1RDSA

Crystal structure of ribonuclease ms (as ribonuclease t1 homologue) complexed with a guanylyl-3',5'-cytidine analogue
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
ESCEYTCGSTCYWSSDVSAAKAKGYSLYESGDTIDDYPHEYHDYEGFDFPVSGTYYEYPIMSDYDVYTGGSPGADRVIFNGDDELAGVITHTGASGDDFVACSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ribonuclease Ms (as a ribonuclease T1 homologue) complexed with a guanylyl-3',5'-cytidine analogue.
pubmed doi rcsb
source organism Aspergillus phoenicis
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE MS
total genus 29
structure length 105
sequence length 105
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rdsA00
1I8VA 1IYYA 1RNBA 5HOHA 1I0VA 1TRQA 1BRHA 3Q3FA 1BNSA 3AGOA 1X1WA 3RNTA 1BAOA 2HOHA 1PY3A 1RGEA 1BRKA 1GMPA 1BNFA 1HZ1A 1FYSA 1I70A 1RGGA 3D5IA 1B2SA 3AHSA 1I3IA 7GSPA 1B2UA 2F4YA 1LNIA 3WR2A 5RNTA 1LOWA 1A2PA 3DH2A 1FUTA 1UCKA 1GOUA 5GSPA 3WHOA 1I2EA 2F5MA 1AY7A 1BGSA 1SARA 1RN1A 1CH0A 1MGWA 1BRIA 1B2ZA 2AADA 1RN4A 1B21A 1T2HA 8RNTA 3HOHA 2RNTA 1BNIA 1X1YA 1MGRA 2KF3A 1B2MA 1X1XA 1JBSA 3GSPA 1TTOA 1B3SA 1GOVA 4GSPA 6RNTA 1RHLA 1LRAA 2KF5A 1RGCA 1AQZA 1G02A 1BRGA 5BU4A 1X1UA 1I2GA 4J5GA 2F56A 1UCIA 1RNTA 2ZA4A 1GMRA 4J5KA 1BNGA 1BU4A 1UCLA 1BRSA 1I2FA 1FZUA 4RNTA 7RNTA 1RLSA 3AGNA 1LOYA 3DGYA 9RNTA 1C54A 2BIRA 1BSDA 1DETA 4HAAA 1LOVA 1T2IA 2KF6A 1BRJA 1YVSA 2C4BA 1BOXA 1GSPA 6GSPA 1RGLA 1JBTA 1RGFA 1BVIA 1B20A 1BNRA 1PYLA 2SARA 1HYFA 1FW7A 1BNJA 1DE3A 1GMQA 3SYUA 5BIRA 1RGAA 2F5WA 1TRPA 2BU4A 2KAAA 1GOYA 1I0XA 3BIRA 1RGKA 4HOHA 1UCJA 1ZGXA 4GHOA 3D5GA 1BSBA 1I3FA 3KCHA 3URPA 3BU4A 1YNVX 1BSAA 1RCLA 1B2XA 3D4AA 1Q9EA 2KF4A 1RSNA 1BANA 4BU4A 1RCKA 1RDSA 1BSEA 4BIRA 3AHWA 1B27A 1BIRA 1BRNL 1RTUA 2RBIA 1YGWA 1R4YA 1RMSA 2GSPA 1RGHA 3A5EA 1BSCA 1JBRA 2AAEA 1BUJA 1FUSA 1BNEA
chains in the Genus database with same CATH superfamily
2IMJA 3IJEB 3WDGB 3OXAA 5HOHA 3Q3FA 2KRTA 2Q07A 1BNSA 3T8NA 1TJDA 2CFWA 1PY3A 3VF1A 1RGEA 2INXA 1OGXA 1Z1SA 4I5QA 1US1A 4R4KA 4TX4A 1N8R4 3U97A 3KSPA 5D83A 1I3IA 3F7SA 1A90A 3DUKA 1Q40B 5LC7A 3PZWA 1ROVA 4HKVB 1VQK3 1GD4A 4WYKA 2RSXA 5RNTA 3BNCA 2HMLB 1FUTA 1UCKA 3AMOB 1GOUA 5GSPA 4ZM8A 1E3VA 1W01A 3FKAA 2F5MA 1UUWB 4LYLB 1SARA 1FGOA 5BVBA 1BRIA 1U8CB 3F40A 1NB5I 5FGOA 3K0ZA 3BNEA 1B21A 2OTJ3 3Q1CA 1D6YA 2UGIA 2C11A 3FCSB 4JRFA 3H3HA 4H3UA 1BNIA 3EB8A 2WGQA 1N5HA 4BTWA 2C10A 1B2MA 1SQWA 5IERA 2QIYA 4XB5A 5KP1A 3MG1A 4BTXA 5G1KA 1M1K4 2P0XA 4GB5A 3OWYA 4HM2B 2QEX3 2I9WA 1O7NB 1G02A 3I553 3CCR3 1X1UA 3OWUA 4J5GA 4KT3B 4LMIA 1IV9A 1JNQA 2E2UA 2F56A 3NUVA 4R9KA 2CG1A 1Q864 1QALA 1RNTA 1GY7A 1GYBA 3LH4A 4I4KA 4J5KA 1W5ZA 1BNGA 4OK0A 1LQGC 1FZUA 2XH9A 1C7HA 5AIHA 3ZG0A 3ZFZA 2RFRA 1LOYA 4EC6A 1TP6A 1W2ZA 1IQ8A 2MF7A 2RCDA 2STDA 3IPTA 1C54A 4L8PA 3FSDA 3F9SA 1CEWI 1IDPA 4HM4B 3EBTA 2C4BA 1E3RA 3G0KA 3GRDA 3H51A 2XFSA 3V92A 4HJLB 4LSOA 1JZOA 3CNXA 6GSPA 1JBTA 2L4VA 2W03A 2OTL3 2Z7AA 1BVIA 4H61A 1B20A 3NX0A 1MOLA 1Q42A 2SARA 4HZBB 1FW7A 1BNJA 1IT7A 3S27A 1G96A 1GMQA 3JVCA 1SJWA 3U1WA 4CCVA 3E99A 4IPBA 2KAAA 2Z77A 1TIJA 2IY2A 3CCQ3 1TUHA 2K54A 1KSIA 4K1VA 2XSOB 1YI23 3TDGA 3DMCA 4WWUC 1EKMA 5EEOA 1OPYA 1YNVX 1OHOA 1RRLA 3HZPA 1VQL3 2CC3A 1B2XA 3LMLA 1O7MB 2KF4A 1RSNA 3O8YA 3FF0A 1OF5A 1K8A4 1GY6A 3NM2A 5IF6A 4MEIA 1RJOA 3SOAA 3AHWA 1YJW3 3G6E3 4FR9A 1A67A 5TGNA 1BIRA 1AV4A 4XBYA 1BRNL 3CD63 2CHCA 3NQYA 4XDWA 2RBIA 3UJMA 3V98A 2W9QA 1YVBI 2LQVA 3KKGA 3F8HA 2P05A 4DKIA 1CQSA 3B4PA 3CCE3 1VQ53 4EV5A 3PXMA 1FUSA 2OOVC 4HBRA 2OWPA 1IVXA 4HZ9B 1RNBA 3JUQA 2R4IA 3X3YA 1BRHA 1W2B2 3BLZA 5AEUB 3AGOA 3FF2A 2Z76A 3DGMA 3RNTA 2HOHA 3EC9A 2B24B 1VQO3 2UX0A 4N6OB 6STDA 1BRKA 3GAXA 2CX1A 1BNFA 2RGQA 1FYSA 3EN1B 4O8SA 1I70A 2ML6A 2YX9A 1ASKA 3D5IA 4HVNA 4R9LA 3OV4A 3MSOA 3PGBA 4HM5B 1QVG2 2WOHA 1V58A 3CPOA 2CG0A 1ULJB 3MPHA 2F99A 1A2PA 2B1XB 2ZDJA 5AIFA 3DH2A 3CC73 1VQ43 3MHEA 1AY7A 1BGSA 3HIGA 1IQXA 1OUNA 3KSED 3VSYA 2GEYA 1RN4A 1YIT3 4N3VA 2BMOB 1T2HA 4MMXB 1NNVA 4OVMA 1O7WB 2ML5A 3HOHA 3M8CA 5AEWB 5CF2A 1NJI4 5M18A 1X1YA 3NQZA 1MGRA 3J7Yd 3LT9A 3SVAA 1X1XA 1JBSA 2QA43 3HI7A 1UI7A 1JKGA 3BNDA 1B3SA 4GSPA 2J8XB 1RHLA 1W00A 4FMBA 4KFDA 1KD14 4KFEA 3NXJA 3DXOA 2YFLB 1RGCA 1S5AA 2Y73A 4NREA 2E2VA 1MWTA 1NU3A 1BRGA 2IUKA 3F8XA 4RNYA 1TFKA 2IYJA 1I2GA 1W6GA 2D1WA 3KFQC 4O02B 3BB9A 1UCIA 2ZA4A 1VQM3 1STDA 4EBGA 1BU4A 1BRSA 1I2FA 2W04A 5KP3A 5D81A 1VQ73 1UW1A 3KE7A 3S29A 3Q90A 3SOYA 2FGTA 3FG4A 3EJVA 1KQS2 9RNTA 2CWUA 3ZG5A 1TFOA 1W7CA 1GS3A 3CC23 2M7OA 3JUNA 1T2IA 4NHFA 1YVSA 2O9UX 3LTBA 3PS8A 3V99A 1Q814 1W4NA 3JUPA 1MWSA 4L8OA 1EG9B 4J8TA 1RGLA 3S5CA 1RGFA 1W6CA 3X40A 2Y74A 1M9GA 1WTHA 1PYLA 2K0MA 4RNZA 2HMKB 5BXQA 1QMAA 1GY5A 2BO9B 3SYUA 1UI8A 5BIRA 2HMNB 3CMA3 2CWVA 1RGAA 2H0GA 3WOFB 1AR0A 1WNHA 2W56A 1GOYA 1UGIA 1O7GB 3BIRA 1N9JA 1RGKA 3CCL3 1DVDA 2IA7A 1ZGXA 2WGOA 4GHOA 1BSBA 5CF1A 3CU3A 1N9EA 3CXC2 3WA3A 3BU4A 3LXUX 2K3DA 4LGQA 5AIIA 1BSAA 1RCLA 3CCU3 1Y4KA 2W9PA 3D4AA 1BUQA 1PFPA 5ELUA 2XGLA 5EVHA 2YFIB 4BU4A 3SLUA 4BL2A 1YHQ3 2F86B 1BSEA 4BIRA 1KWIA 3UNLA 2GXFA 3SXXA 3LZAA 3GZYB 3DZLA 3B4OA 1YGWA 1R4YA 1IK3A 1RGHA 3WOEB 1BSCA 1NWWA 1Q7HA 1QJGA 3D79A 4HM6B 4N6MA 5HGRA 1JBRA 1JB4A 4IT7A 2P38A 3GZRA 1I0VA 1TRQA 4XBXA 3I0YA 3NBJA 2O3OA 3EN8A 1BAOA 3UL5A 3QRDA 2ZL8A 1K28A 2UUGC 3RGAA 5AYSC 1HZ1A 3L0RA 1M1XB 4O2HA 3FZWA 2W0QA 1B2SA 3AHSA 1HKXA 1ZX2A 2BMRB 2W6JH 3JUMA 3CME3 1B2UA 4CPKA 1G0TA 2F4YA 1LNIA 1MWRA 3RDEA 2P09A 1IVUA 2XSHB 3ER7A 1FUWA 5IG3A 3NBBA 2QGUA 1RN1A 3MWZA 2D42A 4AEQA 1N8QA 1OACA 3DGNA 3FH1A 3N8BA 3UL6A 1B2ZA 2BMQB 2GBXB 2AADA 1RRHA 1LNHA 4WFOA 2LYXA 3T8UA 3HIIA 1A2KA 3WODG 7STDA 3N9HA 2W56B 3NV0A 4KFFA 2CX0A 2PNCA 2H0HA 2KF3A 3MYTA 1FGRA 3GSPA 3PYJA 3FG3A 6RNTA 2PZVA 1L5GB 1LXEA 1LVNA 1IU7A 5CK6A 5KP4A 1DVCA 3JUOA 3UB1A 5BU4A 1JN5B 4JF8A 5FW5A 1FGQA 1VZZA 2SBLA 4EV2A 5AI1A 2JDIH 5EQLA 3N54B 3T0UA 1UCLA 1FA3A 4LZIA 3FG1A 4FMAA 2XF3A 3EX9A 1GD3A 1JZDA 1OH0A 1NDOB 2CKFB 2HMOB 3FGYA 7RNTA 3AGNA 1K734 3LT8A 3RGRA 1IVVA 3DGYA 4K61A 5M19A 2CFDA 1V57A 3OX9A 1R4CA 4RBNA 3A76A 3PCRA 4EYCA 2E2TA 3FLJA 3S28A 1UDII 1DMNA 1GSPA 1STFI 1MWUA 3LTDA 1AVLA 1Q824 1AVKA 1U5OA 3SEDA 3EHCA 4L7KA 4Q53A 3D9RA 2MC8A 2XEPA 1WMOA 1QVF2 1HYFA 1O7PB 1YJN3 2A15A 3B8LA 1DE3A 3G8ZA 1K9M4 2OCTA 2F5WA 1TRPA 4K90B 5CXOA 5IW9A 4XBTA 1I0XA 4MMYB 4HOHA 8CHOA 3NHXA 1UCJA 4MMZB 1VQN3 4FMDA 1WQLB 1I3FA 4HM3B 4N6LA 3LTAA 2BNGA 3KCHA 3CPW2 4G1MB 1DYUA 3X41A 1SIHA 3F14A 3D3LA 4GL6A 3CC43 5STDA 2XR8B 1JV2B 3GWRA 1DMMA 1Q9EA 1JN5A 3VGNA 2KCDA 4FCMA 4X2HA 3GZXB 3G16A 1B27A 1W6YA 5A0OB 3NM7A 2XRXB 1RTUA 1A2VA 3Q2PA 2CWTA 1ZS7A 1RMSA 2GSPA 5IEOA 1ROAA 1S723 1IVWA 1QAKA 4FCJA 2AAEA 1ZO2A 4N6TA 5DRVA 4LEHA 1I8VA 1IYYA 4AKZA 1D6ZA 3OWSA 1YJ93 2CIUA 1J2BA 1X1WA 4AKYA 1JB2A 2OOVA 4R1KA 5IG0A 3X42A 1UUGB 4ORLA 4R80A 4BL3A 3OW22 1GMPA 5CLKA 4N6UA 3DY5A 1LOXA 1RGGA 5IENA 2BHMA 1K41A 3LYGA 3S67A 5JPUA 2KXGA 4FMCA 7GSPA 3B7CA 4CJNA 2F98A 3EQQB 3CCM3 1W02A 3CNMA 3WR2A 4KVHA 1LOWA 1QAFA 2CFGA 3LTCA 3CCS3 1HU9A 4QWTA 3K7CA 1FGTA 1O7HB 3LOYA 2CK3H 3K63A 2GU3A 3WHOA 1I2EA 3DM8A 1VQ83 1FGMA 2HMMB 4J9AA 1CH0A 1MGWA 5D82A 3SX1A 2BT3A 4XM4A 3BNBA 3KN4A 2GBWB 3IMAB 5ELJA 1RKYA 5IEPA 3DGOA 4N6V0 3F7XA 4KZ1A 4OUQA 8RNTA 1T3BA 3EF8A 5JPPA 2V1LA 2CH9A 2FXTA 2RNTA 2OQEA 4FCZA 4IIAA 4WYKB 1JRQA 4EXRA 1VQQA 1CYUA 1TTOA 1RN7A 2R41A 3MG3A 1D6UA 4BTYA 1ISKA 4RZMA 1GOVA 4HM1B 1LRAA 5DREA 3KZTA 3STDA 2KF5A 3WMDA 5IG5A 4HM7B 1M904 1AQZA 1UUVB 1UGHI 3PCSA 5JBSA 1NO3A 3DGLA 2CFLA 1OF5B 3MKIA 2WOFA 2CW9A 3ALAA 1DMQA 1GMRA 3EBYA 3NBRA 3X3ZA 4X2OA 3NV0B 4RNTA 5I97A 2L1SA 1EA2A 4CDLA 1YGEA 1RLSA 2HMJB 2XFTA 3CCJ3 1JKGB 3QK9A 1N5PA 2H0IA 4ILFA 4XDVA 2BIRA 1BSDA 1DETA 4HAAA 1EEJA 1LOVA 2KF6A 2Z6BA 3HK4A 3K5TA 5IG4A 1BRJA 3K9MC 4WHAA 3EE1A 1BOXA 3AMOA 1SIIA 2GEXA 2XGNA 1E97A 1MNLA 2P0MA 3I563 1IQYA 1LQMB 1F8NA 1IV7A 4STDA 1VQ93 1CYVA 1VQ63 1BNRA 4O3VA 4K1UA 3WA2X 2W2CA 1Q7Y4 1EQKA 4HM0B 3GZBA 1PU4A 1ULIB 2OQEC 2BU4A 2ZHXB 3CCV3 1OGZA 3G4S3 1OCVA 1JB5A 5M1AA 4EW5A 2CFKA 4U13A 3D5GA 3X3XA 1TU5A 4NPBA 5AYRB 2FNQA 1WMPA 3KIIA 1KC84 3ECFA 1SPUA 1IT8A 3URPA 2JQ5A 1V74A 3G713 1JJ22 4PEJA 4WP5A 3MG2A 5G2GA 1VQP3 5G1LA 1BANA 5LC6A 1RCKA 4HYZA 1RDSA 1NB3I 4MJDA 3HX8A 5AIGA 1OHPA 2GU1A 1Q40A 3ROBA 1T5YA 4N6NB 1WMNA 4HM8B 1EUIC 2YFJB 3A5EA 2IUJA 1OHSA 1YIJ3 1BUJA 2WO0A 1BNEA
chains in the Genus database with same CATH topology
1I8VA 1IYYA 1RNBA 5HOHA 1I0VA 1TRQA 1BRHA 3Q3FA 1BNSA 3AGOA 1X1WA 3RNTA 1BAOA 2HOHA 1PY3A 1RGEA 1BRKA 1GMPA 1BNFA 1HZ1A 1FYSA 1I70A 1RGGA 3D5IA 1B2SA 3AHSA 1I3IA 7GSPA 1B2UA 2F4YA 1LNIA 3WR2A 5RNTA 1LOWA 1A2PA 3DH2A 1FUTA 1UCKA 1GOUA 5GSPA 3WHOA 1I2EA 2F5MA 1AY7A 1BGSA 1SARA 1RN1A 1CH0A 1MGWA 1BRIA 1B2ZA 2AADA 1RN4A 1B21A 1T2HA 8RNTA 3HOHA 2RNTA 1BNIA 1X1YA 1MGRA 2KF3A 1B2MA 1X1XA 1JBSA 3GSPA 1TTOA 1B3SA 1GOVA 4GSPA 6RNTA 1RHLA 1LRAA 2KF5A 1RGCA 1AQZA 1G02A 1BRGA 5BU4A 1X1UA 1I2GA 4J5GA 2F56A 1UCIA 1RNTA 2ZA4A 1GMRA 4J5KA 1BNGA 1BU4A 1UCLA 1BRSA 1I2FA 1FZUA 4RNTA 7RNTA 1RLSA 3AGNA 1LOYA 3DGYA 9RNTA 1C54A 2BIRA 1BSDA 1DETA 4HAAA 1LOVA 1T2IA 2KF6A 1BRJA 1YVSA 2C4BA 1BOXA 1GSPA 6GSPA 1RGLA 1JBTA 1RGFA 1BVIA 1B20A 1BNRA 1PYLA 2SARA 1HYFA 1FW7A 1BNJA 1DE3A 1GMQA 3SYUA 5BIRA 1RGAA 2F5WA 1TRPA 2BU4A 2KAAA 1GOYA 1I0XA 3BIRA 1RGKA 4HOHA 1UCJA 1ZGXA 4GHOA 3D5GA 1BSBA 1I3FA 3KCHA 3URPA 3BU4A 1YNVX 1BSAA 1RCLA 1B2XA 3D4AA 1Q9EA 2KF4A 1RSNA 1BANA 4BU4A 1RCKA 1RDSA 1BSEA 4BIRA 3AHWA 1B27A 1BIRA 1BRNL 1RTUA 2RBIA 1YGWA 1R4YA 1RMSA 2GSPA 1RGHA 3A5EA 1BSCA 1JBRA 2AAEA 1BUJA 1FUSA 1BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8V A;  1IYY A;  1RNB A;  5HOH A;  1I0V A;  1TRQ A;  1BRH A;  3Q3F A;  1BNS A;  3AGO A;  1X1W A;  3RNT A;  1BAO A;  2HOH A;  1PY3 A;  1RGE A;  1BRK A;  1GMP A;  1BNF A;  1HZ1 A;  1FYS A;  1I70 A;  1RGG A;  3D5I A;  1B2S A;  3AHS A;  1I3I A;  7GSP A;  1B2U A;  2F4Y A;  1LNI A;  3WR2 A;  5RNT A;  1LOW A;  1A2P A;  3DH2 A;  1FUT A;  1UCK A;  1GOU A;  5GSP A;  3WHO A;  1I2E A;  2F5M A;  1AY7 A;  1BGS A;  1SAR A;  1RN1 A;  1CH0 A;  1MGW A;  1BRI A;  1B2Z A;  2AAD A;  1RN4 A;  1B21 A;  1T2H A;  8RNT A;  3HOH A;  2RNT A;  1BNI A;  1X1Y A;  1MGR A;  2KF3 A;  1B2M A;  1X1X A;  1JBS A;  3GSP A;  1TTO A;  1B3S A;  1GOV A;  4GSP A;  6RNT A;  1RHL A;  1LRA A;  2KF5 A;  1RGC A;  1AQZ A;  1G02 A;  1BRG A;  5BU4 A;  1X1U A;  1I2G A;  4J5G A;  2F56 A;  1UCI A;  1RNT A;  2ZA4 A;  1GMR A;  4J5K A;  1BNG A;  1BU4 A;  1UCL A;  1BRS A;  1I2F A;  1FZU A;  4RNT A;  7RNT A;  1RLS A;  3AGN A;  1LOY A;  3DGY A;  9RNT A;  1C54 A;  2BIR A;  1BSD A;  1DET A;  4HAA A;  1LOV A;  1T2I A;  2KF6 A;  1BRJ A;  1YVS A;  2C4B A;  1BOX A;  1GSP A;  6GSP A;  1RGL A;  1JBT A;  1RGF A;  1BVI A;  1B20 A;  1BNR A;  1PYL A;  2SAR A;  1HYF A;  1FW7 A;  1BNJ A;  1DE3 A;  1GMQ A;  3SYU A;  5BIR A;  1RGA A;  2F5W A;  1TRP A;  2BU4 A;  2KAA A;  1GOY A;  1I0X A;  3BIR A;  1RGK A;  4HOH A;  1UCJ A;  1ZGX A;  4GHO A;  3D5G A;  1BSB A;  1I3F A;  3KCH A;  3URP A;  3BU4 A;  1YNV X;  1BSA A;  1RCL A;  1B2X A;  3D4A A;  1Q9E A;  2KF4 A;  1RSN A;  1BAN A;  4BU4 A;  1RCK A;  1RDS A;  1BSE A;  4BIR A;  3AHW A;  1B27 A;  1BIR A;  1BRN L;  1RTU A;  2RBI A;  1YGW A;  1R4Y A;  1RMS A;  2GSP A;  1RGH A;  3A5E A;  1BSC A;  1JBR A;  2AAE A;  1BUJ A;  1FUS A;  1BNE A; 
#chains in the Genus database with same CATH topology
 2IMJ A;  3IJE B;  3WDG B;  3OXA A;  5HOH A;  3Q3F A;  2KRT A;  2Q07 A;  1BNS A;  3T8N A;  1TJD A;  2CFW A;  1PY3 A;  3VF1 A;  1RGE A;  2INX A;  1OGX A;  1Z1S A;  4I5Q A;  1US1 A;  4R4K A;  4TX4 A;  1N8R 4;  3U97 A;  3KSP A;  5D83 A;  1I3I A;  3F7S A;  1A90 A;  3DUK A;  1Q40 B;  5LC7 A;  3PZW A;  1ROV A;  4HKV B;  1VQK 3;  1GD4 A;  4WYK A;  2RSX A;  5RNT A;  3BNC A;  2HML B;  1FUT A;  1UCK A;  3AMO B;  1GOU A;  5GSP A;  4ZM8 A;  1E3V A;  1W01 A;  3FKA A;  2F5M A;  1UUW B;  4LYL B;  1SAR A;  1FGO A;  5BVB A;  1BRI A;  1U8C B;  3F40 A;  1NB5 I;  5FGO A;  3K0Z A;  3BNE A;  1B21 A;  2OTJ 3;  3Q1C A;  1D6Y A;  2UGI A;  2C11 A;  3FCS B;  4JRF A;  3H3H A;  4H3U A;  1BNI A;  3EB8 A;  2WGQ A;  1N5H A;  4BTW A;  2C10 A;  1B2M A;  1SQW A;  5IER A;  2QIY A;  4XB5 A;  5KP1 A;  3MG1 A;  4BTX A;  5G1K A;  1M1K 4;  2P0X A;  4GB5 A;  3OWY A;  4HM2 B;  2QEX 3;  2I9W A;  1O7N B;  1G02 A;  3I55 3;  3CCR 3;  1X1U A;  3OWU A;  4J5G A;  4KT3 B;  4LMI A;  1IV9 A;  1JNQ A;  2E2U A;  2F56 A;  3NUV A;  4R9K A;  2CG1 A;  1Q86 4;  1QAL A;  1RNT A;  1GY7 A;  1GYB A;  3LH4 A;  4I4K A;  4J5K A;  1W5Z A;  1BNG A;  4OK0 A;  1LQG C;  1FZU A;  2XH9 A;  1C7H A;  5AIH A;  3ZG0 A;  3ZFZ A;  2RFR A;  1LOY A;  4EC6 A;  1TP6 A;  1W2Z A;  1IQ8 A;  2MF7 A;  2RCD A;  2STD A;  3IPT A;  1C54 A;  4L8P A;  3FSD A;  3F9S A;  1CEW I;  1IDP A;  4HM4 B;  3EBT A;  2C4B A;  1E3R A;  3G0K A;  3GRD A;  3H51 A;  2XFS A;  3V92 A;  4HJL B;  4LSO A;  1JZO A;  3CNX A;  6GSP A;  1JBT A;  2L4V A;  2W03 A;  2OTL 3;  2Z7A A;  1BVI A;  4H61 A;  1B20 A;  3NX0 A;  1MOL A;  1Q42 A;  2SAR A;  4HZB B;  1FW7 A;  1BNJ A;  1IT7 A;  3S27 A;  1G96 A;  1GMQ A;  3JVC A;  1SJW A;  3U1W A;  4CCV A;  3E99 A;  4IPB A;  2KAA A;  2Z77 A;  1TIJ A;  2IY2 A;  3CCQ 3;  1TUH A;  2K54 A;  1KSI A;  4K1V A;  2XSO B;  1YI2 3;  3TDG A;  3DMC A;  4WWU C;  1EKM A;  5EEO A;  1OPY A;  1YNV X;  1OHO A;  1RRL A;  3HZP A;  1VQL 3;  2CC3 A;  1B2X A;  3LML A;  1O7M B;  2KF4 A;  1RSN A;  3O8Y A;  3FF0 A;  1OF5 A;  1K8A 4;  1GY6 A;  3NM2 A;  5IF6 A;  4MEI A;  1RJO A;  3SOA A;  3AHW A;  1YJW 3;  3G6E 3;  4FR9 A;  1A67 A;  5TGN A;  1BIR A;  1AV4 A;  4XBY A;  1BRN L;  3CD6 3;  2CHC A;  3NQY A;  4XDW A;  2RBI A;  3UJM A;  3V98 A;  2W9Q A;  1YVB I;  2LQV A;  3KKG A;  3F8H A;  2P05 A;  4DKI A;  1CQS A;  3B4P A;  3CCE 3;  1VQ5 3;  4EV5 A;  3PXM A;  1FUS A;  2OOV C;  4HBR A;  2OWP A;  1IVX A;  4HZ9 B;  1RNB A;  3JUQ A;  2R4I A;  3X3Y A;  1BRH A;  1W2B 2;  3BLZ A;  5AEU B;  3AGO A;  3FF2 A;  2Z76 A;  3DGM A;  3RNT A;  2HOH A;  3EC9 A;  2B24 B;  1VQO 3;  2UX0 A;  4N6O B;  6STD A;  1BRK A;  3GAX A;  2CX1 A;  1BNF A;  2RGQ A;  1FYS A;  3EN1 B;  4O8S A;  1I70 A;  2ML6 A;  2YX9 A;  1ASK A;  3D5I A;  4HVN A;  4R9L A;  3OV4 A;  3MSO A;  3PGB A;  4HM5 B;  1QVG 2;  2WOH A;  1V58 A;  3CPO A;  2CG0 A;  1ULJ B;  3MPH A;  2F99 A;  1A2P A;  2B1X B;  2ZDJ A;  5AIF A;  3DH2 A;  3CC7 3;  1VQ4 3;  3MHE A;  1AY7 A;  1BGS A;  3HIG A;  1IQX A;  1OUN A;  3KSE D;  3VSY A;  2GEY A;  1RN4 A;  1YIT 3;  4N3V A;  2BMO B;  1T2H A;  4MMX B;  1NNV A;  4OVM A;  1O7W B;  2ML5 A;  3HOH A;  3M8C A;  5AEW B;  5CF2 A;  1NJI 4;  5M18 A;  1X1Y A;  3NQZ A;  1MGR A;  3J7Y d;  3LT9 A;  3SVA A;  1X1X A;  1JBS A;  2QA4 3;  3HI7 A;  1UI7 A;  1JKG A;  3BND A;  1B3S A;  4GSP A;  2J8X B;  1RHL A;  1W00 A;  4FMB A;  4KFD A;  1KD1 4;  4KFE A;  3NXJ A;  3DXO A;  2YFL B;  1RGC A;  1S5A A;  2Y73 A;  4NRE A;  2E2V A;  1MWT A;  1NU3 A;  1BRG A;  2IUK A;  3F8X A;  4RNY A;  1TFK A;  2IYJ A;  1I2G A;  1W6G A;  2D1W A;  3KFQ C;  4O02 B;  3BB9 A;  1UCI A;  2ZA4 A;  1VQM 3;  1STD A;  4EBG A;  1BU4 A;  1BRS A;  1I2F A;  2W04 A;  5KP3 A;  5D81 A;  1VQ7 3;  1UW1 A;  3KE7 A;  3S29 A;  3Q90 A;  3SOY A;  2FGT A;  3FG4 A;  3EJV A;  1KQS 2;  9RNT A;  2CWU A;  3ZG5 A;  1TFO A;  1W7C A;  1GS3 A;  3CC2 3;  2M7O A;  3JUN A;  1T2I A;  4NHF A;  1YVS A;  2O9U X;  3LTB A;  3PS8 A;  3V99 A;  1Q81 4;  1W4N A;  3JUP A;  1MWS A;  4L8O A;  1EG9 B;  4J8T A;  1RGL A;  3S5C A;  1RGF A;  1W6C A;  3X40 A;  2Y74 A;  1M9G A;  1WTH A;  1PYL A;  2K0M A;  4RNZ A;  2HMK B;  5BXQ A;  1QMA A;  1GY5 A;  2BO9 B;  3SYU A;  1UI8 A;  5BIR A;  2HMN B;  3CMA 3;  2CWV A;  1RGA A;  2H0G A;  3WOF B;  1AR0 A;  1WNH A;  2W56 A;  1GOY A;  1UGI A;  1O7G B;  3BIR A;  1N9J A;  1RGK A;  3CCL 3;  1DVD A;  2IA7 A;  1ZGX A;  2WGO A;  4GHO A;  1BSB A;  5CF1 A;  3CU3 A;  1N9E A;  3CXC 2;  3WA3 A;  3BU4 A;  3LXU X;  2K3D A;  4LGQ A;  5AII A;  1BSA A;  1RCL A;  3CCU 3;  1Y4K A;  2W9P A;  3D4A A;  1BUQ A;  1PFP A;  5ELU A;  2XGL A;  5EVH A;  2YFI B;  4BU4 A;  3SLU A;  4BL2 A;  1YHQ 3;  2F86 B;  1BSE A;  4BIR A;  1KWI A;  3UNL A;  2GXF A;  3SXX A;  3LZA A;  3GZY B;  3DZL A;  3B4O A;  1YGW A;  1R4Y A;  1IK3 A;  1RGH A;  3WOE B;  1BSC A;  1NWW A;  1Q7H A;  1QJG A;  3D79 A;  4HM6 B;  4N6M A;  5HGR A;  1JBR A;  1JB4 A;  4IT7 A;  2P38 A;  3GZR A;  1I0V A;  1TRQ A;  4XBX A;  3I0Y A;  3NBJ A;  2O3O A;  3EN8 A;  1BAO A;  3UL5 A;  3QRD A;  2ZL8 A;  1K28 A;  2UUG C;  3RGA A;  5AYS C;  1HZ1 A;  3L0R A;  1M1X B;  4O2H A;  3FZW A;  2W0Q A;  1B2S A;  3AHS A;  1HKX A;  1ZX2 A;  2BMR B;  2W6J H;  3JUM A;  3CME 3;  1B2U A;  4CPK A;  1G0T A;  2F4Y A;  1LNI A;  1MWR A;  3RDE A;  2P09 A;  1IVU A;  2XSH B;  3ER7 A;  1FUW A;  5IG3 A;  3NBB A;  2QGU A;  1RN1 A;  3MWZ A;  2D42 A;  4AEQ A;  1N8Q A;  1OAC A;  3DGN A;  3FH1 A;  3N8B A;  3UL6 A;  1B2Z A;  2BMQ B;  2GBX B;  2AAD A;  1RRH A;  1LNH A;  4WFO A;  2LYX A;  3T8U A;  3HII A;  1A2K A;  3WOD G;  7STD A;  3N9H A;  2W56 B;  3NV0 A;  4KFF A;  2CX0 A;  2PNC A;  2H0H A;  2KF3 A;  3MYT A;  1FGR A;  3GSP A;  3PYJ A;  3FG3 A;  6RNT A;  2PZV A;  1L5G B;  1LXE A;  1LVN A;  1IU7 A;  5CK6 A;  5KP4 A;  1DVC A;  3JUO A;  3UB1 A;  5BU4 A;  1JN5 B;  4JF8 A;  5FW5 A;  1FGQ A;  1VZZ A;  2SBL A;  4EV2 A;  5AI1 A;  2JDI H;  5EQL A;  3N54 B;  3T0U A;  1UCL A;  1FA3 A;  4LZI A;  3FG1 A;  4FMA A;  2XF3 A;  3EX9 A;  1GD3 A;  1JZD A;  1OH0 A;  1NDO B;  2CKF B;  2HMO B;  3FGY A;  7RNT A;  3AGN A;  1K73 4;  3LT8 A;  3RGR A;  1IVV A;  3DGY A;  4K61 A;  5M19 A;  2CFD A;  1V57 A;  3OX9 A;  1R4C A;  4RBN A;  3A76 A;  3PCR A;  4EYC A;  2E2T A;  3FLJ A;  3S28 A;  1UDI I;  1DMN A;  1GSP A;  1STF I;  1MWU A;  3LTD A;  1AVL A;  1Q82 4;  1AVK A;  1U5O A;  3SED A;  3EHC A;  4L7K A;  4Q53 A;  3D9R A;  2MC8 A;  2XEP A;  1WMO A;  1QVF 2;  1HYF A;  1O7P B;  1YJN 3;  2A15 A;  3B8L A;  1DE3 A;  3G8Z A;  1K9M 4;  2OCT A;  2F5W A;  1TRP A;  4K90 B;  5CXO A;  5IW9 A;  4XBT A;  1I0X A;  4MMY B;  4HOH A;  8CHO A;  3NHX A;  1UCJ A;  4MMZ B;  1VQN 3;  4FMD A;  1WQL B;  1I3F A;  4HM3 B;  4N6L A;  3LTA A;  2BNG A;  3KCH A;  3CPW 2;  4G1M B;  1DYU A;  3X41 A;  1SIH A;  3F14 A;  3D3L A;  4GL6 A;  3CC4 3;  5STD A;  2XR8 B;  1JV2 B;  3GWR A;  1DMM A;  1Q9E A;  1JN5 A;  3VGN A;  2KCD A;  4FCM A;  4X2H A;  3GZX B;  3G16 A;  1B27 A;  1W6Y A;  5A0O B;  3NM7 A;  2XRX B;  1RTU A;  1A2V A;  3Q2P A;  2CWT A;  1ZS7 A;  1RMS A;  2GSP A;  5IEO A;  1ROA A;  1S72 3;  1IVW A;  1QAK A;  4FCJ A;  2AAE A;  1ZO2 A;  4N6T A;  5DRV A;  4LEH A;  1I8V A;  1IYY A;  4AKZ A;  1D6Z A;  3OWS A;  1YJ9 3;  2CIU A;  1J2B A;  1X1W A;  4AKY A;  1JB2 A;  2OOV A;  4R1K A;  5IG0 A;  3X42 A;  1UUG B;  4ORL A;  4R80 A;  4BL3 A;  3OW2 2;  1GMP A;  5CLK A;  4N6U A;  3DY5 A;  1LOX A;  1RGG A;  5IEN A;  2BHM A;  1K41 A;  3LYG A;  3S67 A;  5JPU A;  2KXG A;  4FMC A;  7GSP A;  3B7C A;  4CJN A;  2F98 A;  3EQQ B;  3CCM 3;  1W02 A;  3CNM A;  3WR2 A;  4KVH A;  1LOW A;  1QAF A;  2CFG A;  3LTC A;  3CCS 3;  1HU9 A;  4QWT A;  3K7C A;  1FGT A;  1O7H B;  3LOY A;  2CK3 H;  3K63 A;  2GU3 A;  3WHO A;  1I2E A;  3DM8 A;  1VQ8 3;  1FGM A;  2HMM B;  4J9A A;  1CH0 A;  1MGW A;  5D82 A;  3SX1 A;  2BT3 A;  4XM4 A;  3BNB A;  3KN4 A;  2GBW B;  3IMA B;  5ELJ A;  1RKY A;  5IEP A;  3DGO A;  4N6V 0;  3F7X A;  4KZ1 A;  4OUQ A;  8RNT A;  1T3B A;  3EF8 A;  5JPP A;  2V1L A;  2CH9 A;  2FXT A;  2RNT A;  2OQE A;  4FCZ A;  4IIA A;  4WYK B;  1JRQ A;  4EXR A;  1VQQ A;  1CYU A;  1TTO A;  1RN7 A;  2R41 A;  3MG3 A;  1D6U A;  4BTY A;  1ISK A;  4RZM A;  1GOV A;  4HM1 B;  1LRA A;  5DRE A;  3KZT A;  3STD A;  2KF5 A;  3WMD A;  5IG5 A;  4HM7 B;  1M90 4;  1AQZ A;  1UUV B;  1UGH I;  3PCS A;  5JBS A;  1NO3 A;  3DGL A;  2CFL A;  1OF5 B;  3MKI A;  2WOF A;  2CW9 A;  3ALA A;  1DMQ A;  1GMR A;  3EBY A;  3NBR A;  3X3Z A;  4X2O A;  3NV0 B;  4RNT A;  5I97 A;  2L1S A;  1EA2 A;  4CDL A;  1YGE A;  1RLS A;  2HMJ B;  2XFT A;  3CCJ 3;  1JKG B;  3QK9 A;  1N5P A;  2H0I A;  4ILF A;  4XDV A;  2BIR A;  1BSD A;  1DET A;  4HAA A;  1EEJ A;  1LOV A;  2KF6 A;  2Z6B A;  3HK4 A;  3K5T A;  5IG4 A;  1BRJ A;  3K9M C;  4WHA A;  3EE1 A;  1BOX A;  3AMO A;  1SII A;  2GEX A;  2XGN A;  1E97 A;  1MNL A;  2P0M A;  3I56 3;  1IQY A;  1LQM B;  1F8N A;  1IV7 A;  4STD A;  1VQ9 3;  1CYV A;  1VQ6 3;  1BNR A;  4O3V A;  4K1U A;  3WA2 X;  2W2C A;  1Q7Y 4;  1EQK A;  4HM0 B;  3GZB A;  1PU4 A;  1ULI B;  2OQE C;  2BU4 A;  2ZHX B;  3CCV 3;  1OGZ A;  3G4S 3;  1OCV A;  1JB5 A;  5M1A A;  4EW5 A;  2CFK A;  4U13 A;  3D5G A;  3X3X A;  1TU5 A;  4NPB A;  5AYR B;  2FNQ A;  1WMP A;  3KII A;  1KC8 4;  3ECF A;  1SPU A;  1IT8 A;  3URP A;  2JQ5 A;  1V74 A;  3G71 3;  1JJ2 2;  4PEJ A;  4WP5 A;  3MG2 A;  5G2G A;  1VQP 3;  5G1L A;  1BAN A;  5LC6 A;  1RCK A;  4HYZ A;  1RDS A;  1NB3 I;  4MJD A;  3HX8 A;  5AIG A;  1OHP A;  2GU1 A;  1Q40 A;  3ROB A;  1T5Y A;  4N6N B;  1WMN A;  4HM8 B;  1EUI C;  2YFJ B;  3A5E A;  2IUJ A;  1OHS A;  1YIJ 3;  1BUJ A;  2WO0 A;  1BNE A; 
#chains in the Genus database with same CATH homology
 1I8V A;  1IYY A;  1RNB A;  5HOH A;  1I0V A;  1TRQ A;  1BRH A;  3Q3F A;  1BNS A;  3AGO A;  1X1W A;  3RNT A;  1BAO A;  2HOH A;  1PY3 A;  1RGE A;  1BRK A;  1GMP A;  1BNF A;  1HZ1 A;  1FYS A;  1I70 A;  1RGG A;  3D5I A;  1B2S A;  3AHS A;  1I3I A;  7GSP A;  1B2U A;  2F4Y A;  1LNI A;  3WR2 A;  5RNT A;  1LOW A;  1A2P A;  3DH2 A;  1FUT A;  1UCK A;  1GOU A;  5GSP A;  3WHO A;  1I2E A;  2F5M A;  1AY7 A;  1BGS A;  1SAR A;  1RN1 A;  1CH0 A;  1MGW A;  1BRI A;  1B2Z A;  2AAD A;  1RN4 A;  1B21 A;  1T2H A;  8RNT A;  3HOH A;  2RNT A;  1BNI A;  1X1Y A;  1MGR A;  2KF3 A;  1B2M A;  1X1X A;  1JBS A;  3GSP A;  1TTO A;  1B3S A;  1GOV A;  4GSP A;  6RNT A;  1RHL A;  1LRA A;  2KF5 A;  1RGC A;  1AQZ A;  1G02 A;  1BRG A;  5BU4 A;  1X1U A;  1I2G A;  4J5G A;  2F56 A;  1UCI A;  1RNT A;  2ZA4 A;  1GMR A;  4J5K A;  1BNG A;  1BU4 A;  1UCL A;  1BRS A;  1I2F A;  1FZU A;  4RNT A;  7RNT A;  1RLS A;  3AGN A;  1LOY A;  3DGY A;  9RNT A;  1C54 A;  2BIR A;  1BSD A;  1DET A;  4HAA A;  1LOV A;  1T2I A;  2KF6 A;  1BRJ A;  1YVS A;  2C4B A;  1BOX A;  1GSP A;  6GSP A;  1RGL A;  1JBT A;  1RGF A;  1BVI A;  1B20 A;  1BNR A;  1PYL A;  2SAR A;  1HYF A;  1FW7 A;  1BNJ A;  1DE3 A;  1GMQ A;  3SYU A;  5BIR A;  1RGA A;  2F5W A;  1TRP A;  2BU4 A;  2KAA A;  1GOY A;  1I0X A;  3BIR A;  1RGK A;  4HOH A;  1UCJ A;  1ZGX A;  4GHO A;  3D5G A;  1BSB A;  1I3F A;  3KCH A;  3URP A;  3BU4 A;  1YNV X;  1BSA A;  1RCL A;  1B2X A;  3D4A A;  1Q9E A;  2KF4 A;  1RSN A;  1BAN A;  4BU4 A;  1RCK A;  1RDS A;  1BSE A;  4BIR A;  3AHW A;  1B27 A;  1BIR A;  1BRN L;  1RTU A;  2RBI A;  1YGW A;  1R4Y A;  1RMS A;  2GSP A;  1RGH A;  3A5E A;  1BSC A;  1JBR A;  2AAE A;  1BUJ A;  1FUS A;  1BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...