1RDSA

Crystal structure of ribonuclease ms (as ribonuclease t1 homologue) complexed with a guanylyl-3',5'-cytidine analogue
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
b'ESCEYTCGSTCYWSSDVSAAKAKGYSLYESGDTIDDYPHEYHDYEGFDFPVSGTYYEYPIMSDYDVYTGGSPGADRVIFNGDDELAGVITHTGASGDDFVACSSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE MS
publication title Crystal structure of ribonuclease Ms (as a ribonuclease T1 homologue) complexed with a guanylyl-3',5'-cytidine analogue.
pubmed doi rcsb
source organism Aspergillus phoenicis
molecule tags Hydrolase(endoribonuclease)
total genus 29
structure length 105
sequence length 105
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rdsA00
1JBRA 1BSAA 5RNTA 1B3SA 1RGKA 5BIRA 1BGSA 1BU4A 2KF6A 3D5IA 1B20A 1YNVX 4GHOA 1YGWA 1B2MA 1HZ1A 1BRNL 3AHSA 1AY7A 1BVIA 1PY3A 3SYUA 1G02A 1RTUA 1BNSA 1I2EA 4J5KA 2ZA4A 1ZGXA 2BU4A 1BNRA 1RGGA 5HOHA 1MGWA 1B2ZA 1I2FA 1BRHA 1GOUA 1I0VA 1RCKA 7RNTA 1JBSA 1R4YA 1B2SA 8RNTA 1BSCA 1RN1A 2AADA 1BRGA 1RN4A 3URPA 2AAEA 2GSPA 5BU4A 1SARA 1FZUA 1RSNA 3HOHA 1BNIA 3DH2A 1BNEA 1UCJA 3KCHA 1B2XA 1I70A 1GMRA 4RNTA 1RNBA 1RHLA 1BNJA 1RGFA 3D4AA 1HYFA 1X1UA 2F4YA 7GSPA 1TRQA 4BU4A 1X1WA 3AHWA 2C4BA 3A5EA 1BUJA 1BSDA 1RGCA 1YVSA 1RGHA 1BNGA 2KF3A 2RBIA 1RDSA 1I0XA 1CH0A 1BRIA 1JBTA 1B21A 1DE3A 1FYSA 1PYLA 1RGAA 1B2UA 1X1YA 3BU4A 3BIRA 4GSPA 1BAOA 1LNIA 3Q3FA 4HOHA 1BOXA 1MGRA 2KF5A 5GSPA 3RNTA 3D5GA 3DGYA 3AGOA 1RMSA 4J5GA 1IYYA 1BRJA 2F5MA 1LOVA 1I3FA 1I8VA 1TRPA 1RNTA 9RNTA 1RGLA 1GSPA 4HAAA 2KF4A 3WR2A 1LRAA 6RNTA 3WHOA 1I2GA 1Q9EA 1AQZA 1BRKA 2BIRA 6GSPA 1I3IA 1FUTA 2KAAA 1BRSA 1C54A 1FW7A 1GMQA 2F5WA 4BIRA 1X1XA 1RLSA 2RNTA 1UCLA 1FUSA 1GOVA 2F56A 1LOYA 1A2PA 1T2HA 2HOHA 1UCIA 3AGNA 3GSPA 1RGEA 1BSEA 1TTOA 1LOWA 1UCKA 1GOYA 1B27A 1BIRA 1BANA 1GMPA 1BSBA 1RCLA 2SARA 1DETA 1BNFA 1T2IA
chains in the Genus database with same CATH superfamily
2BMQB 1JBRA 4K1VA 2GBWB 3PCSA 1OCVA 2WOFA 1O7WB 1WQLB 3CCJ3 2KF6A 4ILFA 1YNVX 4RNZA 2KCDA 1B2MA 1HZ1A 3PS8A 2RCDA 5G2GA 2CH9A 1N8R4 3EBTA 3EX9A 1J2BA 1W6YA 2Y74A 1L5GB 1DVCA 3IMAB 1RJOA 1IV7A 3UL6A 4CJNA 3OW22 1V58A 1OGXA 1ZGXA 3GZBA 3DXOA 1A2VA 3OX9A 1RN7A 1MGWA 2ZDJA 1W01A 1GD4A 3NV0B 1IVWA 3MHEA 3CNMA 1A90A 1JBSA 3DGNA 5AI1A 5HGRA 3VSYA 8RNTA 5A0OB 3GZRA 3L0RA 2MC8A 1BRGA 1RN4A 3NQZA 5DREA 1JKGA 3AMOA 3X3XA 5BU4A 2CHCA 3JUOA 2MF7A 3MG3A 3CCS3 3PZWA 4IT7A 1KSIA 1BNIA 2CG0A 4RZMA 4AKZA 3NV0A 1B2XA 1I70A 1MWTA 2XH9A 3SLUA 3FF0A 1ROAA 3UL5A 2WOHA 1DMQA 2IMJA 1ZO2A 1NWWA 1TRQA 1YHQ3 2WO0A 1X1WA 2OWPA 3IPTA 2C4BA 1O7PB 3A5EA 1BUJA 2W9PA 2D1WA 4N6V0 1BNGA 2XFTA 1OUNA 2XFSA 1M904 2A15A 2JQ5A 1KQS2 3BLZA 3CD63 1K28A 2BNGA 1B21A 1ULIB 1WMOA 4O02B 1FYSA 3DZLA 1KWIA 2H0HA 1X1YA 3CCV3 3X40A 1BAOA 1F8NA 1O7NB 3EBYA 5CF2A 3V99A 1PFPA 5LC7A 1ULJB 4BTYA 2BMRB 2RGQA 2K0MA 3Q90A 2GEYA 3AGOA 3G8ZA 3JVCA 4FCMA 4XM4A 3PCRA 2B24B 2C11A 2IY2A 1BUQA 1DVDA 2R41A 1OH0A 3S29A 1I3FA 1AR0A 1STDA 2Z77A 4N6UA 1VQK3 4KFEA 2HMLB 2PZVA 1EKMA 5IG0A 3SX1A 4R1KA 3DGOA 4HAAA 1Q814 3VF1A 1ZX2A 5G1LA 3K7CA 6STDA 3HZPA 3WR2A 3WHOA 1C7HA 2WGQA 4MMXB 3UJMA 1Q9EA 2CWUA 5G1KA 1AQZA 1YI23 2BIRA 3N9HA 3LT9A 1NU3A 4KZ1A 2PNCA 5AIFA 2KAAA 5D81A 4J9AA 1M1XB 1GMQA 3X3YA 4BIRA 2XF3A 1X1XA 1D6ZA 2W03A 3F9SA 1GY5A 1OF5B 3B7CA 2HOHA 5AYSC 2OQEA 1U5OA 2CW9A 1VQO3 5EEOA 3CC43 1TTOA 2ML6A 4XBTA 4MMZB 3BNCA 3LH4A 3LXUX 1GOYA 4STDA 4HBRA 1Y4KA 4GB5A 1K8A4 3A76A 2Z7AA 3GZYB 1U8CB 1MWUA 4HM4B 4XBXA 1FGOA 3GRDA 3LT8A 4G1MB 5CXOA 2O9UX 3CCU3 2CIUA 1BNFA 2IUKA 4ZM8A 4LGQA 3FLJA 1SQWA 1B3SA 5IERA 1BU4A 1EUIC 1WTHA 4HVNA 4N6MA 1W00A 1UI8A 5IENA 1OHPA 1W2B2 1UUGB 4R9KA 1UI7A 3STDA 1STFI 1WNHA 1N9EA 3CU3A 2HMJB 3EC9A 4X2HA 4RNYA 5D82A 3UB1A 1I2EA 2R4IA 3BNBA 2XEPA 3PGBA 2BU4A 1BNRA 3HK4A 4WP5A 3MKIA 5HOHA 4HZ9B 1WMPA 3K0ZA 1W6GA 4HM3B 1BRHA 1I0VA 1W5ZA 3RGAA 1N8QA 1B2SA 3HI7A 5JBSA 1RN1A 2P0MA 2H0IA 1JNQA 3NM2A 2CFWA 2AAEA 2GSPA 3URPA 3RDEA 1US1A 2Z76A 4U13A 1Q864 4WHAA 1NB5I 1FGMA 1LQGC 1R4CA 5IEOA 4J8TA 2J8XB 4CCVA 2LYXA 2E2UA 2CG1A 2L4VA 4GL6A 3ZG5A 1BNEA 2BHMA 2OQEC 4FCZA 3QK9A 4RNTA 1RNBA 1TFKA 2WGOA 1IU7A 1RHLA 1LQMB 5IG4A 2P0XA 1YVBI 2F4YA 3KKGA 1JKGB 3AMOB 3JUPA 2QEX3 1IVXA 3AHWA 2W9QA 1UUWB 1IVUA 3S28A 1BSDA 5CK6A 4HKVB 4BL3A 2YFLB 1RGCA 1CEWI 2KF3A 3EHCA 4HM6B 1CH0A 1IQ8A 3F40A 5IEPA 3F14A 3WOEB 3GAXA 3O8YA 3CXC2 3NBRA 1CYVA 5JPPA 1DE3A 3JUNA 1PYLA 3LTAA 3CPW2 1SIIA 2P38A 1IDPA 1RGAA 5IG3A 3BIRA 3D9RA 3EE1A 3Q2PA 4ORLA 2K54A 3KZTA 4WWUC 1W7CA 4CDLA 2KRTA 1BOXA 1MGRA 3B4PA 3MYTA 3WDGB 1AVKA 4LZIA 3RNTA 3LTCA 3D5GA 3OWYA 4JF8A 5D83A 3WODG 1BRJA 3B8LA 2F5MA 1I8VA 3VGNA 1OPYA 2F98A 1QMAA 1D6YA 1RGLA 1GSPA 3IJEB 4HM1B 1O7MB 4K1UA 4FMDA 5ELUA 4HZBB 1KD14 1Q7HA 4R80A 3KFQC 1UGIA 2CK3H 3NHXA 4BTXA 1W6CA 3S67A 1G0TA 1LRAA 2C10A 5EQLA 3S27A 1I2GA 2ZHXB 4JRFA 1WMNA 3FCSB 1FUTA 2BMOB 1BRSA 2K3DA 3FKAA 1C54A 1FW7A 2F5WA 4L7KA 2UUGC 2W04A 3OXAA 4KT3B 5AEWB 1EA2A 2Z6BA 2F56A 2Y73A 3I0YA 2CFDA 2INXA 4HM2B 5KP3A 2V1LA 3K9MC 3CCM3 3AGNA 1VQ63 1RRHA 1RGEA 1BSEA 2F99A 4NPBA 1IK3A 1EEJA 5BXQA 5ELJA 3X41A 4OK0A 3T8UA 3D79A 1FGQA 4MMYB 1VQ93 1LXEA 4L8OA 1LOXA 1K734 1BIRA 3EN8A 1BANA 3HIIA 1GMPA 3K5TA 4NHFA 1DETA 1D6UA 4I4KA 5JPUA 4KFFA 5RNTA 4HM5B 1YIJ3 1OHOA 5AIIA 5IF6A 5BIRA 2OOVC 3CCR3 2HMMB 3KIIA 4DKIA 4GHOA 1NDOB 4AEQA 3BNEA 4HM8B 1BRNL 1ZS7A 3ECFA 3AHSA 3DMCA 3U97A 3CMA3 3LZAA 1G02A 3SYUA 1JB2A 1RTUA 3SXXA 3CCE3 3RGRA 1MNLA 1MWRA 3EN1B 3LOYA 1JJ22 1QVF2 1NNVA 4J5KA 2ML5A 1EG9B 2ZA4A 4L8PA 1JV2B 1RGGA 1B2ZA 1I2FA 1RRLA 1VQ73 3X3ZA 5KP4A 1RCKA 1G96A 7RNTA 3G0KA 1R4YA 1RKYA 1UGHI 1BSCA 2IUJA 1T3BA 2H0GA 3KSED 3LYGA 2QIYA 3B4OA 3CNXA 1FGTA 2M7OA 4N6NB 1VQ83 1RSNA 1FGRA 2GEXA 3NQYA 3HOHA 4QWTA 1E3RA 3OV4A 3DH2A 4RBNA 3F7XA 1UCJA 4MEIA 2YX9A 4H3UA 5CLKA 4EYCA 3ER7A 1YJ93 5KP1A 3PYJA 1FUWA 4HM0B 3SOYA 5M19A 4K90B 1BNJA 1RGFA 5EVHA 3K63A 1W02A 5FW5A 7GSPA 2GU3A 4N6LA 2STDA 1DYUA 1SIHA 1TJDA 1YVSA 1TUHA 1A67A 3NUVA 1N9JA 2OCTA 2RBIA 5M1AA 1JRQA 2XGNA 5AEUB 2OTJ3 2CKFB 1VZZA 3SEDA 3LMLA 2D42A 3N8BA 3G6E3 1S723 1JBTA 1S5AA 4LMIA 3FZWA 1IVVA 1HU9A 4FCJA 2RFRA 4XDWA 2W2CA 1JZDA 3BU4A 4GSPA 5FGOA 1LNIA 1NB3I 1W4NA 4HOHA 1JN5B 2KF5A 3S5CA 4BTWA 1IT8A 4IIAA 1K41A 1GD3A 1OHSA 4IPBA 1O7HB 3DY5A 1QJGA 3DGYA 1CQSA 2XRXB 1RMSA 3G16A 4J5GA 1MOLA 4LEHA 4CPKA 1IYYA 2CC3A 3N54B 2IA7A 1JB4A 2LQVA 3BB9A 1LOVA 3NBJA 3X42A 5M18A 1Q7Y4 4H61A 1T5YA 3LTBA 3MG2A 4Q53A 3TDGA 7STDA 2P09A 3OWUA 5BVBA 3MWZA 3CME3 1JN5A 2RSXA 4NREA 2B1XB 3KSPA 3GWRA 3T0UA 4EV2A 1OGZA 2XR8B 1TFOA 2FGTA 5STDA 1MWSA 2O3OA 2CWTA 3HX8A 1GS3A 6GSPA 3CC73 1K9M4 1TU5A 2FXTA 1JZOA 2XGLA 4XB5A 3FG4A 4N3VA 3DGLA 1Q40B 2HMOB 2RNTA 1CYUA 3G4S3 1IQYA 1FUSA 1UUVB 2OOVA 1T2HA 2GU1A 1UDII 4FMCA 1NJI4 1FA3A 3FSDA 1UCIA 3GSPA 3CPOA 4BL2A 5AYRB 1IV9A 4EXRA 1Z1SA 5IW9A 4HJLB 3Q1CA 3SVAA 3DM8A 1LVNA 3EB8A 2XSHB 3EJVA 1Q40A 2CX1A 3T8NA 3WOFB 1E97A 3WA3A 2SARA 4X2OA 1SARA 5LC6A 1T2IA 4EW5A 4KVHA 1NO3A 1BSAA 1V57A 1RGKA 2BT3A 3UNLA 1BGSA 1M9GA 1ROVA 2YFIB 3D5IA 1B20A 3ALAA 4PEJA 1YGWA 3FG3A 2CFKA 2BO9B 3F8HA 1HKXA 3NM7A 1AY7A 1BVIA 1PY3A 3GZXB 4MJDA 5TGNA 1ISKA 2QGUA 1BNSA 4K61A 4LSOA 1VQ43 3H51A 1EQKA 1UW1A 3H3HA 1W2ZA 1TP6A 1GOUA 3ROBA 3I553 4I5QA 4FMAA 3NX0A 4EC6A 1GYBA 2AADA 1SJWA 3CC23 3M8CA 3NBBA 3FF2A 1GY6A 1VQQA 3PXMA 1FZUA 2GBXB 3FH1A 1YIT3 1AV4A 3QRDA 1E3VA 3OWSA 4R4KA 3KCHA 1GMRA 4FMBA 3WA2X 3ZFZA 2CFLA 3FG1A 2W56B 2F86B 3KE7A 4O8SA 3WMDA 1AVLA 1N5HA 1HYFA 1QAFA 1IT7A 1X1UA 3D4AA 4KFDA 2HMKB 3MPHA 4BU4A 1DMMA 5AIGA 1V74A 4WFOA 2UGIA 2FNQA 3E99A 1RGHA 2JDIH 2L1SA 2GXFA 4N6OB 3CCL3 1RDSA 1I0XA 1SPUA 2P05A 2I9WA 4EV5A 3JUQA 5CF1A 2KXGA 3D3LA 3FGYA 5IG5A 1QVG2 4FR9A 4R9LA 2W56A 1BRIA 1O7GB 8CHOA 1LNHA 1VQM3 2CWVA 2E2TA 1B2UA 3Q3FA 5DRVA 3NXJA 2OTL3 2W0QA 5GSPA 1VQP3 2IYJA 4XDVA 2CFGA 2W6JH 3KN4A 3DGMA 4AKYA 2QA43 3HIGA 2UX0A 1GY7A 4OUQA 1A2KA 1JB5A 1TRPA 3BNDA 1RNTA 3SOAA 3U1WA 9RNTA 1VQL3 4TX4A 1VQN3 1YGEA 3V98A 1QAKA 3V92A 1OACA 1YJW3 1OF5A 1N5PA 2XSOB 3MSOA 1Q42A 2KF4A 4WYKB 1VQ53 4LYLB 1PU4A 6RNTA 1Q824 1M1K4 3JUMA 1DMNA 1QALA 1BRKA 4O3VA 2SBLA 1YJN3 1I3IA 4N6TA 3LTDA 3J7Yd 1IQXA 2ZL8A 3EQQB 1RLSA 1UCLA 2E2VA 1GOVA 2Q07A 5I97A 1LOYA 1A2PA 4XBYA 3MG1A 4HM7B 4O2HA 4WYKA 3ZG0A 4EBGA 1LOWA 1UCKA 2CX0A 3I563 3G713 2YFJB 4HYZA 3CCQ3 1B27A 1ASKA 3F7SA 3EF8A 4OVMA 2HMNB 1KC84 1TIJA 3DUKA 1RCLA 1BSBA 3F8XA 5AIHA
chains in the Genus database with same CATH topology
1JBRA 1BSAA 5RNTA 1B3SA 1RGKA 5BIRA 1BGSA 1BU4A 2KF6A 3D5IA 1B20A 1YNVX 4GHOA 1YGWA 1B2MA 1HZ1A 1BRNL 3AHSA 1AY7A 1BVIA 1PY3A 3SYUA 1G02A 1RTUA 1BNSA 1I2EA 4J5KA 2ZA4A 1ZGXA 2BU4A 1BNRA 1RGGA 5HOHA 1MGWA 1B2ZA 1I2FA 1BRHA 1GOUA 1I0VA 1RCKA 7RNTA 1JBSA 1R4YA 1B2SA 8RNTA 1BSCA 1RN1A 2AADA 1BRGA 1RN4A 3URPA 2AAEA 2GSPA 5BU4A 1SARA 1FZUA 1RSNA 3HOHA 1BNIA 3DH2A 1BNEA 1UCJA 3KCHA 1B2XA 1I70A 1GMRA 4RNTA 1RNBA 1RHLA 1BNJA 1RGFA 3D4AA 1HYFA 1X1UA 2F4YA 7GSPA 1TRQA 4BU4A 1X1WA 3AHWA 2C4BA 3A5EA 1BUJA 1BSDA 1RGCA 1YVSA 1RGHA 1BNGA 2KF3A 2RBIA 1RDSA 1I0XA 1CH0A 1BRIA 1JBTA 1B21A 1DE3A 1FYSA 1PYLA 1RGAA 1B2UA 1X1YA 3BU4A 3BIRA 4GSPA 1BAOA 1LNIA 3Q3FA 4HOHA 1BOXA 1MGRA 2KF5A 5GSPA 3RNTA 3D5GA 3DGYA 3AGOA 1RMSA 4J5GA 1IYYA 1BRJA 2F5MA 1LOVA 1I3FA 1I8VA 1TRPA 1RNTA 9RNTA 1RGLA 1GSPA 4HAAA 2KF4A 3WR2A 1LRAA 6RNTA 3WHOA 1I2GA 1Q9EA 1AQZA 1BRKA 2BIRA 6GSPA 1I3IA 1FUTA 2KAAA 1BRSA 1C54A 1FW7A 1GMQA 2F5WA 4BIRA 1X1XA 1RLSA 2RNTA 1UCLA 1FUSA 1GOVA 2F56A 1LOYA 1A2PA 1T2HA 2HOHA 1UCIA 3AGNA 3GSPA 1RGEA 1BSEA 1TTOA 1LOWA 1UCKA 1GOYA 1B27A 1BIRA 1BANA 1GMPA 1BSBA 1RCLA 2SARA 1DETA 1BNFA 1T2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBR A;  1BSA A;  5RNT A;  1B3S A;  1RGK A;  5BIR A;  1BGS A;  1BU4 A;  2KF6 A;  3D5I A;  1B20 A;  1YNV X;  4GHO A;  1YGW A;  1B2M A;  1HZ1 A;  1BRN L;  3AHS A;  1AY7 A;  1BVI A;  1PY3 A;  3SYU A;  1G02 A;  1RTU A;  1BNS A;  1I2E A;  4J5K A;  2ZA4 A;  1ZGX A;  2BU4 A;  1BNR A;  1RGG A;  5HOH A;  1MGW A;  1B2Z A;  1I2F A;  1BRH A;  1GOU A;  1I0V A;  1RCK A;  7RNT A;  1JBS A;  1R4Y A;  1B2S A;  8RNT A;  1BSC A;  1RN1 A;  2AAD A;  1BRG A;  1RN4 A;  3URP A;  2AAE A;  2GSP A;  5BU4 A;  1SAR A;  1FZU A;  1RSN A;  3HOH A;  1BNI A;  3DH2 A;  1BNE A;  1UCJ A;  3KCH A;  1B2X A;  1I70 A;  1GMR A;  4RNT A;  1RNB A;  1RHL A;  1BNJ A;  1RGF A;  3D4A A;  1HYF A;  1X1U A;  2F4Y A;  7GSP A;  1TRQ A;  4BU4 A;  1X1W A;  3AHW A;  2C4B A;  3A5E A;  1BUJ A;  1BSD A;  1RGC A;  1YVS A;  1RGH A;  1BNG A;  2KF3 A;  2RBI A;  1RDS A;  1I0X A;  1CH0 A;  1BRI A;  1JBT A;  1B21 A;  1DE3 A;  1FYS A;  1PYL A;  1RGA A;  1B2U A;  1X1Y A;  3BU4 A;  3BIR A;  4GSP A;  1BAO A;  1LNI A;  3Q3F A;  4HOH A;  1BOX A;  1MGR A;  2KF5 A;  5GSP A;  3RNT A;  3D5G A;  3DGY A;  3AGO A;  1RMS A;  4J5G A;  1IYY A;  1BRJ A;  2F5M A;  1LOV A;  1I3F A;  1I8V A;  1TRP A;  1RNT A;  9RNT A;  1RGL A;  1GSP A;  4HAA A;  2KF4 A;  3WR2 A;  1LRA A;  6RNT A;  3WHO A;  1I2G A;  1Q9E A;  1AQZ A;  1BRK A;  2BIR A;  6GSP A;  1I3I A;  1FUT A;  2KAA A;  1BRS A;  1C54 A;  1FW7 A;  1GMQ A;  2F5W A;  4BIR A;  1X1X A;  1RLS A;  2RNT A;  1UCL A;  1FUS A;  1GOV A;  2F56 A;  1LOY A;  1A2P A;  1T2H A;  2HOH A;  1UCI A;  3AGN A;  3GSP A;  1RGE A;  1BSE A;  1TTO A;  1LOW A;  1UCK A;  1GOY A;  1B27 A;  1BIR A;  1BAN A;  1GMP A;  1BSB A;  1RCL A;  2SAR A;  1DET A;  1BNF A;  1T2I A; 
#chains in the Genus database with same CATH topology
 2BMQ B;  1JBR A;  4K1V A;  2GBW B;  3PCS A;  1OCV A;  2WOF A;  1O7W B;  1WQL B;  3CCJ 3;  2KF6 A;  4ILF A;  1YNV X;  4RNZ A;  2KCD A;  1B2M A;  1HZ1 A;  3PS8 A;  2RCD A;  5G2G A;  2CH9 A;  1N8R 4;  3EBT A;  3EX9 A;  1J2B A;  1W6Y A;  2Y74 A;  1L5G B;  1DVC A;  3IMA B;  1RJO A;  1IV7 A;  3UL6 A;  4CJN A;  3OW2 2;  1V58 A;  1OGX A;  1ZGX A;  3GZB A;  3DXO A;  1A2V A;  3OX9 A;  1RN7 A;  1MGW A;  2ZDJ A;  1W01 A;  1GD4 A;  3NV0 B;  1IVW A;  3MHE A;  3CNM A;  1A90 A;  1JBS A;  3DGN A;  5AI1 A;  5HGR A;  3VSY A;  8RNT A;  5A0O B;  3GZR A;  3L0R A;  2MC8 A;  1BRG A;  1RN4 A;  3NQZ A;  5DRE A;  1JKG A;  3AMO A;  3X3X A;  5BU4 A;  2CHC A;  3JUO A;  2MF7 A;  3MG3 A;  3CCS 3;  3PZW A;  4IT7 A;  1KSI A;  1BNI A;  2CG0 A;  4RZM A;  4AKZ A;  3NV0 A;  1B2X A;  1I70 A;  1MWT A;  2XH9 A;  3SLU A;  3FF0 A;  1ROA A;  3UL5 A;  2WOH A;  1DMQ A;  2IMJ A;  1ZO2 A;  1NWW A;  1TRQ A;  1YHQ 3;  2WO0 A;  1X1W A;  2OWP A;  3IPT A;  2C4B A;  1O7P B;  3A5E A;  1BUJ A;  2W9P A;  2D1W A;  4N6V 0;  1BNG A;  2XFT A;  1OUN A;  2XFS A;  1M90 4;  2A15 A;  2JQ5 A;  1KQS 2;  3BLZ A;  3CD6 3;  1K28 A;  2BNG A;  1B21 A;  1ULI B;  1WMO A;  4O02 B;  1FYS A;  3DZL A;  1KWI A;  2H0H A;  1X1Y A;  3CCV 3;  3X40 A;  1BAO A;  1F8N A;  1O7N B;  3EBY A;  5CF2 A;  3V99 A;  1PFP A;  5LC7 A;  1ULJ B;  4BTY A;  2BMR B;  2RGQ A;  2K0M A;  3Q90 A;  2GEY A;  3AGO A;  3G8Z A;  3JVC A;  4FCM A;  4XM4 A;  3PCR A;  2B24 B;  2C11 A;  2IY2 A;  1BUQ A;  1DVD A;  2R41 A;  1OH0 A;  3S29 A;  1I3F A;  1AR0 A;  1STD A;  2Z77 A;  4N6U A;  1VQK 3;  4KFE A;  2HML B;  2PZV A;  1EKM A;  5IG0 A;  3SX1 A;  4R1K A;  3DGO A;  4HAA A;  1Q81 4;  3VF1 A;  1ZX2 A;  5G1L A;  3K7C A;  6STD A;  3HZP A;  3WR2 A;  3WHO A;  1C7H A;  2WGQ A;  4MMX B;  3UJM A;  1Q9E A;  2CWU A;  5G1K A;  1AQZ A;  1YI2 3;  2BIR A;  3N9H A;  3LT9 A;  1NU3 A;  4KZ1 A;  2PNC A;  5AIF A;  2KAA A;  5D81 A;  4J9A A;  1M1X B;  1GMQ A;  3X3Y A;  4BIR A;  2XF3 A;  1X1X A;  1D6Z A;  2W03 A;  3F9S A;  1GY5 A;  1OF5 B;  3B7C A;  2HOH A;  5AYS C;  2OQE A;  1U5O A;  2CW9 A;  1VQO 3;  5EEO A;  3CC4 3;  1TTO A;  2ML6 A;  4XBT A;  4MMZ B;  3BNC A;  3LH4 A;  3LXU X;  1GOY A;  4STD A;  4HBR A;  1Y4K A;  4GB5 A;  1K8A 4;  3A76 A;  2Z7A A;  3GZY B;  1U8C B;  1MWU A;  4HM4 B;  4XBX A;  1FGO A;  3GRD A;  3LT8 A;  4G1M B;  5CXO A;  2O9U X;  3CCU 3;  2CIU A;  1BNF A;  2IUK A;  4ZM8 A;  4LGQ A;  3FLJ A;  1SQW A;  1B3S A;  5IER A;  1BU4 A;  1EUI C;  1WTH A;  4HVN A;  4N6M A;  1W00 A;  1UI8 A;  5IEN A;  1OHP A;  1W2B 2;  1UUG B;  4R9K A;  1UI7 A;  3STD A;  1STF I;  1WNH A;  1N9E A;  3CU3 A;  2HMJ B;  3EC9 A;  4X2H A;  4RNY A;  5D82 A;  3UB1 A;  1I2E A;  2R4I A;  3BNB A;  2XEP A;  3PGB A;  2BU4 A;  1BNR A;  3HK4 A;  4WP5 A;  3MKI A;  5HOH A;  4HZ9 B;  1WMP A;  3K0Z A;  1W6G A;  4HM3 B;  1BRH A;  1I0V A;  1W5Z A;  3RGA A;  1N8Q A;  1B2S A;  3HI7 A;  5JBS A;  1RN1 A;  2P0M A;  2H0I A;  1JNQ A;  3NM2 A;  2CFW A;  2AAE A;  2GSP A;  3URP A;  3RDE A;  1US1 A;  2Z76 A;  4U13 A;  1Q86 4;  4WHA A;  1NB5 I;  1FGM A;  1LQG C;  1R4C A;  5IEO A;  4J8T A;  2J8X B;  4CCV A;  2LYX A;  2E2U A;  2CG1 A;  2L4V A;  4GL6 A;  3ZG5 A;  1BNE A;  2BHM A;  2OQE C;  4FCZ A;  3QK9 A;  4RNT A;  1RNB A;  1TFK A;  2WGO A;  1IU7 A;  1RHL A;  1LQM B;  5IG4 A;  2P0X A;  1YVB I;  2F4Y A;  3KKG A;  1JKG B;  3AMO B;  3JUP A;  2QEX 3;  1IVX A;  3AHW A;  2W9Q A;  1UUW B;  1IVU A;  3S28 A;  1BSD A;  5CK6 A;  4HKV B;  4BL3 A;  2YFL B;  1RGC A;  1CEW I;  2KF3 A;  3EHC A;  4HM6 B;  1CH0 A;  1IQ8 A;  3F40 A;  5IEP A;  3F14 A;  3WOE B;  3GAX A;  3O8Y A;  3CXC 2;  3NBR A;  1CYV A;  5JPP A;  1DE3 A;  3JUN A;  1PYL A;  3LTA A;  3CPW 2;  1SII A;  2P38 A;  1IDP A;  1RGA A;  5IG3 A;  3BIR A;  3D9R A;  3EE1 A;  3Q2P A;  4ORL A;  2K54 A;  3KZT A;  4WWU C;  1W7C A;  4CDL A;  2KRT A;  1BOX A;  1MGR A;  3B4P A;  3MYT A;  3WDG B;  1AVK A;  4LZI A;  3RNT A;  3LTC A;  3D5G A;  3OWY A;  4JF8 A;  5D83 A;  3WOD G;  1BRJ A;  3B8L A;  2F5M A;  1I8V A;  3VGN A;  1OPY A;  2F98 A;  1QMA A;  1D6Y A;  1RGL A;  1GSP A;  3IJE B;  4HM1 B;  1O7M B;  4K1U A;  4FMD A;  5ELU A;  4HZB B;  1KD1 4;  1Q7H A;  4R80 A;  3KFQ C;  1UGI A;  2CK3 H;  3NHX A;  4BTX A;  1W6C A;  3S67 A;  1G0T A;  1LRA A;  2C10 A;  5EQL A;  3S27 A;  1I2G A;  2ZHX B;  4JRF A;  1WMN A;  3FCS B;  1FUT A;  2BMO B;  1BRS A;  2K3D A;  3FKA A;  1C54 A;  1FW7 A;  2F5W A;  4L7K A;  2UUG C;  2W04 A;  3OXA A;  4KT3 B;  5AEW B;  1EA2 A;  2Z6B A;  2F56 A;  2Y73 A;  3I0Y A;  2CFD A;  2INX A;  4HM2 B;  5KP3 A;  2V1L A;  3K9M C;  3CCM 3;  3AGN A;  1VQ6 3;  1RRH A;  1RGE A;  1BSE A;  2F99 A;  4NPB A;  1IK3 A;  1EEJ A;  5BXQ A;  5ELJ A;  3X41 A;  4OK0 A;  3T8U A;  3D79 A;  1FGQ A;  4MMY B;  1VQ9 3;  1LXE A;  4L8O A;  1LOX A;  1K73 4;  1BIR A;  3EN8 A;  1BAN A;  3HII A;  1GMP A;  3K5T A;  4NHF A;  1DET A;  1D6U A;  4I4K A;  5JPU A;  4KFF A;  5RNT A;  4HM5 B;  1YIJ 3;  1OHO A;  5AII A;  5IF6 A;  5BIR A;  2OOV C;  3CCR 3;  2HMM B;  3KII A;  4DKI A;  4GHO A;  1NDO B;  4AEQ A;  3BNE A;  4HM8 B;  1BRN L;  1ZS7 A;  3ECF A;  3AHS A;  3DMC A;  3U97 A;  3CMA 3;  3LZA A;  1G02 A;  3SYU A;  1JB2 A;  1RTU A;  3SXX A;  3CCE 3;  3RGR A;  1MNL A;  1MWR A;  3EN1 B;  3LOY A;  1JJ2 2;  1QVF 2;  1NNV A;  4J5K A;  2ML5 A;  1EG9 B;  2ZA4 A;  4L8P A;  1JV2 B;  1RGG A;  1B2Z A;  1I2F A;  1RRL A;  1VQ7 3;  3X3Z A;  5KP4 A;  1RCK A;  1G96 A;  7RNT A;  3G0K A;  1R4Y A;  1RKY A;  1UGH I;  1BSC A;  2IUJ A;  1T3B A;  2H0G A;  3KSE D;  3LYG A;  2QIY A;  3B4O A;  3CNX A;  1FGT A;  2M7O A;  4N6N B;  1VQ8 3;  1RSN A;  1FGR A;  2GEX A;  3NQY A;  3HOH A;  4QWT A;  1E3R A;  3OV4 A;  3DH2 A;  4RBN A;  3F7X A;  1UCJ A;  4MEI A;  2YX9 A;  4H3U A;  5CLK A;  4EYC A;  3ER7 A;  1YJ9 3;  5KP1 A;  3PYJ A;  1FUW A;  4HM0 B;  3SOY A;  5M19 A;  4K90 B;  1BNJ A;  1RGF A;  5EVH A;  3K63 A;  1W02 A;  5FW5 A;  7GSP A;  2GU3 A;  4N6L A;  2STD A;  1DYU A;  1SIH A;  1TJD A;  1YVS A;  1TUH A;  1A67 A;  3NUV A;  1N9J A;  2OCT A;  2RBI A;  5M1A A;  1JRQ A;  2XGN A;  5AEU B;  2OTJ 3;  2CKF B;  1VZZ A;  3SED A;  3LML A;  2D42 A;  3N8B A;  3G6E 3;  1S72 3;  1JBT A;  1S5A A;  4LMI A;  3FZW A;  1IVV A;  1HU9 A;  4FCJ A;  2RFR A;  4XDW A;  2W2C A;  1JZD A;  3BU4 A;  4GSP A;  5FGO A;  1LNI A;  1NB3 I;  1W4N A;  4HOH A;  1JN5 B;  2KF5 A;  3S5C A;  4BTW A;  1IT8 A;  4IIA A;  1K41 A;  1GD3 A;  1OHS A;  4IPB A;  1O7H B;  3DY5 A;  1QJG A;  3DGY A;  1CQS A;  2XRX B;  1RMS A;  3G16 A;  4J5G A;  1MOL A;  4LEH A;  4CPK A;  1IYY A;  2CC3 A;  3N54 B;  2IA7 A;  1JB4 A;  2LQV A;  3BB9 A;  1LOV A;  3NBJ A;  3X42 A;  5M18 A;  1Q7Y 4;  4H61 A;  1T5Y A;  3LTB A;  3MG2 A;  4Q53 A;  3TDG A;  7STD A;  2P09 A;  3OWU A;  5BVB A;  3MWZ A;  3CME 3;  1JN5 A;  2RSX A;  4NRE A;  2B1X B;  3KSP A;  3GWR A;  3T0U A;  4EV2 A;  1OGZ A;  2XR8 B;  1TFO A;  2FGT A;  5STD A;  1MWS A;  2O3O A;  2CWT A;  3HX8 A;  1GS3 A;  6GSP A;  3CC7 3;  1K9M 4;  1TU5 A;  2FXT A;  1JZO A;  2XGL A;  4XB5 A;  3FG4 A;  4N3V A;  3DGL A;  1Q40 B;  2HMO B;  2RNT A;  1CYU A;  3G4S 3;  1IQY A;  1FUS A;  1UUV B;  2OOV A;  1T2H A;  2GU1 A;  1UDI I;  4FMC A;  1NJI 4;  1FA3 A;  3FSD A;  1UCI A;  3GSP A;  3CPO A;  4BL2 A;  5AYR B;  1IV9 A;  4EXR A;  1Z1S A;  5IW9 A;  4HJL B;  3Q1C A;  3SVA A;  3DM8 A;  1LVN A;  3EB8 A;  2XSH B;  3EJV A;  1Q40 A;  2CX1 A;  3T8N A;  3WOF B;  1E97 A;  3WA3 A;  2SAR A;  4X2O A;  1SAR A;  5LC6 A;  1T2I A;  4EW5 A;  4KVH A;  1NO3 A;  1BSA A;  1V57 A;  1RGK A;  2BT3 A;  3UNL A;  1BGS A;  1M9G A;  1ROV A;  2YFI B;  3D5I A;  1B20 A;  3ALA A;  4PEJ A;  1YGW A;  3FG3 A;  2CFK A;  2BO9 B;  3F8H A;  1HKX A;  3NM7 A;  1AY7 A;  1BVI A;  1PY3 A;  3GZX B;  4MJD A;  5TGN A;  1ISK A;  2QGU A;  1BNS A;  4K61 A;  4LSO A;  1VQ4 3;  3H51 A;  1EQK A;  1UW1 A;  3H3H A;  1W2Z A;  1TP6 A;  1GOU A;  3ROB A;  3I55 3;  4I5Q A;  4FMA A;  3NX0 A;  4EC6 A;  1GYB A;  2AAD A;  1SJW A;  3CC2 3;  3M8C A;  3NBB A;  3FF2 A;  1GY6 A;  1VQQ A;  3PXM A;  1FZU A;  2GBX B;  3FH1 A;  1YIT 3;  1AV4 A;  3QRD A;  1E3V A;  3OWS A;  4R4K A;  3KCH A;  1GMR A;  4FMB A;  3WA2 X;  3ZFZ A;  2CFL A;  3FG1 A;  2W56 B;  2F86 B;  3KE7 A;  4O8S A;  3WMD A;  1AVL A;  1N5H A;  1HYF A;  1QAF A;  1IT7 A;  1X1U A;  3D4A A;  4KFD A;  2HMK B;  3MPH A;  4BU4 A;  1DMM A;  5AIG A;  1V74 A;  4WFO A;  2UGI A;  2FNQ A;  3E99 A;  1RGH A;  2JDI H;  2L1S A;  2GXF A;  4N6O B;  3CCL 3;  1RDS A;  1I0X A;  1SPU A;  2P05 A;  2I9W A;  4EV5 A;  3JUQ A;  5CF1 A;  2KXG A;  3D3L A;  3FGY A;  5IG5 A;  1QVG 2;  4FR9 A;  4R9L A;  2W56 A;  1BRI A;  1O7G B;  8CHO A;  1LNH A;  1VQM 3;  2CWV A;  2E2T A;  1B2U A;  3Q3F A;  5DRV A;  3NXJ A;  2OTL 3;  2W0Q A;  5GSP A;  1VQP 3;  2IYJ A;  4XDV A;  2CFG A;  2W6J H;  3KN4 A;  3DGM A;  4AKY A;  2QA4 3;  3HIG A;  2UX0 A;  1GY7 A;  4OUQ A;  1A2K A;  1JB5 A;  1TRP A;  3BND A;  1RNT A;  3SOA A;  3U1W A;  9RNT A;  1VQL 3;  4TX4 A;  1VQN 3;  1YGE A;  3V98 A;  1QAK A;  3V92 A;  1OAC A;  1YJW 3;  1OF5 A;  1N5P A;  2XSO B;  3MSO A;  1Q42 A;  2KF4 A;  4WYK B;  1VQ5 3;  4LYL B;  1PU4 A;  6RNT A;  1Q82 4;  1M1K 4;  3JUM A;  1DMN A;  1QAL A;  1BRK A;  4O3V A;  2SBL A;  1YJN 3;  1I3I A;  4N6T A;  3LTD A;  3J7Y d;  1IQX A;  2ZL8 A;  3EQQ B;  1RLS A;  1UCL A;  2E2V A;  1GOV A;  2Q07 A;  5I97 A;  1LOY A;  1A2P A;  4XBY A;  3MG1 A;  4HM7 B;  4O2H A;  4WYK A;  3ZG0 A;  4EBG A;  1LOW A;  1UCK A;  2CX0 A;  3I56 3;  3G71 3;  2YFJ B;  4HYZ A;  3CCQ 3;  1B27 A;  1ASK A;  3F7S A;  3EF8 A;  4OVM A;  2HMN B;  1KC8 4;  1TIJ A;  3DUK A;  1RCL A;  1BSB A;  3F8X A;  5AIH A; 
#chains in the Genus database with same CATH homology
 1JBR A;  1BSA A;  5RNT A;  1B3S A;  1RGK A;  5BIR A;  1BGS A;  1BU4 A;  2KF6 A;  3D5I A;  1B20 A;  1YNV X;  4GHO A;  1YGW A;  1B2M A;  1HZ1 A;  1BRN L;  3AHS A;  1AY7 A;  1BVI A;  1PY3 A;  3SYU A;  1G02 A;  1RTU A;  1BNS A;  1I2E A;  4J5K A;  2ZA4 A;  1ZGX A;  2BU4 A;  1BNR A;  1RGG A;  5HOH A;  1MGW A;  1B2Z A;  1I2F A;  1BRH A;  1GOU A;  1I0V A;  1RCK A;  7RNT A;  1JBS A;  1R4Y A;  1B2S A;  8RNT A;  1BSC A;  1RN1 A;  2AAD A;  1BRG A;  1RN4 A;  3URP A;  2AAE A;  2GSP A;  5BU4 A;  1SAR A;  1FZU A;  1RSN A;  3HOH A;  1BNI A;  3DH2 A;  1BNE A;  1UCJ A;  3KCH A;  1B2X A;  1I70 A;  1GMR A;  4RNT A;  1RNB A;  1RHL A;  1BNJ A;  1RGF A;  3D4A A;  1HYF A;  1X1U A;  2F4Y A;  7GSP A;  1TRQ A;  4BU4 A;  1X1W A;  3AHW A;  2C4B A;  3A5E A;  1BUJ A;  1BSD A;  1RGC A;  1YVS A;  1RGH A;  1BNG A;  2KF3 A;  2RBI A;  1RDS A;  1I0X A;  1CH0 A;  1BRI A;  1JBT A;  1B21 A;  1DE3 A;  1FYS A;  1PYL A;  1RGA A;  1B2U A;  1X1Y A;  3BU4 A;  3BIR A;  4GSP A;  1BAO A;  1LNI A;  3Q3F A;  4HOH A;  1BOX A;  1MGR A;  2KF5 A;  5GSP A;  3RNT A;  3D5G A;  3DGY A;  3AGO A;  1RMS A;  4J5G A;  1IYY A;  1BRJ A;  2F5M A;  1LOV A;  1I3F A;  1I8V A;  1TRP A;  1RNT A;  9RNT A;  1RGL A;  1GSP A;  4HAA A;  2KF4 A;  3WR2 A;  1LRA A;  6RNT A;  3WHO A;  1I2G A;  1Q9E A;  1AQZ A;  1BRK A;  2BIR A;  6GSP A;  1I3I A;  1FUT A;  2KAA A;  1BRS A;  1C54 A;  1FW7 A;  1GMQ A;  2F5W A;  4BIR A;  1X1X A;  1RLS A;  2RNT A;  1UCL A;  1FUS A;  1GOV A;  2F56 A;  1LOY A;  1A2P A;  1T2H A;  2HOH A;  1UCI A;  3AGN A;  3GSP A;  1RGE A;  1BSE A;  1TTO A;  1LOW A;  1UCK A;  1GOY A;  1B27 A;  1BIR A;  1BAN A;  1GMP A;  1BSB A;  1RCL A;  2SAR A;  1DET A;  1BNF A;  1T2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...