1RDSA

Crystal structure of ribonuclease ms (as ribonuclease t1 homologue) complexed with a guanylyl-3',5'-cytidine analogue
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
ESCEYTCGSTCYWSSDVSAAKAKGYSLYESGDTIDDYPHEYHDYEGFDFPVSGTYYEYPIMSDYDVYTGGSPGADRVIFNGDDELAGVITHTGASGDDFVACSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE MS
publication title Crystal structure of ribonuclease Ms (as a ribonuclease T1 homologue) complexed with a guanylyl-3',5'-cytidine analogue.
pubmed doi rcsb
source organism Aspergillus phoenicis
total genus 29
structure length 105
sequence length 105
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rdsA00
3GSPA 1BSAA 3D5IA 1X1UA 2KF6A 1JBRA 1RGGA 1GMQA 1BSDA 1BSBA 1BGSA 1BVIA 4BIRA 1BNEA 1I2FA 1RDSA 1YVSA 3DGYA 4GHOA 1BIRA 1FUTA 3BIRA 2HOHA 3DH2A 1GOVA 1UCKA 2BIRA 1RSNA 1BRIA 1RN1A 1UCLA 4HOHA 1B27A 1I3IA 1LNIA 3AGOA 1I2GA 1BRSA 1RGHA 2BU4A 1B2XA 5BU4A 1B2SA 1B2ZA 5GSPA 1T2HA 1BNJA 1CH0A 2KF3A 3WR2A 2F4YA 4HAAA 1BNSA 3AGNA 1T2IA 1LOYA 1GOYA 1TRPA 1TRQA 6RNTA 1MGWA 1PYLA 1DETA 1RNTA 5HOHA 1C54A 2KF4A 2F56A 1JBTA 1ZGXA 1RCKA 3URPA 7RNTA 2C4BA 4J5GA 3SYUA 5RNTA 1BRNL 1B20A 3D4AA 1RLSA 3A5EA 3BU4A 4GSPA 9RNTA 1I8VA 1X1XA 1BUJA 1PY3A 1RGFA 1SARA 3D5GA 1BNGA 2AADA 1BRJA 1HYFA 1UCJA 2AAEA 1FW7A 1TTOA 1LOWA 1Q9EA 3AHSA 3KCHA 1I0VA 1BRKA 1YNVX 1BOXA 5BIRA 1AQZA 1AY7A 1FYSA 1G02A 1I3FA 1BANA 3AHWA 1RNBA 1BNRA 1IYYA 2SARA 1B3SA 1MGRA 1BSCA 2KAAA 1I2EA 2F5WA 1RCLA 1RGCA 2RNTA 1LOVA 2ZA4A 1RHLA 2RBIA 1B21A 1RMSA 1I0XA 1X1WA 1RGLA 8RNTA 2GSPA 3WHOA 4RNTA 1RGAA 7GSPA 1JBSA 1UCIA 1DE3A 1BSEA 1HZ1A 1FZUA 1I70A 1BAOA 1BRHA 1GMPA 1X1YA 1FUSA 1RTUA 1YGWA 1A2PA 1BNFA 1GSPA 4BU4A 3RNTA 3HOHA 1BNIA 1B2MA 1LRAA 1RGKA 2KF5A 1BU4A 1GMRA 1BRGA 2F5MA 1GOUA 1RGEA 4J5KA 1RN4A 1R4YA 3Q3FA 1B2UA 6GSPA
chains in the Genus database with same CATH superfamily
4OUQA 1VQ93 1BSAA 1X1UA 4FMCA 4K1UA 1ULIB 1BSDA 2UX0A 2Z76A 1W00A 1E3VA 1BGSA 1S5AA 1IV9A 4R9KA 3FCSB 2CX1A 2P38A 1M1K4 1VQ43 1YVSA 2XF3A 1TUHA 2D42A 2XGNA 3KSPA 4FCJA 2L4VA 5D81A 3SLUA 3X3ZA 2OTJ3 3CCU3 3G6E3 2HOHA 4WHAA 3DH2A 3FZWA 5FGOA 1GOVA 3RDEA 3CCE3 2BIRA 3V92A 1RSNA 3EX9A 3JUNA 1UCLA 4FCMA 4R1KA 3AGOA 1I3IA 1LNIA 2P05A 2P0XA 3I553 1GD3A 1NB5I 2C10A 5AI1A 5LC6A 1PFPA 3I0YA 4HJLB 1KWIA 4HM7B 1SIHA 4DKIA 5D82A 1DMMA 2HMJB 4U13A 1CQSA 2OOVA 4O02B 2D1WA 6RNTA 1PYLA 3SVAA 1DETA 1RNTA 1E97A 1ZS7A 3F9SA 1ISKA 3Q90A 3NXJA 3ALAA 2P0MA 5ELUA 2J8XB 4L7KA 1OF5B 1YI23 4HBRA 1MWTA 4HM4B 1RKYA 1B20A 2CG0A 3N9HA 3S67A 1VQN3 5IEPA 1I8VA 1IVWA 2XFTA 2XSHB 1J2BA 1VZZA 2AADA 1DMQA 3FH1A 1TTOA 1LOWA 1Q9EA 3KCHA 5EQLA 1IQYA 1I0VA 1N5HA 4WWUC 5G1KA 4NREA 1BOXA 1EUIC 1STFI 3K7CA 3AMOA 4LEHA 1EA2A 1BANA 3AHWA 4N3VA 1RNBA 1BNRA 1FA3A 1IYYA 2SARA 3PCSA 1YVBI 1QAFA 1I2EA 2RNTA 1RCLA 2Z7AA 3CU3A 3D9RA 1TFOA 2F98A 3F7XA 1RHLA 3D79A 2QGUA 4AEQA 3WA2X 3KN4A 1TP6A 3NBBA 1QJGA 2CFWA 1KQS2 3CCR3 2OTL3 8RNTA 3CCV3 4RNTA 1HU9A 1UI8A 4HKVB 1JBSA 1T5YA 1G0TA 2XGLA 1BSEA 3EC9A 1FGTA 2HMOB 1BRHA 3EE1A 3DZLA 4XDVA 4Q53A 4EV5A 3WOEB 4KFFA 2Z77A 1YGWA 3PXMA 1Q864 2LQVA 4CCVA 2GBXB 4K61A 1QVG2 1Z1SA 2Z6BA 3F8HA 5DRVA 1W6CA 1BNIA 3CNMA 5STDA 2KF5A 1OGXA 1BU4A 1GMRA 2CHCA 2GEXA 1NJI4 5CXOA 1NDOB 1RGEA 2F86B 5I97A 4N6OB 1V57A 1Q7Y4 4TX4A 3S29A 2QIYA 6GSPA 3CC43 2P09A 1UDII 1MWUA 1JJ22 2W2CA 3GZBA 4H3UA 3T0UA 1JKGA 1BVIA 2E2VA 1BNEA 1RRLA 1O7NB 2XSOB 2YFLB 3FLJA 4BTWA 1SIIA 1ZX2A 1US1A 3LT8A 4HM8B 3CD63 2XEPA 3MG3A 3HIGA 4N6NB 1W2B2 3NQZA 1K28A 2K0MA 3AMOB 1BIRA 2A15A 1AR0A 1GYBA 2B1XB 3DXOA 3EBYA 3BB9A 1UCKA 3L0RA 1STDA 2HMLB 1G96A 2ZDJA 3OWSA 3ZG5A 4HM6B 3CC23 4KFEA 4IIAA 4CDLA 5A0OB 3PS8A 2GEYA 3DUKA 2BU4A 2ML5A 1B2XA 3KSED 4H61A 3MYTA 3K5TA 1B2ZA 4JRFA 1VQM3 2SBLA 1T2HA 1O7MB 3NQYA 4CJNA 1FUWA 1ZO2A 1N5PA 2L1SA 3U1WA 1Q42A 4HAAA 1BNSA 1MOLA 1NO3A 2UGIA 3NBJA 1W4NA 1QALA 1YHQ3 5AYRB 4LZIA 1K9M4 1TRPA 3EF8A 4I5QA 1WMOA 3RGAA 1TRQA 2Y74A 3ECFA 5AYSC 3G4S3 1WNHA 2FXTA 5LC7A 2W56A 2ML6A 1O7WB 1GD4A 2WOHA 4HM2B 1VQL3 2F56A 2JDIH 1RCKA 2CH9A 3LTDA 4KFDA 5RNTA 4XBTA 3LMLA 3VGNA 1RLSA 2ZL8A 1BUQA 1VQQA 9RNTA 3X40A 4R9LA 1W5ZA 1Y4KA 3FF2A 3K63A 5IG0A 1X1XA 3CNXA 3D3LA 1BUJA 3X3XA 1DVDA 1RGFA 4AKYA 3D5GA 1BNGA 1PU4A 1BRJA 1UCJA 4WYKA 3V99A 3KFQC 2OWPA 1KC84 3CMA3 1FW7A 4XBXA 3FG1A 4FR9A 2RGQA 1BRKA 4BL2A 1D6ZA 1U5OA 1YJN3 4X2HA 1G02A 3FGYA 2B24B 3IMAB 1BSCA 2KAAA 3BNDA 3G0KA 2F5WA 5CLKA 1VQ73 4R4KA 5CF2A 2CC3A 3PCRA 5M19A 2R4IA 1WQLB 6STDA 3FG4A 2BMQB 3OXAA 3JUPA 5IENA 3LTAA 3U97A 4IT7A 3WHOA 4LYLB 4XM4A 3EN8A 5IG4A 1OPYA 2CX0A 3DGNA 1NWWA 1UCIA 3H51A 1IU7A 2WGQA 1I70A 5DREA 4WFOA 3KE7A 1WMNA 3ZG0A 5M18A 2OOVC 5TGNA 1AVKA 4RNYA 1X1YA 2BMOB 1IT7A 2Y73A 3NV0A 2V1LA 1DVCA 2WO0A 3FSDA 3OV4A 3LH4A 1GSPA 1LVNA 1U8CB 4O8SA 1O7PB 3WDGB 2IY2A 2XH9A 2BMRB 5D83A 3PYJA 2LYXA 3WOFB 1BRGA 3ZFZA 4LSOA 1RRHA 1GOUA 5IG3A 3G16A 1JN5A 3LT9A 3UNLA 3CCS3 3GSPA 3F8XA 1AVLA 5AIHA 5JPPA 1YGEA 3UJMA 1W6GA 1KD14 1JBRA 3MKIA 4EYCA 4BIRA 3Q1CA 1A2KA 3J7Yd 1JB4A 3BNCA 1RDSA 3DGYA 3MG2A 8CHOA 1YIJ3 1LQGC 4FMBA 1YIT3 1NNVA 3OWUA 1OHSA 4N6V0 3CPW2 3CCQ3 2XFSA 7STDA 1Q40A 1FUTA 3BIRA 2IUJA 5G2GA 3UB1A 3N54B 4RNZA 2KCDA 3X41A 3B8LA 3LXUX 1O7HB 3H3HA 2CFDA 3DGOA 5FW5A 3DMCA 1E3RA 5ELJA 1CEWI 3MPHA 1N9EA 3OX9A 5G1LA 4N6LA 1VQ63 4XDWA 4XBYA 4N6MA 1RGHA 2O9UX 1VQO3 3CCJ3 2W0QA 1TU5A 2W9QA 4FCZA 3WODG 4BL3A 1JZOA 2MC8A 3NX0A 1GY5A 1OH0A 1CH0A 1Q814 1DYUA 2BO9B 1V74A 3UL6A 3AGNA 1JV2B 1OHOA 3BLZA 3TDGA 1LQMB 5EVHA 1GOYA 1JB2A 2R41A 1TJDA 3QK9A 2I9WA 1MGWA 2JQ5A 1N8QA 4MJDA 4HVNA 5HOHA 1C54A 1IQ8A 1ZGXA 3CME3 3NM7A 3URPA 2CG1A 1MWRA 2C4BA 1GY7A 2M7OA 1KSIA 2OCTA 4K90B 1JN5B 4QWTA 3RGRA 1VQP3 3A5EA 2E2TA 2CFLA 3SEDA 2ZHXB 2KRTA 3CCM3 2FNQA 4EW5A 1FGQA 1K8A4 4KT3B 4MEIA 5AIIA 4I4KA 2YFJB 1JNQA 3LYGA 1SARA 3PGBA 1YJW3 1IK3A 3K9MC 1VQ53 2AAEA 2YFIB 3G8ZA 1SQWA 1YNVX 5BIRA 1AQZA 4J9AA 2XR8B 1CYUA 3S28A 1FYSA 1I3FA 3IPTA 5IF6A 1B3SA 1MGRA 3HZPA 3NHXA 3SOAA 5JBSA 1D6UA 4L8PA 1M904 5IG5A 3T8UA 2GU3A 3GWRA 4JF8A 5KP4A 1N8R4 1M9GA 3FKAA 4RBNA 1OACA 4STDA 3PZWA 3EN1B 1RJOA 3M8CA 3EQQB 4HYZA 1UUGB 4FMDA 2CWTA 1GY6A 1RGAA 1DMNA 2WOFA 7GSPA 1DE3A 4R80A 1JKGB 1LNHA 1AV4A 1ROAA 1TIJA 4J8TA 3SXXA 1VQK3 1A67A 1OCVA 3B4OA 3F40A 4HM3B 4LGQA 4ORLA 5AIFA 4EBGA 3GZYB 4FMAA 1WMPA 1JZDA 2BHMA 2RSXA 3GZRA 3JUMA 4ILFA 4IPBA 4KZ1A 3DY5A 3HOHA 4OK0A 1S723 1M1XB 1RGKA 3EHCA 2IMJA 3GAXA 1JB5A 4BTYA 1MNLA 1UUVB 3KZTA 2QA43 3VSYA 1MWSA 3LTBA 1RN4A 1RN7A 3ER7A 1B2UA 2HMMB 2E2UA 2CK3H 1EG9B 4HZ9B 4MMXB 3D5IA 2KF6A 1RGGA 1GMQA 2W04A 3A76A 2IA7A 1UUWB 1BSBA 3WMDA 1EQKA 1K41A 1IVXA 1I2FA 1LXEA 1OHPA 1OGZA 3X42A 4CPKA 2CFGA 2GU1A 4GHOA 1OUNA 1D6YA 1UI7A 2UUGC 3GRDA 5HGRA 3HI7A 5BVBA 5IEOA 2QEX3 2PNCA 2W56B 3G713 4O3VA 1IDPA 3OWYA 3E99A 4AKZA 4GB5A 1K734 1BRIA 1RN1A 2H0GA 2RFRA 3JVCA 4HOHA 1W01A 2OQEA 4ZM8A 1B27A 2STDA 1UGIA 2H0IA 1I2GA 1LOXA 4HM1B 3EB8A 1BRSA 1O7GB 2HMNB 5KP3A 3FF0A 3HIIA 1ROVA 1TFKA 5BU4A 2CWVA 1B2SA 2K54A 2IYJA 1CYVA 2CKFB 2F99A 4G1MB 5GSPA 1BNJA 3CXC2 1GS3A 2KF3A 3MG1A 3DGMA 3WR2A 3OW22 2F4YA 3BNEA 1L5GB 4EV2A 3CCL3 1QAKA 2IUKA 4WYKB 2MF7A 2W03A 1T2IA 4NHFA 1LOYA 2K3DA 4N6TA 4XB5A 2GBWB 3HX8A 4L8OA 3B4PA 3CC73 1VQ83 4WP5A 2RCDA 1IQXA 3BNBA 2XRXB 4MMZB 2FGTA 4EC6A 3STDA 2OQEC 1JRQA 2KF4A 1JBTA 1EEJA 1N9JA 1QMAA 4BTXA 4PEJA 5AEUB 7RNTA 5CF1A 4J5GA 1BRNL 3SYUA 3DGLA 4HM5B 1NB3I 3D4AA 3N8BA 5IW9A 5JPUA 1HKXA 2CFKA 3BU4A 4GSPA 5M1AA 1IVUA 3DM8A 5KP1A 3F14A 3I563 2YX9A 1SPUA 1PY3A 5EEOA 1Q7HA 3FG3A 1IVVA 1W02A 3MHEA 2WGOA 1HYFA 3NBRA 3O8YA 2CIUA 3LTCA 3AHSA 4X2OA 4RZMA 3GZXB 2C11A 3NM2A 1C7HA 1AY7A 2BT3A 4O2HA 3V98A 3NV0B 2GXFA 3Q2PA 4KVHA 3T8NA 4GL6A 4HZBB 1IT8A 3KIIA 1RGCA 4K1VA 4EXRA 1Q824 1LOVA 2ZA4A 2RBIA 1UW1A 2BNGA 2H0HA 1W7CA 1B21A 1RMSA 1NU3A 5BXQA 2W9PA 1QVF2 1FGMA 1I0XA 2KXGA 3EJVA 3QRDA 1X1WA 2INXA 3LZAA 3LOYA 1RGLA 3JUOA 4N6UA 2GSPA 2O3OA 2CW9A 5AEWB 2Q07A 3X3YA 2HMKB 3KKGA 3IJEB 1A90A 5CK6A 1EKMA 1ULJB 1FGRA 1R4CA 4MMYB 1SJWA 1HZ1A 1FZUA 1ASKA 1IV7A 1F8NA 3VF1A 4OVMA 1BAOA 3JUQA 3MWZA 3NUVA 3F7SA 2W6JH 1GMPA 1FUSA 1W2ZA 1RTUA 3B7CA 3S5CA 3SOYA 1A2PA 1BNFA 1UGHI 3WA3A 4BU4A 3MSOA 4HM0B 3RNTA 1FGOA 1Q40B 2CWUA 5AIGA 1B2MA 1LRAA 4LMIA 3SX1A 1W6YA 2PZVA 1A2VA 3EBTA 1T3BA 1V58A 3ROBA 3UL5A 2F5MA 1OF5A 3S27A 4J5KA 1YJ93 5IERA 1WTHA 1R4YA 3K0ZA 3CPOA 3Q3FA 4NPBA 3HK4A
chains in the Genus database with same CATH topology
3GSPA 1BSAA 3D5IA 1X1UA 2KF6A 1JBRA 1RGGA 1GMQA 1BSDA 1BSBA 1BGSA 1BVIA 4BIRA 1BNEA 1I2FA 1RDSA 1YVSA 3DGYA 4GHOA 1BIRA 1FUTA 3BIRA 2HOHA 3DH2A 1GOVA 1UCKA 2BIRA 1RSNA 1BRIA 1RN1A 1UCLA 4HOHA 1B27A 1I3IA 1LNIA 3AGOA 1I2GA 1BRSA 1RGHA 2BU4A 1B2XA 5BU4A 1B2SA 1B2ZA 5GSPA 1T2HA 1BNJA 1CH0A 2KF3A 3WR2A 2F4YA 4HAAA 1BNSA 3AGNA 1T2IA 1LOYA 1GOYA 1TRPA 1TRQA 6RNTA 1MGWA 1PYLA 1DETA 1RNTA 5HOHA 1C54A 2KF4A 2F56A 1JBTA 1ZGXA 1RCKA 3URPA 7RNTA 2C4BA 4J5GA 3SYUA 5RNTA 1BRNL 1B20A 3D4AA 1RLSA 3A5EA 3BU4A 4GSPA 9RNTA 1I8VA 1X1XA 1BUJA 1PY3A 1RGFA 1SARA 3D5GA 1BNGA 2AADA 1BRJA 1HYFA 1UCJA 2AAEA 1FW7A 1TTOA 1LOWA 1Q9EA 3AHSA 3KCHA 1I0VA 1BRKA 1YNVX 1BOXA 5BIRA 1AQZA 1AY7A 1FYSA 1G02A 1I3FA 1BANA 3AHWA 1RNBA 1BNRA 1IYYA 2SARA 1B3SA 1MGRA 1BSCA 2KAAA 1I2EA 2F5WA 1RCLA 1RGCA 2RNTA 1LOVA 2ZA4A 1RHLA 2RBIA 1B21A 1RMSA 1I0XA 1X1WA 1RGLA 8RNTA 2GSPA 3WHOA 4RNTA 1RGAA 7GSPA 1JBSA 1UCIA 1DE3A 1BSEA 1HZ1A 1FZUA 1I70A 1BAOA 1BRHA 1GMPA 1X1YA 1FUSA 1RTUA 1YGWA 1A2PA 1BNFA 1GSPA 4BU4A 3RNTA 3HOHA 1BNIA 1B2MA 1LRAA 1RGKA 2KF5A 1BU4A 1GMRA 1BRGA 2F5MA 1GOUA 1RGEA 4J5KA 1RN4A 1R4YA 3Q3FA 1B2UA 6GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GSP A;  1BSA A;  3D5I A;  1X1U A;  2KF6 A;  1JBR A;  1RGG A;  1GMQ A;  1BSD A;  1BSB A;  1BGS A;  1BVI A;  4BIR A;  1BNE A;  1I2F A;  1RDS A;  1YVS A;  3DGY A;  4GHO A;  1BIR A;  1FUT A;  3BIR A;  2HOH A;  3DH2 A;  1GOV A;  1UCK A;  2BIR A;  1RSN A;  1BRI A;  1RN1 A;  1UCL A;  4HOH A;  1B27 A;  1I3I A;  1LNI A;  3AGO A;  1I2G A;  1BRS A;  1RGH A;  2BU4 A;  1B2X A;  5BU4 A;  1B2S A;  1B2Z A;  5GSP A;  1T2H A;  1BNJ A;  1CH0 A;  2KF3 A;  3WR2 A;  2F4Y A;  4HAA A;  1BNS A;  3AGN A;  1T2I A;  1LOY A;  1GOY A;  1TRP A;  1TRQ A;  6RNT A;  1MGW A;  1PYL A;  1DET A;  1RNT A;  5HOH A;  1C54 A;  2KF4 A;  2F56 A;  1JBT A;  1ZGX A;  1RCK A;  3URP A;  7RNT A;  2C4B A;  4J5G A;  3SYU A;  5RNT A;  1BRN L;  1B20 A;  3D4A A;  1RLS A;  3A5E A;  3BU4 A;  4GSP A;  9RNT A;  1I8V A;  1X1X A;  1BUJ A;  1PY3 A;  1RGF A;  1SAR A;  3D5G A;  1BNG A;  2AAD A;  1BRJ A;  1HYF A;  1UCJ A;  2AAE A;  1FW7 A;  1TTO A;  1LOW A;  1Q9E A;  3AHS A;  3KCH A;  1I0V A;  1BRK A;  1YNV X;  1BOX A;  5BIR A;  1AQZ A;  1AY7 A;  1FYS A;  1G02 A;  1I3F A;  1BAN A;  3AHW A;  1RNB A;  1BNR A;  1IYY A;  2SAR A;  1B3S A;  1MGR A;  1BSC A;  2KAA A;  1I2E A;  2F5W A;  1RCL A;  1RGC A;  2RNT A;  1LOV A;  2ZA4 A;  1RHL A;  2RBI A;  1B21 A;  1RMS A;  1I0X A;  1X1W A;  1RGL A;  8RNT A;  2GSP A;  3WHO A;  4RNT A;  1RGA A;  7GSP A;  1JBS A;  1UCI A;  1DE3 A;  1BSE A;  1HZ1 A;  1FZU A;  1I70 A;  1BAO A;  1BRH A;  1GMP A;  1X1Y A;  1FUS A;  1RTU A;  1YGW A;  1A2P A;  1BNF A;  1GSP A;  4BU4 A;  3RNT A;  3HOH A;  1BNI A;  1B2M A;  1LRA A;  1RGK A;  2KF5 A;  1BU4 A;  1GMR A;  1BRG A;  2F5M A;  1GOU A;  1RGE A;  4J5K A;  1RN4 A;  1R4Y A;  3Q3F A;  1B2U A;  6GSP A; 
#chains in the Genus database with same CATH topology
 4OUQ A;  1VQ9 3;  1BSA A;  1X1U A;  4FMC A;  4K1U A;  1ULI B;  1BSD A;  2UX0 A;  2Z76 A;  1W00 A;  1E3V A;  1BGS A;  1S5A A;  1IV9 A;  4R9K A;  3FCS B;  2CX1 A;  2P38 A;  1M1K 4;  1VQ4 3;  1YVS A;  2XF3 A;  1TUH A;  2D42 A;  2XGN A;  3KSP A;  4FCJ A;  2L4V A;  5D81 A;  3SLU A;  3X3Z A;  2OTJ 3;  3CCU 3;  3G6E 3;  2HOH A;  4WHA A;  3DH2 A;  3FZW A;  5FGO A;  1GOV A;  3RDE A;  3CCE 3;  2BIR A;  3V92 A;  1RSN A;  3EX9 A;  3JUN A;  1UCL A;  4FCM A;  4R1K A;  3AGO A;  1I3I A;  1LNI A;  2P05 A;  2P0X A;  3I55 3;  1GD3 A;  1NB5 I;  2C10 A;  5AI1 A;  5LC6 A;  1PFP A;  3I0Y A;  4HJL B;  1KWI A;  4HM7 B;  1SIH A;  4DKI A;  5D82 A;  1DMM A;  2HMJ B;  4U13 A;  1CQS A;  2OOV A;  4O02 B;  2D1W A;  6RNT A;  1PYL A;  3SVA A;  1DET A;  1RNT A;  1E97 A;  1ZS7 A;  3F9S A;  1ISK A;  3Q90 A;  3NXJ A;  3ALA A;  2P0M A;  5ELU A;  2J8X B;  4L7K A;  1OF5 B;  1YI2 3;  4HBR A;  1MWT A;  4HM4 B;  1RKY A;  1B20 A;  2CG0 A;  3N9H A;  3S67 A;  1VQN 3;  5IEP A;  1I8V A;  1IVW A;  2XFT A;  2XSH B;  1J2B A;  1VZZ A;  2AAD A;  1DMQ A;  3FH1 A;  1TTO A;  1LOW A;  1Q9E A;  3KCH A;  5EQL A;  1IQY A;  1I0V A;  1N5H A;  4WWU C;  5G1K A;  4NRE A;  1BOX A;  1EUI C;  1STF I;  3K7C A;  3AMO A;  4LEH A;  1EA2 A;  1BAN A;  3AHW A;  4N3V A;  1RNB A;  1BNR A;  1FA3 A;  1IYY A;  2SAR A;  3PCS A;  1YVB I;  1QAF A;  1I2E A;  2RNT A;  1RCL A;  2Z7A A;  3CU3 A;  3D9R A;  1TFO A;  2F98 A;  3F7X A;  1RHL A;  3D79 A;  2QGU A;  4AEQ A;  3WA2 X;  3KN4 A;  1TP6 A;  3NBB A;  1QJG A;  2CFW A;  1KQS 2;  3CCR 3;  2OTL 3;  8RNT A;  3CCV 3;  4RNT A;  1HU9 A;  1UI8 A;  4HKV B;  1JBS A;  1T5Y A;  1G0T A;  2XGL A;  1BSE A;  3EC9 A;  1FGT A;  2HMO B;  1BRH A;  3EE1 A;  3DZL A;  4XDV A;  4Q53 A;  4EV5 A;  3WOE B;  4KFF A;  2Z77 A;  1YGW A;  3PXM A;  1Q86 4;  2LQV A;  4CCV A;  2GBX B;  4K61 A;  1QVG 2;  1Z1S A;  2Z6B A;  3F8H A;  5DRV A;  1W6C A;  1BNI A;  3CNM A;  5STD A;  2KF5 A;  1OGX A;  1BU4 A;  1GMR A;  2CHC A;  2GEX A;  1NJI 4;  5CXO A;  1NDO B;  1RGE A;  2F86 B;  5I97 A;  4N6O B;  1V57 A;  1Q7Y 4;  4TX4 A;  3S29 A;  2QIY A;  6GSP A;  3CC4 3;  2P09 A;  1UDI I;  1MWU A;  1JJ2 2;  2W2C A;  3GZB A;  4H3U A;  3T0U A;  1JKG A;  1BVI A;  2E2V A;  1BNE A;  1RRL A;  1O7N B;  2XSO B;  2YFL B;  3FLJ A;  4BTW A;  1SII A;  1ZX2 A;  1US1 A;  3LT8 A;  4HM8 B;  3CD6 3;  2XEP A;  3MG3 A;  3HIG A;  4N6N B;  1W2B 2;  3NQZ A;  1K28 A;  2K0M A;  3AMO B;  1BIR A;  2A15 A;  1AR0 A;  1GYB A;  2B1X B;  3DXO A;  3EBY A;  3BB9 A;  1UCK A;  3L0R A;  1STD A;  2HML B;  1G96 A;  2ZDJ A;  3OWS A;  3ZG5 A;  4HM6 B;  3CC2 3;  4KFE A;  4IIA A;  4CDL A;  5A0O B;  3PS8 A;  2GEY A;  3DUK A;  2BU4 A;  2ML5 A;  1B2X A;  3KSE D;  4H61 A;  3MYT A;  3K5T A;  1B2Z A;  4JRF A;  1VQM 3;  2SBL A;  1T2H A;  1O7M B;  3NQY A;  4CJN A;  1FUW A;  1ZO2 A;  1N5P A;  2L1S A;  3U1W A;  1Q42 A;  4HAA A;  1BNS A;  1MOL A;  1NO3 A;  2UGI A;  3NBJ A;  1W4N A;  1QAL A;  1YHQ 3;  5AYR B;  4LZI A;  1K9M 4;  1TRP A;  3EF8 A;  4I5Q A;  1WMO A;  3RGA A;  1TRQ A;  2Y74 A;  3ECF A;  5AYS C;  3G4S 3;  1WNH A;  2FXT A;  5LC7 A;  2W56 A;  2ML6 A;  1O7W B;  1GD4 A;  2WOH A;  4HM2 B;  1VQL 3;  2F56 A;  2JDI H;  1RCK A;  2CH9 A;  3LTD A;  4KFD A;  5RNT A;  4XBT A;  3LML A;  3VGN A;  1RLS A;  2ZL8 A;  1BUQ A;  1VQQ A;  9RNT A;  3X40 A;  4R9L A;  1W5Z A;  1Y4K A;  3FF2 A;  3K63 A;  5IG0 A;  1X1X A;  3CNX A;  3D3L A;  1BUJ A;  3X3X A;  1DVD A;  1RGF A;  4AKY A;  3D5G A;  1BNG A;  1PU4 A;  1BRJ A;  1UCJ A;  4WYK A;  3V99 A;  3KFQ C;  2OWP A;  1KC8 4;  3CMA 3;  1FW7 A;  4XBX A;  3FG1 A;  4FR9 A;  2RGQ A;  1BRK A;  4BL2 A;  1D6Z A;  1U5O A;  1YJN 3;  4X2H A;  1G02 A;  3FGY A;  2B24 B;  3IMA B;  1BSC A;  2KAA A;  3BND A;  3G0K A;  2F5W A;  5CLK A;  1VQ7 3;  4R4K A;  5CF2 A;  2CC3 A;  3PCR A;  5M19 A;  2R4I A;  1WQL B;  6STD A;  3FG4 A;  2BMQ B;  3OXA A;  3JUP A;  5IEN A;  3LTA A;  3U97 A;  4IT7 A;  3WHO A;  4LYL B;  4XM4 A;  3EN8 A;  5IG4 A;  1OPY A;  2CX0 A;  3DGN A;  1NWW A;  1UCI A;  3H51 A;  1IU7 A;  2WGQ A;  1I70 A;  5DRE A;  4WFO A;  3KE7 A;  1WMN A;  3ZG0 A;  5M18 A;  2OOV C;  5TGN A;  1AVK A;  4RNY A;  1X1Y A;  2BMO B;  1IT7 A;  2Y73 A;  3NV0 A;  2V1L A;  1DVC A;  2WO0 A;  3FSD A;  3OV4 A;  3LH4 A;  1GSP A;  1LVN A;  1U8C B;  4O8S A;  1O7P B;  3WDG B;  2IY2 A;  2XH9 A;  2BMR B;  5D83 A;  3PYJ A;  2LYX A;  3WOF B;  1BRG A;  3ZFZ A;  4LSO A;  1RRH A;  1GOU A;  5IG3 A;  3G16 A;  1JN5 A;  3LT9 A;  3UNL A;  3CCS 3;  3GSP A;  3F8X A;  1AVL A;  5AIH A;  5JPP A;  1YGE A;  3UJM A;  1W6G A;  1KD1 4;  1JBR A;  3MKI A;  4EYC A;  4BIR A;  3Q1C A;  1A2K A;  3J7Y d;  1JB4 A;  3BNC A;  1RDS A;  3DGY A;  3MG2 A;  8CHO A;  1YIJ 3;  1LQG C;  4FMB A;  1YIT 3;  1NNV A;  3OWU A;  1OHS A;  4N6V 0;  3CPW 2;  3CCQ 3;  2XFS A;  7STD A;  1Q40 A;  1FUT A;  3BIR A;  2IUJ A;  5G2G A;  3UB1 A;  3N54 B;  4RNZ A;  2KCD A;  3X41 A;  3B8L A;  3LXU X;  1O7H B;  3H3H A;  2CFD A;  3DGO A;  5FW5 A;  3DMC A;  1E3R A;  5ELJ A;  1CEW I;  3MPH A;  1N9E A;  3OX9 A;  5G1L A;  4N6L A;  1VQ6 3;  4XDW A;  4XBY A;  4N6M A;  1RGH A;  2O9U X;  1VQO 3;  3CCJ 3;  2W0Q A;  1TU5 A;  2W9Q A;  4FCZ A;  3WOD G;  4BL3 A;  1JZO A;  2MC8 A;  3NX0 A;  1GY5 A;  1OH0 A;  1CH0 A;  1Q81 4;  1DYU A;  2BO9 B;  1V74 A;  3UL6 A;  3AGN A;  1JV2 B;  1OHO A;  3BLZ A;  3TDG A;  1LQM B;  5EVH A;  1GOY A;  1JB2 A;  2R41 A;  1TJD A;  3QK9 A;  2I9W A;  1MGW A;  2JQ5 A;  1N8Q A;  4MJD A;  4HVN A;  5HOH A;  1C54 A;  1IQ8 A;  1ZGX A;  3CME 3;  3NM7 A;  3URP A;  2CG1 A;  1MWR A;  2C4B A;  1GY7 A;  2M7O A;  1KSI A;  2OCT A;  4K90 B;  1JN5 B;  4QWT A;  3RGR A;  1VQP 3;  3A5E A;  2E2T A;  2CFL A;  3SED A;  2ZHX B;  2KRT A;  3CCM 3;  2FNQ A;  4EW5 A;  1FGQ A;  1K8A 4;  4KT3 B;  4MEI A;  5AII A;  4I4K A;  2YFJ B;  1JNQ A;  3LYG A;  1SAR A;  3PGB A;  1YJW 3;  1IK3 A;  3K9M C;  1VQ5 3;  2AAE A;  2YFI B;  3G8Z A;  1SQW A;  1YNV X;  5BIR A;  1AQZ A;  4J9A A;  2XR8 B;  1CYU A;  3S28 A;  1FYS A;  1I3F A;  3IPT A;  5IF6 A;  1B3S A;  1MGR A;  3HZP A;  3NHX A;  3SOA A;  5JBS A;  1D6U A;  4L8P A;  1M90 4;  5IG5 A;  3T8U A;  2GU3 A;  3GWR A;  4JF8 A;  5KP4 A;  1N8R 4;  1M9G A;  3FKA A;  4RBN A;  1OAC A;  4STD A;  3PZW A;  3EN1 B;  1RJO A;  3M8C A;  3EQQ B;  4HYZ A;  1UUG B;  4FMD A;  2CWT A;  1GY6 A;  1RGA A;  1DMN A;  2WOF A;  7GSP A;  1DE3 A;  4R80 A;  1JKG B;  1LNH A;  1AV4 A;  1ROA A;  1TIJ A;  4J8T A;  3SXX A;  1VQK 3;  1A67 A;  1OCV A;  3B4O A;  3F40 A;  4HM3 B;  4LGQ A;  4ORL A;  5AIF A;  4EBG A;  3GZY B;  4FMA A;  1WMP A;  1JZD A;  2BHM A;  2RSX A;  3GZR A;  3JUM A;  4ILF A;  4IPB A;  4KZ1 A;  3DY5 A;  3HOH A;  4OK0 A;  1S72 3;  1M1X B;  1RGK A;  3EHC A;  2IMJ A;  3GAX A;  1JB5 A;  4BTY A;  1MNL A;  1UUV B;  3KZT A;  2QA4 3;  3VSY A;  1MWS A;  3LTB A;  1RN4 A;  1RN7 A;  3ER7 A;  1B2U A;  2HMM B;  2E2U A;  2CK3 H;  1EG9 B;  4HZ9 B;  4MMX B;  3D5I A;  2KF6 A;  1RGG A;  1GMQ A;  2W04 A;  3A76 A;  2IA7 A;  1UUW B;  1BSB A;  3WMD A;  1EQK A;  1K41 A;  1IVX A;  1I2F A;  1LXE A;  1OHP A;  1OGZ A;  3X42 A;  4CPK A;  2CFG A;  2GU1 A;  4GHO A;  1OUN A;  1D6Y A;  1UI7 A;  2UUG C;  3GRD A;  5HGR A;  3HI7 A;  5BVB A;  5IEO A;  2QEX 3;  2PNC A;  2W56 B;  3G71 3;  4O3V A;  1IDP A;  3OWY A;  3E99 A;  4AKZ A;  4GB5 A;  1K73 4;  1BRI A;  1RN1 A;  2H0G A;  2RFR A;  3JVC A;  4HOH A;  1W01 A;  2OQE A;  4ZM8 A;  1B27 A;  2STD A;  1UGI A;  2H0I A;  1I2G A;  1LOX A;  4HM1 B;  3EB8 A;  1BRS A;  1O7G B;  2HMN B;  5KP3 A;  3FF0 A;  3HII A;  1ROV A;  1TFK A;  5BU4 A;  2CWV A;  1B2S A;  2K54 A;  2IYJ A;  1CYV A;  2CKF B;  2F99 A;  4G1M B;  5GSP A;  1BNJ A;  3CXC 2;  1GS3 A;  2KF3 A;  3MG1 A;  3DGM A;  3WR2 A;  3OW2 2;  2F4Y A;  3BNE A;  1L5G B;  4EV2 A;  3CCL 3;  1QAK A;  2IUK A;  4WYK B;  2MF7 A;  2W03 A;  1T2I A;  4NHF A;  1LOY A;  2K3D A;  4N6T A;  4XB5 A;  2GBW B;  3HX8 A;  4L8O A;  3B4P A;  3CC7 3;  1VQ8 3;  4WP5 A;  2RCD A;  1IQX A;  3BNB A;  2XRX B;  4MMZ B;  2FGT A;  4EC6 A;  3STD A;  2OQE C;  1JRQ A;  2KF4 A;  1JBT A;  1EEJ A;  1N9J A;  1QMA A;  4BTX A;  4PEJ A;  5AEU B;  7RNT A;  5CF1 A;  4J5G A;  1BRN L;  3SYU A;  3DGL A;  4HM5 B;  1NB3 I;  3D4A A;  3N8B A;  5IW9 A;  5JPU A;  1HKX A;  2CFK A;  3BU4 A;  4GSP A;  5M1A A;  1IVU A;  3DM8 A;  5KP1 A;  3F14 A;  3I56 3;  2YX9 A;  1SPU A;  1PY3 A;  5EEO A;  1Q7H A;  3FG3 A;  1IVV A;  1W02 A;  3MHE A;  2WGO A;  1HYF A;  3NBR A;  3O8Y A;  2CIU A;  3LTC A;  3AHS A;  4X2O A;  4RZM A;  3GZX B;  2C11 A;  3NM2 A;  1C7H A;  1AY7 A;  2BT3 A;  4O2H A;  3V98 A;  3NV0 B;  2GXF A;  3Q2P A;  4KVH A;  3T8N A;  4GL6 A;  4HZB B;  1IT8 A;  3KII A;  1RGC A;  4K1V A;  4EXR A;  1Q82 4;  1LOV A;  2ZA4 A;  2RBI A;  1UW1 A;  2BNG A;  2H0H A;  1W7C A;  1B21 A;  1RMS A;  1NU3 A;  5BXQ A;  2W9P A;  1QVF 2;  1FGM A;  1I0X A;  2KXG A;  3EJV A;  3QRD A;  1X1W A;  2INX A;  3LZA A;  3LOY A;  1RGL A;  3JUO A;  4N6U A;  2GSP A;  2O3O A;  2CW9 A;  5AEW B;  2Q07 A;  3X3Y A;  2HMK B;  3KKG A;  3IJE B;  1A90 A;  5CK6 A;  1EKM A;  1ULJ B;  1FGR A;  1R4C A;  4MMY B;  1SJW A;  1HZ1 A;  1FZU A;  1ASK A;  1IV7 A;  1F8N A;  3VF1 A;  4OVM A;  1BAO A;  3JUQ A;  3MWZ A;  3NUV A;  3F7S A;  2W6J H;  1GMP A;  1FUS A;  1W2Z A;  1RTU A;  3B7C A;  3S5C A;  3SOY A;  1A2P A;  1BNF A;  1UGH I;  3WA3 A;  4BU4 A;  3MSO A;  4HM0 B;  3RNT A;  1FGO A;  1Q40 B;  2CWU A;  5AIG A;  1B2M A;  1LRA A;  4LMI A;  3SX1 A;  1W6Y A;  2PZV A;  1A2V A;  3EBT A;  1T3B A;  1V58 A;  3ROB A;  3UL5 A;  2F5M A;  1OF5 A;  3S27 A;  4J5K A;  1YJ9 3;  5IER A;  1WTH A;  1R4Y A;  3K0Z A;  3CPO A;  3Q3F A;  4NPB A;  3HK4 A; 
#chains in the Genus database with same CATH homology
 3GSP A;  1BSA A;  3D5I A;  1X1U A;  2KF6 A;  1JBR A;  1RGG A;  1GMQ A;  1BSD A;  1BSB A;  1BGS A;  1BVI A;  4BIR A;  1BNE A;  1I2F A;  1RDS A;  1YVS A;  3DGY A;  4GHO A;  1BIR A;  1FUT A;  3BIR A;  2HOH A;  3DH2 A;  1GOV A;  1UCK A;  2BIR A;  1RSN A;  1BRI A;  1RN1 A;  1UCL A;  4HOH A;  1B27 A;  1I3I A;  1LNI A;  3AGO A;  1I2G A;  1BRS A;  1RGH A;  2BU4 A;  1B2X A;  5BU4 A;  1B2S A;  1B2Z A;  5GSP A;  1T2H A;  1BNJ A;  1CH0 A;  2KF3 A;  3WR2 A;  2F4Y A;  4HAA A;  1BNS A;  3AGN A;  1T2I A;  1LOY A;  1GOY A;  1TRP A;  1TRQ A;  6RNT A;  1MGW A;  1PYL A;  1DET A;  1RNT A;  5HOH A;  1C54 A;  2KF4 A;  2F56 A;  1JBT A;  1ZGX A;  1RCK A;  3URP A;  7RNT A;  2C4B A;  4J5G A;  3SYU A;  5RNT A;  1BRN L;  1B20 A;  3D4A A;  1RLS A;  3A5E A;  3BU4 A;  4GSP A;  9RNT A;  1I8V A;  1X1X A;  1BUJ A;  1PY3 A;  1RGF A;  1SAR A;  3D5G A;  1BNG A;  2AAD A;  1BRJ A;  1HYF A;  1UCJ A;  2AAE A;  1FW7 A;  1TTO A;  1LOW A;  1Q9E A;  3AHS A;  3KCH A;  1I0V A;  1BRK A;  1YNV X;  1BOX A;  5BIR A;  1AQZ A;  1AY7 A;  1FYS A;  1G02 A;  1I3F A;  1BAN A;  3AHW A;  1RNB A;  1BNR A;  1IYY A;  2SAR A;  1B3S A;  1MGR A;  1BSC A;  2KAA A;  1I2E A;  2F5W A;  1RCL A;  1RGC A;  2RNT A;  1LOV A;  2ZA4 A;  1RHL A;  2RBI A;  1B21 A;  1RMS A;  1I0X A;  1X1W A;  1RGL A;  8RNT A;  2GSP A;  3WHO A;  4RNT A;  1RGA A;  7GSP A;  1JBS A;  1UCI A;  1DE3 A;  1BSE A;  1HZ1 A;  1FZU A;  1I70 A;  1BAO A;  1BRH A;  1GMP A;  1X1Y A;  1FUS A;  1RTU A;  1YGW A;  1A2P A;  1BNF A;  1GSP A;  4BU4 A;  3RNT A;  3HOH A;  1BNI A;  1B2M A;  1LRA A;  1RGK A;  2KF5 A;  1BU4 A;  1GMR A;  1BRG A;  2F5M A;  1GOU A;  1RGE A;  4J5K A;  1RN4 A;  1R4Y A;  3Q3F A;  1B2U A;  6GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...