1VQN3

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqn300
1YI23 1VQ43 3I563 1KQS2 1Q864 1VQO3 1W2B2 3CCE3 1K734 3CXC2 3CD63 2OTJ3 1KC84 2OTL3 3CC23 1VQK3 1YIT3 1VQ83 3I553 3CC73 2QA43 1YJW3 1Q824 3CCR3 1VQ53 3CME3 1K8A4 3CC43 3CMA3 1VQL3 1YIJ3 3CCL3 3G6E3 1VQM3 1Q814 1QVG2 1YJN3 3CPW2 1M904 3CCM3 1VQP3 2QEX3 3CCV3 1VQ93 1JJ22 1YJ93 1S723 1N8R4 3G713 3OW22 1M1K4 1NJI4 3CCS3 1VQ73 3CCU3 1QVF2 3CCQ3 1K9M4 1YHQ3 1VQN3 1Q7Y4 1VQ63 3G4S3 1KD14 3CCJ3
chains in the Genus database with same CATH superfamily
1RHLA 1NWWA 6RNTA 1Q42A 1JRQA 1UDII 4FMDA 1BRSA 3EC9A 1BRHA 4J5GA 1G96A 3I0YA 1EG9B 1WTHA 1STDA 2J8XB 3F8HA 4WHAA 1RGKA 1N8QA 4N6LA 2CWVA 1BOXA 1YJW3 3UJMA 2KF3A 2F5MA 5RNTA 4BTXA 1ZGXA 1BVIA 3DGNA 4EV5A 1W6YA 1BNRA 1O7MB 2CFGA 3D79A 4BTYA 3WA2X 3B8LA 2FNQA 1RN7A 2HMNB 4N6OB 2F98A 1R4CA 4K61A 1JN5A 1ROVA 3OV4A 4IIAA 3EHCA 1HZ1A 3CCQ3 1BNEA 1ASKA 1D6YA 3DMCA 4HM7B 3FH1A 3NV0B 1X1XA 1UI8A 1SJWA 1UI7A 1ROAA 3K9MC 1GY6A 2GEXA 2L4VA 3CU3A 3KCHA 2W56A 4KFFA 2XEPA 2CX1A 5EQLA 1SIIA 4LYLB 1IDPA 3MSOA 3UNLA 3D4AA 3VSYA 3ZG5A 4J5KA 1VQK3 3CNMA 5EEOA 5IF6A 2CHCA 4AKZA 5BVBA 1LRAA 2CH9A 3FF0A 1RMSA 4FMBA 2Q07A 3NQZA 3EN1B 4R80A 5IG0A 3HZPA 3PCRA 3WHOA 1AV4A 1SQWA 3ZG0A 1YJN3 3ALAA 2XFTA 1M904 5ELJA 4N6V0 2HMLB 4O2HA 1W02A 5BXQA 4ILFA 1W4NA 4EW5A 2K54A 2R41A 3MKIA 1NJI4 3CNXA 3SVAA 2ML5A 2MF7A 3BNEA 3EF8A 1GY7A 1UUWB 3AGNA 4O3VA 1CQSA 1RDSA 1RGCA 2Z7AA 3X3XA 3I563 3NBBA 4FMCA 3JUPA 3CD63 3CXC2 4LEHA 1RN4A 1RKYA 1UGIA 3FF2A 3DUKA 2ZHXB 2SARA 3OWYA 4HM6B 5IG3A 1J2BA 1AQZA 1B2ZA 1UCJA 3KFQC 1A67A 1G0TA 1DVDA 1Q824 1VQ53 4FCJA 1IT7A 1YIJ3 3HK4A 2LYXA 1MWTA 2W0QA 5CLKA 1IQ8A 3LTDA 1N9JA 1RRLA 1MNLA 1LNHA 3WOEB 1GY5A 4X2HA 1W7CA 3STDA 3OW22 4R9LA 4MJDA 1HU9A 1CH0A 2F5WA 3EB8A 3RGAA 1FGQA 3D3LA 2B24B 1UUVB 4LZIA 4ZM8A 1G02A 4MEIA 2YFIB 2B1XB 1M9GA 3BNBA 1YNVX 2ML6A 2BIRA 3S67A 5LC7A 1VQ63 1NB3I 2CK3H 1WMNA 4OUQA 3K7CA 1I3FA 3DGOA 3HX8A 3LTCA 2HMKB 4HM3B 4O02B 3X42A 4EC6A 5IERA 3CC23 3DXOA 3I553 3CC73 1E3VA 4RNTA 2XSOB 1OHOA 1BSBA 2MC8A 1ISKA 2K0MA 3FLJA 1L5GB 1Y4KA 4WWUC 1U8CB 4MMXB 1IU7A 1DETA 1Q7HA 3MYTA 3T8NA 1UCKA 1FGMA 2KF5A 1B20A 1RTUA 1MWRA 3CCS3 1E3RA 1OCVA 1RGAA 3SOYA 1IT8A 4FMAA 1PFPA 1V57A 1JKGB 2XSHB 3D5GA 1VQO3 2IYJA 2P0MA 3V92A 5IG5A 1W2B2 5IEOA 1O7HB 4ORLA 3FG3A 3NM2A 3AGOA 3PCSA 4BL2A 1IQXA 1BAOA 4HM0B 3LT8A 1BIRA 4HVNA 5AYSC 1BSCA 1RGEA 3B4OA 3F7SA 4H61A 4N6MA 6STDA 2KF6A 3BB9A 8CHOA 1QAFA 2BMOB 1B2MA 2OCTA 2WOHA 2H0GA 2W03A 2QIYA 4GB5A 1RLSA 2IUKA 3EX9A 1OHSA 2F86B 5HOHA 2ZL8A 2V1LA 2E2UA 4XBXA 2GEYA 2KRTA 1B21A 4QWTA 2H0IA 5JBSA 4RNZA 1EKMA 3KN4A 3NV0A 1LOYA 4HYZA 4HM8B 1YVSA 5AIHA 1TJDA 5AEUB 1DVCA 3FZWA 3N8BA 1I2GA 1TFOA 5FW5A 4GL6A 2IMJA 3G6E3 1UCIA 4LMIA 3GZBA 3Q1CA 3ER7A 5DRVA 1TRQA 3DZLA 3GAXA 1W5ZA 2P05A 2OWPA 4HM4B 4K1UA 5CF2A 1FYSA 3PYJA 5IG4A 4HJLB 3AHSA 3IMAB 3S5CA 1LOXA 1BSDA 1GOYA 2WOFA 1K8A4 5D81A 1RRHA 2CFWA 1BRGA 3G8ZA 1BNGA 1C7HA 4NREA 4BIRA 1KQS2 1T2IA 3BNDA 1O7WB 3KE7A 1X1YA 1D6ZA 1OF5B 2WGOA 4L8PA 3T8UA 1I70A 1FUTA 3CC43 3F8XA 3QRDA 1MWSA 3GWRA 4LSOA 3GZYB 3E99A 3WODG 4KT3B 5JPPA 1TU5A 1DE3A 4XB5A 1RGLA 4KVHA 1VQP3 3NHXA 3N9HA 3U1WA 3G0KA 4GSPA 1F8NA 3D5IA 3WOFB 3DGLA 3WA3A 2Y74A 3N54B 3MHEA 4XBYA 5M1AA 4WYKB 4AEQA 1IK3A 3Q3FA 5CXOA 2XFSA 1ZO2A 2GSPA 1QMAA 1BRJA 3CCE3 1B3SA 1NNVA 3ROBA 4WFOA 4HZ9B 1PY3A 4XDWA 1SPUA 2INXA 4KZ1A 1A2KA 4FCZA 1LQGC 1Z1SA 1RNBA 1FGOA 3X3YA 3CCL3 1AY7A 2XF3A 3V98A 1VQM3 4R4KA 4JF8A 3ZFZA 1ZX2A 4NHFA 1JB5A 3TDGA 1PU4A 1SIHA 2GU3A 3Q90A 5AIIA 6GSPA 1S723 3UL6A 4PEJA 2PNCA 5BU4A 1OGXA 1V58A 1JBRA 1C54A 3GRDA 2HMMB 3A5EA 3LXUX 1YHQ3 1ULJB 1UCLA 2JQ5A 4DKIA 1W01A 3K63A 3LMLA 4K1VA 3EBTA 1TUHA 1BUJA 3AMOB 1KSIA 1BSEA 1DMQA 1I0VA 2O9UX 3GZRA 3PGBA 5STDA 3MG1A 4EYCA 1GSPA 1WNHA 2BMRB 3EQQB 4CCVA 1YGWA 4HOHA 1BNSA 3MWZA 1MGRA 1JKGA 2XGLA 3RGRA 1QVG2 1IVXA 1DMMA 2JDIH 1JZOA 1W00A 1STFI 7GSPA 1CYVA 3CPOA 3J7Yd 1JJ22 5AIGA 2R4IA 2CX0A 2UUGC 1BGSA 1I2EA 1TRPA 5CK6A 4GHOA 3GZXB 4K90B 2BNGA 5AEWB 1ULIB 4XBTA 5BIRA 2F99A 3NQYA 1FGRA 4Q53A 3T0UA 1GYBA 1MGWA 2HMOB 2L1SA 2CKFB 1RJOA 1T2HA 4BTWA 2OTJ3 3OX9A 4N3VA 5A0OB 3UB1A 3OWSA 2ZDJA 2RSXA 5ELUA 3EBYA 9RNTA 2Z76A 1EQKA 1RCLA 4KFDA 1IV7A 2RNTA 3KKGA 4N6NB 2KCDA 5AYRB 4I4KA 2IA7A 4R1KA 1IVVA 1LOWA 4G1MB 3CME3 3SEDA 1VQL3 3X41A 2STDA 4RBNA 1CEWI 2OQEC 1NU3A 4CJNA 4HM2B 1BNIA 1IVUA 2AADA 1YVBI 2CC3A 2W9PA 3FSDA 4FR9A 5G1LA 1YJ93 3NBRA 1JNQA 1WMOA 2D1WA 1GMQA 4CPKA 3L0RA 3LT9A 1LQMB 4EV2A 1BRIA 4N6UA 3OWUA 1BSAA 4LGQA 2XH9A 2E2VA 4HZBB 2W9QA 2IUJA 3HIGA 5KP1A 2OQEA 1PYLA 1UW1A 3URPA 3LH4A 1GOVA 2PZVA 1LVNA 3MG2A 1O7PB 1YIT3 1IV9A 1KWIA 3BLZA 3SYUA 3D9RA 1B2SA 1A2PA 2UX0A 3BU4A 2QA43 1MOLA 4N6TA 2IY2A 2M7OA 1JBTA 1Q40B 2YX9A 1EEJA 5HGRA 2Y73A 5LC6A 7STDA 1X1UA 3JUQA 2BT3A 3HIIA 5G1KA 1BUQA 1OH0A 4HBRA 1NB5I 1OF5A 5CF1A 3VGNA 3DH2A 1HKXA 1JB2A 1N5PA 3NXJA 3GSPA 3FKAA 5I97A 1OPYA 4U13A 3F9SA 2BO9B 4MMYB 1JB4A 3G4S3 1A90A 1YI23 1VQ43 1JZDA 2GU1A 3WDGB 1US1A 1OACA 1BANA 1R4YA 5D83A 2OTL3 1NO3A 1I8VA 1BRKA 2W04A 4O8SA 1K28A 1N5HA 3LOYA 4WYKA 5IW9A 4X2OA 1S5AA 1VQQA 2XR8B 3X40A 3DGYA 1FUSA 3CMA3 4JRFA 1RN1A 2WO0A 5FGOA 2D42A 2K3DA 1VZZA 5EVHA 1Q814 2CW9A 1O7GB 4HM5B 4NPBA 4WP5A 3JUOA 3CCM3 1HYFA 1QJGA 1IQYA 2CFKA 3IJEB 3DGMA 2CFLA 3G713 3FG4A 2XRXB 4XDVA 3KSED 3MPHA 1M1XB 1QVF2 1TP6A 2WGQA 2RFRA 4J9AA 2CIUA 3HI7A 1I3IA 1JBSA 1B2XA 1RGGA 1TIJA 2C11A 3QK9A 4STDA 1K734 2E2TA 1BRNL 3EE1A 4HKVB 4H3UA 3LTAA 2UGIA 4L8OA 2KAAA 2HMJB 1EUIC 1ZS7A 4BL3A 5AIFA 3KIIA 5G2GA 1GD3A 3CCR3 1JN5B 3KSPA 3AMOA 2RGQA 3JUNA 4OVMA 1X1WA 5DREA 2W6JH 3OXAA 1B27A 4L7KA 2QEX3 4IPBA 3SXXA 2W56B 3BNCA 3FGYA 2RCDA 1RCKA 1NDOB 2GXFA 3ECFA 4AKYA 3CCU3 3V99A 4R9KA 4RNYA 1BU4A 4KFEA 2SBLA 5AI1A 3CCJ3 2RBIA 1U5OA 2CFDA 3RDEA 4HM1B 4J8TA 1UGHI 3NUVA 1WMPA 1AVLA 3U97A 1K41A 3WMDA 5KP4A 5M18A 3F40A 2HOHA 3S28A 5JPUA 2KXGA 2F4YA 3K0ZA 3IPTA 4IT7A 1RSNA 3PXMA 2I9WA 1FZUA 3SOAA 1YGEA 2H0HA 3B4PA 2XGNA 3PS8A 7RNTA 3FG1A 4EBGA 2F56A 1RNTA 3DY5A 3O8YA 3H3HA 3PZWA 2O3OA 1EA2A 4XM4A 1VQ93 1BNJA 1E97A 1LXEA 1O7NB 1BNFA 1N8R4 5IENA 1VQ73 3NM7A 3M8CA 1GS3A 8RNTA 1K9M4 1DYUA 1W2ZA 1TTOA 3UL5A 3F7XA 2Z6BA 1I2FA 3G16A 2YFLB 4EXRA 2P38A 1AVKA 2GBWB 2BMQB 1N9EA 3FCSB 4I5QA 5GSPA 5KP3A 2CG1A 1Q864 4MMZB 3H51A 1KC84 1GMPA 1FW7A 1W6CA 1Q9EA 2FXTA 1I0XA 2P0XA 3DM8A 1QAKA 2QGUA 2OOVC 2YFJB 2FGTA 3Q2PA 2CG0A 2ZA4A 3NBJA 3A76A 5TGNA 1GMRA 4HAAA 1WQLB 3CPW2 1UUGB 1TFKA 2BHMA 1RGFA 3K5TA 3NX0A 3CCV3 1DMNA 1W6GA 5M19A 3LTBA 1FGTA 3S29A 4RZMA 4TX4A 4CDLA 1Q40A 3BIRA 2OOVA 3S27A 1CYUA 1JV2B 2C4BA 3EJVA 2KF4A 5D82A 2C10A 3JVCA 3F14A 3SLUA 1OHPA 3RNTA 1LOVA 1OGZA 1OUNA 3VF1A 2BU4A 3X3ZA 3LYGA 5IEPA 3HOHA 1FUWA 3KZTA 1VQ83 1A2VA 1GD4A 1MWUA 1LNIA 1D6UA 1AR0A 1GOUA 1IVWA 2Z77A 1T3BA 2CWTA 2P09A 2LQVA 1FA3A 2W2CA 1RGHA 1B2UA 1QALA 2A15A 2CWUA 3AHWA 1M1K4 2AAEA 1SARA 4FCMA 4OK0A 3SX1A 1V74A 1IYYA 1T5YA 3LZAA 1VQN3 3MG3A 3WR2A 3JUMA 2GBXB 1Q7Y4 4BU4A 3EN8A 3B7CA 1KD14
chains in the Genus database with same CATH topology
1NWWA 1Q42A 1JRQA 4FMDA 3EC9A 1G96A 3I0YA 1EG9B 1WTHA 1STDA 3F8HA 4WHAA 1N8QA 4N6LA 2CWVA 1YJW3 3UJMA 4EV5A 3DGNA 1W6YA 1O7MB 2CFGA 4BTYA 3WA2X 3B8LA 2FNQA 1RN7A 2HMNB 4N6OB 2F98A 1R4CA 4K61A 1JN5A 1ROVA 3OV4A 4IIAA 3EHCA 3CCQ3 1ASKA 1D6YA 3DMCA 4HM7B 3FH1A 3NV0B 1UI8A 1SJWA 1UI7A 1ROAA 3K9MC 1GY6A 2GEXA 2L4VA 3CU3A 2W56A 4KFFA 2XEPA 5EQLA 3UNLA 1SIIA 1IDPA 3MSOA 3VSYA 1VQK3 3CNMA 5EEOA 5IF6A 2CHCA 4AKZA 5BVBA 2CH9A 3FF0A 4FMBA 4BTXA 2Q07A 3NQZA 3EN1B 4R80A 5IG0A 3HZPA 3PCRA 1AV4A 1SQWA 1YJN3 3ALAA 2XFTA 1M904 5ELJA 4N6V0 2HMLB 4O2HA 1W02A 5BXQA 1W4NA 2K54A 3MKIA 1NJI4 3CNXA 3SVAA 2ML5A 2MF7A 3BNEA 3EF8A 1GY7A 1UUWB 4O3VA 1CQSA 2Z7AA 3X3XA 3I563 3NBBA 4FMCA 3JUPA 3CD63 3CXC2 4LEHA 1RKYA 3FF2A 3DUKA 3OWYA 5IG3A 4HM6B 1J2BA 1A67A 3KFQC 1DVDA 1Q824 1VQ53 4FCJA 1IT7A 1YIJ3 3HK4A 2LYXA 2W0QA 5CLKA 1IQ8A 3LTDA 1N9JA 1RRLA 1MNLA 1LNHA 3WOEB 1GY5A 4X2HA 1W7CA 3STDA 3OW22 4R9LA 4MJDA 1HU9A 3EB8A 3RGAA 1FGQA 3D3LA 2B24B 1UUVB 4LZIA 4ZM8A 4MEIA 2YFIB 2B1XB 1M9GA 3BNBA 2ML6A 3S67A 1VQ63 5LC7A 1NB3I 2CK3H 1WMNA 4OUQA 3K7CA 3DGOA 3HX8A 3LTCA 2HMKB 4HM3B 4O02B 3X42A 4EC6A 5IERA 3CC23 3DXOA 3I553 3CC73 1E3VA 2XSOB 1OHOA 2MC8A 1ISKA 2K0MA 3FLJA 1L5GB 1Y4KA 4WWUC 1U8CB 4MMXB 1IU7A 3MYTA 3T8NA 1FGMA 3CCS3 1E3RA 1OCVA 3SOYA 1IT8A 4FMAA 1PFPA 1JKGB 2XSHB 1VQO3 3V92A 2P0MA 5IG5A 1W2B2 5IEOA 1O7HB 4ORLA 3FG3A 3NM2A 3PCSA 1IQXA 4HM0B 3LT8A 4HVNA 5AYSC 3B4OA 3F7SA 4H61A 4N6MA 6STDA 3BB9A 8CHOA 1QAFA 2BMOB 2OCTA 2WOHA 2W03A 2QIYA 4GB5A 2IUKA 3EX9A 1OHSA 2F86B 2ZL8A 2V1LA 2E2UA 4XBXA 2GEYA 2KRTA 4QWTA 5JBSA 4RNZA 1EKMA 3KN4A 3NV0A 4HYZA 4HM8B 5AIHA 5AEUB 1DVCA 3FZWA 3N8BA 5FW5A 1TFOA 4GL6A 2IMJA 3G6E3 4LMIA 3GZBA 3Q1CA 3ER7A 5DRVA 3DZLA 3GAXA 1W5ZA 2P05A 2OWPA 4HM4B 4K1UA 5CF2A 3PYJA 5IG4A 4HJLB 3IMAB 3S5CA 1LOXA 2WOFA 1K8A4 5D81A 1RRHA 2CFWA 4NREA 3G8ZA 1C7HA 1KQS2 3BNDA 1O7WB 3KE7A 1D6ZA 1OF5B 2WGOA 4L8PA 3T8UA 3CC43 3F8XA 3QRDA 3GWRA 4LSOA 3GZYB 3E99A 3WODG 5JPPA 1TU5A 4XB5A 4KVHA 1VQP3 3NHXA 3N9HA 3U1WA 3G0KA 1F8NA 3WOFB 3DGLA 3WA3A 2Y74A 3N54B 3MHEA 4XBYA 4WYKB 4AEQA 1IK3A 5CXOA 2XFSA 1ZO2A 1QMAA 3CCE3 3ROBA 4WFOA 4HZ9B 4XDWA 1SPUA 2INXA 4KZ1A 1A2KA 4FCZA 1Z1SA 1FGOA 3X3YA 3CCL3 2XF3A 3V98A 1VQM3 4R4KA 4JF8A 1ZX2A 4NHFA 1JB5A 3TDGA 1PU4A 1SIHA 2GU3A 3Q90A 5AIIA 1S723 3UL6A 4PEJA 2PNCA 1OGXA 3GRDA 2HMMB 3LXUX 1YHQ3 1ULJB 2JQ5A 1W01A 3K63A 3LMLA 4K1VA 3EBTA 1TUHA 3AMOB 1KSIA 1DMQA 3GZRA 2O9UX 3PGBA 5STDA 4EYCA 3MG1A 1WNHA 2BMRB 3EQQB 4CCVA 3MWZA 1JKGA 2XGLA 3RGRA 1QVG2 1IVXA 1DMMA 2JDIH 1W00A 1STFI 1CYVA 3CPOA 3J7Yd 1JJ22 5AIGA 2R4IA 5CK6A 4K90B 3GZXB 2BNGA 5AEWB 1ULIB 4XBTA 2F99A 3NQYA 1FGRA 4Q53A 3T0UA 1GYBA 2HMOB 2CKFB 1RJOA 4BTWA 2OTJ3 3OX9A 4N3VA 5A0OB 3UB1A 3OWSA 2ZDJA 2RSXA 5ELUA 3EBYA 1EQKA 2Z76A 4KFDA 1IV7A 3KKGA 4N6NB 2KCDA 5AYRB 4I4KA 2IA7A 4R1KA 1IVVA 4G1MB 3CME3 3SEDA 1VQL3 3X41A 2STDA 4RBNA 1CEWI 2OQEC 1NU3A 4HM2B 1IVUA 2CC3A 2W9PA 1YVBI 3FSDA 4FR9A 1YJ93 3NBRA 1JNQA 1WMOA 2D1WA 3L0RA 3LT9A 4EV2A 4N6UA 3OWUA 4LGQA 2XH9A 2E2VA 4HZBB 2W9QA 2IUJA 3HIGA 5KP1A 2OQEA 1UW1A 3LH4A 2PZVA 1LVNA 3MG2A 1O7PB 1YIT3 1IV9A 1KWIA 3BLZA 3D9RA 2QA43 2UX0A 1MOLA 4N6TA 2M7OA 1Q40B 2YX9A 5HGRA 2Y73A 5LC6A 7STDA 3JUQA 2BT3A 3HIIA 1BUQA 1OH0A 4HBRA 1NB5I 1OF5A 5CF1A 3VGNA 1HKXA 1JB2A 1N5PA 3NXJA 3FKAA 5I97A 1OPYA 4U13A 3F9SA 2BO9B 4MMYB 1JB4A 3G4S3 1A90A 1YI23 1VQ43 2GU1A 3WDGB 1US1A 1OACA 5D83A 2OTL3 1NO3A 2W04A 4O8SA 1K28A 1N5HA 3LOYA 4WYKA 5IW9A 4X2OA 1S5AA 2XR8B 3X40A 3CMA3 4JRFA 2WO0A 5FGOA 2D42A 5EVHA 1VZZA 1Q814 2CW9A 1O7GB 4HM5B 4WP5A 3CCM3 3JUOA 1QJGA 1IQYA 2CFKA 3IJEB 3DGMA 2CFLA 3G713 3FG4A 2XRXB 4XDVA 3KSED 3MPHA 1M1XB 1QVF2 1TP6A 2WGQA 2RFRA 4J9AA 2CIUA 3HI7A 1TIJA 2C11A 3QK9A 4STDA 1K734 2E2TA 3EE1A 4HKVB 4H3UA 3LTAA 4L8OA 2HMJB 5AIFA 3KIIA 5G2GA 1GD3A 3CCR3 1JN5B 3KSPA 3AMOA 2RGQA 3JUNA 4OVMA 5DREA 2W6JH 3OXAA 4L7KA 2QEX3 4IPBA 3SXXA 2W56B 3BNCA 3FGYA 2RCDA 2GXFA 1NDOB 3ECFA 4AKYA 3CCU3 3V99A 4R9KA 4RNYA 4KFEA 2SBLA 5AI1A 3CCJ3 1U5OA 2CFDA 3RDEA 4HM1B 4J8TA 3NUVA 1WMPA 1AVLA 3U97A 1K41A 3WMDA 5KP4A 3F40A 3S28A 5JPUA 2KXGA 3K0ZA 3IPTA 4IT7A 3PXMA 2I9WA 3SOAA 1YGEA 3B4PA 2XGNA 3PS8A 3FG1A 4EBGA 3DY5A 3O8YA 3PZWA 3H3HA 4XM4A 2O3OA 1EA2A 1VQ93 1E97A 1LXEA 1O7NB 1N8R4 5IENA 1VQ73 3NM7A 3M8CA 1GS3A 1K9M4 1DYUA 1W2ZA 3UL5A 3F7XA 2Z6BA 3G16A 2YFLB 4EXRA 2P38A 1AVKA 2GBWB 2BMQB 1N9EA 3FCSB 5KP3A 2CG1A 1Q864 4MMZB 3H51A 1KC84 1W6CA 3DM8A 2FXTA 2P0XA 1QAKA 2QGUA 2OOVC 2YFJB 2FGTA 3Q2PA 2CG0A 3NBJA 3A76A 5TGNA 1WQLB 3CPW2 1TFKA 2BHMA 3K5TA 3NX0A 3CCV3 1DMNA 1W6GA 3LTBA 1FGTA 3S29A 4RZMA 4TX4A 4CDLA 1Q40A 2OOVA 3S27A 1CYUA 1JV2B 3EJVA 5D82A 2C10A 3JVCA 3F14A 3SLUA 1OHPA 1OGZA 1OUNA 3VF1A 3X3ZA 3LYGA 5IEPA 1FUWA 3KZTA 1VQ83 1A2VA 1GD4A 1D6UA 1AR0A 1IVWA 2Z77A 2CWTA 2P09A 2LQVA 1FA3A 2W2CA 1QALA 2A15A 2CWUA 1M1K4 4FCMA 4OK0A 3SX1A 1V74A 1T5YA 3LZAA 1VQN3 3MG3A 3JUMA 2GBXB 1Q7Y4 3EN8A 3B7CA 1KD14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 3;  1VQ4 3;  3I56 3;  1KQS 2;  1Q86 4;  1VQO 3;  1W2B 2;  3CCE 3;  1K73 4;  3CXC 2;  3CD6 3;  2OTJ 3;  1KC8 4;  2OTL 3;  3CC2 3;  1VQK 3;  1YIT 3;  1VQ8 3;  3I55 3;  3CC7 3;  2QA4 3;  1YJW 3;  1Q82 4;  3CCR 3;  1VQ5 3;  3CME 3;  1K8A 4;  3CC4 3;  3CMA 3;  1VQL 3;  1YIJ 3;  3CCL 3;  3G6E 3;  1VQM 3;  1Q81 4;  1QVG 2;  1YJN 3;  3CPW 2;  1M90 4;  3CCM 3;  1VQP 3;  2QEX 3;  3CCV 3;  1VQ9 3;  1JJ2 2;  1YJ9 3;  1S72 3;  1N8R 4;  3G71 3;  3OW2 2;  1M1K 4;  1NJI 4;  3CCS 3;  1VQ7 3;  3CCU 3;  1QVF 2;  3CCQ 3;  1K9M 4;  1YHQ 3;  1VQN 3;  1Q7Y 4;  1VQ6 3;  3G4S 3;  1KD1 4;  3CCJ 3; 
#chains in the Genus database with same CATH topology
 1RHL A;  1NWW A;  6RNT A;  1Q42 A;  1JRQ A;  1UDI I;  4FMD A;  1BRS A;  3EC9 A;  1BRH A;  4J5G A;  1G96 A;  3I0Y A;  1EG9 B;  1WTH A;  1STD A;  2J8X B;  3F8H A;  4WHA A;  1RGK A;  1N8Q A;  4N6L A;  2CWV A;  1BOX A;  1YJW 3;  3UJM A;  2KF3 A;  2F5M A;  5RNT A;  4BTX A;  1ZGX A;  1BVI A;  3DGN A;  4EV5 A;  1W6Y A;  1BNR A;  1O7M B;  2CFG A;  3D79 A;  4BTY A;  3WA2 X;  3B8L A;  2FNQ A;  1RN7 A;  2HMN B;  4N6O B;  2F98 A;  1R4C A;  4K61 A;  1JN5 A;  1ROV A;  3OV4 A;  4IIA A;  3EHC A;  1HZ1 A;  3CCQ 3;  1BNE A;  1ASK A;  1D6Y A;  3DMC A;  4HM7 B;  3FH1 A;  3NV0 B;  1X1X A;  1UI8 A;  1SJW A;  1UI7 A;  1ROA A;  3K9M C;  1GY6 A;  2GEX A;  2L4V A;  3CU3 A;  3KCH A;  2W56 A;  4KFF A;  2XEP A;  2CX1 A;  5EQL A;  1SII A;  4LYL B;  1IDP A;  3MSO A;  3UNL A;  3D4A A;  3VSY A;  3ZG5 A;  4J5K A;  1VQK 3;  3CNM A;  5EEO A;  5IF6 A;  2CHC A;  4AKZ A;  5BVB A;  1LRA A;  2CH9 A;  3FF0 A;  1RMS A;  4FMB A;  2Q07 A;  3NQZ A;  3EN1 B;  4R80 A;  5IG0 A;  3HZP A;  3PCR A;  3WHO A;  1AV4 A;  1SQW A;  3ZG0 A;  1YJN 3;  3ALA A;  2XFT A;  1M90 4;  5ELJ A;  4N6V 0;  2HML B;  4O2H A;  1W02 A;  5BXQ A;  4ILF A;  1W4N A;  4EW5 A;  2K54 A;  2R41 A;  3MKI A;  1NJI 4;  3CNX A;  3SVA A;  2ML5 A;  2MF7 A;  3BNE A;  3EF8 A;  1GY7 A;  1UUW B;  3AGN A;  4O3V A;  1CQS A;  1RDS A;  1RGC A;  2Z7A A;  3X3X A;  3I56 3;  3NBB A;  4FMC A;  3JUP A;  3CD6 3;  3CXC 2;  4LEH A;  1RN4 A;  1RKY A;  1UGI A;  3FF2 A;  3DUK A;  2ZHX B;  2SAR A;  3OWY A;  4HM6 B;  5IG3 A;  1J2B A;  1AQZ A;  1B2Z A;  1UCJ A;  3KFQ C;  1A67 A;  1G0T A;  1DVD A;  1Q82 4;  1VQ5 3;  4FCJ A;  1IT7 A;  1YIJ 3;  3HK4 A;  2LYX A;  1MWT A;  2W0Q A;  5CLK A;  1IQ8 A;  3LTD A;  1N9J A;  1RRL A;  1MNL A;  1LNH A;  3WOE B;  1GY5 A;  4X2H A;  1W7C A;  3STD A;  3OW2 2;  4R9L A;  4MJD A;  1HU9 A;  1CH0 A;  2F5W A;  3EB8 A;  3RGA A;  1FGQ A;  3D3L A;  2B24 B;  1UUV B;  4LZI A;  4ZM8 A;  1G02 A;  4MEI A;  2YFI B;  2B1X B;  1M9G A;  3BNB A;  1YNV X;  2ML6 A;  2BIR A;  3S67 A;  5LC7 A;  1VQ6 3;  1NB3 I;  2CK3 H;  1WMN A;  4OUQ A;  3K7C A;  1I3F A;  3DGO A;  3HX8 A;  3LTC A;  2HMK B;  4HM3 B;  4O02 B;  3X42 A;  4EC6 A;  5IER A;  3CC2 3;  3DXO A;  3I55 3;  3CC7 3;  1E3V A;  4RNT A;  2XSO B;  1OHO A;  1BSB A;  2MC8 A;  1ISK A;  2K0M A;  3FLJ A;  1L5G B;  1Y4K A;  4WWU C;  1U8C B;  4MMX B;  1IU7 A;  1DET A;  1Q7H A;  3MYT A;  3T8N A;  1UCK A;  1FGM A;  2KF5 A;  1B20 A;  1RTU A;  1MWR A;  3CCS 3;  1E3R A;  1OCV A;  1RGA A;  3SOY A;  1IT8 A;  4FMA A;  1PFP A;  1V57 A;  1JKG B;  2XSH B;  3D5G A;  1VQO 3;  2IYJ A;  2P0M A;  3V92 A;  5IG5 A;  1W2B 2;  5IEO A;  1O7H B;  4ORL A;  3FG3 A;  3NM2 A;  3AGO A;  3PCS A;  4BL2 A;  1IQX A;  1BAO A;  4HM0 B;  3LT8 A;  1BIR A;  4HVN A;  5AYS C;  1BSC A;  1RGE A;  3B4O A;  3F7S A;  4H61 A;  4N6M A;  6STD A;  2KF6 A;  3BB9 A;  8CHO A;  1QAF A;  2BMO B;  1B2M A;  2OCT A;  2WOH A;  2H0G A;  2W03 A;  2QIY A;  4GB5 A;  1RLS A;  2IUK A;  3EX9 A;  1OHS A;  2F86 B;  5HOH A;  2ZL8 A;  2V1L A;  2E2U A;  4XBX A;  2GEY A;  2KRT A;  1B21 A;  4QWT A;  2H0I A;  5JBS A;  4RNZ A;  1EKM A;  3KN4 A;  3NV0 A;  1LOY A;  4HYZ A;  4HM8 B;  1YVS A;  5AIH A;  1TJD A;  5AEU B;  1DVC A;  3FZW A;  3N8B A;  1I2G A;  1TFO A;  5FW5 A;  4GL6 A;  2IMJ A;  3G6E 3;  1UCI A;  4LMI A;  3GZB A;  3Q1C A;  3ER7 A;  5DRV A;  1TRQ A;  3DZL A;  3GAX A;  1W5Z A;  2P05 A;  2OWP A;  4HM4 B;  4K1U A;  5CF2 A;  1FYS A;  3PYJ A;  5IG4 A;  4HJL B;  3AHS A;  3IMA B;  3S5C A;  1LOX A;  1BSD A;  1GOY A;  2WOF A;  1K8A 4;  5D81 A;  1RRH A;  2CFW A;  1BRG A;  3G8Z A;  1BNG A;  1C7H A;  4NRE A;  4BIR A;  1KQS 2;  1T2I A;  3BND A;  1O7W B;  3KE7 A;  1X1Y A;  1D6Z A;  1OF5 B;  2WGO A;  4L8P A;  3T8U A;  1I70 A;  1FUT A;  3CC4 3;  3F8X A;  3QRD A;  1MWS A;  3GWR A;  4LSO A;  3GZY B;  3E99 A;  3WOD G;  4KT3 B;  5JPP A;  1TU5 A;  1DE3 A;  4XB5 A;  1RGL A;  4KVH A;  1VQP 3;  3NHX A;  3N9H A;  3U1W A;  3G0K A;  4GSP A;  1F8N A;  3D5I A;  3WOF B;  3DGL A;  3WA3 A;  2Y74 A;  3N54 B;  3MHE A;  4XBY A;  5M1A A;  4WYK B;  4AEQ A;  1IK3 A;  3Q3F A;  5CXO A;  2XFS A;  1ZO2 A;  2GSP A;  1QMA A;  1BRJ A;  3CCE 3;  1B3S A;  1NNV A;  3ROB A;  4WFO A;  4HZ9 B;  1PY3 A;  4XDW A;  1SPU A;  2INX A;  4KZ1 A;  1A2K A;  4FCZ A;  1LQG C;  1Z1S A;  1RNB A;  1FGO A;  3X3Y A;  3CCL 3;  1AY7 A;  2XF3 A;  3V98 A;  1VQM 3;  4R4K A;  4JF8 A;  3ZFZ A;  1ZX2 A;  4NHF A;  1JB5 A;  3TDG A;  1PU4 A;  1SIH A;  2GU3 A;  3Q90 A;  5AII A;  6GSP A;  1S72 3;  3UL6 A;  4PEJ A;  2PNC A;  5BU4 A;  1OGX A;  1V58 A;  1JBR A;  1C54 A;  3GRD A;  2HMM B;  3A5E A;  3LXU X;  1YHQ 3;  1ULJ B;  1UCL A;  2JQ5 A;  4DKI A;  1W01 A;  3K63 A;  3LML A;  4K1V A;  3EBT A;  1TUH A;  1BUJ A;  3AMO B;  1KSI A;  1BSE A;  1DMQ A;  1I0V A;  2O9U X;  3GZR A;  3PGB A;  5STD A;  3MG1 A;  4EYC A;  1GSP A;  1WNH A;  2BMR B;  3EQQ B;  4CCV A;  1YGW A;  4HOH A;  1BNS A;  3MWZ A;  1MGR A;  1JKG A;  2XGL A;  3RGR A;  1QVG 2;  1IVX A;  1DMM A;  2JDI H;  1JZO A;  1W00 A;  1STF I;  7GSP A;  1CYV A;  3CPO A;  3J7Y d;  1JJ2 2;  5AIG A;  2R4I A;  2CX0 A;  2UUG C;  1BGS A;  1I2E A;  1TRP A;  5CK6 A;  4GHO A;  3GZX B;  4K90 B;  2BNG A;  5AEW B;  1ULI B;  4XBT A;  5BIR A;  2F99 A;  3NQY A;  1FGR A;  4Q53 A;  3T0U A;  1GYB A;  1MGW A;  2HMO B;  2L1S A;  2CKF B;  1RJO A;  1T2H A;  4BTW A;  2OTJ 3;  3OX9 A;  4N3V A;  5A0O B;  3UB1 A;  3OWS A;  2ZDJ A;  2RSX A;  5ELU A;  3EBY A;  9RNT A;  2Z76 A;  1EQK A;  1RCL A;  4KFD A;  1IV7 A;  2RNT A;  3KKG A;  4N6N B;  2KCD A;  5AYR B;  4I4K A;  2IA7 A;  4R1K A;  1IVV A;  1LOW A;  4G1M B;  3CME 3;  3SED A;  1VQL 3;  3X41 A;  2STD A;  4RBN A;  1CEW I;  2OQE C;  1NU3 A;  4CJN A;  4HM2 B;  1BNI A;  1IVU A;  2AAD A;  1YVB I;  2CC3 A;  2W9P A;  3FSD A;  4FR9 A;  5G1L A;  1YJ9 3;  3NBR A;  1JNQ A;  1WMO A;  2D1W A;  1GMQ A;  4CPK A;  3L0R A;  3LT9 A;  1LQM B;  4EV2 A;  1BRI A;  4N6U A;  3OWU A;  1BSA A;  4LGQ A;  2XH9 A;  2E2V A;  4HZB B;  2W9Q A;  2IUJ A;  3HIG A;  5KP1 A;  2OQE A;  1PYL A;  1UW1 A;  3URP A;  3LH4 A;  1GOV A;  2PZV A;  1LVN A;  3MG2 A;  1O7P B;  1YIT 3;  1IV9 A;  1KWI A;  3BLZ A;  3SYU A;  3D9R A;  1B2S A;  1A2P A;  2UX0 A;  3BU4 A;  2QA4 3;  1MOL A;  4N6T A;  2IY2 A;  2M7O A;  1JBT A;  1Q40 B;  2YX9 A;  1EEJ A;  5HGR A;  2Y73 A;  5LC6 A;  7STD A;  1X1U A;  3JUQ A;  2BT3 A;  3HII A;  5G1K A;  1BUQ A;  1OH0 A;  4HBR A;  1NB5 I;  1OF5 A;  5CF1 A;  3VGN A;  3DH2 A;  1HKX A;  1JB2 A;  1N5P A;  3NXJ A;  3GSP A;  3FKA A;  5I97 A;  1OPY A;  4U13 A;  3F9S A;  2BO9 B;  4MMY B;  1JB4 A;  3G4S 3;  1A90 A;  1YI2 3;  1VQ4 3;  1JZD A;  2GU1 A;  3WDG B;  1US1 A;  1OAC A;  1BAN A;  1R4Y A;  5D83 A;  2OTL 3;  1NO3 A;  1I8V A;  1BRK A;  2W04 A;  4O8S A;  1K28 A;  1N5H A;  3LOY A;  4WYK A;  5IW9 A;  4X2O A;  1S5A A;  1VQQ A;  2XR8 B;  3X40 A;  3DGY A;  1FUS A;  3CMA 3;  4JRF A;  1RN1 A;  2WO0 A;  5FGO A;  2D42 A;  2K3D A;  1VZZ A;  5EVH A;  1Q81 4;  2CW9 A;  1O7G B;  4HM5 B;  4NPB A;  4WP5 A;  3JUO A;  3CCM 3;  1HYF A;  1QJG A;  1IQY A;  2CFK A;  3IJE B;  3DGM A;  2CFL A;  3G71 3;  3FG4 A;  2XRX B;  4XDV A;  3KSE D;  3MPH A;  1M1X B;  1QVF 2;  1TP6 A;  2WGQ A;  2RFR A;  4J9A A;  2CIU A;  3HI7 A;  1I3I A;  1JBS A;  1B2X A;  1RGG A;  1TIJ A;  2C11 A;  3QK9 A;  4STD A;  1K73 4;  2E2T A;  1BRN L;  3EE1 A;  4HKV B;  4H3U A;  3LTA A;  2UGI A;  4L8O A;  2KAA A;  2HMJ B;  1EUI C;  1ZS7 A;  4BL3 A;  5AIF A;  3KII A;  5G2G A;  1GD3 A;  3CCR 3;  1JN5 B;  3KSP A;  3AMO A;  2RGQ A;  3JUN A;  4OVM A;  1X1W A;  5DRE A;  2W6J H;  3OXA A;  1B27 A;  4L7K A;  2QEX 3;  4IPB A;  3SXX A;  2W56 B;  3BNC A;  3FGY A;  2RCD A;  1RCK A;  1NDO B;  2GXF A;  3ECF A;  4AKY A;  3CCU 3;  3V99 A;  4R9K A;  4RNY A;  1BU4 A;  4KFE A;  2SBL A;  5AI1 A;  3CCJ 3;  2RBI A;  1U5O A;  2CFD A;  3RDE A;  4HM1 B;  4J8T A;  1UGH I;  3NUV A;  1WMP A;  1AVL A;  3U97 A;  1K41 A;  3WMD A;  5KP4 A;  5M18 A;  3F40 A;  2HOH A;  3S28 A;  5JPU A;  2KXG A;  2F4Y A;  3K0Z A;  3IPT A;  4IT7 A;  1RSN A;  3PXM A;  2I9W A;  1FZU A;  3SOA A;  1YGE A;  2H0H A;  3B4P A;  2XGN A;  3PS8 A;  7RNT A;  3FG1 A;  4EBG A;  2F56 A;  1RNT A;  3DY5 A;  3O8Y A;  3H3H A;  3PZW A;  2O3O A;  1EA2 A;  4XM4 A;  1VQ9 3;  1BNJ A;  1E97 A;  1LXE A;  1O7N B;  1BNF A;  1N8R 4;  5IEN A;  1VQ7 3;  3NM7 A;  3M8C A;  1GS3 A;  8RNT A;  1K9M 4;  1DYU A;  1W2Z A;  1TTO A;  3UL5 A;  3F7X A;  2Z6B A;  1I2F A;  3G16 A;  2YFL B;  4EXR A;  2P38 A;  1AVK A;  2GBW B;  2BMQ B;  1N9E A;  3FCS B;  4I5Q A;  5GSP A;  5KP3 A;  2CG1 A;  1Q86 4;  4MMZ B;  3H51 A;  1KC8 4;  1GMP A;  1FW7 A;  1W6C A;  1Q9E A;  2FXT A;  1I0X A;  2P0X A;  3DM8 A;  1QAK A;  2QGU A;  2OOV C;  2YFJ B;  2FGT A;  3Q2P A;  2CG0 A;  2ZA4 A;  3NBJ A;  3A76 A;  5TGN A;  1GMR A;  4HAA A;  1WQL B;  3CPW 2;  1UUG B;  1TFK A;  2BHM A;  1RGF A;  3K5T A;  3NX0 A;  3CCV 3;  1DMN A;  1W6G A;  5M19 A;  3LTB A;  1FGT A;  3S29 A;  4RZM A;  4TX4 A;  4CDL A;  1Q40 A;  3BIR A;  2OOV A;  3S27 A;  1CYU A;  1JV2 B;  2C4B A;  3EJV A;  2KF4 A;  5D82 A;  2C10 A;  3JVC A;  3F14 A;  3SLU A;  1OHP A;  3RNT A;  1LOV A;  1OGZ A;  1OUN A;  3VF1 A;  2BU4 A;  3X3Z A;  3LYG A;  5IEP A;  3HOH A;  1FUW A;  3KZT A;  1VQ8 3;  1A2V A;  1GD4 A;  1MWU A;  1LNI A;  1D6U A;  1AR0 A;  1GOU A;  1IVW A;  2Z77 A;  1T3B A;  2CWT A;  2P09 A;  2LQV A;  1FA3 A;  2W2C A;  1RGH A;  1B2U A;  1QAL A;  2A15 A;  2CWU A;  3AHW A;  1M1K 4;  2AAE A;  1SAR A;  4FCM A;  4OK0 A;  3SX1 A;  1V74 A;  1IYY A;  1T5Y A;  3LZA A;  1VQN 3;  3MG3 A;  3WR2 A;  3JUM A;  2GBX B;  1Q7Y 4;  4BU4 A;  3EN8 A;  3B7C A;  1KD1 4; 
#chains in the Genus database with same CATH homology
 1NWW A;  1Q42 A;  1JRQ A;  4FMD A;  3EC9 A;  1G96 A;  3I0Y A;  1EG9 B;  1WTH A;  1STD A;  3F8H A;  4WHA A;  1N8Q A;  4N6L A;  2CWV A;  1YJW 3;  3UJM A;  4EV5 A;  3DGN A;  1W6Y A;  1O7M B;  2CFG A;  4BTY A;  3WA2 X;  3B8L A;  2FNQ A;  1RN7 A;  2HMN B;  4N6O B;  2F98 A;  1R4C A;  4K61 A;  1JN5 A;  1ROV A;  3OV4 A;  4IIA A;  3EHC A;  3CCQ 3;  1ASK A;  1D6Y A;  3DMC A;  4HM7 B;  3FH1 A;  3NV0 B;  1UI8 A;  1SJW A;  1UI7 A;  1ROA A;  3K9M C;  1GY6 A;  2GEX A;  2L4V A;  3CU3 A;  2W56 A;  4KFF A;  2XEP A;  5EQL A;  3UNL A;  1SII A;  1IDP A;  3MSO A;  3VSY A;  1VQK 3;  3CNM A;  5EEO A;  5IF6 A;  2CHC A;  4AKZ A;  5BVB A;  2CH9 A;  3FF0 A;  4FMB A;  4BTX A;  2Q07 A;  3NQZ A;  3EN1 B;  4R80 A;  5IG0 A;  3HZP A;  3PCR A;  1AV4 A;  1SQW A;  1YJN 3;  3ALA A;  2XFT A;  1M90 4;  5ELJ A;  4N6V 0;  2HML B;  4O2H A;  1W02 A;  5BXQ A;  1W4N A;  2K54 A;  3MKI A;  1NJI 4;  3CNX A;  3SVA A;  2ML5 A;  2MF7 A;  3BNE A;  3EF8 A;  1GY7 A;  1UUW B;  4O3V A;  1CQS A;  2Z7A A;  3X3X A;  3I56 3;  3NBB A;  4FMC A;  3JUP A;  3CD6 3;  3CXC 2;  4LEH A;  1RKY A;  3FF2 A;  3DUK A;  3OWY A;  5IG3 A;  4HM6 B;  1J2B A;  1A67 A;  3KFQ C;  1DVD A;  1Q82 4;  1VQ5 3;  4FCJ A;  1IT7 A;  1YIJ 3;  3HK4 A;  2LYX A;  2W0Q A;  5CLK A;  1IQ8 A;  3LTD A;  1N9J A;  1RRL A;  1MNL A;  1LNH A;  3WOE B;  1GY5 A;  4X2H A;  1W7C A;  3STD A;  3OW2 2;  4R9L A;  4MJD A;  1HU9 A;  3EB8 A;  3RGA A;  1FGQ A;  3D3L A;  2B24 B;  1UUV B;  4LZI A;  4ZM8 A;  4MEI A;  2YFI B;  2B1X B;  1M9G A;  3BNB A;  2ML6 A;  3S67 A;  1VQ6 3;  5LC7 A;  1NB3 I;  2CK3 H;  1WMN A;  4OUQ A;  3K7C A;  3DGO A;  3HX8 A;  3LTC A;  2HMK B;  4HM3 B;  4O02 B;  3X42 A;  4EC6 A;  5IER A;  3CC2 3;  3DXO A;  3I55 3;  3CC7 3;  1E3V A;  2XSO B;  1OHO A;  2MC8 A;  1ISK A;  2K0M A;  3FLJ A;  1L5G B;  1Y4K A;  4WWU C;  1U8C B;  4MMX B;  1IU7 A;  3MYT A;  3T8N A;  1FGM A;  3CCS 3;  1E3R A;  1OCV A;  3SOY A;  1IT8 A;  4FMA A;  1PFP A;  1JKG B;  2XSH B;  1VQO 3;  3V92 A;  2P0M A;  5IG5 A;  1W2B 2;  5IEO A;  1O7H B;  4ORL A;  3FG3 A;  3NM2 A;  3PCS A;  1IQX A;  4HM0 B;  3LT8 A;  4HVN A;  5AYS C;  3B4O A;  3F7S A;  4H61 A;  4N6M A;  6STD A;  3BB9 A;  8CHO A;  1QAF A;  2BMO B;  2OCT A;  2WOH A;  2W03 A;  2QIY A;  4GB5 A;  2IUK A;  3EX9 A;  1OHS A;  2F86 B;  2ZL8 A;  2V1L A;  2E2U A;  4XBX A;  2GEY A;  2KRT A;  4QWT A;  5JBS A;  4RNZ A;  1EKM A;  3KN4 A;  3NV0 A;  4HYZ A;  4HM8 B;  5AIH A;  5AEU B;  1DVC A;  3FZW A;  3N8B A;  5FW5 A;  1TFO A;  4GL6 A;  2IMJ A;  3G6E 3;  4LMI A;  3GZB A;  3Q1C A;  3ER7 A;  5DRV A;  3DZL A;  3GAX A;  1W5Z A;  2P05 A;  2OWP A;  4HM4 B;  4K1U A;  5CF2 A;  3PYJ A;  5IG4 A;  4HJL B;  3IMA B;  3S5C A;  1LOX A;  2WOF A;  1K8A 4;  5D81 A;  1RRH A;  2CFW A;  4NRE A;  3G8Z A;  1C7H A;  1KQS 2;  3BND A;  1O7W B;  3KE7 A;  1D6Z A;  1OF5 B;  2WGO A;  4L8P A;  3T8U A;  3CC4 3;  3F8X A;  3QRD A;  3GWR A;  4LSO A;  3GZY B;  3E99 A;  3WOD G;  5JPP A;  1TU5 A;  4XB5 A;  4KVH A;  1VQP 3;  3NHX A;  3N9H A;  3U1W A;  3G0K A;  1F8N A;  3WOF B;  3DGL A;  3WA3 A;  2Y74 A;  3N54 B;  3MHE A;  4XBY A;  4WYK B;  4AEQ A;  1IK3 A;  5CXO A;  2XFS A;  1ZO2 A;  1QMA A;  3CCE 3;  3ROB A;  4WFO A;  4HZ9 B;  4XDW A;  1SPU A;  2INX A;  4KZ1 A;  1A2K A;  4FCZ A;  1Z1S A;  1FGO A;  3X3Y A;  3CCL 3;  2XF3 A;  3V98 A;  1VQM 3;  4R4K A;  4JF8 A;  1ZX2 A;  4NHF A;  1JB5 A;  3TDG A;  1PU4 A;  1SIH A;  2GU3 A;  3Q90 A;  5AII A;  1S72 3;  3UL6 A;  4PEJ A;  2PNC A;  1OGX A;  3GRD A;  2HMM B;  3LXU X;  1YHQ 3;  1ULJ B;  2JQ5 A;  1W01 A;  3K63 A;  3LML A;  4K1V A;  3EBT A;  1TUH A;  3AMO B;  1KSI A;  1DMQ A;  3GZR A;  2O9U X;  3PGB A;  5STD A;  4EYC A;  3MG1 A;  1WNH A;  2BMR B;  3EQQ B;  4CCV A;  3MWZ A;  1JKG A;  2XGL A;  3RGR A;  1QVG 2;  1IVX A;  1DMM A;  2JDI H;  1W00 A;  1STF I;  1CYV A;  3CPO A;  3J7Y d;  1JJ2 2;  5AIG A;  2R4I A;  5CK6 A;  4K90 B;  3GZX B;  2BNG A;  5AEW B;  1ULI B;  4XBT A;  2F99 A;  3NQY A;  1FGR A;  4Q53 A;  3T0U A;  1GYB A;  2HMO B;  2CKF B;  1RJO A;  4BTW A;  2OTJ 3;  3OX9 A;  4N3V A;  5A0O B;  3UB1 A;  3OWS A;  2ZDJ A;  2RSX A;  5ELU A;  3EBY A;  1EQK A;  2Z76 A;  4KFD A;  1IV7 A;  3KKG A;  4N6N B;  2KCD A;  5AYR B;  4I4K A;  2IA7 A;  4R1K A;  1IVV A;  4G1M B;  3CME 3;  3SED A;  1VQL 3;  3X41 A;  2STD A;  4RBN A;  1CEW I;  2OQE C;  1NU3 A;  4HM2 B;  1IVU A;  2CC3 A;  2W9P A;  1YVB I;  3FSD A;  4FR9 A;  1YJ9 3;  3NBR A;  1JNQ A;  1WMO A;  2D1W A;  3L0R A;  3LT9 A;  4EV2 A;  4N6U A;  3OWU A;  4LGQ A;  2XH9 A;  2E2V A;  4HZB B;  2W9Q A;  2IUJ A;  3HIG A;  5KP1 A;  2OQE A;  1UW1 A;  3LH4 A;  2PZV A;  1LVN A;  3MG2 A;  1O7P B;  1YIT 3;  1IV9 A;  1KWI A;  3BLZ A;  3D9R A;  2QA4 3;  2UX0 A;  1MOL A;  4N6T A;  2M7O A;  1Q40 B;  2YX9 A;  5HGR A;  2Y73 A;  5LC6 A;  7STD A;  3JUQ A;  2BT3 A;  3HII A;  1BUQ A;  1OH0 A;  4HBR A;  1NB5 I;  1OF5 A;  5CF1 A;  3VGN A;  1HKX A;  1JB2 A;  1N5P A;  3NXJ A;  3FKA A;  5I97 A;  1OPY A;  4U13 A;  3F9S A;  2BO9 B;  4MMY B;  1JB4 A;  3G4S 3;  1A90 A;  1YI2 3;  1VQ4 3;  2GU1 A;  3WDG B;  1US1 A;  1OAC A;  5D83 A;  2OTL 3;  1NO3 A;  2W04 A;  4O8S A;  1K28 A;  1N5H A;  3LOY A;  4WYK A;  5IW9 A;  4X2O A;  1S5A A;  2XR8 B;  3X40 A;  3CMA 3;  4JRF A;  2WO0 A;  5FGO A;  2D42 A;  5EVH A;  1VZZ A;  1Q81 4;  2CW9 A;  1O7G B;  4HM5 B;  4WP5 A;  3CCM 3;  3JUO A;  1QJG A;  1IQY A;  2CFK A;  3IJE B;  3DGM A;  2CFL A;  3G71 3;  3FG4 A;  2XRX B;  4XDV A;  3KSE D;  3MPH A;  1M1X B;  1QVF 2;  1TP6 A;  2WGQ A;  2RFR A;  4J9A A;  2CIU A;  3HI7 A;  1TIJ A;  2C11 A;  3QK9 A;  4STD A;  1K73 4;  2E2T A;  3EE1 A;  4HKV B;  4H3U A;  3LTA A;  4L8O A;  2HMJ B;  5AIF A;  3KII A;  5G2G A;  1GD3 A;  3CCR 3;  1JN5 B;  3KSP A;  3AMO A;  2RGQ A;  3JUN A;  4OVM A;  5DRE A;  2W6J H;  3OXA A;  4L7K A;  2QEX 3;  4IPB A;  3SXX A;  2W56 B;  3BNC A;  3FGY A;  2RCD A;  2GXF A;  1NDO B;  3ECF A;  4AKY A;  3CCU 3;  3V99 A;  4R9K A;  4RNY A;  4KFE A;  2SBL A;  5AI1 A;  3CCJ 3;  1U5O A;  2CFD A;  3RDE A;  4HM1 B;  4J8T A;  3NUV A;  1WMP A;  1AVL A;  3U97 A;  1K41 A;  3WMD A;  5KP4 A;  3F40 A;  3S28 A;  5JPU A;  2KXG A;  3K0Z A;  3IPT A;  4IT7 A;  3PXM A;  2I9W A;  3SOA A;  1YGE A;  3B4P A;  2XGN A;  3PS8 A;  3FG1 A;  4EBG A;  3DY5 A;  3O8Y A;  3PZW A;  3H3H A;  4XM4 A;  2O3O A;  1EA2 A;  1VQ9 3;  1E97 A;  1LXE A;  1O7N B;  1N8R 4;  5IEN A;  1VQ7 3;  3NM7 A;  3M8C A;  1GS3 A;  1K9M 4;  1DYU A;  1W2Z A;  3UL5 A;  3F7X A;  2Z6B A;  3G16 A;  2YFL B;  4EXR A;  2P38 A;  1AVK A;  2GBW B;  2BMQ B;  1N9E A;  3FCS B;  5KP3 A;  2CG1 A;  1Q86 4;  4MMZ B;  3H51 A;  1KC8 4;  1W6C A;  3DM8 A;  2FXT A;  2P0X A;  1QAK A;  2QGU A;  2OOV C;  2YFJ B;  2FGT A;  3Q2P A;  2CG0 A;  3NBJ A;  3A76 A;  5TGN A;  1WQL B;  3CPW 2;  1TFK A;  2BHM A;  3K5T A;  3NX0 A;  3CCV 3;  1DMN A;  1W6G A;  3LTB A;  1FGT A;  3S29 A;  4RZM A;  4TX4 A;  4CDL A;  1Q40 A;  2OOV A;  3S27 A;  1CYU A;  1JV2 B;  3EJV A;  5D82 A;  2C10 A;  3JVC A;  3F14 A;  3SLU A;  1OHP A;  1OGZ A;  1OUN A;  3VF1 A;  3X3Z A;  3LYG A;  5IEP A;  1FUW A;  3KZT A;  1VQ8 3;  1A2V A;  1GD4 A;  1D6U A;  1AR0 A;  1IVW A;  2Z77 A;  2CWT A;  2P09 A;  2LQV A;  1FA3 A;  2W2C A;  1QAL A;  2A15 A;  2CWU A;  1M1K 4;  4FCM A;  4OK0 A;  3SX1 A;  1V74 A;  1T5Y A;  3LZA A;  1VQN 3;  3MG3 A;  3JUM A;  2GBX B;  1Q7Y 4;  3EN8 A;  3B7C A;  1KD1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...