3TDGA

Structural and functional characterization of helicobacter pylori dsbg
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
232
structure length
232
Chain Sequence
QDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTKVENTTKKIFESGVIKGVPFLYHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of Helicobacter pylori DsbG
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 77
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18257 DsbG_N Disulfide isomerase DsbG N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.520 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3tdgA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tdgA02
1OC9A 4MF6A 3LXTA 2IFQA 3HDCA 3UEMA 3C71A 4V2LA 1AUCA 3M0FA 4PUAA 1ZOFA 1YKAA 2H1DA 3L0HA 5J9BA 4OCEA 2YJHA 2F8FA 1O8XA 1VF3A 3TJKA 3GV1A 1G6YA 3FK8A 4L0WA 4KE3A 4WBRD 3VI7A 1PD21 4YQUA 2L4CA 3ZIVA 3VI5A 4Q5QA 3HVVA 2HYXA 2CZ2A 5D73A 2QC7A 4BA7A 1SK1A 4LMVA 3N5OA 2V32A 3DRNA 3FR3A 4IVFA 1DBYA 4ML6A 3CBUA 3TKSE 3EMPA 13GSA 2B5EA 4HQSA 2R6KA 3CMIA 5IPHA 4XS4B 1K0CA 5E4WA 2H6YA 3A2WA 6GSYA 3D22A 2VL9A 1U88A 2DJJA 2LTKA 1GSEA 3D0ZA 5ECQB 2V6OA 2LJKA 1EV4A 5ABRA 3QDNA 3FKFA 2O87A 3ZLPA 2YNXA 3GIXA 1QMVA 4IGJA 2FY6A 4MF5A 4WF5A 2GS3A 2YV9A 2L5LA 6GSVA 2PGTA 1PSQA 3L9SA 2FA8A 2C0GA 3IDVA 1PX6A 1O8WA 2KUCA 5IMAA 4MJAA 4K7IA 2F8AA 2VOCA 5IQYA 2LKUA 3P90A 2GQMA 4WETA 1MDIA 4PURA 1GSQA 1G7EA 2HI7A 2WZ9A 4BPYA 2YWNA 2DIZA 3GFKA 3DXBA 2K8SA 5JCGA 4EF0A 1A2JA 4QL9A 2OE0A 3DWVA 4MH3A 5D8IA 1S3DA 2GGTA 3VWXA 1JLWA 2H19A 2GT5A 3WGXA 2FWFA 1E6BA 2IWTA 2H71A 2C4JA 2DJ3A 4MP4A 3TRXA 5L71A 2C0FA 2AHEA 2R3XA 2HZEB 2WGRA 1K3OA 2H72A 3CTGA 3FHKA 4WF4A 1A2MA 3GL3A 4KNDA 4ZBAA 1VGLA 4O5RA 2JL4A 1WWJA 1R26A 2O89A 1X5CA 4K7NA 1KBNA 1K0DA 1XWGA 4GSNA 1GWCA 2LRTA 3CSHA 3RPNA 1XXUA 3QCPA 1ML6A 1HNCA 2H1GA 3IXRA 4GQFA 4NAXA 5CRDA 1J9BA 3RPPA 2E2MA 3KCMA 3JCML 4AJ7A 1SD9A 5GAND 2CVKA 4MJBA 2MBTA 3C7MA 4JU5A 3A5WA 4MMMA 5HFKA 1THXA 3IRAA 5DQSA 3RHCA 1ON4A 2VM1A 2R4VA 3GYKA 1V58A 1GTBA 1SL0B 1ZCPA 2PU9C 3SBCA 1GP1A 3D6IA 3ZFBA 4MPFA 4ECCA 2YOIA 4I5QA 1F6MC 2HZEA 2OACA 3U5RE 8GSSA 3TRPA 3UVHA 1VF2A 1X9MB 1AIUA 1LJRA 1T4ZA 2VIMA 2ALBA 1AQXA 2HSYA 3TOUA 2GDRA 2I1UA 4IQAA 3FEUA 1URMA 3RBTA 4XTSA 2B1LA 2XHFA 1R4WA 3ZZXA 5H5RA 3LWAA 1SJZA 2IMFA 4MLYA 2H74A 4GSSA 3E9JB 3I43A 1F37A 4HJ2A 5J5NA 1M2BA 1PN9A 5DJMA 1NM3A 4IBPA 5ECOB 4LA1A 4EDYA 3NOFA 3KD0A 3QR6A 1QK8A 4EE0A 3GKMA 1ERWA 1TJDA 4ZBDA 1K0BA 4IJIA 10GSA 4MA9A 1G0TA 1MTCA 1AW9A 1THOA 2CVBA 2PMTA 1GSSA 1T1VA 5FHIA 1SK2A 1PKZA 4IP6A 3C8EA 2L59A 1FVJA 4K7OA 5F05A 4G9HA 3UIWA 3TKQA 4POBA 2IIYA 3C1SA 4WR4A 4I6XA 2E2GA 1AXDA 5EPFA 2G2QA 1FG4A 2EIOA 3EMXA 1V40A 4NV2A 4JR6A 22GSA 2YN1A 4TXOB 1YZXA 2OKAA 2X8HA 1EP8A 2BTOT 2H01A 3F4RA 7GSSA 2WDUA 1FO5A 1E2YA 2C8UA 3US3A 2RUEA 6GSWA 3IR4A 3KH7A 5JWRB 1VF1A 4CDOA 3GKXA 4JE1A 4I97A 2L6CA 3LSZA 4POKA 4GXZA 3HJPA 2VCZA 3C73A 4HI7A 1WE0A 2H6XA 4G10A 2M46A 4V1Ag 2JZRA 1SJ6A 1QQ2A 2H1AA 1JLVA 1T7PB 4L5LA 1B9XC 3FR6A 5ECNB 5CAXA 2RIIA 2GZZA 3R2QA 3F63A 1SYXA 2PVOC 3CSIA 5CRGA 5B8BA 5G31A 4MK3A 1GLPA 3PINA 4ECBA 2FA4A 3GA4A 1OE7A 1UVZA 1XOBA 2K18A 1HNAA 1X0RA 2H0GA 3VWUA 2M80A 1K3YA 2PVQA 5IMZA 4K2DA 12GSA 1Z6NA 1XZOA 1NHYA 1M2AA 4K0GA 3GURA 4K1FA 1U3IA 3GKKA 4AJ6A 1SL2B 2DJ0A 5KN0A 5CRHA 1SD8A 2R2JA 1KEBA 3HZ4A 3Q74A 4GCIA 1XPVA 2VL2A 4BWSA 4DSSB 4HU9A 1K3LA 2GSRA 2GQKA 2FWHA 1N2AA 2VCQA 1A8LA 2DMMA 4XRAA 1PX7A 4XIHA 3J7Yb 2I3YA 1FB0A 4TR1A 2HRFA 4E8HA 2H8LA 4IQ1A 3VPTA 2L57A 4ZL9A 2RLIA 1GSFA 3MNGA 1PL1A 1TXXA 1ZL9A 4HUAA 4XS4A 5CREA 1TDIA 3M3MA 3I69A 3MAKA 2JSZA 2EIRA 4ZL7A 1ST9A 1YEPA 2ON5A 2B5XA 2VM2A 5HR2A 3P2AA 5DAKA 2CX4A 4WKWA 2C80A 4Q5FA 1YQ1A 1M7TA 6GSXA 4KCAA 2FD3A 5INYA 2KOKA 2MMNA 4ECJA 4XS1A 4FIWA 3TDGA 1BJXA 3PH9A 4BVYA 1QXHA 3KEBA 2FUG2 2XPDA 3WT2A 2VAFA 1Q4JA 5IOXA 2M72A 2YP6A 3QFBC 2ZUPA 4MABA 2TRXA 1NHOA 3A2XA 4ZIJA 2R37A 3KP8A 4ZB8A 4MCUA 3TCOA 2C0DA 4LLRA 2ES7A 3FZAA 3GUSA 1Y25A 1KNGA 3VWVA 3C1RA 14GSA 2HXKA 4I2UA 1PL2A 4OFTA 1XWKA 4OCFA 3KTLA 4BVXA 4GF0A 4DEJA 2BMXA 5JCWA 1YEXA 3UMAA 2EC4A 4TN8A 4KDYA 3TKPA 1TU8A 4CW9A 1VF4A 2V2GA 4KA0A 5EY6A 1DE1A 4XCSA 2I9HA 2VCXA 3M1GA 5HFGA 3EINA 2AAWA 2I81A 2H0HA 4ISDA 3TJBA 4D73A 4YAVA 4HDEA 2A2RA 2WB9A 1O6JA 1EV9A 3E3EA 4RI7A 1YF1A 2B3SA 4X0XA 4ILFA 4I2TA 2PPTA 2LJRA 4XHMA 2IMDA 1HQOA 2DIYA 3QAGA 1OYJA 3GX0A 4POMA 4MPGA 5HR1A 1V98A 4OWYA 1KTEA 2P5QA 2RM5A 5D9WA 1V57A 2YWMA 3LFLA 2VLVA 4ECIA 3WGDA 1MDKA 3GRXA 3IK9A 5B6MA 2GTUA 4ZILA 1EGRA 5LNKe 2HZFA 4OD7A 1GSDA 4LMWA 1B4QA 5DALB 3QMXA 4GRFA 4NV5A 3RDWA 1AC1A 2DMLA 3LG6A 2QSIA 3EURA 3VPQA 2JZTA 3ED3A 5LCZA 3A3TA 16GSA 3ISOA 2FLSA 2K6VA 3EC3A 1GTUA 3IA1A 3D4TA 4KCEA 1ERTA 5HQPA 5JWOB 5CNWA 4Q5RA 4WXTA 2CAQA 2EIQA 2YCDA 1QUWA 4EUYA 4AJ8A 3ERWA 2DJ1A 2CT6A 4K9ZA 4HZ4A 2B6MA 2TIRA 4ULXA 1O7UA 3GNJA 3IAS2 2O7KA 1TKDB 2R5GA 1K0AA 2LRNA 5J9CA 4O32A 5DALA 3IK7A 3ZTLA 1UA5A 4NHWA 1FW1A 5IM9A 3APSA 1R5AA 3KZQA 2RUFA 4ZB6A 1U6TA 1PQNA 3ZIJA 2LS5A 5ECPB 1GH2A 4KUNA 5J4UA 2AB6A 3U6VA 1GTAA 5ECMB 1FAAA 2DJKA 2ZCTA 4HZ2A 4WR5A 4BL7A 3DMLA 2LNTA 4QQ7A 5B8AA 4WBJA 2VCTA 2PBJA 1XVQA 3UARA 2K8VA 4QL7A 1TI3A 3MWHA 4N30A 3DKSA 4FYUA 5DQYA 2B1KA 3DIEA 1BAYA 5G1KA 3L4NA 2HSHA 4PNFA 3FRCA 4KDUA 5F06A 2DBCA 4JBBA 1AAZA 3TRQA 4L8EA 2LUSA 4KGIA 1BYEA 1WOUA 3G7JA 3HZ8A 2A2SA 4TOPA 1OVNA 5A5KA 3EVIA 1CQHA 3F3RA 2HLSA 3BOAA 2QKEA 5AGYA 4ACSA 1X9WB 1GRXA 2ZNMA 3H8QA 2FWEA 3UBLA 2YZHA 4IHUA 4V2MA 18GSA 4KSMA 4PGTA 3GSSA 3FZ5A 4RQXA 1K0MA 2O85A 1DE2A 2C3NA 1FOVA 1MD4A 4OFMA 1Z6MA 3F6FA 1K0NA 1SL1B 4EC0A 3GH9A 2L6DA 4ZXGA 3DYRA 4JEDA 4YH2A 3EU4A 4Z7XA 1YJ6A 3UVTA 3H79A 1O81A 4MJCA 3GX8A 5C04A 3H4KA 1BX9A 4KH7A 4IELA 3K8NA 2TRCP 6GSSA 2HNLA 4EDZA 2XBIA 5AN1A 4MDCA 3UL3A 4PQHA 5EVOA 2WJUA 3F0IA 3F3QA 1X5EA 1A24A 1SK0A 2B5YA 3P8WA 2VLTA 3CYNA 5DAKB 5B6NA 1ERUA 1RK4A 1TK0B 3GH6A 3PGTA 2LSTA 1GULA 6GSUA 3FW2A 3GSTA 3RHBA 2PN8A 1OKTA 1YF0A 1OAZA 3GL5A 3GTUA 2CAIA 2V1MA 3ME8A 3HHVA 5IO0A 5KN1A 3BJ5A 1EP7A 1XWCA 1Z9HA 4OO4A 5ID2A 3HCZA 2NVLA 4P3YB 5G2ZA 3HJOA 1M2DA 3LQ7A 4J57E 2WCIA 2CA8A 1G7OA 5C00A 4TR3A 4DSSA 3TKSC 1MD3A 3HXSA 4MJEA 5FWGA 3D21A 1GLQA 2IL3A 3TJFA 4L0UA 1F9MA 2N5FA 4X1UA 4EL1A 3G9BA 2CVDA 2AUVA 1A23A 1GTIA 1TK8B 4GQCA 3UBKA 5AIXA 2V6KA 1ERVA 1PA3A 4MH2A 3MSZA 4K8MA 3G7YA 3J7Yk 3WYWA 3L9UA 1NSWA 3I9V2 2VL3A 2XBQA 20GSA 5DVBA 2FHEA 1TW9A 5G5EA 1JZRA 5J3RA 3Q18A 3RAZA 2PERA 1WMJA 5ECRB 3SWLA 2LV3A 2X64A 3HD5A 5IIZA 1DUGA 1B4PA 3HYPA 2DLXA 2FGXA 4X43A 2DJ2A 5ELAA 2GT6A 4HU7A 4NXIA 5KEJA 4NMUA 4N11A 1U87A 2I4AA 1FHEA 5H5QA 5KN3A 3W6GA 1ABAA 4V1Ap 3LJRA 4KAEA 3DVWA 2WFCA 5G30A 4D73B 1PMTA 4TXOA 2YWIA 3CSJA 2E0QA 3CTFA 3DGQA 2ON7A 3TUEA 1F3AA 2BJXA 3FY7A 2KHPA 3CRUA 3FZ4A 4F0BA 2GQLA 1AQWA 3DVXA 4GSTA 3IE3A 4N0ZA 5FT3A 1XCCA 4F2IA 2OBIA 3PR8A 4DSRA 5GAPD 1F2EA 2P5RA 3DD3A 4PQ1A 3L78A 3O76A 1TI1A 2G0FA 2L5OA 5KN2A 1RW1A 2P0GA 4KB3A 2JZSA 5IOWA 1G6WA 4LL4B 2H0IA 3FZ9A 3IC4A 2IPAA 4XRDA 3F4TA 19GSA 1PKWA 1SKRB 1XW6A 1TTZA 5DCGA 5J41A 4OFNA 1B48A 4EXJA 4GLTA 1EEJA 2VO4A 4ID0A 2LJAA 1HD2A 4TR1B 1X9SB 3Q6OA 5CRWA 5CYYA 3AY8A 3MDKA 5ECIB 1RQMA 1S3CA 5DBQA 2MYGA 1MDJA 3IV4A 1XW5A 4YAPA 4DSQA 1YY7A 4MF7A 1GSUA 4RUVA 1BG5A 1LBKA 1HNBA 2FWGA 3H1NA 4FYCA 3M9JA 4KW6A 4IN0A 2YZUA 3ERFA 2LRCA 5ECLB 3IOSA 2C1YA 1J0FA 4G2EA 3ZVJA 2OBKA 1YDKA 1M99A 4HEA2 3UJ1A 2NDOA 1T00A 1IYIA 2VL2C 4AGSA 5HR0A 1WIKA 1N8JA 4TVEA 1Z5YE 11GSA 1M0UA 2GVPA 1F3BA 4TXVA 3CRTA 2F3MA 1JFUA 4FH8A 4TR0A 2H30A 1A2LA 1Y6EA 3UAPA 2AJQB 2IMKA 5COHA 3IPZA 5LD0A 1UN2A 3GMFA 5H5SA 2CX3A 3WD6A 2GSTA 3M8NA 1I5GA 1TP9A 5GZZB 5ECSA 5CO3A 1XFLA 5D9TA 1Z7RA 2H1BA 1OE8A 4N10A 3ZMKA 3ZRDA 4OMVA 3LYKA 5IMDA 3S9FA 6GSTA 4CHSA 3KIJA 5F0GA 1XWAA 3QAVA 3APOA 4IJ3A 5IMCA 3TB2A 5ECKB 5ECHB 1TOFA 3A2VA 1PRXA 3BD2A 3M9KA 5GSTA 3EYTA 3HY2A 3LORA 3TJGA 2VD0A 1OKDA 3TKRA 5D93A 5F07A 2GZYA 5F8BA 4F03A 5IO2A 3N9JA 4JZQA 3ZYWA 3H93A 4PNGA 3QPMA 2F9SA 3LGCA 2HT9A 4XS6A 1CQGA 2X8GA 4ZB9A 2C0EA 3NIVA 4PQIA 3BBYA 3BCKA 2IFQB 3EE2A 1TK5B 3DEXA 2E7PA 5CP1A 1GUHA 4IS0A 5A4UA 3LEFA 1SKWB 1QGVA 1ILOA 1EEMA 3IHQA 1LU4A 1W4VA 4LL1B 1SKSB 4HS1A 1R5PA 2KP1A 5G1LA 3BCIA 4AF2A 2N5AA 5HR3A 2OADA 3QD9A 5DCHA 4ZBBA 1TRSA 1EZKA 4TRXA 3EU3A 1U3AA 2AV4A 2C3TA 4GWRA 3FYGA 4G19A 1TRVA 2DSAA 5IPGA 4E8EA 4KDXA 4HJMA 2WS2A 3GTUB 2YANA 3TGZA 1O85A 3D4MA 1M9AA 5D9VA 1JZWA 4RI6A 4YQMA 3NZNA 4N0VA 1FB6A 2OE1A 3WT1A 2OJLA 1XWBA 4NWYA 2IJYA 3W8SA 2H75A 2PUKC 4O92A 2X99A 17GSA 5JCUA 4F9ZA 4TW5A 3E0UA 1A0RP 2Z9SA 4IP1A 1ZYEA 9GSSA 4PUFC 3VURA 3Q19A 1C72A 1JZDA 3HKRA 5A4WA 5JWQB 1H4OA 3G7IA 3O6TA 1BQ7A 2C3QA 2NPBA 2MBSA 4HQZA 4YQVA 4DVCA 4FO5A 3VFIA 1ZZYA 5IMFA 3O3TA 3I6AA 5IMVA 4ZL8A 4JRRA 3KXOA 3P7XA 4F82A 1ACVA 2IMIA 3UOMA 4I8BA 3QAWA 5D9XA 1EOGA 3QFAC 3TOTA 2H70A 2CQ9A 4PXOA 2OE3A 1YKCA 1T3BA 2CZ3A 2HFDA 1GUKA 1I9DA 4ML1A 3ZVJD 2FCHA 3HJMA 4FYBA 4L5OA 1ZYQB 4K6XA 1XOAA 1XW9A 1K0OA 2YJ7A 1OC8A 3EWLA 2YPMA 1GUMA 4O7HA 1SU9A 2LNSA 1ZGNA 2MMOA 4HOJA 2VCWA 1Z3EA 4H86A 2JU5A 1QFNA 5B7CA 1TRUA 1OC3A 1PGTA 4V2NA 3KMNA 3LXZA 4TKYA 4BWQA 2MMAA 2GSSA 2GZPA 2HE3A 1O73A 3ZFLA 2YV7A 2HRNA 4KSOA 5DJLA 1W89A 1OC9B 2NBSA 3APQA 1EOHA 4J56E 5AIVA 2REMA 2L4QA 2LEGA 1Q98A 2WRTA 2RM6A 1V2AA 3D5JA 4F0CA 2QGVA 1WP0A 2CV4A 2JSYA 2P31A 3GHAA 2XC2A 4MZCA 3V1WA 1X5DA 4TR4A 5G5FA 3ZL5A 2AYTA 1TRWA 2D2ZA 1SJIA 3KGKA 1UC7A 4NPBA 2H76A 2WULA 3ZREA 2PWJA 5A4VA 3KTBA 1MEKA 1B8XA 5DDLA 1VRSD 3FR9A 2YWOA 4GTUA 3ME7A 4JR4A 1NW2A 2MZCA 1A8YA 3VLNA 2MMZA 5AISA 3KP9A 5ENUA 1TU7A 3HVSA 3F4SA 3WGEA 5ELGA 3F6DA 3GKNA 2O8VB 2LQQA 3HVXA 3KH9A 3W8JA 1DSBA 1WJKA 2IN3A 1BEDA 5HFIA 2KP2A 3IBHA 1GNWA 1HYUA 4J2FA 4RQRA 3IAM2 3OR5A 2VLUA 4IKHA 2VD1A 5E59A 4WEYA 1M9BA 1GSYA 3TKSA 4NHZA 1R7HA 1GNEA 3TJJA 2X8CA 2JACA 1WPIA 1FVKA 3HA9A 3QOUA 4MZBA 4Q5NA 5GSSA 2H6ZA 1IYHA 1H75A 1SYRA 2GSQA 3KMOA 3VWWA 1XVWA 4EVMA 2VUPA 4EKZA 4OO5A 1XIYA 2LQOA 2GLRA 4POLA 2B7KA 2N5BA 2JADA 3ZMLA 1T8EB 3KM6A 1JZOA 3GN3A 3L9VA 4KX4A 1V9WA 2OA7A 1WRYA 3ZITA 1SENA 1XBSA 2V41A 1S3AA 2IMEA 1ZMAA 4K0NA 2H66A 2J9HA 1T4YA 4EO3A 5ID2B 1JHBA 1EGOA 2KLXA 2J23A 3CXGA 3F8UA 4PX1A 3KJYA 3ERGA 4IW9A 3VK9A 2K9FA 2VCVA 2H73A 5D96A 2XPEA 1Z7PA 3LYPA 1EWXA 1B9YC 2NTOA 4MZWA 1J08A 1GL8A 1A0FA 2B7JA 3F9UA 2F51A 5EL8A 2DC5A 1AQVA 2FNOA 1USBA 2A4VA
chains in the Genus database with same CATH superfamily
1OC9A 4MF6A 1UUGB 1FUSA 1IQ8A 3LXTA 2CHCA 2IFQA 1QVG2 3HDCA 1FGTA 2RSXA 3UEMA 3EN8A 1LQGC 5EQLA 3C71A 4V2LA 1AUCA 3M0FA 4N6TA 4PUAA 4L8PA 1ZOFA 1YKAA 2H1DA 4J5KA 3L0HA 1A67A 2XSHB 5J9BA 4OCEA 2YJHA 2F8FA 1O8XA 3KIIA 1VF3A 2R0CA 2FGTA 3HX8A 3GV1A 3TJKA 1G6YA 3FK8A 4L0WA 1RGGA 4KE3A 4WBRD 3VI7A 1PD21 3FGYA 3LOYA 4YQUA 2L4CA 3ZIVA 3T8NA 5IEPA 3MYDA 1IVVA 1UUWB 3VI5A 3PGBA 5FW5A 3G4S3 4Q5QA 3HVVA 1UGHI 2HYXA 2CZ2A 5D73A 2QC7A 4U13A 3PXMA 4BA7A 2GU3A 1SK1A 4LMVA 3N5OA 2V32A 3DGOA 3DRNA 1RGCA 3CC43 3STDA 3FR3A 4IVFA 3EF8A 1DBYA 1IVXA 5TGNA 4ML6A 3CBUA 3K9MC 3TKSE 3OXAA 3EMPA 13GSA 1OF5A 1I2GA 3F14A 2B5EA 5IG3A 4HQSA 1BSDA 2R6KA 3CMIA 3QK9A 2F4YA 4J5GA 5IPHA 1KD14 4XS4B 1K0CA 3N9HA 1MWSA 5E4WA 5A0OB 2H6YA 1IU7A 2W03A 3A2WA 6GSYA 3D22A 2VL9A 2XEPA 3GZBA 1QVF2 2OCTA 2X49A 1U88A 1UI8A 2DJJA 2LTKA 1GSEA 3D0ZA 5ECQB 2V6OA 3BIRA 2LJKA 3BNDA 3AGOA 1EV4A 1U5OA 4HM7B 5ABRA 3WODG 3QDNA 3FKFA 4FMAA 2O87A 3ZLPA 3NQYA 7GSPA 2YNXA 3PYJA 1HU9A 1TIJA 3GIXA 2OWPA 1Q7Y4 1QMVA 3LTCA 4IGJA 3OW22 2FY6A 4MF5A 4WF5A 1CYUA 2WOFA 2GS3A 2YV9A 1BRHA 2RBIA 1CQSA 3EBTA 1UUVB 2L5LA 6GSVA 2PGTA 1PSQA 3L9SA 2FA8A 2C0GA 3IDVA 2XFTA 1PX6A 1O8WA 2KUCA 5IMAA 4MJAA 4K7IA 2RCDA 4TX4A 2OOVA 2F8AA 2VOCA 6GSPA 1M904 5IQYA 3FCSB 1GD4A 2LKUA 3P90A 2GQMA 1YNVX 3LTAA 5IW9A 1RGFA 4WETA 1JV2B 3D5IA 3G16A 5CXOA 2D1WA 3JUOA 1MDIA 2ML6A 2F99A 4PURA 1GSQA 1G7EA 2HI7A 3NQZA 1MWTA 2WZ9A 3FG4A 4BPYA 1N9EA 2YWNA 2DIZA 3GFKA 3DXBA 1RGEA 2PNCA 2K8SA 5JCGA 4EF0A 2KF5A 1A2JA 4QL9A 8RNTA 2OE0A 1TTOA 3DWVA 1VQO3 2XGNA 4XDVA 4MH3A 5D8IA 1S3DA 1IV9A 1E97A 2CKFB 2GGTA 4KF9A 4RNYA 1JLWA 3VWXA 2H19A 3DGMA 2GT5A 3CQFA 3I563 3WGXA 2FWFA 1E6BA 2IWTA 2H71A 2C4JA 1IVWA 2DJ3A 1SQWA 4MP4A 1TUHA 3TRXA 5L71A 2C0FA 4J9AA 2R41A 2HSMA 3WHOA 2AHEA 2R3XA 3SOYA 2HZEB 2WGRA 1K3OA 1Q9EA 1A90A 2H72A 3CTGA 2P0MA 3FHKA 1OPYA 1B2MA 1A2MA 4WF4A 3GL3A 4KFDA 3RGAA 4KNDA 1OCVA 4ZBAA 1BUJA 2CW9A 3S27A 1VGLA 4O5RA 2JL4A 1WWJA 1R26A 2O89A 1X5CA 4K7NA 1KBNA 1OUNA 1K0DA 1PN0A 1R4YA 1XWGA 4GSNA 4STDA 3X3XA 1GWCA 3UJMA 2LRTA 3CSHA 3RPNA 1XXUA 1DETA 3QCPA 1ML6A 1OHOA 1HNCA 2H1GA 1DMQA 3LZAA 1I0XA 3H51A 1I8VA 1Q40A 1A2VA 3QRDA 5BVBA 3IXRA 4GQFA 4NAXA 5CRDA 1FGOA 1J9BA 3RPPA 5ELUA 1JRQA 3HIIA 3FG1A 2E2MA 3KCMA 3JCML 4AJ7A 1SD9A 5GAND 3I0YA 1RCKA 2CVKA 4MJBA 3GZYB 1BRGA 1DYUA 2MBTA 3C7MA 3LTDA 4JU5A 3A5WA 1MWUA 1NB3I 3D9RA 4MMMA 5HFKA 3K63A 1THXA 1YIJ3 3IRAA 4YKFA 5DQSA 4NREA 3RHCA 1ON4A 2VM1A 2R4VA 3GYKA 1V58A 1GTBA 2CWTA 1SL0B 1ZCPA 4G0IA 1RMSA 2PU9C 1FGMA 3SBCA 1RJOA 1GP1A 3D6IA 5BMUA 3ZFBA 4MPFA 4ECCA 2YOIA 4I5QA 1F6MC 2HZEA 2OACA 3U5RE 8GSSA 3TRPA 3UVHA 1IYYA 3JUMA 3HIGA 2JDIH 1VF2A 1X9MB 1AIUA 1LJRA 3DY5A 4K5SA 1T4ZA 2VIMA 2O9UX 3MSOA 2ALBA 1AQXA 2HSYA 2WGOA 4WWUC 3LTBA 3TOUA 2GDRA 2I1UA 2XFSA 4IQAA 3FEUA 1URMA 2CWVA 5JBSA 3RBTA 4XTSA 4MMZB 1TFKA 2B1LA 2XHFA 1R4WA 1RCLA 3ZZXA 5H5RA 1W02A 5DRVA 2I9WA 3LWAA 1SJZA 3SXXA 2IMFA 4IT7A 1QMAA 4MLYA 5KOWA 2F5WA 1JKGB 4N6UA 2H74A 4GSSA 3E9JB 3DXOA 3I43A 3LYGA 1F37A 4HJ2A 4HM8B 5J5NA 1M2BA 1SIHA 2B24B 1PN9A 5DJMA 1LNHA 1NM3A 4IBPA 5ECOB 4LA1A 3CCS3 4EDYA 3NOFA 3KD0A 4L7KA 3HI7A 3QR6A 2WO0A 1QK8A 4EE0A 3GKMA 1JB4A 4HAAA 1ERWA 1TJDA 4ZBDA 1K0BA 4IJIA 3K0ZA 10GSA 4BTYA 4GSPA 4MA9A 1G0TA 1MTCA 1AW9A 1G02A 1DMNA 1THOA 5IG4A 2CVBA 2PMTA 1RTUA 1GSSA 1T1VA 2P05A 5FHIA 4R4KA 5AIFA 1SK2A 1PKZA 4IP6A 3C8EA 2L59A 1ISKA 1FVJA 4K7OA 2BMQB 2C10A 1YI23 3CPOA 4FR9A 5F05A 4G9HA 3UIWA 3TKQA 1S5AA 3SYUA 1Q864 5IG0A 1GYBA 1MNLA 4POBA 2IIYA 3C1SA 4WR4A 1IK3A 4I6XA 1YJ93 4N3VA 2E2GA 1AXDA 5EPFA 3ROBA 2G2QA 1FG4A 4EV2A 2EIOA 3EMXA 1V40A 1TFOA 4NV2A 3U1WA 3WA2X 4JR6A 2BO9B 22GSA 2YN1A 4TXOB 3RDEA 1YZXA 4XBTA 2OKAA 2X8HA 1EP8A 2BTOT 1NDOB 5CLKA 2H01A 3F4RA 1OHPA 7GSSA 1WMOA 2WDUA 1FO5A 1E2YA 2HOHA 2C8UA 2HMJB 3US3A 2RUEA 6GSWA 3NXJA 1BVIA 3G713 3IR4A 3KH7A 4CCVA 5JWRB 1W4NA 1FUWA 1VF1A 4CDOA 3GKXA 4N6MA 4JE1A 4I97A 2L6CA 2RNTA 3LSZA 1SJWA 1KWIA 3D3LA 4GXZA 4POKA 3HJPA 2VCZA 3C73A 4HI7A 1WE0A 4GHOA 1RHLA 2H6XA 4G10A 2V1LA 2M46A 1K8A4 4V1Ag 3O8YA 2JZRA 1HZ1A 1SJ6A 1QQ2A 2H1AA 3WOFB 1RLSA 1QAFA 1I70A 1JLVA 2A4HA 3GZXB 1T7PB 3EB8A 4L5LA 1B9XC 4LSOA 2RFRA 3FR6A 5ECNB 5CAXA 2RIIA 3JVCA 2GZZA 4CJNA 3R2QA 3F63A 4J8TA 3S28A 1SYXA 5JPPA 2PVOC 1EKMA 3CSIA 1FGQA 5CRGA 5B8BA 2GXFA 5G31A 4MK3A 1GLPA 3PINA 4ECBA 2FA4A 3GA4A 1OE7A 1UVZA 3CCV3 1XOBA 2K18A 1HNAA 2H0GA 1X0RA 3VWUA 2M80A 1K3YA 2QA1A 2PVQA 4HM4B 5IMZA 4K2DA 1OACA 12GSA 1Z6NA 3X3ZA 1XZOA 1NHYA 1M2AA 4K0GA 4CDLA 3GURA 1I2EA 4K1FA 2YFJB 2QEX3 1X1XA 1KC84 1U3IA 3GKKA 2F56A 4AJ6A 1SL2B 4OK0A 1N8QA 2DJ0A 5KN0A 5CRHA 4HM5B 1SD8A 1ASKA 2R2JA 1KEBA 3HZ4A 3Q74A 2FXTA 2W6JH 4GCIA 1VZZA 1XPVA 2VL2A 1K41A 1KSIA 4BWSA 4DSSB 4HU9A 1K3LA 1YJN3 2GSRA 2GQKA 2FWHA 1N2AA 2VCQA 1A8LA 2DMMA 1PFPA 3T0UA 4XRAA 3GZRA 3U97A 3FH1A 1PX7A 4XIHA 1BNJA 3J7Yb 1M9GA 4USSA 3ZG0A 2I3YA 4QWTA 1FB0A 1W2ZA 4TR1A 2HMKB 4FCMA 2HRFA 4E8HA 1OHSA 2H8LA 3EE1A 4KZ1A 3RGRA 1YJW3 4IQ1A 3VPTA 2L57A 4ZL9A 3F7SA 5AEUB 3Q90A 2RLIA 1GY5A 3X42A 1GSFA 3CPW2 3MNGA 4PEJA 2XR8B 1PL1A 1TXXA 1SARA 1LOXA 1ZL9A 4X2HA 1MWRA 3Q1CA 1PFOA 4HUAA 4XS4A 4K61A 5CREA 2HMOB 1TDIA 3M3MA 1K734 3I69A 3MAKA 3WDGB 2EIRA 2JSZA 4ZL7A 1M1XB 2J8XB 1OGXA 3AHWA 1ST9A 1YEPA 4R9KA 2ON5A 2B5XA 2VM2A 5HR2A 3P2AA 5DAKA 3SX1A 1VQ93 2CX4A 4G0LA 4WKWA 2C80A 3D79A 4Q5FA 4EBGA 1YQ1A 1M7TA 6GSXA 2KAAA 2QA43 1HKXA 4KCAA 2FD3A 5INYA 2KOKA 2CFKA 1WMNA 1TU5A 2MMNA 4ECJA 1AV4A 1W7CA 4XS1A 1BSEA 4FIWA 2A15A 3TDGA 1BJXA 3GSPA 4EW5A 3PH9A 4BVYA 1QXHA 3KEBA 3DGNA 2FUG2 2XPDA 2Z6BA 3WT2A 2VAFA 2YX9A 1Q4JA 4O5QA 5IOXA 1NNVA 2M72A 2YP6A 4H3UA 2ZUPA 3MHEA 3QFBC 4MABA 2TRXA 1NHOA 3A2XA 4ZIJA 2R37A 3KP8A 4ZB8A 4MCUA 3TCOA 2C0DA 1BNIA 1X1UA 3LT9A 2ES7A 4LLRA 3FZAA 1O7MB 2R0GA 3GUSA 1Y25A 1KNGA 3IMAB 1IQYA 1CH0A 1W6CA 4BL7B 3VWVA 1OGZA 1N5HA 3C1RA 14GSA 3EBYA 3N8BA 2HXKA 4I2UA 3NBJA 1PL2A 4OFTA 1XWKA 3Q2PA 4OCFA 1LRAA 3KTLA 4JF8A 2KXGA 4BVXA 4GF0A 1IT7A 1RDSA 4DEJA 2BMXA 5JCWA 1YEXA 2IY2A 4N6LA 5HGRA 1Y4KA 3UMAA 2EC4A 4TN8A 1FW7A 1BSCA 4KDYA 3TKPA 3PZWA 3VF1A 1TU8A 4CW9A 1B2UA 3HK4A 2E2UA 4BIRA 1VF4A 2V2GA 4KA0A 1GD3A 5EY6A 1DE1A 4XCSA 2I9HA 2JQ5A 2VCXA 3M1GA 5HFGA 3EINA 2AAWA 2I81A 2H0HA 4O3VA 4MMYB 4ISDA 4HKVB 2BT3A 3TJBA 4D73A 4YAVA 2INXA 4HDEA 2KRTA 2A2RA 3DM8A 1W6GA 2WB9A 4LEHA 1EV9A 1O6JA 3E3EA 4RI7A 1LNIA 1YF1A 2B3SA 4X0XA 1UI7A 4N6NB 4ILFA 3ZG5A 4I2TA 2PPTA 2LJRA 4XHMA 2IMDA 1HQOA 4K5RA 2DIYA 1B20A 3AGNA 3QAGA 1OYJA 3GX0A 4POMA 4MPGA 5HR1A 1V98A 2XGLA 1EUIC 4OWYA 3B4OA 1KTEA 2P5QA 3MIXA 2RM5A 4CY8A 5D9WA 1V57A 1RKYA 2YWMA 3LFLA 2VLVA 1M1K4 1RNBA 4ECIA 2Y73A 3WGDA 3WR2A 1MDKA 3GRXA 3LMLA 3PCRA 3IK9A 1O7PB 5B6MA 2GTUA 2IMJA 4ZILA 1EGRA 3CC73 5LNKe 4MMXB 2HZFA 4OD7A 1LVNA 1GSDA 1JKGA 3LW9A 1OH0A 4LMWA 4HBRA 1B4QA 1QJGA 5DALB 3QMXA 1UCLA 4GRFA 1GMPA 4NV5A 3RDWA 1PY3A 1JBTA 2E2TA 1AC1A 2DMLA 2OOVC 3LG6A 2QSIA 5STDA 3EURA 3VPQA 2UZ8A 4BTXA 2JZTA 3ED3A 5LCZA 3A3TA 1BRKA 1BUQA 16GSA 1W2B2 3BNCA 4FCZA 1VQ73 3ISOA 2FLSA 2K6VA 3GRDA 2BMRB 3EC3A 1GTUA 1BGSA 3IA1A 3CCR3 3D4TA 2P0XA 4FQUA 3V99A 4KCEA 1ERTA 3J7Yd 5HQPA 5JWOB 5CNWA 4Q5RA 3ZFZA 4WXTA 2CAQA 2EIQA 2YCDA 1QUWA 4EUYA 4HOHA 4AJ8A 5IERA 3NM7A 3ERWA 5M1AA 2CT6A 2DJ1A 4K9ZA 4HZ4A 1ROAA 2B6MA 4RZMA 2TIRA 4ULXA 1O7UA 3GAXA 3GNJA 3IAS2 2O7KA 3KFQC 1TKDB 2R5GA 1BAOA 1K0AA 2LRNA 2IYJA 5J9CA 4O32A 5DALA 3IK7A 4MEIA 2B1XB 4G1MB 3ZTLA 1UA5A 4NHWA 1FW1A 2KF6A 3PCSA 5IM9A 1PYLA 3JUNA 1R5AA 3APSA 3KZQA 2RUFA 4ZB6A 2CK3H 6STDA 1GOUA 1U6TA 2GEXA 1PQNA 3A5IA 3CCL3 3ZIJA 2LS5A 5AYSC 5ECPB 4HM3B 3DGYA 1AVLA 1GH2A 4KT3B 4KUNA 5J4UA 2AB6A 2QA2A 2BIRA 3U6VA 1GTAA 5ECMB 4WYKA 1FAAA 2DJKA 2ZCTA 3MYTA 1N5PA 4HZ2A 4WR5A 4BL7A 3RNTA 3DMLA 3S67A 4CY6A 2LNTA 4QQ7A 5B8AA 1MOLA 4WBJA 2OQEA 3UNLA 2VCTA 2BHMA 4JRFA 2PBJA 3FLJA 4OUQA 1XVQA 2HRAA 3UARA 2K8VA 1JBSA 4QL7A 1TI3A 3MWHA 4N30A 1M3JA 3DKSA 1JBRA 4FYUA 1N8R4 5DQYA 2B1KA 2FNQA 1YIT3 3DIEA 1BAYA 3MKIA 3H3HA 5CF2A 5G1KA 3L4NA 2HSHA 4PNFA 2F86B 1MGWA 1RGLA 1A2KA 3FRCA 4KDUA 2E2VA 5F06A 3F9SA 2DBCA 4JBBA 3UL6A 1AAZA 3TRQA 4L8EA 2LUSA 2F98A 3BU4A 4KGIA 1BYEA 1WOUA 3G7JA 1UDII 4XB5A 3HZ8A 2A2SA 4TOPA 1OVNA 5A5KA 3EVIA 3OWYA 1CQHA 3F3RA 2HLSA 3BOAA 2QKEA 5AGYA 1DVDA 4ACSA 1X9WB 1GRXA 2ZNMA 3H8QA 2FWEA 3UBLA 2YZHA 4IHUA 4V2MA 1Q814 18GSA 3GSSA 4KSMA 4PGTA 3FZ5A 5G2GA 2DKIA 4BIKA 4RNTA 3F40A 4RQXA 1K0MA 2O85A 2CH9A 1D6UA 2P38A 1DE2A 2C3NA 1FOVA 1MD4A 4XBXA 1FYSA 4OFMA 2BU4A 1VQ83 1Z6MA 3F6FA 5ELJA 1GMRA 1K0NA 5IENA 1SL1B 2CFDA 1K28A 3G8ZA 2D42A 4EC0A 1B3SA 1HYFA 3GH9A 2L6DA 3A76A 4ZXGA 3DYRA 3OWSA 4JEDA 4YH2A 3EU4A 4Z7XA 1YJ6A 3UVTA 3H79A 4XDWA 4BTWA 2IUJA 2GEYA 4I4KA 1O81A 4MJCA 3GX8A 1GY7A 5C04A 3H4KA 1BX9A 4KH7A 4IELA 3K8NA 1JNQA 1IVUA 1TRQA 2TRCP 6GSSA 4HZBB 2HNLA 4EDZA 2XBIA 1F8NA 5AN1A 3R3EA 4MDCA 3UL3A 4PQHA 5EVOA 2GSPA 6RNTA 3DUKA 2WJUA 3EQQB 3F0IA 3F3QA 5AI1A 1X5EA 1A24A 1BRNL 1B2ZA 2HMNB 1SK0A 2B5YA 3P8WA 2VLTA 3CYNA 5DAKB 5B6NA 1ERUA 1RK4A 2Z7AA 1OF5B 1TK0B 3GH6A 5JPUA 1S723 3VSYA 3PGTA 2LSTA 1D6YA 4FMDA 3LXUX 2UX0A 5M19A 1GULA 3FW2A 6GSUA 3GSTA 3X40A 3RHBA 3PPUA 2PN8A 1RGAA 1OKTA 1YF0A 3FSDA 3LT8A 1OAZA 3GL5A 3F7XA 3NBRA 3AMOB 3GTUA 2CAIA 2V1MA 2SBLA 3ME8A 1G96A 4LYLB 4NHFA 3HHVA 5IO0A 3MG1A 3BJ5A 5KN1A 1EP7A 4N6V0 1XWCA 1Z9HA 4OO4A 3DZLA 5ID2A 1T2IA 3HCZA 3CD63 4KFFA 2BNGA 2NVLA 4P3YB 5G2ZA 1ZX2A 3HJOA 1M2DA 3V92A 3LQ7A 4J57E 1SPUA 2CA8A 2WCIA 1G7OA 5C00A 4TR3A 1PU4A 1X1YA 3OX9A 4DSSA 3TKSC 1MD3A 3JUQA 3HXSA 4MJEA 3CMA3 5FWGA 4EIQA 3EPTA 3D21A 1GLQA 3CCU3 2QGUA 1ZYNA 2IL3A 3TJFA 4L0UA 1F9MA 2N5FA 4X1UA 4EL1A 5LC7A 3G9BA 2CVDA 5BRTA 3SOAA 1NB5I 2AUVA 1A23A 1GTIA 1Q824 3MG2A 4GQCA 3UBKA 1TK8B 5AIXA 2V6KA 1BSAA 1ERVA 1PA3A 4MH2A 3MSZA 3K5TA 5DREA 4K8MA 3MG3A 3G7YA 2LYXA 3WYWA 3J7Yk 2W2CA 1IQXA 3L9UA 1NSWA 3I9V2 3HOHA 3FZWA 2HMLB 2VL3A 4RNZA 3WOEB 2XBQA 2AADA 20GSA 5DVBA 2FHEA 3X3YA 1TW9A 1GSPA 5G5EA 1JZRA 5J3RA 3Q18A 5D82A 3RAZA 2HMMB 2PERA 1WMJA 5ECRB 3SWLA 2CWUA 3BNBA 5AIIA 2LV3A 3OV4A 2X64A 3HD5A 5HOHA 5IIZA 1DUGA 2CG1A 1B4PA 1E3VA 1YGEA 1E3RA 3HYPA 2DLXA 2FGXA 1BNSA 4X43A 2DJ2A 5ELAA 4HJLB 4HYZA 3ALAA 2GT6A 4HU7A 4NXIA 5KEJA 1IDPA 1CYVA 1STFI 4NMUA 3BB9A 3CCE3 2KF3A 3S5CA 4N11A 1YVBI 1U87A 2F5MA 2I4AA 1FHEA 5H5QA 1KQS2 5KN3A 3W6GA 1ABAA 4ICYA 1VQQA 2K54A 4K1UA 4V1Ap 1CEWI 3KN4A 3LJRA 3JUPA 1B2XA 1W01A 4BL3A 4KAEA 2MC8A 1W00A 1NWWA 3DVWA 2WFCA 2KF4A 5G30A 1YVSA 4D73B 1PMTA 4TXOA 3KKGA 2ML5A 2YWIA 4OVMA 1VQL3 3CSJA 2E0QA 3CTFA 3DGQA 2ON7A 2LQVA 3TUEA 1RSNA 1F3AA 2W56B 2BJXA 1AVKA 1D6ZA 2GBWB 4N6OB 2CG0A 5AIGA 1Q40B 3FY7A 1QAKA 2KHPA 1IT8A 3CRUA 3FZ4A 4F0BA 2GQLA 1AQWA 3DVXA 4GSTA 3IE3A 3PS8A 4N0ZA 5FT3A 4FCJA 1XCCA 4F2IA 2OBIA 3PR8A 2CFGA 4DSRA 5GAPD 1AY7A 1F2EA 4XBYA 2P5RA 3DD3A 1Q42A 3DGLA 4PQ1A 2L4VA 1QALA 1B21A 3L78A 3O76A 2STDA 9RNTA 1TI1A 1RGHA 4EV5A 2M7OA 1EQKA 2G0FA 1YGWA 2L5OA 5KN2A 1RW1A 1C54A 2GBXB 2P0GA 3EJVA 4K90B 1JJ22 3B4PA 4KB3A 2JZSA 5IOWA 1G6WA 3IJEB 1M3IA 4LL4B 2H0IA 3FZ9A 3IC4A 2IPAA 2X4AA 4XRDA 3CCQ3 3F4TA 1LOYA 19GSA 1PKWA 1SKRB 1XW6A 5KOXA 4A5PA 4WFOA 1TTZA 5DCGA 2AAEA 5J41A 4OFNA 1B48A 4EXJA 4GLTA 1A2PA 1EEJA 2VO4A 4ID0A 2W0QA 2LJAA 1HD2A 4TR1B 1X9SB 1TRPA 3Q6OA 5CRWA 5CYYA 3AY8A 3NV0A 3MDKA 1RQMA 5ECIB 1S3CA 5DBQA 2MYGA 1MDJA 3IV4A 1XW5A 4YAPA 4DSQA 1YY7A 4MF7A 2A2PA 5D81A 1NU3A 5BU4A 1GSUA 4RUVA 1BG5A 1LBKA 1HNBA 2FWGA 3FG3A 3H1NA 4FYCA 3M9JA 4KW6A 4IN0A 1IV7A 2YZUA 3ERFA 1I0VA 2LRCA 5ECLB 3IOSA 2C1YA 1J0FA 4G2EA 1WQLB 3ZVJA 2OBKA 1YDKA 1DMMA 1M99A 4HEA2 1UCKA 3KZTA 2ZDJA 3UJ1A 4O8SA 4HZ9B 3HZPA 2NDOA 1T00A 1IYIA 2VL2C 4AGSA 5HR0A 5CF1A 1WIKA 8CHOA 1N8JA 2XH9A 4TVEA 1Z5YE 11GSA 1M0UA 2GVPA 1S3RA 1UW1A 1F3BA 3FKAA 3DH2A 4TXVA 3CRTA 3NV0B 3SEDA 3EHCA 2F3MA 1JFUA 3IPTA 4FH8A 4HM1B 4TR0A 2H30A 4R1KA 1A2LA 4KVHA 1VQ63 1Y6EA 2PZVA 3UAPA 2IMKA 2AJQB 5COHA 3IPZA 4O5UA 5LD0A 1UN2A 3GMFA 5H5SA 2CX3A 1R4CA 3SLUA 4LZIA 3WD6A 2GSTA 3M8NA 1I5GA 3B8LA 2XF3A 1TP9A 5GZZB 2YFLB 5ECSA 5CO3A 1XFLA 5D9TA 1Z7RA 5M18A 2H1BA 1OE8A 4N10A 3ZMKA 3ZRDA 4OMVA 1Z1SA 4FMBA 1EA2A 3LYKA 5IMDA 3S9FA 6GSTA 4CHSA 3KIJA 5F0GA 1XWAA 3QAVA 3BLZA 3F8HA 3G0KA 3CCM3 3UB1A 3APOA 4IJ3A 5IMCA 3TB2A 5IF6A 5ECKB 5ECHB 1TOFA 2IUKA 3A2VA 3EN1B 5LC6A 1PRXA 3BD2A 3M9KA 3B7CA 5GSTA 1O7WB 3EYTA 3HY2A 3LORA 3TJGA 2VD0A 1OKDA 3TKRA 5D93A 5F07A 2GZYA 5F8BA 1JB5A 1J2BA 4F03A 4EC6A 1N9JA 5IO2A 3N9JA 3D5GA 2CFWA 4JZQA 5FGOA 1C7HA 1UGIA 3ZYWA 1W5ZA 1ROVA 3H93A 1O7NB 4PNGA 3QPMA 4GB5A 4YKGA 2F9SA 3LGCA 2HT9A 4BL2A 4XS6A 1CQGA 2X8GA 4ZB9A 2C0EA 3NIVA 4PQIA 3BBYA 1GMQA 3BCKA 2IFQB 3EE2A 1TK5B 5AYRB 4PTSA 3DEXA 1LOWA 2E7PA 5CP1A 1GUHA 4IS0A 1ULJB 3WA3A 5A4UA 3LEFA 1SKWB 1QGVA 2L1SA 1ILOA 3T8UA 2K0MA 3CC23 1EEMA 3IHQA 1RN1A 1LU4A 4AEQA 1W4VA 2ZA4A 4LL1B 4Z2TA 4GL6A 1SKSB 4MJDA 1R5PA 4HS1A 2WOHA 5G1LA 2KP1A 3BCIA 1US1A 2XSOB 4AF2A 1RGKA 2N5AA 3KSPA 5HR3A 2OADA 3QD9A 5DCHA 4ZBBA 1TRSA 5BXQA 1EZKA 3OWUA 1B2SA 4TRXA 3EU3A 1U3AA 2AV4A 2C3TA 4GWRA 1BNEA 3FYGA 1RN7A 3CCJ3 4G19A 2HRKA 2UGIA 5KP4A 1TRVA 2DSAA 5IPGA 7STDA 1I2FA 4E8EA 4KDXA 3URPA 4HJMA 2WS2A 3AMOA 2YANA 3GTUB 3TGZA 1O85A 4R9LA 3D4MA 1M9AA 3M8CA 1ZS7A 1ZGXA 5GSPA 5D9VA 1JZWA 4RI6A 4YQMA 3NZNA 4N0VA 1FB6A 4G0KA 2OE1A 3E99A 3WT1A 1I3IA 2BMOB 2OJLA 1XWBA 4NWYA 2IJYA 3W8SA 4DKIA 4WHAA 1WTHA 2CFLA 2H75A 1Q7HA 2PUKC 4O92A 2X99A 17GSA 5JCUA 2C4BA 5BIRA 4K2XA 3ER7A 1VQK3 3E0UA 4TW5A 4F9ZA 1A0RP 1FUTA 2Z9SA 4IP1A 1VQN3 1ZYEA 4BU4A 9GSSA 1BNGA 4PUFC 3VURA 1VQ43 3X41A 3Q19A 3V98A 1C72A 1JZDA 3HKRA 2W9PA 2IA7A 5A4WA 4R80A 1O7HB 5JWQB 1H4OA 3G7IA 2W56A 1JB2A 3O6TA 1JN5B 3NX0A 1BQ7A 2C3QA 2YFIB 2NPBA 2MBSA 2K3DA 5RNTA 1TP6A 5EEOA 4HQZA 4YQVA 4DVCA 4FO5A 3VFIA 1RN4A 2OTL3 1ZZYA 5IMFA 3O3TA 1FGRA 3CNMA 3I6AA 5IMVA 2ZL8A 4ZL8A 1BOXA 4JRRA 3KXOA 3P7XA 4F82A 1ACVA 4RBNA 2IMIA 3UOMA 1BNFA 4I8BA 2Q07A 3QAWA 5D9XA 1EOGA 3QFAC 1FA3A 1DE3A 4HSCX 3TOTA 2H70A 2CQ9A 2UUGC 1GS3A 2OE3A 4PXOA 3ECFA 1YKCA 1T3BA 2W04A 1T5YA 2CZ3A 4EYCA 2HFDA 2CIUA 1GUKA 1I9DA 4ML1A 3ZVJD 2FCHA 3HJMA 4FYBA 1RRHA 4L5OA 1ZYQB 4K6XA 1BRSA 1XOAA 1XW9A 3CNXA 3LH4A 1K0OA 2YJ7A 3FMWA 1OC8A 3EWLA 2YPMA 1GUMA 1FZUA 4O7HA 3KSED 1SU9A 2GU1A 4Z2RA 2LNSA 1NO3A 1ZGNA 1LOVA 2MMOA 4HOJA 1ULIB 2VCWA 4ORLA 1Z3EA 4H86A 4IPBA 2JU5A 1QFNA 5B7CA 1TRUA 1OC3A 1PGTA 4V2NA 3KMNA 3LXZA 2RGQA 4TKYA 2R0PA 4BWQA 2MMAA 2GSSA 1MGRA 2GZPA 2HE3A 2OTJ3 1O73A 4IIAA 3ZFLA 2YV7A 2HRNA 2C11A 5D83A 1VQP3 1AR0A 4KSOA 5DJLA 3I553 1W89A 1OC9B 2NBSA 3APQA 1EOHA 4J56E 4HM2B 5AIVA 2REMA 2CX1A 4WYKB 2L4QA 1XG8A 2LEGA 1Q98A 2WRTA 2RM6A 1V2AA 3D5JA 1BANA 3HVNA 2QGVA 1WP0A 4X4JA 2CV4A 1FOHA 4WP5A 2JSYA 3UL5A 2P31A 2XC2A 3GHAA 4MZCA 4ZM8A 3V1WA 1X5DA 3CU3A 1GOVA 4TR4A 1BRJA 4EIPA 3D4AA 5G5FA 3ZL5A 2AYTA 1K9M4 3Q3FA 1AQZA 1TRWA 2CC3A 5IG5A 2D2ZA 2SARA 1O7GB 3IHGA 1X1WA 1SJIA 4LMIA 3KGKA 2WGQA 1UC7A 4NPBA 2H76A 3EX9A 2WULA 3ZREA 2OQEC 2PWJA 5A4VA 5KP1A 3KTBA 1MEKA 2R4IA 1B8XA 5DDLA 3GWRA 1VRSD 3FR9A 1U8CB 2YWOA 4GTUA 1YHQ3 3ME7A 1NW2A 4JR4A 1STDA 2MZCA 2QIYA 1WNHA 4O2HA 1A8YA 3VLNA 2MMZA 5AISA 3KP9A 2P09A 5ENUA 1TU7A 1RNTA 1UCJA 1BU4A 3HVSA 4KFEA 3F4SA 3WGEA 4BVXB 3VGNA 1ZYPA 5ELGA 3F6DA 3GKNA 2O8VB 1L5GB 1GY6A 2LQQA 4CPKA 3HVXA 1BRIA 4H61A 3KH9A 3W8JA 1DSBA 4HM6B 4K1VA 3MWZA 1WJKA 2IN3A 2ZHXB 1BEDA 5HFIA 3NHXA 2KP2A 1LXEA 4L8OA 1BNRA 3BNEA 3IBHA 7RNTA 1GNWA 1HYUA 1B27A 4J2FA 4RQRA 3IAM2 3OR5A 1UCIA 2Z76A 4XM4A 5IEOA 2VLUA 4IKHA 1W6YA 2VD1A 5E59A 3L0RA 1JN5A 4WEYA 4EXRA 1M9BA 1GSYA 5CK6A 3TKSA 4NHZA 1R7HA 1LQMB 3NBBA 3KE7A 1GNEA 3TJJA 3WMDA 4HM0B 2X8CA 2JACA 1WPIA 3EC9A 1FVKA 3HA9A 3QOUA 4MZBA 4AKZA 4Q5NA 5GSSA 4F0CA 2H6ZA 1IYHA 1H75A 1SYRA 2GSQA 3KMOA 3VWWA 2Y74A 3F8XA 1XVWA 4EVMA 2VUPA 4O02B 4EKZA 2DKHA 2KCDA 3S29A 4OO5A 3DMCA 1XIYA 2LQOA 3CXC2 2GLRA 4POLA 2B7KA 2N5BA 1BIRA 3G6E3 1NJI4 1I3FA 2JADA 3NM2A 3ZMLA 3MPHA 4Q53A 1T2HA 1T8EB 1V74A 3KM6A 1JZOA 3GN3A 3L9VA 4KX4A 3CME3 1BSBA 1V9WA 2OA7A 1VQ53 1DVCA 1WRYA 3ZITA 1SENA 1XBSA 1EG9B 2V41A 5EVHA 1S3AA 2IMEA 1ZMAA 4K0NA 5AIHA 1VQM3 2O3OA 1RRLA 2H66A 2J9HA 3KCHA 2W9QA 1T4YA 4EO3A 5ID2B 2MF7A 3K7CA 1JHBA 3IC8A 1EGOA 1SIIA 2KLXA 4HVNA 2J23A 5I97A 3CXGA 3F8UA 4BVYB 3NUVA 4PX1A 2CX0A 1WMPA 3FF0A 2XRXB 3KJYA 3A5EA 4X2OA 3N54B 3FF2A 3ERGA 4IW9A 3VK9A 2K9FA 2VCVA 1ZO2A 2H73A 2XPEA 5D96A 1Z7PA 3LYPA 1EWXA 1B9YC 2NTOA 3SVAA 4Z2UA 4MZWA 5AEWB 1J08A 1GL8A 1GOYA 1A0FA 2B7JA 2Z77A 3AHSA 4MNNA 4AKYA 3F9UA 2F51A 5EL8A 5KP3A 2DC5A 4LGQA 1AQVA 2FNOA 1USBA 2A4VA 4FMCA
chains in the Genus database with same CATH topology
1OC9A 4MF6A 1IQ8A 3LXTA 2CHCA 2IFQA 1QVG2 3HDCA 1FGTA 2RSXA 3UEMA 3EN8A 5EQLA 3C71A 4V2LA 1AUCA 3M0FA 4N6TA 4PUAA 4L8PA 1ZOFA 1YKAA 2H1DA 3L0HA 1A67A 2XSHB 5J9BA 4OCEA 2YJHA 2F8FA 1O8XA 3KIIA 1VF3A 2R0CA 2FGTA 3HX8A 3GV1A 3TJKA 1G6YA 3FK8A 4L0WA 4KE3A 4WBRD 3VI7A 1PD21 3FGYA 3LOYA 4YQUA 2L4CA 3ZIVA 3T8NA 5IEPA 3MYDA 1IVVA 1UUWB 3VI5A 3PGBA 5FW5A 3G4S3 4Q5QA 3HVVA 2HYXA 2CZ2A 5D73A 2QC7A 4U13A 3PXMA 4BA7A 2GU3A 1SK1A 4LMVA 3N5OA 2V32A 3DGOA 3DRNA 3CC43 3STDA 3FR3A 4IVFA 3EF8A 1DBYA 1IVXA 5TGNA 4ML6A 3CBUA 3K9MC 3TKSE 3OXAA 3EMPA 13GSA 1OF5A 3F14A 2B5EA 5IG3A 4HQSA 2R6KA 3CMIA 3QK9A 5IPHA 1KD14 4XS4B 1K0CA 3N9HA 5E4WA 5A0OB 2H6YA 1IU7A 2W03A 3A2WA 6GSYA 3D22A 2VL9A 2XEPA 3GZBA 1QVF2 2OCTA 2X49A 1U88A 1UI8A 2DJJA 2LTKA 1GSEA 3D0ZA 5ECQB 2V6OA 2LJKA 3BNDA 1EV4A 1U5OA 4HM7B 5ABRA 3WODG 3QDNA 3FKFA 4FMAA 2O87A 3ZLPA 3NQYA 2YNXA 3PYJA 1HU9A 1TIJA 3GIXA 2OWPA 1Q7Y4 1QMVA 3LTCA 4IGJA 3OW22 2FY6A 4MF5A 4WF5A 1CYUA 2WOFA 2GS3A 2YV9A 1CQSA 3EBTA 1UUVB 2L5LA 6GSVA 2PGTA 1PSQA 3L9SA 2FA8A 2C0GA 3IDVA 2XFTA 1PX6A 1O8WA 2KUCA 5IMAA 4MJAA 4K7IA 2RCDA 4TX4A 2OOVA 2F8AA 2VOCA 1M904 5IQYA 3FCSB 1GD4A 2LKUA 3P90A 2GQMA 3LTAA 5IW9A 4WETA 1JV2B 3G16A 5CXOA 2D1WA 3JUOA 1MDIA 2ML6A 2F99A 4PURA 1GSQA 1G7EA 2HI7A 3NQZA 2WZ9A 3FG4A 4BPYA 1N9EA 2YWNA 2DIZA 3GFKA 3DXBA 2PNCA 2K8SA 5JCGA 4EF0A 1A2JA 4QL9A 2OE0A 3DWVA 1VQO3 2XGNA 4XDVA 4MH3A 5D8IA 1S3DA 1IV9A 1E97A 2CKFB 2GGTA 4KF9A 4RNYA 1JLWA 3VWXA 2H19A 3DGMA 2GT5A 3I563 3WGXA 2FWFA 1E6BA 2IWTA 2H71A 2C4JA 1IVWA 2DJ3A 1SQWA 4MP4A 1TUHA 3TRXA 5L71A 2C0FA 4J9AA 2HSMA 2AHEA 2R3XA 3SOYA 2HZEB 2WGRA 1K3OA 1A90A 2H72A 3CTGA 2P0MA 3FHKA 1OPYA 4WF4A 1A2MA 3GL3A 4KFDA 3RGAA 4KNDA 1OCVA 4ZBAA 2CW9A 3S27A 1VGLA 4O5RA 2JL4A 1WWJA 1R26A 2O89A 1X5CA 4K7NA 1KBNA 1OUNA 1K0DA 1PN0A 1XWGA 4GSNA 4STDA 3X3XA 1GWCA 3UJMA 2LRTA 3CSHA 3RPNA 1XXUA 3QCPA 1ML6A 1OHOA 1HNCA 2H1GA 1DMQA 3LZAA 3H51A 1Q40A 1A2VA 3QRDA 5BVBA 3IXRA 4GQFA 4NAXA 5CRDA 1FGOA 1J9BA 3RPPA 5ELUA 1JRQA 3HIIA 3FG1A 2E2MA 3KCMA 3JCML 4AJ7A 1SD9A 5GAND 3I0YA 2CVKA 4MJBA 3GZYB 1DYUA 2MBTA 3C7MA 3LTDA 4JU5A 3A5WA 1NB3I 3D9RA 4MMMA 5HFKA 3K63A 1THXA 1YIJ3 3IRAA 4YKFA 5DQSA 4NREA 3RHCA 1ON4A 2VM1A 2R4VA 3GYKA 1V58A 1GTBA 2CWTA 1SL0B 1ZCPA 4G0IA 2PU9C 1FGMA 3SBCA 1RJOA 1GP1A 3D6IA 5BMUA 3ZFBA 4MPFA 4ECCA 2YOIA 4I5QA 1F6MC 2HZEA 2OACA 3U5RE 8GSSA 3TRPA 3UVHA 3JUMA 3HIGA 2JDIH 1VF2A 1X9MB 1AIUA 1LJRA 3DY5A 4K5SA 1T4ZA 2VIMA 2O9UX 3MSOA 2HSYA 2ALBA 1AQXA 2WGOA 4WWUC 3LTBA 3TOUA 2GDRA 2I1UA 2XFSA 4IQAA 3FEUA 1URMA 2CWVA 5JBSA 3RBTA 4XTSA 4MMZB 1TFKA 2B1LA 2XHFA 1R4WA 3ZZXA 5H5RA 1W02A 5DRVA 2I9WA 3LWAA 1SJZA 3SXXA 2IMFA 4IT7A 1QMAA 4MLYA 5KOWA 1JKGB 4N6UA 2H74A 4GSSA 3E9JB 3DXOA 3I43A 3LYGA 1F37A 4HJ2A 4HM8B 5J5NA 1M2BA 1SIHA 2B24B 1PN9A 5DJMA 1LNHA 1NM3A 4IBPA 5ECOB 4LA1A 3CCS3 4EDYA 3NOFA 3KD0A 4L7KA 3HI7A 3QR6A 2WO0A 1QK8A 4EE0A 3GKMA 1JB4A 1ERWA 1TJDA 4ZBDA 1K0BA 4IJIA 3K0ZA 10GSA 4BTYA 4MA9A 1G0TA 1MTCA 1AW9A 1DMNA 1THOA 5IG4A 2CVBA 2PMTA 1GSSA 1T1VA 2P05A 5FHIA 4R4KA 5AIFA 1SK2A 1PKZA 4IP6A 3C8EA 2L59A 1ISKA 1FVJA 4K7OA 2BMQB 2C10A 1YI23 3CPOA 4FR9A 5F05A 4G9HA 3UIWA 3TKQA 1S5AA 1Q864 5IG0A 1GYBA 1MNLA 4POBA 2IIYA 3C1SA 4WR4A 1IK3A 4I6XA 1YJ93 4N3VA 2E2GA 1AXDA 5EPFA 3ROBA 2G2QA 1FG4A 4EV2A 2EIOA 3EMXA 1V40A 1TFOA 4NV2A 3U1WA 3WA2X 4JR6A 2BO9B 22GSA 2YN1A 4TXOB 3RDEA 1YZXA 4XBTA 2OKAA 2X8HA 1EP8A 2BTOT 1NDOB 5CLKA 2H01A 3F4RA 1OHPA 7GSSA 1WMOA 2WDUA 1FO5A 1E2YA 2C8UA 2HMJB 3US3A 2RUEA 6GSWA 3NXJA 3G713 3IR4A 3KH7A 4CCVA 5JWRB 1W4NA 1FUWA 1VF1A 4CDOA 3GKXA 4N6MA 4JE1A 4I97A 2L6CA 3LSZA 1SJWA 1KWIA 3D3LA 4GXZA 4POKA 3HJPA 2VCZA 3C73A 4HI7A 1WE0A 2H6XA 4G10A 2V1LA 2M46A 1K8A4 4V1Ag 3O8YA 2JZRA 1SJ6A 1QQ2A 2H1AA 3WOFB 1QAFA 1JLVA 2A4HA 3GZXB 1T7PB 3EB8A 4L5LA 1B9XC 4LSOA 2RFRA 3FR6A 5ECNB 5CAXA 2RIIA 3JVCA 2GZZA 3R2QA 3F63A 4J8TA 3S28A 1SYXA 5JPPA 2PVOC 1EKMA 3CSIA 1FGQA 5CRGA 5B8BA 2GXFA 5G31A 4MK3A 1GLPA 3PINA 4ECBA 2FA4A 3GA4A 1OE7A 1UVZA 3CCV3 1XOBA 2K18A 1HNAA 1X0RA 2H0GA 3VWUA 2M80A 1K3YA 2QA1A 2PVQA 4HM4B 5IMZA 4K2DA 1OACA 12GSA 1Z6NA 3X3ZA 1XZOA 1NHYA 1M2AA 4K0GA 4CDLA 3GURA 4K1FA 2YFJB 2QEX3 1KC84 1U3IA 3GKKA 4AJ6A 1SL2B 4OK0A 1N8QA 2DJ0A 5KN0A 5CRHA 4HM5B 1SD8A 1ASKA 2R2JA 1KEBA 3HZ4A 3Q74A 2FXTA 2W6JH 4GCIA 1VZZA 1XPVA 2VL2A 1K41A 1KSIA 4BWSA 4DSSB 4HU9A 1K3LA 1YJN3 2GSRA 2GQKA 2FWHA 1N2AA 2VCQA 1A8LA 2DMMA 1PFPA 3T0UA 4XRAA 3GZRA 3U97A 3FH1A 1PX7A 4XIHA 3J7Yb 1M9GA 4USSA 2I3YA 4QWTA 1FB0A 1W2ZA 4TR1A 2HMKB 4FCMA 2HRFA 4E8HA 1OHSA 2H8LA 3EE1A 4KZ1A 3RGRA 1YJW3 4IQ1A 3VPTA 2L57A 4ZL9A 3F7SA 5AEUB 3Q90A 2RLIA 1GY5A 3X42A 1GSFA 3CPW2 3MNGA 4PEJA 2XR8B 1PL1A 1TXXA 1LOXA 1ZL9A 4X2HA 4HUAA 3Q1CA 4XS4A 4K61A 5CREA 2HMOB 1TDIA 3M3MA 1K734 3I69A 3MAKA 3WDGB 2EIRA 2JSZA 4ZL7A 1M1XB 1OGXA 1ST9A 1YEPA 4R9KA 2ON5A 2B5XA 2VM2A 5HR2A 3P2AA 5DAKA 3SX1A 1VQ93 2CX4A 4G0LA 4WKWA 2C80A 4Q5FA 4EBGA 1YQ1A 1M7TA 6GSXA 2QA43 1HKXA 4KCAA 2FD3A 5INYA 2KOKA 2CFKA 1WMNA 1TU5A 2MMNA 4ECJA 1AV4A 1W7CA 4XS1A 4FIWA 2A15A 3TDGA 1BJXA 3PH9A 4BVYA 1QXHA 3KEBA 3DGNA 2FUG2 2XPDA 2Z6BA 3WT2A 2VAFA 2YX9A 1Q4JA 4O5QA 5IOXA 2M72A 2YP6A 4H3UA 2ZUPA 3MHEA 3QFBC 4MABA 2TRXA 1NHOA 3A2XA 4ZIJA 2R37A 3KP8A 4ZB8A 4MCUA 3TCOA 2C0DA 3LT9A 2ES7A 4LLRA 3FZAA 1O7MB 2R0GA 3GUSA 1Y25A 1KNGA 3IMAB 1IQYA 1W6CA 4BL7B 3VWVA 1OGZA 1N5HA 3C1RA 14GSA 3EBYA 3N8BA 2HXKA 4I2UA 3NBJA 1PL2A 4OFTA 1XWKA 3Q2PA 4OCFA 3KTLA 4JF8A 2KXGA 4BVXA 4GF0A 1IT7A 4DEJA 2BMXA 5JCWA 1YEXA 4N6LA 5HGRA 1Y4KA 3UMAA 2EC4A 4TN8A 4KDYA 3TKPA 3PZWA 3VF1A 1TU8A 4CW9A 3HK4A 2E2UA 1VF4A 2V2GA 4KA0A 1GD3A 5EY6A 1DE1A 4XCSA 2I9HA 2JQ5A 2VCXA 3M1GA 5HFGA 3EINA 2AAWA 2I81A 2H0HA 4O3VA 4MMYB 4ISDA 4HKVB 2BT3A 3TJBA 4D73A 4YAVA 2INXA 4HDEA 2KRTA 2A2RA 3DM8A 1W6GA 2WB9A 4LEHA 1EV9A 1O6JA 3E3EA 4RI7A 1YF1A 2B3SA 4X0XA 1UI7A 4N6NB 4ILFA 4I2TA 2PPTA 2LJRA 4XHMA 2IMDA 1HQOA 4K5RA 2DIYA 3QAGA 1OYJA 3GX0A 4POMA 4MPGA 5HR1A 1V98A 2XGLA 4OWYA 3B4OA 1KTEA 2P5QA 3MIXA 2RM5A 4CY8A 5D9WA 1V57A 1RKYA 2YWMA 3LFLA 2VLVA 1M1K4 4ECIA 2Y73A 3WGDA 1MDKA 3GRXA 3LMLA 3PCRA 3IK9A 1O7PB 5B6MA 2GTUA 2IMJA 4ZILA 1EGRA 3CC73 5LNKe 4MMXB 2HZFA 4OD7A 1LVNA 1GSDA 1JKGA 3LW9A 1OH0A 4LMWA 4HBRA 1B4QA 1QJGA 5DALB 3QMXA 4GRFA 4NV5A 3RDWA 2E2TA 1AC1A 2DMLA 2OOVC 3LG6A 2QSIA 5STDA 3EURA 3VPQA 2UZ8A 4BTXA 2JZTA 3ED3A 5LCZA 3A3TA 1BUQA 16GSA 1W2B2 3BNCA 4FCZA 1VQ73 3ISOA 2FLSA 2K6VA 3GRDA 2BMRB 3EC3A 1GTUA 3IA1A 3CCR3 3D4TA 2P0XA 4FQUA 3V99A 4KCEA 1ERTA 3J7Yd 5HQPA 5JWOB 5CNWA 4Q5RA 4WXTA 2CAQA 2EIQA 2YCDA 1QUWA 4EUYA 4AJ8A 5IERA 3NM7A 3ERWA 2DJ1A 2CT6A 4K9ZA 4HZ4A 1ROAA 2B6MA 4RZMA 2TIRA 4ULXA 1O7UA 3GAXA 3GNJA 3IAS2 2O7KA 3KFQC 1TKDB 2R5GA 1K0AA 2LRNA 5J9CA 4O32A 5DALA 3IK7A 4MEIA 2B1XB 4G1MB 3ZTLA 1UA5A 4NHWA 1FW1A 3PCSA 5IM9A 3JUNA 3APSA 1R5AA 3KZQA 2RUFA 4ZB6A 2CK3H 6STDA 1U6TA 2GEXA 1PQNA 3A5IA 3CCL3 3ZIJA 2LS5A 5AYSC 5ECPB 4HM3B 1AVLA 1GH2A 4KUNA 5J4UA 2AB6A 2QA2A 3U6VA 1GTAA 5ECMB 4WYKA 1FAAA 2DJKA 2ZCTA 3MYTA 1N5PA 4HZ2A 4WR5A 4BL7A 3DMLA 3S67A 4CY6A 2LNTA 4QQ7A 5B8AA 1MOLA 4WBJA 2OQEA 3UNLA 2VCTA 2BHMA 4JRFA 2PBJA 3FLJA 4OUQA 1XVQA 2HRAA 3UARA 2K8VA 4QL7A 1TI3A 3MWHA 4N30A 3DKSA 4FYUA 1N8R4 5DQYA 2B1KA 2FNQA 1YIT3 3DIEA 1BAYA 3MKIA 3H3HA 5CF2A 5G1KA 3L4NA 2HSHA 4PNFA 2F86B 1A2KA 3FRCA 4KDUA 2E2VA 5F06A 3F9SA 2DBCA 4JBBA 3UL6A 1AAZA 3TRQA 4L8EA 2LUSA 2F98A 4KGIA 1BYEA 1WOUA 3G7JA 4XB5A 3HZ8A 2A2SA 4TOPA 1OVNA 5A5KA 3EVIA 3OWYA 1CQHA 3F3RA 2HLSA 3BOAA 2QKEA 5AGYA 1DVDA 4ACSA 1X9WB 1GRXA 2ZNMA 3H8QA 2FWEA 3UBLA 2YZHA 4IHUA 4V2MA 1Q814 18GSA 3GSSA 4KSMA 4PGTA 3FZ5A 5G2GA 2DKIA 3F40A 4RQXA 1K0MA 2O85A 2CH9A 1D6UA 2P38A 1DE2A 2C3NA 1FOVA 1MD4A 4XBXA 4OFMA 1VQ83 1Z6MA 3F6FA 5ELJA 1K0NA 5IENA 1SL1B 2CFDA 1K28A 3G8ZA 2D42A 4EC0A 3GH9A 2L6DA 3A76A 4ZXGA 3DYRA 3OWSA 4JEDA 4YH2A 3EU4A 4Z7XA 1YJ6A 3UVTA 3H79A 4XDWA 4BTWA 2IUJA 2GEYA 4I4KA 1O81A 4MJCA 3GX8A 1GY7A 5C04A 3H4KA 1BX9A 4KH7A 4IELA 3K8NA 1JNQA 1IVUA 2TRCP 6GSSA 4HZBB 2HNLA 4EDZA 2XBIA 1F8NA 5AN1A 3R3EA 4MDCA 3UL3A 4PQHA 5EVOA 3DUKA 2WJUA 3EQQB 3F0IA 3F3QA 5AI1A 1X5EA 1A24A 2HMNB 1SK0A 2B5YA 3P8WA 2VLTA 3CYNA 5DAKB 5B6NA 1ERUA 1RK4A 2Z7AA 1OF5B 1TK0B 3GH6A 5JPUA 1S723 3VSYA 3PGTA 2LSTA 1D6YA 4FMDA 3LXUX 2UX0A 1GULA 3FW2A 6GSUA 3GSTA 3X40A 3RHBA 3PPUA 2PN8A 1OKTA 1YF0A 3FSDA 3LT8A 1OAZA 3GL5A 3F7XA 3NBRA 3AMOB 3GTUA 2CAIA 2V1MA 2SBLA 3ME8A 1G96A 4NHFA 3HHVA 5IO0A 3MG1A 3BJ5A 5KN1A 1EP7A 4N6V0 1XWCA 1Z9HA 4OO4A 3DZLA 5ID2A 3HCZA 3CD63 4KFFA 2BNGA 2NVLA 4P3YB 5G2ZA 1ZX2A 3HJOA 1M2DA 3V92A 3LQ7A 4J57E 1SPUA 2CA8A 2WCIA 1G7OA 5C00A 4TR3A 1PU4A 3OX9A 4DSSA 3TKSC 1MD3A 3JUQA 3HXSA 4MJEA 3CMA3 5FWGA 4EIQA 3EPTA 3D21A 1GLQA 3CCU3 2QGUA 1ZYNA 2IL3A 3TJFA 4L0UA 1F9MA 2N5FA 4X1UA 4EL1A 5LC7A 3G9BA 2CVDA 5BRTA 3SOAA 1NB5I 2AUVA 1A23A 1GTIA 1Q824 3MG2A 4GQCA 3UBKA 1TK8B 5AIXA 2V6KA 1ERVA 1PA3A 4MH2A 3MSZA 3K5TA 5DREA 4K8MA 3MG3A 3G7YA 2LYXA 3WYWA 3J7Yk 2W2CA 1IQXA 3L9UA 1NSWA 3I9V2 3FZWA 2HMLB 2VL3A 4RNZA 3WOEB 2XBQA 20GSA 5DVBA 2FHEA 3X3YA 1TW9A 5G5EA 1JZRA 5J3RA 3Q18A 5D82A 3RAZA 2HMMB 2PERA 1WMJA 5ECRB 3SWLA 2CWUA 3BNBA 5AIIA 2LV3A 3OV4A 2X64A 3HD5A 5IIZA 1DUGA 2CG1A 1B4PA 1E3VA 1YGEA 1E3RA 3HYPA 2DLXA 2FGXA 4X43A 2DJ2A 5ELAA 4HJLB 4HYZA 3ALAA 2GT6A 4HU7A 4NXIA 5KEJA 1IDPA 1CYVA 1STFI 4NMUA 3BB9A 3CCE3 3S5CA 4N11A 1YVBI 1U87A 2I4AA 1FHEA 5H5QA 1KQS2 5KN3A 3W6GA 1ABAA 4ICYA 2K54A 4K1UA 4V1Ap 1CEWI 3KN4A 3LJRA 3JUPA 1W01A 4KAEA 2MC8A 1W00A 1NWWA 3DVWA 2WFCA 5G30A 4D73B 1PMTA 4TXOA 3KKGA 2ML5A 2YWIA 4OVMA 1VQL3 3CSJA 2E0QA 3CTFA 3DGQA 2ON7A 2LQVA 3TUEA 1F3AA 2W56B 2BJXA 1AVKA 1D6ZA 2GBWB 4N6OB 2CG0A 5AIGA 1Q40B 3FY7A 1QAKA 2KHPA 1IT8A 3CRUA 3FZ4A 4F0BA 2GQLA 1AQWA 3DVXA 4GSTA 3IE3A 3PS8A 4N0ZA 5FT3A 4FCJA 1XCCA 4F2IA 2OBIA 3PR8A 2CFGA 4DSRA 5GAPD 1F2EA 4XBYA 2P5RA 3DD3A 1Q42A 3DGLA 4PQ1A 2L4VA 1QALA 3L78A 3O76A 2STDA 1TI1A 1EQKA 4EV5A 2M7OA 2G0FA 2L5OA 5KN2A 1RW1A 2GBXB 2P0GA 3EJVA 4K90B 1JJ22 3B4PA 4KB3A 2JZSA 5IOWA 1G6WA 3IJEB 4LL4B 2H0IA 3FZ9A 3IC4A 2IPAA 2X4AA 4XRDA 3CCQ3 3F4TA 19GSA 1PKWA 1SKRB 1XW6A 5KOXA 4A5PA 4WFOA 1TTZA 5DCGA 5J41A 4OFNA 1B48A 4EXJA 4GLTA 1EEJA 2VO4A 4ID0A 2W0QA 2LJAA 1HD2A 4TR1B 1X9SB 3Q6OA 5CRWA 5CYYA 3AY8A 3NV0A 3MDKA 1RQMA 5ECIB 1S3CA 5DBQA 2MYGA 1MDJA 3IV4A 1XW5A 4YAPA 4DSQA 1YY7A 4MF7A 2A2PA 5D81A 1NU3A 1GSUA 4RUVA 1BG5A 1LBKA 1HNBA 2FWGA 3FG3A 3H1NA 4FYCA 3M9JA 4KW6A 4IN0A 1IV7A 2YZUA 3ERFA 2LRCA 5ECLB 3IOSA 2C1YA 1J0FA 4G2EA 1WQLB 3ZVJA 2OBKA 1YDKA 1DMMA 1M99A 4HEA2 3KZTA 2ZDJA 3UJ1A 4O8SA 4HZ9B 3HZPA 2NDOA 1T00A 1IYIA 2VL2C 4AGSA 5HR0A 5CF1A 1WIKA 8CHOA 1N8JA 2XH9A 4TVEA 1Z5YE 11GSA 1M0UA 2GVPA 1UW1A 1F3BA 3FKAA 4TXVA 3CRTA 3NV0B 3SEDA 3EHCA 2F3MA 1JFUA 3IPTA 4FH8A 4HM1B 4TR0A 2H30A 4R1KA 1A2LA 4KVHA 1VQ63 1Y6EA 2PZVA 3UAPA 2IMKA 2AJQB 5COHA 3IPZA 4O5UA 5LD0A 1UN2A 3GMFA 5H5SA 2CX3A 1R4CA 3SLUA 4LZIA 3WD6A 2GSTA 3M8NA 1I5GA 3B8LA 2XF3A 1TP9A 5GZZB 2YFLB 5ECSA 5CO3A 1XFLA 5D9TA 1Z7RA 2H1BA 1OE8A 4N10A 3ZMKA 3ZRDA 4OMVA 1Z1SA 4FMBA 1EA2A 3LYKA 5IMDA 3S9FA 6GSTA 4CHSA 3KIJA 5F0GA 1XWAA 3QAVA 3BLZA 3F8HA 3G0KA 3CCM3 3UB1A 3APOA 4IJ3A 5IMCA 3TB2A 5IF6A 5ECKB 5ECHB 1TOFA 2IUKA 3A2VA 3EN1B 5LC6A 1PRXA 3BD2A 3M9KA 3B7CA 5GSTA 1O7WB 3EYTA 3HY2A 3LORA 3TJGA 2VD0A 1OKDA 3TKRA 5D93A 5F07A 2GZYA 5F8BA 1JB5A 1J2BA 4F03A 4EC6A 1N9JA 5IO2A 3N9JA 2CFWA 4JZQA 5FGOA 1C7HA 3ZYWA 1W5ZA 1ROVA 3H93A 1O7NB 4PNGA 3QPMA 4GB5A 4YKGA 2F9SA 3LGCA 2HT9A 4XS6A 1CQGA 2X8GA 4ZB9A 2C0EA 3NIVA 4PQIA 3BBYA 3BCKA 2IFQB 3EE2A 1TK5B 5AYRB 4PTSA 3DEXA 2E7PA 5CP1A 1GUHA 4IS0A 1ULJB 3WA3A 5A4UA 3LEFA 1SKWB 1QGVA 1ILOA 3T8UA 2K0MA 3CC23 1EEMA 3IHQA 1LU4A 4AEQA 1W4VA 4LL1B 4Z2TA 4GL6A 1SKSB 4MJDA 1R5PA 4HS1A 2WOHA 2KP1A 5G1LA 3BCIA 1US1A 2XSOB 4AF2A 2N5AA 3KSPA 5HR3A 2OADA 3QD9A 5DCHA 4ZBBA 1TRSA 5BXQA 1EZKA 3OWUA 4TRXA 3EU3A 1U3AA 2AV4A 2C3TA 4GWRA 3FYGA 1RN7A 3CCJ3 4G19A 2HRKA 5KP4A 1TRVA 2DSAA 5IPGA 7STDA 4E8EA 4KDXA 4HJMA 2WS2A 3AMOA 2YANA 3GTUB 3TGZA 1O85A 4R9LA 3D4MA 1M9AA 3M8CA 5D9VA 1JZWA 4RI6A 4YQMA 3NZNA 4N0VA 1FB6A 4G0KA 2OE1A 3E99A 3WT1A 2BMOB 2OJLA 1XWBA 4NWYA 2IJYA 3W8SA 4WHAA 1WTHA 2CFLA 2H75A 2PUKC 4O92A 2X99A 17GSA 5JCUA 4F9ZA 4K2XA 4TW5A 3ER7A 1VQK3 3E0UA 1A0RP 2Z9SA 4IP1A 1VQN3 1ZYEA 9GSSA 4PUFC 3VURA 1VQ43 3X41A 3Q19A 3V98A 1C72A 1JZDA 3HKRA 2W9PA 2IA7A 5A4WA 4R80A 1O7HB 5JWQB 1H4OA 3G7IA 2W56A 1JB2A 3O6TA 1JN5B 3NX0A 1BQ7A 2C3QA 2YFIB 2NPBA 2MBSA 1TP6A 5EEOA 4HQZA 4YQVA 4DVCA 4FO5A 3VFIA 2OTL3 1ZZYA 5IMFA 3O3TA 1FGRA 3CNMA 3I6AA 5IMVA 2ZL8A 4ZL8A 4JRRA 3KXOA 3P7XA 4F82A 1ACVA 4RBNA 2IMIA 3UOMA 4I8BA 2Q07A 3QAWA 5D9XA 1EOGA 3QFAC 1FA3A 3TOTA 2H70A 2CQ9A 4PXOA 1GS3A 2OE3A 3ECFA 1YKCA 1T3BA 2W04A 1T5YA 2CZ3A 4EYCA 2HFDA 2CIUA 1GUKA 1I9DA 4ML1A 3ZVJD 2FCHA 3HJMA 4FYBA 1RRHA 4L5OA 1ZYQB 4K6XA 1XOAA 1XW9A 3CNXA 3LH4A 1K0OA 2YJ7A 3FMWA 1OC8A 3EWLA 2YPMA 1GUMA 4O7HA 3KSED 1SU9A 2GU1A 4Z2RA 2LNSA 1NO3A 1ZGNA 2MMOA 4HOJA 1ULIB 2VCWA 4ORLA 1Z3EA 4H86A 4IPBA 2JU5A 1QFNA 5B7CA 1TRUA 1OC3A 1PGTA 4V2NA 3KMNA 3LXZA 2RGQA 4TKYA 2R0PA 4BWQA 2MMAA 2GSSA 2GZPA 2HE3A 2OTJ3 1O73A 4IIAA 3ZFLA 2YV7A 2HRNA 2C11A 5D83A 1VQP3 1AR0A 4KSOA 5DJLA 3I553 1W89A 1OC9B 2NBSA 3APQA 1EOHA 4J56E 4HM2B 5AIVA 2REMA 4WYKB 2L4QA 2LEGA 1Q98A 2WRTA 2RM6A 1V2AA 3D5JA 4F0CA 2QGVA 1WP0A 4X4JA 2CV4A 1FOHA 4WP5A 2JSYA 3UL5A 2P31A 2XC2A 3GHAA 4MZCA 4ZM8A 3V1WA 1X5DA 3CU3A 4TR4A 4EIPA 5G5FA 3ZL5A 2AYTA 1K9M4 1TRWA 2CC3A 5IG5A 2D2ZA 1O7GB 3IHGA 1SJIA 4LMIA 3KGKA 2WGQA 1UC7A 4NPBA 2H76A 3EX9A 2WULA 3ZREA 2OQEC 2PWJA 5A4VA 5KP1A 3KTBA 1MEKA 2R4IA 1B8XA 5DDLA 3GWRA 1VRSD 3FR9A 1U8CB 2YWOA 4GTUA 1YHQ3 3ME7A 1NW2A 4JR4A 1STDA 2MZCA 2QIYA 1WNHA 4O2HA 1A8YA 3VLNA 2MMZA 5AISA 3KP9A 2P09A 5ENUA 1TU7A 3HVSA 4KFEA 3F4SA 3WGEA 4BVXB 3VGNA 1ZYPA 5ELGA 3F6DA 3GKNA 2O8VB 1L5GB 1GY6A 2LQQA 3HVXA 4H61A 3KH9A 3W8JA 1DSBA 4HM6B 4K1VA 3MWZA 1WJKA 2IN3A 1BEDA 5HFIA 3NHXA 2KP2A 1LXEA 4L8OA 3BNEA 3IBHA 1GNWA 1HYUA 4J2FA 4RQRA 3IAM2 3OR5A 2Z76A 4XM4A 5IEOA 2VLUA 4IKHA 1W6YA 2VD1A 5E59A 3L0RA 1JN5A 4WEYA 4EXRA 1M9BA 1GSYA 5CK6A 3TKSA 4NHZA 1R7HA 3NBBA 3KE7A 1GNEA 3TJJA 3WMDA 4HM0B 2X8CA 2JACA 1WPIA 3EC9A 1FVKA 3HA9A 3QOUA 4MZBA 4AKZA 4Q5NA 5GSSA 2H6ZA 1IYHA 1H75A 1SYRA 2GSQA 3KMOA 3VWWA 2Y74A 3F8XA 1XVWA 4EVMA 2VUPA 4O02B 4EKZA 2DKHA 2KCDA 3S29A 4OO5A 3DMCA 1XIYA 2LQOA