1RDSA

Crystal structure of ribonuclease ms (as ribonuclease t1 homologue) complexed with a guanylyl-3',5'-cytidine analogue
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
b'ESCEYTCGSTCYWSSDVSAAKAKGYSLYESGDTIDDYPHEYHDYEGFDFPVSGTYYEYPIMSDYDVYTGGSPGADRVIFNGDDELAGVITHTGASGDDFVACSSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE MS
molecule tags Hydrolase(endoribonuclease)
source organism Aspergillus phoenicis
publication title Crystal structure of ribonuclease Ms (as a ribonuclease T1 homologue) complexed with a guanylyl-3',5'-cytidine analogue.
pubmed doi rcsb
total genus 29
structure length 105
sequence length 105
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rdsA00
2BU4A 1I3FA 5HOHA 2HOHA 1JBSA 1TRPA 1FYSA 1BRJA 3A5EA 5RNTA 1BNIA 1RGKA 2KF5A 1JBTA 2RNTA 1UCLA 1BUJA 1B2XA 1MGWA 1RHLA 1GOUA 1B20A 2F56A 4BIRA 1RMSA 1HYFA 1RGAA 1TTOA 7RNTA 4RNTA 2RBIA 1AY7A 2KF3A 3AGOA 1GMPA 1RCLA 1R4YA 1I2EA 3WHOA 4GHOA 1BNFA 1B2MA 2KF6A 1I8VA 1RSNA 1YNVX 2C4BA 1LRAA 3D5GA 3KCHA 6RNTA 1A2PA 1I0XA 1BRHA 1GSPA 1HZ1A 3AGNA 1GOYA 2BIRA 1RCKA 1RGEA 2SARA 1BNGA 1BSCA 1ZGXA 6GSPA 1RNBA 1GMQA 1CH0A 1PY3A 1RDSA 3DH2A 1T2HA 1BSBA 1G02A 1AQZA 1BAOA 2F5WA 4J5KA 1GOVA 1FW7A 1BNRA 1DETA 1BSEA 1C54A 1FUTA 1RGHA 2F5MA 1X1UA 3D5IA 1BU4A 1GMRA 1RLSA 8RNTA 2AADA 1B2UA 1RGFA 1I2GA 3GSPA 1BRKA 3URPA 4GSPA 1BGSA 1LNIA 5GSPA 1BRGA 1SARA 2F4YA 1YVSA 1X1YA 1DE3A 7GSPA 3BU4A 1UCIA 1RN1A 1JBRA 3AHWA 3WR2A 1X1XA 1RGLA 3AHSA 3Q3FA 2KAAA 1Q9EA 3SYUA 1LOWA 4BU4A 1T2IA 1LOYA 2GSPA 1BNJA 5BIRA 1BVIA 1RGCA 1BRIA 1I2FA 3HOHA 3RNTA 1YGWA 1FZUA 1BNEA 1BRNL 1BNSA 9RNTA 2ZA4A 1IYYA 4J5GA 1BIRA 1PYLA 1FUSA 1RN4A 1RTUA 1UCJA 1I0VA 1MGRA 2AAEA 1B2SA 1LOVA 2KF4A 1TRQA 5BU4A 1RGGA 1UCKA 1BOXA 1RNTA 3D4AA 1BSAA 1B2ZA 1BSDA 4HOHA 1X1WA 1I70A 1BANA 1B3SA 1BRSA 4HAAA 3BIRA 1B21A 3DGYA 1B27A 1I3IA
chains in the Genus database with same CATH superfamily
5DRVA 2BU4A 3HK4A 3MWZA 1ULJB 1ASKA 3PCSA 3MG3A 1FYSA 1YJW3 1JRQA 1SIIA 1IV7A 3D79A 2P0XA 3G4S3 3MSOA 1JBTA 1LQGC 3DGMA 1TFKA 5FGOA 5M1AA 3JUQA 2D1WA 1BUJA 3DGOA 1N5PA 1RHLA 1VQ63 3WA2X 1D6UA 1E3RA 2Y74A 4X2HA 2QA43 3LOYA 1VQQA 2XH9A 1HYFA 2XR8B 2V1LA 2RBIA 3NV0A 3KZTA 1M1K4 1W2B2 2K54A 1RJOA 2YX9A 1K9M4 2QIYA 4EYCA 2MC8A 1B2MA 1I8VA 1RSNA 3KCHA 2C4BA 2XSOB 3D5GA 2K3DA 2WO0A 1J2BA 4BL2A 1JN5B 2INXA 1V57A 1STDA 2R4IA 1M9GA 3AGNA 3FG4A 1O7GB 1TJDA 1UUWB 1W01A 4N6V0 3NXJA 3FH1A 3PZWA 1BNGA 4LZIA 1VQ73 3FSDA 4HM4B 1RDSA 1SQWA 4NPBA 4QWTA 3SEDA 4PEJA 4EV5A 4MMYB 3VGNA 1QVG2 3X41A 1AQZA 3WA3A 1IV9A 2PNCA 1GOVA 1FW7A 3DM8A 1DETA 3DMCA 2P09A 2H0HA 1N8QA 1ZS7A 1CYUA 2O3OA 3KSED 1IT8A 1BU4A 2YFIB 1KWIA 1B2UA 2XRXB 3BB9A 2IA7A 1OHPA 5IF6A 2W6JH 1EQKA 2A15A 1I2GA 1O7HB 2CK3H 3FCSB 3GSPA 4IT7A 4TX4A 1G0TA 4N3VA 3S27A 3U1WA 1BGSA 1LNIA 3GZYB 3URPA 1QJGA 2CWTA 3CCR3 1YVSA 1W7CA 1X1YA 3IMAB 4LMIA 4RZMA 1QALA 2CX1A 1FGRA 4J9AA 2IMJA 1VQM3 3G6E3 4FMDA 1Q42A 2UUGC 4I4KA 1C7HA 4X2OA 1M1XB 1X1XA 1AV4A 4J8TA 3Q3FA 2CFWA 3S28A 3D9RA 4NREA 1UGHI 1U5OA 2W9QA 3SYUA 1UUVB 2L1SA 5D81A 2GSPA 2P05A 3NHXA 4HM8B 5BIRA 2UX0A 1RGCA 1WMPA 1GY7A 1WTHA 1I2FA 2YFJB 1IVWA 3RNTA 1VQP3 1PFPA 1YHQ3 3V99A 3OV4A 1O7PB 2LYXA 3SX1A 4FCZA 1JB4A 4LGQA 3SOAA 3CCM3 3A76A 3OXAA 2XF3A 3QK9A 4J5GA 2WOHA 3UB1A 1YJN3 1FUSA 2P38A 1UI8A 2AAEA 4XDWA 5TGNA 3CNXA 4XBYA 1TRQA 4N6TA 3K5TA 1D6ZA 4FMCA 2Z77A 2CKFB 4FR9A 5G1KA 1Q814 1CYVA 2CWUA 3JUPA 1FGMA 1X1WA 3IPTA 2CFGA 3UJMA 3O8YA 4EBGA 3PXMA 2RCDA 4R9LA 4HM5B 1HU9A 3F9SA 1VQ53 3B4OA 1I3IA 2FNQA 3BNBA 3CCS3 3WMDA 4HBRA 1Q824 3NQYA 1RKYA 1D6YA 2HMMB 4HM0B 3A5EA 5RNTA 1JZOA 5M19A 2BMOB 2ML6A 3OWYA 1BNIA 3SLUA 2RNTA 4O2HA 3UL6A 2CG1A 3LTCA 1B2XA 3T8NA 3EB8A 1KQS2 3VF1A 1OGXA 3DZLA 1UDII 2OQEA 1B20A 1DMQA 1JB2A 2F56A 1N5HA 1OHOA 2LQVA 3DUKA 1AR0A 1TTOA 1DVCA 2CH9A 5EVHA 3VSYA 7RNTA 3OW22 1A67A 1K41A 1R4YA 4N6MA 1IU7A 1JV2B 4GHOA 3CCU3 3EE1A 6RNTA 1YI23 2F99A 4LSOA 1A2PA 1I0XA 3NBBA 2BHMA 5KP3A 1IQ8A 2PZVA 3HI7A 5G1LA 3GWRA 2BIRA 1F8NA 1RCKA 2SBLA 5ELJA 1BSCA 1ZGXA 3G8ZA 3KFQC 5EEOA 5AEWB 6GSPA 1NU3A 1FA3A 3CMA3 3EHCA 1Q7HA 1OGZA 2MF7A 2J8XB 1IT7A 1PY3A 2GBXB 1WNHA 1CEWI 3BNDA 1FGOA 1JKGB 1ZO2A 2L4VA 2HMJB 1PU4A 1YIT3 3EN1B 1T2HA 1BSBA 1G02A 1BAOA 2F5WA 1L5GB 5IERA 3MYTA 1Z1SA 3EQQB 3L0RA 4CDLA 4J5KA 8CHOA 1BNRA 1T3BA 3LTAA 1GD3A 4H61A 1BSEA 1FUTA 2F5MA 1JJ22 1GMRA 1RLSA 4L8PA 8RNTA 5CK6A 3RGAA 3MG1A 1MWUA 5CF2A 1ZX2A 1IDPA 1BRKA 4O02B 1NDOB 2H0IA 2JDIH 3B8LA 1W6CA 2OOVC 2F98A 1OCVA 4EXRA 2GU3A 3UNLA 1KSIA 7GSPA 2P0MA 1Q864 1RN1A 2QEX3 1AVLA 2ZL8A 3CME3 4HJLB 3RDEA 2B24B 5LC7A 4MEIA 1RGLA 1V74A 4HZBB 3AHSA 2F86B 4XBXA 2KAAA 3X3ZA 1VZZA 1ULIB 4XM4A 3I0YA 1LOWA 3BLZA 4RBNA 1V58A 2R41A 4RNYA 4BU4A 1T2IA 3EC9A 5AYSC 3F7SA 3CCL3 1TUHA 3F8HA 1LOXA 3X3YA 3CC43 2C10A 3LXUX 4KFDA 1BVIA 1EKMA 3HIGA 4R4KA 2GEXA 2XGLA 3CPOA 3HOHA 1LNHA 3STDA 1BNEA 5IEOA 3EF8A 2BMRB 1BNSA 3M8CA 3GZBA 1K734 4NHFA 3FGYA 3NM7A 2BMQB 3NUVA 2C11A 1T5YA 3F7XA 2KF4A 1RGGA 1UCKA 4LYLB 2W56A 7STDA 1ISKA 5BVBA 1B2ZA 4OVMA 1GY5A 2OWPA 2CFDA 2E2TA 3EBYA 4N6OB 5AIHA 5HGRA 1I70A 1NNVA 1KD14 1BANA 1OACA 1BRSA 1STFI 1UGIA 1DMNA 5BXQA 5I97A 4HM6B 1B21A 2KCDA 1W4NA 3LT8A 2XEPA 3UL5A 3X42A 4EW5A 1TFOA 1I3FA 1VQL3 1JBSA 1TRPA 1U8CB 4WHAA 2ZHXB 4XBTA 3WODG 3ZG5A 2BT3A 2H0GA 1W2ZA 5AIGA 2KF5A 3NV0B 3K0ZA 5G2GA 4BL3A 3Q1CA 1TIJA 3DXOA 3V98A 2ML5A 5CF1A 1O7WB 1VQK3 5A0OB 5JPPA 3F40A 1RMSA 3S5CA 4BIRA 4RNTA 1MWTA 1AY7A 1FGQA 1MWSA 2KF3A 1GMPA 1RCLA 3AGOA 3IJEB 4FMAA 1OPYA 1RRHA 4WFOA 2CHCA 3WHOA 3U97A 2KF6A 3BNEA 3GZRA 5AIFA 4K1VA 5CXOA 3B7CA 3S67A 3CC23 1W6GA 1GD4A 1BRHA 1HZ1A 3DGLA 4CCVA 1DVDA 2Z76A 4R9KA 3OWSA 1HKXA 3WOEB 1N9JA 3GZXB 1RGEA 2SARA 1KC84 1K8A4 1NB5I 3PYJA 2E2UA 1UW1A 3NM2A 1GMQA 1Q40B 2XSHB 3F8XA 1W6YA 1CH0A 1UI7A 4RNZA 5CLKA 2W56B 4AKZA 1BUQA 2CC3A 1DMMA 3QRDA 4KZ1A 3DH2A 5AI1A 4FMBA 3TDGA 4HYZA 5ELUA 2KRTA 3SOYA 3LMLA 3LYGA 1EEJA 1YIJ3 3D3LA 1DYUA 1W02A 2WGOA 1UUGB 3CNMA 5M18A 1A2KA 3PCRA 1YJ93 3ZG0A 4LEHA 1X1UA 2AADA 2W2CA 4EV2A 3HIIA 1MOLA 3I563 2OTL3 1VQN3 2GEYA 2HMNB 3JUOA 4MJDA 3RGRA 5GSPA 1OF5B 4MMXB 1A90A 1IQYA 1SARA 3OX9A 2F4YA 2K0MA 4R80A 2E2VA 4N6NB 1RN7A 1VQO3 2XGNA 1UCIA 1JB5A 3NQZA 1JBRA 4ORLA 3MG2A 2XFSA 4HVNA 3EJVA 1US1A 1YVBI 4HZ9B 4EC6A 4STDA 1NB3I 3DGNA 4G1MB 4K61A 6STDA 5IEPA 3MKIA 2D42A 3N54B 4KFFA 1LOYA 4WYKB 1BNJA 1OHSA 3CC73 2GU1A 1NWWA 3CXC2 5LC6A 3LTBA 1QVF2 2Z6BA 2ZDJA 5FW5A 3JUMA 1O7MB 3DY5A 3AMOB 1B27A 2OOVA 2ZA4A 1IYYA 3X3XA 3I553 2W04A 2I9WA 3K63A 1WQLB 3N9HA 1RN4A 1RTUA 4GL6A 1GYBA 1I0VA 1MGRA 3LZAA 4O8SA 3H51A 1EUIC 1LOVA 2HMOB 1JN5A 1G96A 3X40A 5KP4A 3D4AA 1BSAA 1WMOA 1W5ZA 4HOHA 4ILFA 5IG5A 1S723 4XB5A 3LT9A 1A2VA 1B3SA 3EN8A 3JVCA 4HAAA 4Q53A 5D83A 3BIRA 4HM2B 3ER7A 3KSPA 4KVHA 1JKGA 3MPHA 5HOHA 1E97A 1GY6A 2HOHA 3OWUA 4KFEA 3N8BA 2XFTA 1BRJA 2W9PA 3NBJA 4OK0A 2CG0A 4CPKA 3EBTA 1SJWA 1QMAA 3J7Yd 3CCV3 2Z7AA 1RGKA 4IIAA 1FUWA 2OCTA 1OF5A 5STDA 3HZPA 1UCLA 4K90B 2IUJA 5IG3A 1MGWA 4U13A 1N9EA 2HMKB 3FKAA 4CJNA 1TU5A 1GOUA 2HMLB 2W0QA 1RGAA 2RSXA 3FLJA 1LVNA 3FG3A 1SPUA 4IPBA 4L8OA 1I2EA 1RRLA 1BNFA 4JRFA 1R4CA 1ROVA 2M7OA 1YNVX 2IYJA 4FCMA 1LRAA 1VQ83 5IW9A 1GSPA 2GXFA 1GOYA 4I5QA 2FGTA 4WP5A 5JBSA 4AKYA 1E3VA 3F14A 1RNBA 3PS8A 3CD63 1Q40A 4WWUC 1N8R4 3EX9A 4JF8A 1NJI4 3E99A 2IUKA 2Q07A 3ROBA 1GS3A 1MNLA 1OH0A 2RGQA 1JZDA 1WMNA 2CX0A 3HX8A 3ZFZA 3CPW2 3CCE3 1EG9B 1W00A 1TP6A 2JQ5A 3KIIA 1IK3A 3WDGB 3GRDA 3WOFB 1M904 4GB5A 1RGHA 1C54A 1YGEA 2WGQA 3D5IA 4L7KA 1VQ93 3T8UA 3NX0A 3K7CA 1AVKA 1IQXA 3LTDA 1RGFA 3GAXA 2YFLB 3LH4A 2UGIA 4GSPA 3K9MC 4HM3B 1BRGA 2W03A 2WOFA 4R1KA 3B4PA 3KN4A 3CCQ3 3FZWA 3JUNA 5D82A 1DE3A 3SXXA 4XDVA 3Q2PA 1K28A 3BU4A 3AMOA 3H3HA 2RFRA 1IVXA 3AHWA 5KP1A 1EA2A 3WR2A 5AEUB 5JPUA 1QAFA 1IVUA 5IG0A 2OTJ3 4O3VA 4BTXA 2Y73A 5AYRB 1IVVA 5IG4A 4KT3B 2KXGA 1Q9EA 3MHEA 1MWRA 3FG1A 3S29A 4H3UA 2QGUA 1LQMB 3T0UA 2O9UX 2BNGA 4AEQA 2CIUA 3G0KA 2CFLA 2B1XB 2CW9A 3KKGA 1BRIA 3FF2A 4FCJA 5AIIA 1YGWA 1Y4KA 1FZUA 1OUNA 4OUQA 3ECFA 1BRNL 1FGTA 3FF0A 3V92A 9RNTA 4WYKA 2IY2A 1BIRA 1PYLA 5EQLA 4BTWA 3G713 2CFKA 4N6UA 1UCJA 1S5AA 3ALAA 1NO3A 2STDA 1JNQA 1QAKA 1B2SA 2OQEC 1CQSA 3PGBA 4ZM8A 5BU4A 3CCJ3 2BO9B 2CWVA 5IENA 4MMZB 1BOXA 1LXEA 1RNTA 1SIHA 4K1UA 1ROAA 3NBRA 1BSDA 3SVAA 3Q90A 5DREA 2GBWB 3KE7A 4HKVB 4N6LA 1Q7Y4 1VQ43 4HM1B 2FXTA 3DGYA 3CU3A 3G16A 1O7NB 3BNCA 4HM7B 4DKIA 4BTYA
chains in the Genus database with same CATH topology
2BU4A 1I3FA 5HOHA 2HOHA 1JBSA 1TRPA 1FYSA 1BRJA 3A5EA 5RNTA 1BNIA 1RGKA 2KF5A 1JBTA 2RNTA 1UCLA 1BUJA 1B2XA 1MGWA 1RHLA 1GOUA 1B20A 2F56A 4BIRA 1RMSA 1HYFA 1RGAA 1TTOA 7RNTA 4RNTA 2RBIA 1AY7A 2KF3A 3AGOA 1GMPA 1RCLA 1R4YA 1I2EA 3WHOA 4GHOA 1BNFA 1B2MA 2KF6A 1I8VA 1RSNA 1YNVX 2C4BA 1LRAA 3D5GA 3KCHA 6RNTA 1A2PA 1I0XA 1BRHA 1GSPA 1HZ1A 3AGNA 1GOYA 2BIRA 1RCKA 1RGEA 2SARA 1BNGA 1BSCA 1ZGXA 6GSPA 1RNBA 1GMQA 1CH0A 1PY3A 1RDSA 3DH2A 1T2HA 1BSBA 1G02A 1AQZA 1BAOA 2F5WA 4J5KA 1GOVA 1FW7A 1BNRA 1DETA 1BSEA 1C54A 1FUTA 1RGHA 2F5MA 1X1UA 3D5IA 1BU4A 1GMRA 1RLSA 8RNTA 2AADA 1B2UA 1RGFA 1I2GA 3GSPA 1BRKA 3URPA 4GSPA 1BGSA 1LNIA 5GSPA 1BRGA 1SARA 2F4YA 1YVSA 1X1YA 1DE3A 7GSPA 3BU4A 1UCIA 1RN1A 1JBRA 3AHWA 3WR2A 1X1XA 1RGLA 3AHSA 3Q3FA 2KAAA 1Q9EA 3SYUA 1LOWA 4BU4A 1T2IA 1LOYA 2GSPA 1BNJA 5BIRA 1BVIA 1RGCA 1BRIA 1I2FA 3HOHA 3RNTA 1YGWA 1FZUA 1BNEA 1BRNL 1BNSA 9RNTA 2ZA4A 1IYYA 4J5GA 1BIRA 1PYLA 1FUSA 1RN4A 1RTUA 1UCJA 1I0VA 1MGRA 2AAEA 1B2SA 1LOVA 2KF4A 1TRQA 5BU4A 1RGGA 1UCKA 1BOXA 1RNTA 3D4AA 1BSAA 1B2ZA 1BSDA 4HOHA 1X1WA 1I70A 1BANA 1B3SA 1BRSA 4HAAA 3BIRA 1B21A 3DGYA 1B27A 1I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU4 A;  1I3F A;  5HOH A;  2HOH A;  1JBS A;  1TRP A;  1FYS A;  1BRJ A;  3A5E A;  5RNT A;  1BNI A;  1RGK A;  2KF5 A;  1JBT A;  2RNT A;  1UCL A;  1BUJ A;  1B2X A;  1MGW A;  1RHL A;  1GOU A;  1B20 A;  2F56 A;  4BIR A;  1RMS A;  1HYF A;  1RGA A;  1TTO A;  7RNT A;  4RNT A;  2RBI A;  1AY7 A;  2KF3 A;  3AGO A;  1GMP A;  1RCL A;  1R4Y A;  1I2E A;  3WHO A;  4GHO A;  1BNF A;  1B2M A;  2KF6 A;  1I8V A;  1RSN A;  1YNV X;  2C4B A;  1LRA A;  3D5G A;  3KCH A;  6RNT A;  1A2P A;  1I0X A;  1BRH A;  1GSP A;  1HZ1 A;  3AGN A;  1GOY A;  2BIR A;  1RCK A;  1RGE A;  2SAR A;  1BNG A;  1BSC A;  1ZGX A;  6GSP A;  1RNB A;  1GMQ A;  1CH0 A;  1PY3 A;  1RDS A;  3DH2 A;  1T2H A;  1BSB A;  1G02 A;  1AQZ A;  1BAO A;  2F5W A;  4J5K A;  1GOV A;  1FW7 A;  1BNR A;  1DET A;  1BSE A;  1C54 A;  1FUT A;  1RGH A;  2F5M A;  1X1U A;  3D5I A;  1BU4 A;  1GMR A;  1RLS A;  8RNT A;  2AAD A;  1B2U A;  1RGF A;  1I2G A;  3GSP A;  1BRK A;  3URP A;  4GSP A;  1BGS A;  1LNI A;  5GSP A;  1BRG A;  1SAR A;  2F4Y A;  1YVS A;  1X1Y A;  1DE3 A;  7GSP A;  3BU4 A;  1UCI A;  1RN1 A;  1JBR A;  3AHW A;  3WR2 A;  1X1X A;  1RGL A;  3AHS A;  3Q3F A;  2KAA A;  1Q9E A;  3SYU A;  1LOW A;  4BU4 A;  1T2I A;  1LOY A;  2GSP A;  1BNJ A;  5BIR A;  1BVI A;  1RGC A;  1BRI A;  1I2F A;  3HOH A;  3RNT A;  1YGW A;  1FZU A;  1BNE A;  1BRN L;  1BNS A;  9RNT A;  2ZA4 A;  1IYY A;  4J5G A;  1BIR A;  1PYL A;  1FUS A;  1RN4 A;  1RTU A;  1UCJ A;  1I0V A;  1MGR A;  2AAE A;  1B2S A;  1LOV A;  2KF4 A;  1TRQ A;  5BU4 A;  1RGG A;  1UCK A;  1BOX A;  1RNT A;  3D4A A;  1BSA A;  1B2Z A;  1BSD A;  4HOH A;  1X1W A;  1I70 A;  1BAN A;  1B3S A;  1BRS A;  4HAA A;  3BIR A;  1B21 A;  3DGY A;  1B27 A;  1I3I A; 
#chains in the Genus database with same CATH topology
 5DRV A;  2BU4 A;  3HK4 A;  3MWZ A;  1ULJ B;  1ASK A;  3PCS A;  3MG3 A;  1FYS A;  1YJW 3;  1JRQ A;  1SII A;  1IV7 A;  3D79 A;  2P0X A;  3G4S 3;  3MSO A;  1JBT A;  1LQG C;  3DGM A;  1TFK A;  5FGO A;  5M1A A;  3JUQ A;  2D1W A;  1BUJ A;  3DGO A;  1N5P A;  1RHL A;  1VQ6 3;  3WA2 X;  1D6U A;  1E3R A;  2Y74 A;  4X2H A;  2QA4 3;  3LOY A;  1VQQ A;  2XH9 A;  1HYF A;  2XR8 B;  2V1L A;  2RBI A;  3NV0 A;  3KZT A;  1M1K 4;  1W2B 2;  2K54 A;  1RJO A;  2YX9 A;  1K9M 4;  2QIY A;  4EYC A;  2MC8 A;  1B2M A;  1I8V A;  1RSN A;  3KCH A;  2C4B A;  2XSO B;  3D5G A;  2K3D A;  2WO0 A;  1J2B A;  4BL2 A;  1JN5 B;  2INX A;  1V57 A;  1STD A;  2R4I A;  1M9G A;  3AGN A;  3FG4 A;  1O7G B;  1TJD A;  1UUW B;  1W01 A;  4N6V 0;  3NXJ A;  3FH1 A;  3PZW A;  1BNG A;  4LZI A;  1VQ7 3;  3FSD A;  4HM4 B;  1RDS A;  1SQW A;  4NPB A;  4QWT A;  3SED A;  4PEJ A;  4EV5 A;  4MMY B;  3VGN A;  1QVG 2;  3X41 A;  1AQZ A;  3WA3 A;  1IV9 A;  2PNC A;  1GOV A;  1FW7 A;  3DM8 A;  1DET A;  3DMC A;  2P09 A;  2H0H A;  1N8Q A;  1ZS7 A;  1CYU A;  2O3O A;  3KSE D;  1IT8 A;  1BU4 A;  2YFI B;  1KWI A;  1B2U A;  2XRX B;  3BB9 A;  2IA7 A;  1OHP A;  5IF6 A;  2W6J H;  1EQK A;  2A15 A;  1I2G A;  1O7H B;  2CK3 H;  3FCS B;  3GSP A;  4IT7 A;  4TX4 A;  1G0T A;  4N3V A;  3S27 A;  3U1W A;  1BGS A;  1LNI A;  3GZY B;  3URP A;  1QJG A;  2CWT A;  3CCR 3;  1YVS A;  1W7C A;  1X1Y A;  3IMA B;  4LMI A;  4RZM A;  1QAL A;  2CX1 A;  1FGR A;  4J9A A;  2IMJ A;  1VQM 3;  3G6E 3;  4FMD A;  1Q42 A;  2UUG C;  4I4K A;  1C7H A;  4X2O A;  1M1X B;  1X1X A;  1AV4 A;  4J8T A;  3Q3F A;  2CFW A;  3S28 A;  3D9R A;  4NRE A;  1UGH I;  1U5O A;  2W9Q A;  3SYU A;  1UUV B;  2L1S A;  5D81 A;  2GSP A;  2P05 A;  3NHX A;  4HM8 B;  5BIR A;  2UX0 A;  1RGC A;  1WMP A;  1GY7 A;  1WTH A;  1I2F A;  2YFJ B;  1IVW A;  3RNT A;  1VQP 3;  1PFP A;  1YHQ 3;  3V99 A;  3OV4 A;  1O7P B;  2LYX A;  3SX1 A;  4FCZ A;  1JB4 A;  4LGQ A;  3SOA A;  3CCM 3;  3A76 A;  3OXA A;  2XF3 A;  3QK9 A;  4J5G A;  2WOH A;  3UB1 A;  1YJN 3;  1FUS A;  2P38 A;  1UI8 A;  2AAE A;  4XDW A;  5TGN A;  3CNX A;  4XBY A;  1TRQ A;  4N6T A;  3K5T A;  1D6Z A;  4FMC A;  2Z77 A;  2CKF B;  4FR9 A;  5G1K A;  1Q81 4;  1CYV A;  2CWU A;  3JUP A;  1FGM A;  1X1W A;  3IPT A;  2CFG A;  3UJM A;  3O8Y A;  4EBG A;  3PXM A;  2RCD A;  4R9L A;  4HM5 B;  1HU9 A;  3F9S A;  1VQ5 3;  3B4O A;  1I3I A;  2FNQ A;  3BNB A;  3CCS 3;  3WMD A;  4HBR A;  1Q82 4;  3NQY A;  1RKY A;  1D6Y A;  2HMM B;  4HM0 B;  3A5E A;  5RNT A;  1JZO A;  5M19 A;  2BMO B;  2ML6 A;  3OWY A;  1BNI A;  3SLU A;  2RNT A;  4O2H A;  3UL6 A;  2CG1 A;  3LTC A;  1B2X A;  3T8N A;  3EB8 A;  1KQS 2;  3VF1 A;  1OGX A;  3DZL A;  1UDI I;  2OQE A;  1B20 A;  1DMQ A;  1JB2 A;  2F56 A;  1N5H A;  1OHO A;  2LQV A;  3DUK A;  1AR0 A;  1TTO A;  1DVC A;  2CH9 A;  5EVH A;  3VSY A;  7RNT A;  3OW2 2;  1A67 A;  1K41 A;  1R4Y A;  4N6M A;  1IU7 A;  1JV2 B;  4GHO A;  3CCU 3;  3EE1 A;  6RNT A;  1YI2 3;  2F99 A;  4LSO A;  1A2P A;  1I0X A;  3NBB A;  2BHM A;  5KP3 A;  1IQ8 A;  2PZV A;  3HI7 A;  5G1L A;  3GWR A;  2BIR A;  1F8N A;  1RCK A;  2SBL A;  5ELJ A;  1BSC A;  1ZGX A;  3G8Z A;  3KFQ C;  5EEO A;  5AEW B;  6GSP A;  1NU3 A;  1FA3 A;  3CMA 3;  3EHC A;  1Q7H A;  1OGZ A;  2MF7 A;  2J8X B;  1IT7 A;  1PY3 A;  2GBX B;  1WNH A;  1CEW I;  3BND A;  1FGO A;  1JKG B;  1ZO2 A;  2L4V A;  2HMJ B;  1PU4 A;  1YIT 3;  3EN1 B;  1T2H A;  1BSB A;  1G02 A;  1BAO A;  2F5W A;  1L5G B;  5IER A;  3MYT A;  1Z1S A;  3EQQ B;  3L0R A;  4CDL A;  4J5K A;  8CHO A;  1BNR A;  1T3B A;  3LTA A;  1GD3 A;  4H61 A;  1BSE A;  1FUT A;  2F5M A;  1JJ2 2;  1GMR A;  1RLS A;  4L8P A;  8RNT A;  5CK6 A;  3RGA A;  3MG1 A;  1MWU A;  5CF2 A;  1ZX2 A;  1IDP A;  1BRK A;  4O02 B;  1NDO B;  2H0I A;  2JDI H;  3B8L A;  1W6C A;  2OOV C;  2F98 A;  1OCV A;  4EXR A;  2GU3 A;  3UNL A;  1KSI A;  7GSP A;  2P0M A;  1Q86 4;  1RN1 A;  2QEX 3;  1AVL A;  2ZL8 A;  3CME 3;  4HJL B;  3RDE A;  2B24 B;  5LC7 A;  4MEI A;  1RGL A;  1V74 A;  4HZB B;  3AHS A;  2F86 B;  4XBX A;  2KAA A;  3X3Z A;  1VZZ A;  1ULI B;  4XM4 A;  3I0Y A;  1LOW A;  3BLZ A;  4RBN A;  1V58 A;  2R41 A;  4RNY A;  4BU4 A;  1T2I A;  3EC9 A;  5AYS C;  3F7S A;  3CCL 3;  1TUH A;  3F8H A;  1LOX A;  3X3Y A;  3CC4 3;  2C10 A;  3LXU X;  4KFD A;  1BVI A;  1EKM A;  3HIG A;  4R4K A;  2GEX A;  2XGL A;  3CPO A;  3HOH A;  1LNH A;  3STD A;  1BNE A;  5IEO A;  3EF8 A;  2BMR B;  1BNS A;  3M8C A;  3GZB A;  1K73 4;  4NHF A;  3FGY A;  3NM7 A;  2BMQ B;  3NUV A;  2C11 A;  1T5Y A;  3F7X A;  2KF4 A;  1RGG A;  1UCK A;  4LYL B;  2W56 A;  7STD A;  1ISK A;  5BVB A;  1B2Z A;  4OVM A;  1GY5 A;  2OWP A;  2CFD A;  2E2T A;  3EBY A;  4N6O B;  5AIH A;  5HGR A;  1I70 A;  1NNV A;  1KD1 4;  1BAN A;  1OAC A;  1BRS A;  1STF I;  1UGI A;  1DMN A;  5BXQ A;  5I97 A;  4HM6 B;  1B21 A;  2KCD A;  1W4N A;  3LT8 A;  2XEP A;  3UL5 A;  3X42 A;  4EW5 A;  1TFO A;  1I3F A;  1VQL 3;  1JBS A;  1TRP A;  1U8C B;  4WHA A;  2ZHX B;  4XBT A;  3WOD G;  3ZG5 A;  2BT3 A;  2H0G A;  1W2Z A;  5AIG A;  2KF5 A;  3NV0 B;  3K0Z A;  5G2G A;  4BL3 A;  3Q1C A;  1TIJ A;  3DXO A;  3V98 A;  2ML5 A;  5CF1 A;  1O7W B;  1VQK 3;  5A0O B;  5JPP A;  3F40 A;  1RMS A;  3S5C A;  4BIR A;  4RNT A;  1MWT A;  1AY7 A;  1FGQ A;  1MWS A;  2KF3 A;  1GMP A;  1RCL A;  3AGO A;  3IJE B;  4FMA A;  1OPY A;  1RRH A;  4WFO A;  2CHC A;  3WHO A;  3U97 A;  2KF6 A;  3BNE A;  3GZR A;  5AIF A;  4K1V A;  5CXO A;  3B7C A;  3S67 A;  3CC2 3;  1W6G A;  1GD4 A;  1BRH A;  1HZ1 A;  3DGL A;  4CCV A;  1DVD A;  2Z76 A;  4R9K A;  3OWS A;  1HKX A;  3WOE B;  1N9J A;  3GZX B;  1RGE A;  2SAR A;  1KC8 4;  1K8A 4;  1NB5 I;  3PYJ A;  2E2U A;  1UW1 A;  3NM2 A;  1GMQ A;  1Q40 B;  2XSH B;  3F8X A;  1W6Y A;  1CH0 A;  1UI7 A;  4RNZ A;  5CLK A;  2W56 B;  4AKZ A;  1BUQ A;  2CC3 A;  1DMM A;  3QRD A;  4KZ1 A;  3DH2 A;  5AI1 A;  4FMB A;  3TDG A;  4HYZ A;  5ELU A;  2KRT A;  3SOY A;  3LML A;  3LYG A;  1EEJ A;  1YIJ 3;  3D3L A;  1DYU A;  1W02 A;  2WGO A;  1UUG B;  3CNM A;  5M18 A;  1A2K A;  3PCR A;  1YJ9 3;  3ZG0 A;  4LEH A;  1X1U A;  2AAD A;  2W2C A;  4EV2 A;  3HII A;  1MOL A;  3I56 3;  2OTL 3;  1VQN 3;  2GEY A;  2HMN B;  3JUO A;  4MJD A;  3RGR A;  5GSP A;  1OF5 B;  4MMX B;  1A90 A;  1IQY A;  1SAR A;  3OX9 A;  2F4Y A;  2K0M A;  4R80 A;  2E2V A;  4N6N B;  1RN7 A;  1VQO 3;  2XGN A;  1UCI A;  1JB5 A;  3NQZ A;  1JBR A;  4ORL A;  3MG2 A;  2XFS A;  4HVN A;  3EJV A;  1US1 A;  1YVB I;  4HZ9 B;  4EC6 A;  4STD A;  1NB3 I;  3DGN A;  4G1M B;  4K61 A;  6STD A;  5IEP A;  3MKI A;  2D42 A;  3N54 B;  4KFF A;  1LOY A;  4WYK B;  1BNJ A;  1OHS A;  3CC7 3;  2GU1 A;  1NWW A;  3CXC 2;  5LC6 A;  3LTB A;  1QVF 2;  2Z6B A;  2ZDJ A;  5FW5 A;  3JUM A;  1O7M B;  3DY5 A;  3AMO B;  1B27 A;  2OOV A;  2ZA4 A;  1IYY A;  3X3X A;  3I55 3;  2W04 A;  2I9W A;  3K63 A;  1WQL B;  3N9H A;  1RN4 A;  1RTU A;  4GL6 A;  1GYB A;  1I0V A;  1MGR A;  3LZA A;  4O8S A;  3H51 A;  1EUI C;  1LOV A;  2HMO B;  1JN5 A;  1G96 A;  3X40 A;  5KP4 A;  3D4A A;  1BSA A;  1WMO A;  1W5Z A;  4HOH A;  4ILF A;  5IG5 A;  1S72 3;  4XB5 A;  3LT9 A;  1A2V A;  1B3S A;  3EN8 A;  3JVC A;  4HAA A;  4Q53 A;  5D83 A;  3BIR A;  4HM2 B;  3ER7 A;  3KSP A;  4KVH A;  1JKG A;  3MPH A;  5HOH A;  1E97 A;  1GY6 A;  2HOH A;  3OWU A;  4KFE A;  3N8B A;  2XFT A;  1BRJ A;  2W9P A;  3NBJ A;  4OK0 A;  2CG0 A;  4CPK A;  3EBT A;  1SJW A;  1QMA A;  3J7Y d;  3CCV 3;  2Z7A A;  1RGK A;  4IIA A;  1FUW A;  2OCT A;  1OF5 A;  5STD A;  3HZP A;  1UCL A;  4K90 B;  2IUJ A;  5IG3 A;  1MGW A;  4U13 A;  1N9E A;  2HMK B;  3FKA A;  4CJN A;  1TU5 A;  1GOU A;  2HML B;  2W0Q A;  1RGA A;  2RSX A;  3FLJ A;  1LVN A;  3FG3 A;  1SPU A;  4IPB A;  4L8O A;  1I2E A;  1RRL A;  1BNF A;  4JRF A;  1R4C A;  1ROV A;  2M7O A;  1YNV X;  2IYJ A;  4FCM A;  1LRA A;  1VQ8 3;  5IW9 A;  1GSP A;  2GXF A;  1GOY A;  4I5Q A;  2FGT A;  4WP5 A;  5JBS A;  4AKY A;  1E3V A;  3F14 A;  1RNB A;  3PS8 A;  3CD6 3;  1Q40 A;  4WWU C;  1N8R 4;  3EX9 A;  4JF8 A;  1NJI 4;  3E99 A;  2IUK A;  2Q07 A;  3ROB A;  1GS3 A;  1MNL A;  1OH0 A;  2RGQ A;  1JZD A;  1WMN A;  2CX0 A;  3HX8 A;  3ZFZ A;  3CPW 2;  3CCE 3;  1EG9 B;  1W00 A;  1TP6 A;  2JQ5 A;  3KII A;  1IK3 A;  3WDG B;  3GRD A;  3WOF B;  1M90 4;  4GB5 A;  1RGH A;  1C54 A;  1YGE A;  2WGQ A;  3D5I A;  4L7K A;  1VQ9 3;  3T8U A;  3NX0 A;  3K7C A;  1AVK A;  1IQX A;  3LTD A;  1RGF A;  3GAX A;  2YFL B;  3LH4 A;  2UGI A;  4GSP A;  3K9M C;  4HM3 B;  1BRG A;  2W03 A;  2WOF A;  4R1K A;  3B4P A;  3KN4 A;  3CCQ 3;  3FZW A;  3JUN A;  5D82 A;  1DE3 A;  3SXX A;  4XDV A;  3Q2P A;  1K28 A;  3BU4 A;  3AMO A;  3H3H A;  2RFR A;  1IVX A;  3AHW A;  5KP1 A;  1EA2 A;  3WR2 A;  5AEU B;  5JPU A;  1QAF A;  1IVU A;  5IG0 A;  2OTJ 3;  4O3V A;  4BTX A;  2Y73 A;  5AYR B;  1IVV A;  5IG4 A;  4KT3 B;  2KXG A;  1Q9E A;  3MHE A;  1MWR A;  3FG1 A;  3S29 A;  4H3U A;  2QGU A;  1LQM B;  3T0U A;  2O9U X;  2BNG A;  4AEQ A;  2CIU A;  3G0K A;  2CFL A;  2B1X B;  2CW9 A;  3KKG A;  1BRI A;  3FF2 A;  4FCJ A;  5AII A;  1YGW A;  1Y4K A;  1FZU A;  1OUN A;  4OUQ A;  3ECF A;  1BRN L;  1FGT A;  3FF0 A;  3V92 A;  9RNT A;  4WYK A;  2IY2 A;  1BIR A;  1PYL A;  5EQL A;  4BTW A;  3G71 3;  2CFK A;  4N6U A;  1UCJ A;  1S5A A;  3ALA A;  1NO3 A;  2STD A;  1JNQ A;  1QAK A;  1B2S A;  2OQE C;  1CQS A;  3PGB A;  4ZM8 A;  5BU4 A;  3CCJ 3;  2BO9 B;  2CWV A;  5IEN A;  4MMZ B;  1BOX A;  1LXE A;  1RNT A;  1SIH A;  4K1U A;  1ROA A;  3NBR A;  1BSD A;  3SVA A;  3Q90 A;  5DRE A;  2GBW B;  3KE7 A;  4HKV B;  4N6L A;  1Q7Y 4;  1VQ4 3;  4HM1 B;  2FXT A;  3DGY A;  3CU3 A;  3G16 A;  1O7N B;  3BNC A;  4HM7 B;  4DKI A;  4BTY A; 
#chains in the Genus database with same CATH homology
 2BU4 A;  1I3F A;  5HOH A;  2HOH A;  1JBS A;  1TRP A;  1FYS A;  1BRJ A;  3A5E A;  5RNT A;  1BNI A;  1RGK A;  2KF5 A;  1JBT A;  2RNT A;  1UCL A;  1BUJ A;  1B2X A;  1MGW A;  1RHL A;  1GOU A;  1B20 A;  2F56 A;  4BIR A;  1RMS A;  1HYF A;  1RGA A;  1TTO A;  7RNT A;  4RNT A;  2RBI A;  1AY7 A;  2KF3 A;  3AGO A;  1GMP A;  1RCL A;  1R4Y A;  1I2E A;  3WHO A;  4GHO A;  1BNF A;  1B2M A;  2KF6 A;  1I8V A;  1RSN A;  1YNV X;  2C4B A;  1LRA A;  3D5G A;  3KCH A;  6RNT A;  1A2P A;  1I0X A;  1BRH A;  1GSP A;  1HZ1 A;  3AGN A;  1GOY A;  2BIR A;  1RCK A;  1RGE A;  2SAR A;  1BNG A;  1BSC A;  1ZGX A;  6GSP A;  1RNB A;  1GMQ A;  1CH0 A;  1PY3 A;  1RDS A;  3DH2 A;  1T2H A;  1BSB A;  1G02 A;  1AQZ A;  1BAO A;  2F5W A;  4J5K A;  1GOV A;  1FW7 A;  1BNR A;  1DET A;  1BSE A;  1C54 A;  1FUT A;  1RGH A;  2F5M A;  1X1U A;  3D5I A;  1BU4 A;  1GMR A;  1RLS A;  8RNT A;  2AAD A;  1B2U A;  1RGF A;  1I2G A;  3GSP A;  1BRK A;  3URP A;  4GSP A;  1BGS A;  1LNI A;  5GSP A;  1BRG A;  1SAR A;  2F4Y A;  1YVS A;  1X1Y A;  1DE3 A;  7GSP A;  3BU4 A;  1UCI A;  1RN1 A;  1JBR A;  3AHW A;  3WR2 A;  1X1X A;  1RGL A;  3AHS A;  3Q3F A;  2KAA A;  1Q9E A;  3SYU A;  1LOW A;  4BU4 A;  1T2I A;  1LOY A;  2GSP A;  1BNJ A;  5BIR A;  1BVI A;  1RGC A;  1BRI A;  1I2F A;  3HOH A;  3RNT A;  1YGW A;  1FZU A;  1BNE A;  1BRN L;  1BNS A;  9RNT A;  2ZA4 A;  1IYY A;  4J5G A;  1BIR A;  1PYL A;  1FUS A;  1RN4 A;  1RTU A;  1UCJ A;  1I0V A;  1MGR A;  2AAE A;  1B2S A;  1LOV A;  2KF4 A;  1TRQ A;  5BU4 A;  1RGG A;  1UCK A;  1BOX A;  1RNT A;  3D4A A;  1BSA A;  1B2Z A;  1BSD A;  4HOH A;  1X1W A;  1I70 A;  1BAN A;  1B3S A;  1BRS A;  4HAA A;  3BIR A;  1B21 A;  3DGY A;  1B27 A;  1I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...