 4FCZA 2C0DA 3IHGA 3LG6A 3F0IA 2LNTA 3FH1A 3KZQA 1T3BA 1OHPA 2DKIA 2DJ0A 4MZWA 2R6KA 3V1WA 3BCIA 1YKCA 2L4VA 4K1VA 3A5WA 4F0BA 2LJKA 2ZL8A 5G5FA 3VI7A 3D9RA 1FGQA 1JLVA 4XDVA 1AVLA 3N9HA 2OE3A 3QFAC 3BB9A 5G31A 3WGXA 2FHEA 3STDA 1S3AA 4HYZA 3GNJA 2W6JH 4XM4A 3MWHA 5F0GA 3GWRA 1FG4A 2IFQB 2IUJA 2H6YA 2GBXB 4ISDA 4MLYA 3VWVA 2HYXA 3DWVA 1WQLB 2CAQA 3GZRA 1OC9A 4I97A 1EA2A 2XPEA 2H0IA 2P5QA 1D6ZA 3FR3A 2XSOB 3KTLA 3UL5A 1JZDA 1NDOB 1O7HB 2RUFA 1EGRA 3S5CA 2A15A 2RCDA 2OWPA 2J23A 3QD9A 2C10A 2DJJA 4BVYA 2N5BA 2CFGA 4EL1A 4R4KA 4MPGA 2D1WA 3LWAA 3DGOA 3DVXA 1JKGB 1Q4JA 3BNBA 1YJN3 2K9FA 2LRTA 4KNDA 4MEIA 3WYWA 5JBSA 1M2BA 1JJ22 2FXTA 1PGTA 5HFKA 1SPUA 4HVNA 1TP6A 2PZVA 1AC1A 5B7CA 3JCML 5HR0A 1K41A 3DUKA 1YI23 3UJMA 1VQ73 4IPBA 2DJ2A 5D81A 2NVLA 12GSA 3VWWA 3EN8A 3ME7A 3TRQA 5AGYA 4IKHA 2IMKA 1V58A 1W6YA 1R7HA 2ZDJA 1JZWA 3Q19A 3VK9A 1NWWA 4H3UA 1N9JA 1ML6A 3UVTA 4BVXB 5IF6A 2X49A 5CF2A 2OE0A 4L8PA 1IQXA 4JBBA 4JRFA 2X8CA 4G10A 1EP7A 3IBHA 5CRGA 2ON5A 3ZFLA 3GH9A 4N6NB 3F40A 3KJYA 3NQZA 5LC7A 3JUPA 2CG0A 1G6YA 4NHZA 2XRXB 3JUOA 4TR1A 5KP1A 4FR9A 4IS0A 4HUAA 3F9UA 1FGTA 1JB5A 4TX4A 4XS1A 5EEOA 2LV3A 3GA4A 2OQEA 2H19A 4J57E 4NPBA 3M8NA 1W6CA 1FHEA 4KUNA 3KIJA 3TJFA 2V6KA 1YDKA 4ECBA 3G6E3 1AV4A 1YIJ3 1WMOA 3L9UA 3B7CA 3M8CA 3HYPA 4MK3A 1QALA 3CPW2 5CRWA 2WGQA 1DVDA 2HMOB 1W7CA 4XS6A 4JR6A 1NB5I 4K0NA 4YKGA 1M1K4 3GX8A 4J9AA 1X5EA 5F06A 1EOHA 4ICYA 1JV2B 2VL3A 4P3YB 1N8R4 3NIVA 4HZ2A 5DJLA 2DLXA 1YGEA 3VF1A 1SJWA 1TUHA 3I0YA 5ELUA 1MTCA 3DYRA 5DCHA 3NXJA 3OWSA 2RLIA 3M3MA 2OE1A 5DALB 3F7XA 1R5AA 5DDLA 2R0PA 4BTWA 2WZ9A 3EC3A 1US1A 1WJKA 3FR9A 2RGQA 2LQOA 4MZCA 4EDYA 1FUWA 4N30A 3C1RA 5AISA 4KZ1A 2LJAA 3PS8A 3NV0B 2LS5A 1XWAA 4RQRA 5C00A 1BQ7A 2FD3A 5DREA 3I43A 3T8UA 4XS4A 1QXHA 6GSUA 5G1LA 3TKPA 4HM1B 1K0AA 1YQ1A 2VCXA 1PU4A 3QDNA 3HKRA 3F8HA 1SQWA 3LFLA 4R9KA 2LSTA 1KTEA 3GUSA 2BMRB 1OYJA 2XEPA 5ID2B 4K5RA 5DAKA 3CYNA 4BTYA 3CME3 3KP9A 4N0ZA 5ECIB 4LL1B 1A2KA 2FGXA 4YQMA 1XW5A 1JNQA 2WGRA 2OKAA 3Q1CA 3WGEA 1N5PA 1ZL9A 4NV5A 2H8LA 2QSIA 4G2EA 2B1KA 2YNXA 4MDCA 3KFQC 1GSEA 3CCQ3 4Q5NA 1C72A 1M7TA 2CK3H 3D6IA 5IG0A 3CPOA 4KF9A 3I9V2 1GLPA 1DBYA 1FGRA 4KFFA 1OVNA 1IYHA 2TIRA 2GQLA 3DGMA 5KP4A 3ZIJA 4XIHA 3LXUX 3PR8A 1HNBA 4PNGA 4JEDA 1NW2A 2MMOA 2PWJA 4N11A 1WPIA 1XCCA 3VSYA 3QK9A 4HM0B 3LSZA 1GTUA 2Z7AA 2CH9A 1K3OA 3QCPA 2YOIA 2KXGA 1HYUA 1IV9A 3GL3A 2WS2A 4I2TA 3TOUA 1O7MB 2IMDA 1WMNA 3FHKA 1GUHA 1A2LA 4AEQA 4ZL9A 3LQ7A 3SBCA 1V9WA 4V1Ap 4EKZA 1HD2A 3NBRA 3NHXA 2LRNA 1VF4A 3VWUA 2V1LA 5IG3A 3QRDA 3TCOA 2IMJA 1O73A 4WETA 1B9YC 2VL2C 2CC3A 2FWHA 4WYKA 2Q07A 5CP1A 1U5OA 4ECIA 4WBRD 4I2UA 2ALBA 2KUCA 2DIZA 5DRVA 3F8XA 2E2VA 3ER7A 16GSA 4MH3A 3DY5A 2FNOA 1QVG2 4FYUA 2H72A 1MDKA 1ERWA 1A8LA 2TRXA 1W2B2 2FNQA 3IAM2 3U1WA 4ZBBA 2HMNB 5AIFA 3M0FA 2HMMB 2B7JA 2HLSA 1V2AA 4KFEA 3HVXA 2BT3A 1AXDA 3FZ4A 3PYJA 3FR6A 1OC9B 3LYKA 1O7NB 2W2CA 2XHFA 2QA43 1SD8A 2X4AA 2IPAA 3KM6A 5D9VA 3UJ1A 2L59A 1JKGA 3LTCA 2WOHA 4N6V0 4KCAA 1G7OA 2H1GA 1I5GA 4WKWA 2C0GA 4F82A 4POLA 3IDVA 2QA2A 1YJ93 3CSJA 4I8BA 4IQ1A 5JWRB 3VI5A 5IMDA 2DJ3A 2H6XA 6STDA 2HRAA 2J9HA 1HNAA 2PERA 2C3QA 2DMLA 1BJXA 2IIYA 1O8WA 2L6CA 5DCGA 3QR6A 4HEA2 1SKRB 1XOBA 2B7KA 3CNXA 4OO5A 2B3SA 4MP4A 3ZVJD 1GSDA 3LMLA 4DSQA 2HI7A 1O7PB 2H66A 3GURA 5CO3A 5HQPA 2GTUA 2I3YA 2VD0A 4L5LA 1PA3A 4K1UA 3X42A 3HA9A 1ZYNA 3O6TA 3K9MC 1A90A 2KLXA 4ML1A 1XXUA 3JVCA 3MDKA 1W2ZA 1TDIA 3M9JA 5DVBA 4JF8A 3UARA 3I553 13GSA 2GGTA 2R4IA 1JFUA 4H61A 2O3OA 2GSTA 4OUQA 1O6JA 3ZIVA 4EVMA 1FOVA 2YJ7A 1S3CA 3QOUA 4ZB9A 5J5NA 4WFOA 3F6FA 3TDGA 4RI7A 1VQM3 1AW9A 3KIIA 2MZCA 5ECKB 3WD6A 3WT1A 3U5RE 2A4VA 4TR1B 5KN0A 2X99A 4HM2B 5B8BA 4LMIA 1RK4A 2REMA 3FY7A 1VF1A 1O7GB 3EMPA 1ULJB 4F2IA 2W9PA 2CFWA 2HZEA 4QL9A 4G0IA 1GYBA 4BWQA 1QJGA 5F07A 3FMWA 4MZBA 1MDIA 6GSWA 3LXTA 1DVCA 3IA1A 2OTL3 3LTDA 4K61A 3FKFA 3H79A 4HM7B 2JSYA 3AY8A 4OWYA 1U87A 2PGTA 1FGOA 1STDA 4I4KA 4EC6A 3TOTA 1B4QA 1A67A 4IVFA 1WWJA 2W0QA 3EF8A 3PPUA 2A2RA 4HZ9B 2CQ9A 2PMTA 3GIXA 4DEJA 1QMAA 5FHIA 1TRSA 3S9FA 2UX0A 2XFSA 4KGIA 2XFTA 3K7CA 2CFLA 1SD9A 3WT2A 3CBUA 3O3TA 5CK6A 6GSTA 1G0TA 2NBSA 5GAPD 4WR5A 14GSA 1M0UA 1Q824 2HXKA 3VWXA 5IMZA 1IVUA 3UBLA 1DYUA 5ECHB 1GS3A 2YANA 3KSED 5JCWA 2CIUA 1E2YA 1URMA 1SL2B 2STDA 3P7XA 1TU7A 1X9WB 1ABAA 3J7Yb 1NB3I 3JUNA 3H3HA 3HJOA 2H70A 4K7OA 2HFDA 1PSQA 1GY6A 4HBRA 4PUAA 2Z77A 3VLNA 4XCSA 2R2JA 2Z76A 5ID2A 2VAFA 4MPFA 3CD63 3D0ZA 4GSTA 5KEJA 3OV4A 2GEYA 4FMAA 2BHMA 2GXFA 1MD4A 5DAKB 3H1NA 1T4YA 4GLTA 2CVBA 4HZ4A 2MC8A 2CFKA 3L9SA 3Q6OA 1B9XC 1NO3A 5H5QA 2F8FA 5JPPA 5D93A 3SWLA 2YWOA 1A2MA 5IG4A 1UW1A 3PCRA 3I563 2IL3A 1N2AA 2HSHA 1OACA 3C7MA 1JZOA 2C4JA 4ZIJA 4RNZA 3X3XA 3Q18A 1Z5YE 4Z2RA 1K0BA 5ELGA 2B5XA 3ZFBA 4HKVB 2X64A 3IC8A 1GLQA 1ROAA 3EJVA 4YQUA 2MMAA 2L5OA 1OF5B 1VF2A 3UL3A 1LU4A 1MEKA 3V98A 1YHQ3 3N5OA 3DGQA 2H71A 5E59A 3MAKA 2P0GA 1ZMAA 5A5KA 4X2HA 5HR3A 1A23A 4HOJA 1KWIA 3NZNA 4OCFA 4MF7A 1BUQA 4EF0A 2FLSA 3G0KA 3O76A 3F14A 3H51A 4RI6A 5G5EA 5ABRA 3FKAA 2GSQA 1GWCA 4LSOA 3NOFA 3AMOA 2NPBA 1Q40A 5H5RA 3W6GA 3MIXA 2VCQA 1GSYA 2YFLB 2PUKC 2IUKA 1YEPA 2VM1A 2K6VA 3CSHA 1YVBI 2GBWB 3CCV3 1MD3A 2PVOC 3B4PA 3US3A 3CNMA 3DVWA 4O5QA 3MG2A 4WYKB 5KP3A 2N5AA 2W56B 3FYGA 1IVVA 3PXMA 3SEDA 5D9TA 2YP6A 4MF5A 2ZCTA 4GB5A 1DE1A 3SVAA 2FCHA 4HDEA 3IXRA 4IP1A 2LQQA 4RNYA 3KEBA 1HQOA 2H74A 3MKIA 1SK1A 2H76A 1O85A 1VQ83 5IEPA 2P0XA 2QKEA 1ILOA 5GAND 2QA1A 2B1XB 5DQYA 4OCEA 3KMOA 4LLRA 2C3NA 4BWSA 2A2PA 1UUWB 1Z3EA 5B6MA 1M9GA 1PN0A 4HQSA 4JR4A 2CVDA 1PQNA 2L57A 3EX9A 3G8ZA 2OTJ3 5CNWA 1F2EA 1GNEA 4O5RA 4RBNA 3K63A 2VOCA 4JZQA 4X2OA 3DKSA 3B8LA 2W03A 2CZ2A 3IK7A 4FMBA 3KCMA 1H4OA 4YH2A 4L5OA 1Z1SA 4STDA 4EUYA 3I6AA 4IELA 3CXGA 2XF3A 4KSOA 1R5PA 1CEWI 3CC43 4E8EA 4OO4A 3IHQA 3WOEB 2OA7A 3WA3A 2QIYA 1E3VA 3TKQA 5AN1A 4IJ3A 6GSSA 1V40A 4KDUA 3GV1A 2PNCA 2O85A 1BYEA 4GCIA 4RQXA 4IBPA 3R2QA 3IV4A 1TI3A 4HM3B 4XDWA 2RM5A 1IT8A 2CWUA 3VURA 1VQ93 1XVWA 2GSSA 1W4VA 3OXAA 2L5LA 5J4UA 4O8SA 1W01A 2VL2A 5CF1A 3GYKA 3MYDA 2CZ3A 5J41A 1PL2A 5J9CA 5CXOA 1GH2A 2KP2A 4EC0A 4XB5A 1BEDA 1GL8A 4DSRA 1TK8B 2FUG2 1Y6EA 3VFIA 4TR4A 3SOAA 4H86A 4AF2A 3EWLA 4L8OA 2HSYA 1T7PB 1TK0B 2IA7A 1VRSD 4QWTA 1PD21 4N6LA 1TKDB 1TFOA 1KEBA 5CRDA 1IVXA 2I9WA 3G9BA 3F3RA 2HZEB 1FB0A 5AEWB 2B24B 2IMEA 3UNLA 4AKZA 2VD1A 1WRYA 3HZ4A 2INXA 4FH8A 1OAZA 4N10A 2P09A 2E0QA 3PCSA 1K0DA 1K3LA 1Z6MA 1UC7A 3FG1A 2DJKA 3KH9A 2G2QA 1LOXA 3LTBA 4NREA 5FWGA 5GZZB 1Q42A 3EU4A 4L0WA 2AYTA 4PX1A 4TRXA 4LEHA 4GQFA 1ON4A 1XIYA 2AB6A 2R0CA 1VQL3 3TJBA 1SYRA 1QVF2 3LH4A 2M80A 3WDGB 4KDYA 4K1FA 4XRAA 2WULA 4FYCA 2F8AA 5D82A 3F4TA 4BA7A 5ECNB 6GSVA 1AQXA 3DMCA 1TIJA 1K3YA 1SK2A 3PINA 4OFMA 1XWBA 3D21A 1OGZA 3FF0A 3K8NA 5F05A 1OGXA 3PZWA 4LGQA 1WP0A 2DC5A 5IMAA 1PKZA 1M9BA 2EIQA 2GZYA 1PN9A 5A4WA 3F4SA 2ML5A 5STDA 1AVKA 1XW6A 4V2NA 4KCEA 2PN8A 3LYPA 2G0FA 3HIGA 3VPTA 3DRNA 1USBA 3ED3A 3KGKA 1WE0A 3GRDA 1ULIB 2XSHB 1QMVA 2HNLA 3UOMA 1D6UA 2CWVA 5L71A 4PGTA 3SX1A 3GSTA 2K54A 4OFTA 2KCDA 2XC2A 4PEJA 3D22A 3HDCA 1YJ6A 1AAZA 4EYCA 4O32A 2CV4A 3L78A 3UEMA 1GSUA 4G0KA 5B6NA 3G16A 2XGNA 4HU9A 1CQHA 3KZTA 1Z7PA 2V32A 1GRXA 1OF5A 4DSSB 1XPVA 1GP1A 1YY7A 3GRXA 1S3DA 1L5GB 4BPYA 5HFGA 1EGOA 17GSA 5E4WA 1TFKA 5KOXA 5FW5A 1AUCA 1GSQA 1M904 2KRTA 2O8VB 3TUEA 1ROVA 3NX0A 3BCKA 2CX3A 4MMXB 3DD3A 2K8SA 2BMQB 4QL7A 3TJGA 5IM9A 3PH9A 2WDUA 2RM6A 4ORLA 4WXTA 1SYXA 3EQQB 5LNKe 2GU1A 4O3VA 3AMOB 2O9UX 4EV2A 4L0UA 2GT6A 1Q40B 3BNDA 3QPMA 4IP6A 2VCZA 3R3EA 4POBA 1W00A 4Q5QA 2DIYA 1AQWA 5IOWA 2W56A 3HX8A 3IE3A 1KD14 3CMIA 1TU5A 4BL7A 3FZWA 1OHSA 2V41A 1IQ8A 4HI7A 1MOLA 1MDJA 1PRXA 4HM8B 4E8HA 3V92A 2H0GA 2EIRA 1A0FA 3B4OA 5ELAA 1RJOA 2Z6BA 1TRUA 1KSIA 1TI1A 4K2XA 1OC3A 5D9WA 5G30A 1ISKA 1NSWA 2CVKA 3CC73 4ZILA 3RHCA 3CTGA 2LYXA 3C8EA 1SL0B 4HU7A 1AQVA 1WIKA 4IQAA 2R4VA 1JZRA 5EPFA 3MHEA 1EOGA 5EY6A 5AYSC 4NHFA 5IMVA 1RN7A 3A5IA 2A4HA 1J08A 1PX6A 5H5SA 2LUSA 4AJ8A 5TGNA 4PQ1A 4OD7A 4POKA 1M99A 1B8XA 1W02A 5G2GA 1GTAA 3X3ZA 4HM5B 2DJ1A 2YZUA 4HM6B 2C80A 3HJPA 1IT7A 4YQVA 4XTSA 1T8EB 1EKMA 4BTXA 3HJMA 3L0HA 4L7KA 1UA5A 2OACA 3E0UA 3GZBA 3FZ5A 5ECRB 1BAYA 3G4S3 2A2SA 2AV4A 5D96A 3GTUA 4HM4B 4EXJA 7GSSA 3FEUA 1ZCPA 4EV5A 3FGYA 1XWKA 3CCU3 1JHBA 2DBCA 4O5UA 1DMMA 1RKYA 4IHUA 2F51A 1X0RA 1TXXA 3TJJA 5AYRB 1U8CB 5AIXA 5IW9A 3QAVA 2JDIH 2C11A 1FA3A 4WHAA 2GDRA 4LA1A 4MH2A 4K0GA 2JZTA 1BX9A 5COHA 3KP8A 2BO9B 1Q814 1STFI 1KBNA 3ME8A 3IK9A 2ES7A 1IQYA 1OPYA 5BMUA 3NBJA 5ECOB 2FY6A 4CDLA 1JRQA 5IPHA 5AEUB 2LJRA 4YKFA 2M7OA 2HE3A 4JU5A 3HI7A 4ECCA 4IJIA 4PNFA 5EVOA 5IO2A 1GTBA 3D3LA 2FWFA 4R9LA 2JSZA 2FWGA 3O8YA 4N6TA 4OK0A 3IC4A 3LW9A 2VCWA 4V2MA 1N9EA 2VLVA 4MJCA 4G9HA 4GWRA 2BNGA 3EPTA 4U13A 4MNNA 3FZ9A 1TTZA 4Q5FA 3SLUA 1ASKA 4PURA 1UI8A 5AIVA 1QQ2A 1JB4A 1UN2A 1V57A 1XFLA 1SIHA 3F8UA 2JZSA 4ZB6A 2HMLB 4ZBDA 3GZXB 3X3YA 2KP1A 3W8JA 3IPTA 5AIIA 3N54B 3KD0A 3EINA 3P8WA 4WWUC 1IK3A 2LRCA 4Q5RA 1TW9A 5KN3A 4PUFC 3QMXA 4USSA 3QAWA 1QK8A 3EYTA 3IJEB 2CA8A 3FZAA 4X0XA 1SU9A 1UVZA 3APSA 1TP9A 1SJIA 2AUVA 3UBKA 1M9AA 5HGRA 3OWYA 1Z9HA 2CAIA 4J56E 4TVEA 4K9ZA 1EEMA 5JPUA 4XBYA 4PQHA 4LMVA 4FYBA 5KOWA 3A3TA 1HKXA 2YN1A 1OHOA 4WP5A 1X9MB 2AJQB 1EZKA 4EBGA 3TKSE 1F9MA 1ST9A 4EIPA 1DMNA 3NQYA 1J2BA 1M2DA 2LNSA 2BTOT 5AIGA 1YKAA 3LTAA 5G2ZA 3DGNA 2B1LA 2RSXA 5JCUA 1IVWA 3X40A 2WRTA 4FQUA 2HZFA 4LL4B 5HR1A 4O02B 1QAKA 4MA9A 2V1MA 4CCVA 4EO3A 2DSAA 2I9HA 3TKRA 4O92A 2H30A 2YV9A 3IR4A 3T0UA 2CHCA 4DSSA 1JB2A 1V98A 3G713 1LBKA 4TR0A 4CW9A 4LZIA 2VCVA 2JACA 1LJRA 5G1KA 1GUKA 5KN1A 5DBQA 3TJKA 1VQN3 5IG5A 3CCL3 4X1UA 19GSA 5INYA 3CC23 4Z2TA 4N0VA 2C0FA 2QEX3 2YPMA 3APQA 1R26A 1M2AA 4PXOA 3C1SA 3UMAA 3ZYWA 3EBTA 4OMVA 3ROBA 4FCMA 3GKKA 1E3RA 1A2VA 2QC7A 4F03A 1FOHA 4ZM8A 1K8A4 2CW9A 4O7HA 3CRUA 1XWGA 4R1KA 3EMXA 4KE3A 1W5ZA 1OE8A 2H0HA 2R37A 3WGDA 1EQKA 2B5EA 1RW1A 2H6ZA 2ML6A 1XZOA 3VGNA 1IYIA 1E6BA 1YEXA 1FW1A 4FMDA 2AHEA 1TOFA 3KMNA 3OR5A 2OOVC 3ZL5A 1RRLA 3HIIA 3CCE3 3D5JA 4HZBB 4AJ7A 3LXZA 1DE2A 2X8GA 5EQLA 1E97A 3ERFA 4AGSA 2E2GA 2H73A 1TK5B 2GQKA 2B6MA 3CU3A 3A76A 1FVJA