1YGWA

Nmr structure of ribonuclease t1, 34 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Limits of NMR structure determination using variable target function calculations: ribonuclease T1, a case study.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 14
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ygwA00
1LNIA 3GSPA 1BNJA 1G02A 2KF6A 1RGCA 1RMSA 1BSAA 1BSCA 1TRPA 1UCJA 1PY3A 3AHSA 4HAAA 2F4YA 1GSPA 7GSPA 2RBIA 3A5EA 1DE3A 1BSBA 1GOUA 1I3IA 1A2PA 1RCLA 4BIRA 1B2ZA 1I0VA 1RLSA 1UCLA 8RNTA 1B2XA 5RNTA 1I2EA 5GSPA 2BIRA 1YGWA 2KF3A 1TTOA 1UCIA 1B20A 1GMPA 1AQZA 1FZUA 1RNBA 1YNVX 1I0XA 1CH0A 1FYSA 1X1XA 1B3SA 6RNTA 1RGGA 1RGHA 1I2FA 1JBSA 1BSDA 1ZGXA 2F5WA 1X1YA 1LOVA 1LRAA 3D4AA 2AAEA 1BANA 3Q3FA 1GOYA 1JBRA 3DH2A 2HOHA 6GSPA 2F5MA 1I8VA 9RNTA 3KCHA 5HOHA 1X1UA 4J5KA 1B27A 1MGRA 1FUSA 7RNTA 1I70A 5BIRA 3DGYA 1Q9EA 1B2UA 2SARA 5BU4A 1HYFA 3D5GA 3RNTA 1RCKA 1BAOA 1RDSA 1BUJA 1MGWA 4HOHA 4GSPA 1LOYA 2KAAA 1FUTA 3D5IA 1BNSA 3AHWA 1GMQA 1RN1A 1RSNA 1RGKA 3WR2A 4GHOA 1PYLA 1RTUA 2BU4A 1T2HA 3HOHA 3AGOA 2F56A 1T2IA 2KF4A 3WHOA 1IYYA 1BRHA 1BSEA 1YVSA 2KF5A 1B21A 1RGLA 1BVIA 1C54A 1X1WA 2C4BA 1GOVA 1DETA 1TRQA 2AADA 2GSPA 3AGNA 1BRKA 1BNEA 1UCKA 4J5GA 1BNIA 1HZ1A 3BU4A 1BRNL 1BIRA 1I2GA 1RGAA 1BGSA 1BRGA 1RGFA 1BRJA 1RGEA 1B2SA 1RNTA 1BNRA 1R4YA 1AY7A 1SARA 1LOWA 1BRSA 1GMRA 4BU4A 1B2MA 1RN4A 4RNTA 2RNTA 2ZA4A 1BOXA 3SYUA 3URPA 1BNGA 3BIRA 1I3FA 1BNFA 1FW7A 1BRIA 1RHLA 1BU4A 1JBTA
chains in the Genus database with same CATH superfamily
1FGTA 1LNIA 3GSPA 3MSOA 5AI1A 2KF6A 2YFIB 2LQVA 3L0RA 1WMNA 5CK6A 5G1KA 4N6V0 1PY3A 2XGNA 3NV0B 1UW1A 3LYGA 4R9KA 4AEQA 1VQK3 1N5PA 3EBYA 4N6OB 2OTJ3 3MPHA 2R41A 4EV2A 2IUJA 2R4IA 1GOUA 1LQMB 2OQEC 3ZFZA 1Q7HA 5IW9A 2H0IA 3EN8A 4HM1B 3F7SA 1ZX2A 3PGBA 1VQP3 2XF3A 1N8R4 1QVF2 2E2VA 1IV7A 2Z7AA 1YGWA 1IVXA 1JKGA 3T8NA 4KT3B 4L7KA 1UCIA 2FGTA 4FCMA 1GMPA 1W01A 4R9LA 1RNBA 1YNVX 1IQ8A 2OWPA 3NBJA 2BHMA 1UUGB 3GZXB 3CC43 2CFKA 2IMJA 3V99A 3G4S3 4NREA 1B3SA 6RNTA 4LMIA 2ML5A 1ISKA 1AVLA 1IDPA 5LC7A 1BSDA 1IT7A 3CCE3 3U1WA 8CHOA 3G0KA 4GB5A 2AAEA 1TUHA 1W5ZA 1FA3A 2J8XB 1GOYA 1NNVA 3Q3FA 1UI7A 1JBRA 4O02B 2GBXB 4KVHA 2CG1A 6GSPA 1I8VA 2IUKA 2OTL3 1EQKA 1V74A 1T3BA 9RNTA 4J5KA 3PZWA 1MGRA 3CU3A 1DYUA 5HGRA 3LTAA 5TGNA 2GU3A 3NV0A 3NQZA 3OWSA 3X42A 1I70A 2XRXB 1UUVB 3K7CA 2UX0A 5IERA 3F14A 3BLZA 6STDA 3D5GA 1IQYA 4N6UA 3RNTA 1S5AA 3GZRA 3X41A 1BAOA 4EYCA 3AMOB 3E99A 4WP5A 2CW9A 4BTWA 5EQLA 1NDOB 2CKFB 1UI8A 3K5TA 3MG2A 2W03A 3VSYA 1BUJA 1T5YA 5AEWB 4EXRA 1LOYA 3SXXA 3LT9A 1K28A 1YIJ3 1Q864 1STDA 1QAKA 1BNSA 3EBTA 3KE7A 3MWZA 5CXOA 4STDA 1SIHA 1PYLA 1CEWI 3I0YA 1T2HA 1W6GA 2UUGC 3AGOA 2F56A 1T2IA 2KF4A 4MJDA 1OUNA 3WHOA 1OHPA 4N6TA 1BRHA 1BSEA 1YVSA 3HIIA 4HM7B 4U13A 2KF5A 2OOVC 3VF1A 3WOEB 5IEPA 1JZDA 2I9WA 1C54A 1A2KA 1GOVA 2C4BA 4AKZA 2GSPA 2E2UA 2P38A 1BRKA 1BNEA 3MG3A 1GS3A 2B24B 3BU4A 4R1KA 1QAFA 1W7CA 2P0MA 1V58A 3RGRA 2L4VA 1U5OA 1RGEA 2CFWA 1RNTA 4FCJA 3WODG 1OACA 3SOAA 4HM8B 1Q824 3K9MC 1DVDA 2FXTA 2OCTA 4LGQA 4BU4A 3LT8A 1KSIA 4IIAA 1IK3A 4MMXB 2QEX3 1DVCA 1RN4A 2W56B 2WGQA 5IG3A 2JQ5A 5DREA 1YVBI 5DRVA 3LTDA 1JN5B 1KD14 1N9EA 2K54A 2V1LA 5AIHA 3G16A 5D83A 4BTXA 2F99A 5AEUB 3LTCA 5IG4A 3DXOA 3SLUA 1IVVA 3JUPA 1JZOA 1Q40B 1DMMA 1RMSA 3SEDA 1EA2A 3AHSA 2F4YA 1Y4KA 5KP3A 2CFLA 3HX8A 2W0QA 3G6E3 2CFDA 3BNEA 2K3DA 1AV4A 5KP1A 1BSBA 3NBRA 1LOXA 2CWUA 3X3YA 1VQL3 1A2PA 1RCLA 4FMDA 1B2ZA 1C7HA 1A2VA 3FH1A 3TDGA 4BIRA 4K1UA 2WO0A 5RNTA 3EX9A 2W9PA 4KFFA 4PEJA 1TTOA 4LYLB 1WMPA 4JRFA 1E97A 3UL6A 1JV2B 3GZYB 4ORLA 2F98A 1VQ93 1GD3A 2GEXA 1UDII 5AYSC 3WMDA 1VQ43 2CH9A 3BB9A 4LZIA 4IPBA 3MHEA 2HMLB 2BMQB 2OQEA 1JB2A 1RGHA 7STDA 1ZGXA 2F5WA 4HZBB 2W56A 4L8OA 5ELJA 1OH0A 1ROVA 1JN5A 3Q2PA 2XEPA 1Q42A 4WHAA 1SPUA 4AKYA 2H0HA 1WMOA 3B8LA 1R4CA 3CPOA 5HOHA 1RRHA 3KCHA 3ALAA 1B27A 1Q40A 3CNMA 3DM8A 2GBWB 5A0OB 1FUSA 7RNTA 1IVWA 3LXUX 3CCL3 3IPTA 3Q90A 3DGYA 4QWTA 1Q9EA 5ELUA 5G2GA 1N8QA 3JUOA 3D3LA 3CC23 2GEYA 3KIIA 1ZS7A 1O7HB 3FCSB 2F86B 4MEIA 2LYXA 5CF1A 4GSPA 1OHSA 1QVG2 2D42A 2Z76A 3O8YA 2KAAA 1M1K4 3D5IA 3Q1CA 3VGNA 2WGOA 3FLJA 1WTHA 2RFRA 3WR2A 4FMBA 3ECFA 3HI7A 1YJ93 2CC3A 1OGZA 2WOFA 2Z77A 1IYYA 4X2HA 4XBTA 2M7OA 2BMRB 3F8XA 3D9RA 3EQQB 4EBGA 1OGXA 1X1WA 1DETA 1O7WB 2AADA 2CG0A 2L1SA 3LTBA 4HM2B 4WFOA 1UCKA 1Z1SA 4ILFA 1VQN3 1UGHI 1BRNL 5STDA 3IMAB 1I2GA 1RGFA 3CNXA 1BRGA 3LZAA 1FGQA 1MWRA 1W6YA 1TFKA 2E2TA 3GRDA 1NWWA 3MG1A 1OF5B 3JVCA 1BNRA 1KWIA 2KCDA 3NUVA 1AY7A 5CLKA 1OCVA 3ROBA 1EG9B 1GY5A 1MWSA 2OOVA 4EC6A 2IY2A 4KFEA 5JBSA 3J7Yd 1AR0A 3CMA3 1B2MA 4TX4A 1YI23 4GL6A 5IG5A 3URPA 3NBBA 1BNGA 1O7MB 1BNFA 3NX0A 1LXEA 2FNQA 3UJMA 3OW22 4G1MB 1LNHA 4FCZA 1IQXA 4HVNA 4O8SA 1TFOA 3CCQ3 3H3HA 1ULIB 4XBYA 1G02A 1YGEA 3DUKA 1BSAA 2IA7A 2XH9A 4HAAA 4N3VA 4NHFA 3B7CA 5FW5A 2ZHXB 5IG0A 2GXFA 1E3VA 2YX9A 3A5EA 1EUIC 1RRLA 1STFI 4LSOA 3RGAA 3CXC2 2P09A 1I3IA 1N9JA 1Q7Y4 3EHCA 3EC9A 1RLSA 2GU1A 1UCLA 3UNLA 1IVUA 5GSPA 4JF8A 4EV5A 1SJWA 2KF3A 3WOFB 5IENA 1W00A 1B20A 3KKGA 3N9HA 2HMOB 1JB4A 2UGIA 3GAXA 3HIGA 3KSPA 3T8UA 1I0XA 4CDLA 1FYSA 4DKIA 1EKMA 2SBLA 1CQSA 1OF5A 1X1XA 1GY7A 4BL2A 1QALA 1IV9A 5BXQA 3EF8A 1RGGA 4RBNA 1K8A4 2ML6A 1NU3A 1ULJB 1JRQA 1SQWA 1LOVA 1X1YA 1GY6A 4K1VA 1FGOA 4Q53A 5G1LA 3S27A 1BANA 4I5QA 2BT3A 1EEJA 1O7PB 2XR8B 1W4NA 3KZTA 4J9AA 3DH2A 1VZZA 5D82A 3S28A 2XGLA 3PXMA 3DZLA 4RZMA 2MF7A 1WQLB 1G0TA 2BNGA 3WA2X 2QIYA 5AIFA 5BVBA 1FGMA 4LEHA 1X1UA 2ZL8A 4HJLB 2W2CA 4FMCA 3SVAA 4RNYA 5AIIA 1MNLA 5AIGA 3BNBA 4WWUC 5BU4A 2O9UX 2W6JH 1M1XB 3X3XA 4K61A 5FGOA 4CPKA 1AVKA 3V92A 4KZ1A 4NPBA 1RDSA 2XFSA 1KQS2 2BMOB 1NO3A 1FGRA 3K0ZA 4K90B 4XDWA 5IEOA 2D1WA 4BL3A 4HOHA 4OK0A 2STDA 4KFDA 3BNDA 4CJNA 2C10A 5EVHA 1TP6A 4OVMA 5LC6A 1FUTA 1K9M4 3F8HA 3DY5A 1RN7A 4H3UA 3AHWA 5EEOA 2XSHB 1VQ73 3KN4A 1RN1A 2CIUA 1RGKA 2P0XA 3EB8A 4FMAA 2BU4A 1RTUA 2CX0A 3FSDA 3HOHA 2P05A 4GHOA 3CCS3 1NB3I 4HM6B 3S5CA 1NB5I 1GD4A 1OHOA 3M8CA 1JNQA 1HKXA 1B21A 1QJGA 3EN1B 3PS8A 3KFQC 1ROAA 5M19A 3CC73 4MMYB 3N54B 3NQYA 4HZ9B 4WYKB 3CCM3 3QK9A 1BNIA 2IYJA 5CF2A 1VQ83 4XM4A 1W2B2 1BRJA 2KRTA 4XDVA 3ZG0A 1JJ22 4N6NB 1R4YA 3FF0A 3JUQA 5I97A 1SARA 1LVNA 4FR9A 3WDGB 3D79A 2Q07A 4ZM8A 3FG1A 1M904 1VQ53 1DMNA 4J8TA 3LMLA 3IJEB 3KSED 3NXJA 5M18A 2RSXA 1MWTA 3CCJ3 1YJW3 1U8CB 2ZA4A 4OUQA 3QRDA 3V98A 1F8NA 2HMJB 3CPW2 3CCU3 2XSOB 1GYBA 1JB5A 3GWRA 3CD63 2CK3H 1JBTA 3I553 1BNJA 1DMQA 3EJVA 1G96A 1RGCA 2YFLB 1UCJA 1BSCA 1TRPA 2XFTA 1L5GB 2KXGA 1VQM3 3N8BA 3OWUA 1GSPA 3B4OA 7GSPA 2RBIA 1OPYA 1PU4A 3CME3 3UL5A 4IT7A 1DE3A 2CWTA 2JDIH 1VQ63 4R80A 1W6CA 3U97A 4XB5A 4HKVB 1I0VA 2YFJB 1TIJA 8RNTA 1VQQA 1B2XA 3OWYA 1I2EA 2BIRA 3DGOA 3X3ZA 1D6ZA 1UGIA 3EE1A 4WYKA 3NM7A 4R4KA 1SIIA 1AQZA 1FZUA 1O7GB 3F9SA 1ASKA 3FF2A 4HM0B 1KC84 1Q814 1BUQA 1CH0A 3MYTA 3NHXA 3LH4A 4HM5B 5M1AA 5AYRB 5JPPA 2INXA 2CHCA 1I2FA 1JBSA 1LQGC 2CFGA 1FUWA 3S29A 2CWVA 3FGYA 3MKIA 1LRAA 3D4AA 3FG3A 1YIT3 1ZO2A 1NJI4 3JUNA 1US1A 1IU7A 4H61A 4X2OA 3T0UA 4EW5A 1IT8A 3OV4A 5JPUA 3FG4A 2HOHA 3RDEA 3K63A 3S67A 3FZWA 2F5MA 3GZBA 4HM3B 2QGUA 3ER7A 3X40A 3CCR3 4N6LA 1TJDA 3DGNA 4BTYA 2HMNB 2A15A 2Y73A 3PYJA 4I4KA 2K0MA 1B2UA 2SARA 3JUMA 5BIRA 3I563 2QA43 1A67A 1HYFA 2H0GA 1YJN3 3F7XA 1VQO3 1RCKA 1D6UA 1K734 2C11A 2W9QA 3SOYA 3HZPA 3NM2A 1MGWA 1D6YA 3LOYA 4HYZA 3STDA 5IF6A 1MOLA 2BO9B 1W02A 2HMMB 2WOHA 2B1XB 1K41A 4MMZB 3WA3A 2MC8A 1UUWB 2RGQA 3BNCA 3DGMA 1GMQA 1CYVA 3DGLA 3SX1A 1S723 1RSNA 3OXAA 4HM4B 3UB1A 3OX9A 1V57A 1WNHA 4N6MA 3AMOA 4L8PA 2PNCA 3B4PA 3DMCA 1RGLA 3G8ZA 1BVIA 1E3RA 1CYUA 3CCV3 1TRQA 1O7NB 3AGNA 1N5HA 1MWUA 1JKGB 1W2ZA 1HU9A 4J5GA 4O3VA 1HZ1A 5D81A 1BIRA 3FKAA 1RGAA 3HK4A 1BGSA 4RNZA 4CCVA 1PFPA 4HBRA 1TU5A 1B2SA 2Z6BA 4O2HA 2Y74A 2ZDJA 3F40A 2CX1A 1YHQ3 1LOWA 1BRSA 1GMRA 1QMAA 3ZG5A 1RKYA 4XBXA 1M9GA 2O3OA 4RNTA 2RNTA 5KP4A 1BOXA 3H51A 3SYUA 3PCRA 1J2BA 3PCSA 3G713 1RJOA 1I3FA 2RCDA 3A76A 3BIRA 2W04A 1FW7A 1A90A 1BRIA 2PZVA 1RHLA 2HMKB 1BU4A
chains in the Genus database with same CATH topology
1LNIA 3GSPA 1BNJA 1G02A 2KF6A 1RGCA 1RMSA 1BSAA 1BSCA 1TRPA 1UCJA 1PY3A 3AHSA 4HAAA 2F4YA 1GSPA 7GSPA 2RBIA 3A5EA 1DE3A 1BSBA 1GOUA 1I3IA 1A2PA 1RCLA 4BIRA 1B2ZA 1I0VA 1RLSA 1UCLA 8RNTA 1B2XA 5RNTA 1I2EA 5GSPA 2BIRA 1YGWA 2KF3A 1TTOA 1UCIA 1B20A 1GMPA 1AQZA 1FZUA 1RNBA 1YNVX 1I0XA 1CH0A 1FYSA 1X1XA 1B3SA 6RNTA 1RGGA 1RGHA 1I2FA 1JBSA 1BSDA 1ZGXA 2F5WA 1X1YA 1LOVA 1LRAA 3D4AA 2AAEA 1BANA 3Q3FA 1GOYA 1JBRA 3DH2A 2HOHA 6GSPA 2F5MA 1I8VA 9RNTA 3KCHA 5HOHA 1X1UA 4J5KA 1B27A 1MGRA 1FUSA 7RNTA 1I70A 5BIRA 3DGYA 1Q9EA 1B2UA 2SARA 5BU4A 1HYFA 3D5GA 3RNTA 1RCKA 1BAOA 1RDSA 1BUJA 1MGWA 4HOHA 4GSPA 1LOYA 2KAAA 1FUTA 3D5IA 1BNSA 3AHWA 1GMQA 1RN1A 1RSNA 1RGKA 3WR2A 4GHOA 1PYLA 1RTUA 2BU4A 1T2HA 3HOHA 3AGOA 2F56A 1T2IA 2KF4A 3WHOA 1IYYA 1BRHA 1BSEA 1YVSA 2KF5A 1B21A 1RGLA 1BVIA 1C54A 1X1WA 2C4BA 1GOVA 1DETA 1TRQA 2AADA 2GSPA 3AGNA 1BRKA 1BNEA 1UCKA 4J5GA 1BNIA 1HZ1A 3BU4A 1BRNL 1BIRA 1I2GA 1RGAA 1BGSA 1BRGA 1RGFA 1BRJA 1RGEA 1B2SA 1RNTA 1BNRA 1R4YA 1AY7A 1SARA 1LOWA 1BRSA 1GMRA 4BU4A 1B2MA 1RN4A 4RNTA 2RNTA 2ZA4A 1BOXA 3SYUA 3URPA 1BNGA 3BIRA 1I3FA 1BNFA 1FW7A 1BRIA 1RHLA 1BU4A 1JBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNI A;  3GSP A;  1BNJ A;  1G02 A;  2KF6 A;  1RGC A;  1RMS A;  1BSA A;  1BSC A;  1TRP A;  1UCJ A;  1PY3 A;  3AHS A;  4HAA A;  2F4Y A;  1GSP A;  7GSP A;  2RBI A;  3A5E A;  1DE3 A;  1BSB A;  1GOU A;  1I3I A;  1A2P A;  1RCL A;  4BIR A;  1B2Z A;  1I0V A;  1RLS A;  1UCL A;  8RNT A;  1B2X A;  5RNT A;  1I2E A;  5GSP A;  2BIR A;  1YGW A;  2KF3 A;  1TTO A;  1UCI A;  1B20 A;  1GMP A;  1AQZ A;  1FZU A;  1RNB A;  1YNV X;  1I0X A;  1CH0 A;  1FYS A;  1X1X A;  1B3S A;  6RNT A;  1RGG A;  1RGH A;  1I2F A;  1JBS A;  1BSD A;  1ZGX A;  2F5W A;  1X1Y A;  1LOV A;  1LRA A;  3D4A A;  2AAE A;  1BAN A;  3Q3F A;  1GOY A;  1JBR A;  3DH2 A;  2HOH A;  6GSP A;  2F5M A;  1I8V A;  9RNT A;  3KCH A;  5HOH A;  1X1U A;  4J5K A;  1B27 A;  1MGR A;  1FUS A;  7RNT A;  1I70 A;  5BIR A;  3DGY A;  1Q9E A;  1B2U A;  2SAR A;  5BU4 A;  1HYF A;  3D5G A;  3RNT A;  1RCK A;  1BAO A;  1RDS A;  1BUJ A;  1MGW A;  4HOH A;  4GSP A;  1LOY A;  2KAA A;  1FUT A;  3D5I A;  1BNS A;  3AHW A;  1GMQ A;  1RN1 A;  1RSN A;  1RGK A;  3WR2 A;  4GHO A;  1PYL A;  1RTU A;  2BU4 A;  1T2H A;  3HOH A;  3AGO A;  2F56 A;  1T2I A;  2KF4 A;  3WHO A;  1IYY A;  1BRH A;  1BSE A;  1YVS A;  2KF5 A;  1B21 A;  1RGL A;  1BVI A;  1C54 A;  1X1W A;  2C4B A;  1GOV A;  1DET A;  1TRQ A;  2AAD A;  2GSP A;  3AGN A;  1BRK A;  1BNE A;  1UCK A;  4J5G A;  1BNI A;  1HZ1 A;  3BU4 A;  1BRN L;  1BIR A;  1I2G A;  1RGA A;  1BGS A;  1BRG A;  1RGF A;  1BRJ A;  1RGE A;  1B2S A;  1RNT A;  1BNR A;  1R4Y A;  1AY7 A;  1SAR A;  1LOW A;  1BRS A;  1GMR A;  4BU4 A;  1B2M A;  1RN4 A;  4RNT A;  2RNT A;  2ZA4 A;  1BOX A;  3SYU A;  3URP A;  1BNG A;  3BIR A;  1I3F A;  1BNF A;  1FW7 A;  1BRI A;  1RHL A;  1BU4 A;  1JBT A; 
#chains in the Genus database with same CATH topology
 1FGT A;  1LNI A;  3GSP A;  3MSO A;  5AI1 A;  2KF6 A;  2YFI B;  2LQV A;  3L0R A;  1WMN A;  5CK6 A;  5G1K A;  4N6V 0;  1PY3 A;  2XGN A;  3NV0 B;  1UW1 A;  3LYG A;  4R9K A;  4AEQ A;  1VQK 3;  1N5P A;  3EBY A;  4N6O B;  2OTJ 3;  3MPH A;  2R41 A;  4EV2 A;  2IUJ A;  2R4I A;  1GOU A;  1LQM B;  2OQE C;  3ZFZ A;  1Q7H A;  5IW9 A;  2H0I A;  3EN8 A;  4HM1 B;  3F7S A;  1ZX2 A;  3PGB A;  1VQP 3;  2XF3 A;  1N8R 4;  1QVF 2;  2E2V A;  1IV7 A;  2Z7A A;  1YGW A;  1IVX A;  1JKG A;  3T8N A;  4KT3 B;  4L7K A;  1UCI A;  2FGT A;  4FCM A;  1GMP A;  1W01 A;  4R9L A;  1RNB A;  1YNV X;  1IQ8 A;  2OWP A;  3NBJ A;  2BHM A;  1UUG B;  3GZX B;  3CC4 3;  2CFK A;  2IMJ A;  3V99 A;  3G4S 3;  4NRE A;  1B3S A;  6RNT A;  4LMI A;  2ML5 A;  1ISK A;  1AVL A;  1IDP A;  5LC7 A;  1BSD A;  1IT7 A;  3CCE 3;  3U1W A;  8CHO A;  3G0K A;  4GB5 A;  2AAE A;  1TUH A;  1W5Z A;  1FA3 A;  2J8X B;  1GOY A;  1NNV A;  3Q3F A;  1UI7 A;  1JBR A;  4O02 B;  2GBX B;  4KVH A;  2CG1 A;  6GSP A;  1I8V A;  2IUK A;  2OTL 3;  1EQK A;  1V74 A;  1T3B A;  9RNT A;  4J5K A;  3PZW A;  1MGR A;  3CU3 A;  1DYU A;  5HGR A;  3LTA A;  5TGN A;  2GU3 A;  3NV0 A;  3NQZ A;  3OWS A;  3X42 A;  1I70 A;  2XRX B;  1UUV B;  3K7C A;  2UX0 A;  5IER A;  3F14 A;  3BLZ A;  6STD A;  3D5G A;  1IQY A;  4N6U A;  3RNT A;  1S5A A;  3GZR A;  3X41 A;  1BAO A;  4EYC A;  3AMO B;  3E99 A;  4WP5 A;  2CW9 A;  4BTW A;  5EQL A;  1NDO B;  2CKF B;  1UI8 A;  3K5T A;  3MG2 A;  2W03 A;  3VSY A;  1BUJ A;  1T5Y A;  5AEW B;  4EXR A;  1LOY A;  3SXX A;  3LT9 A;  1K28 A;  1YIJ 3;  1Q86 4;  1STD A;  1QAK A;  1BNS A;  3EBT A;  3KE7 A;  3MWZ A;  5CXO A;  4STD A;  1SIH A;  1PYL A;  1CEW I;  3I0Y A;  1T2H A;  1W6G A;  2UUG C;  3AGO A;  2F56 A;  1T2I A;  2KF4 A;  4MJD A;  1OUN A;  3WHO A;  1OHP A;  4N6T A;  1BRH A;  1BSE A;  1YVS A;  3HII A;  4HM7 B;  4U13 A;  2KF5 A;  2OOV C;  3VF1 A;  3WOE B;  5IEP A;  1JZD A;  2I9W A;  1C54 A;  1A2K A;  1GOV A;  2C4B A;  4AKZ A;  2GSP A;  2E2U A;  2P38 A;  1BRK A;  1BNE A;  3MG3 A;  1GS3 A;  2B24 B;  3BU4 A;  4R1K A;  1QAF A;  1W7C A;  2P0M A;  1V58 A;  3RGR A;  2L4V A;  1U5O A;  1RGE A;  2CFW A;  1RNT A;  4FCJ A;  3WOD G;  1OAC A;  3SOA A;  4HM8 B;  1Q82 4;  3K9M C;  1DVD A;  2FXT A;  2OCT A;  4LGQ A;  4BU4 A;  3LT8 A;  1KSI A;  4IIA A;  1IK3 A;  4MMX B;  2QEX 3;  1DVC A;  1RN4 A;  2W56 B;  2WGQ A;  5IG3 A;  2JQ5 A;  5DRE A;  1YVB I;  5DRV A;  3LTD A;  1JN5 B;  1KD1 4;  1N9E A;  2K54 A;  2V1L A;  5AIH A;  3G16 A;  5D83 A;  4BTX A;  2F99 A;  5AEU B;  3LTC A;  5IG4 A;  3DXO A;  3SLU A;  1IVV A;  3JUP A;  1JZO A;  1Q40 B;  1DMM A;  1RMS A;  3SED A;  1EA2 A;  3AHS A;  2F4Y A;  1Y4K A;  5KP3 A;  2CFL A;  3HX8 A;  2W0Q A;  3G6E 3;  2CFD A;  3BNE A;  2K3D A;  1AV4 A;  5KP1 A;  1BSB A;  3NBR A;  1LOX A;  2CWU A;  3X3Y A;  1VQL 3;  1A2P A;  1RCL A;  4FMD A;  1B2Z A;  1C7H A;  1A2V A;  3FH1 A;  3TDG A;  4BIR A;  4K1U A;  2WO0 A;  5RNT A;  3EX9 A;  2W9P A;  4KFF A;  4PEJ A;  1TTO A;  4LYL B;  1WMP A;  4JRF A;  1E97 A;  3UL6 A;  1JV2 B;  3GZY B;  4ORL A;  2F98 A;  1VQ9 3;  1GD3 A;  2GEX A;  1UDI I;  5AYS C;  3WMD A;  1VQ4 3;  2CH9 A;  3BB9 A;  4LZI A;  4IPB A;  3MHE A;  2HML B;  2BMQ B;  2OQE A;  1JB2 A;  1RGH A;  7STD A;  1ZGX A;  2F5W A;  4HZB B;  2W56 A;  4L8O A;  5ELJ A;  1OH0 A;  1ROV A;  1JN5 A;  3Q2P A;  2XEP A;  1Q42 A;  4WHA A;  1SPU A;  4AKY A;  2H0H A;  1WMO A;  3B8L A;  1R4C A;  3CPO A;  5HOH A;  1RRH A;  3KCH A;  3ALA A;  1B27 A;  1Q40 A;  3CNM A;  3DM8 A;  2GBW B;  5A0O B;  1FUS A;  7RNT A;  1IVW A;  3LXU X;  3CCL 3;  3IPT A;  3Q90 A;  3DGY A;  4QWT A;  1Q9E A;  5ELU A;  5G2G A;  1N8Q A;  3JUO A;  3D3L A;  3CC2 3;  2GEY A;  3KII A;  1ZS7 A;  1O7H B;  3FCS B;  2F86 B;  4MEI A;  2LYX A;  5CF1 A;  4GSP A;  1OHS A;  1QVG 2;  2D42 A;  2Z76 A;  3O8Y A;  2KAA A;  1M1K 4;  3D5I A;  3Q1C A;  3VGN A;  2WGO A;  3FLJ A;  1WTH A;  2RFR A;  3WR2 A;  4FMB A;  3ECF A;  3HI7 A;  1YJ9 3;  2CC3 A;  1OGZ A;  2WOF A;  2Z77 A;  1IYY A;  4X2H A;  4XBT A;  2M7O A;  2BMR B;  3F8X A;  3D9R A;  3EQQ B;  4EBG A;  1OGX A;  1X1W A;  1DET A;  1O7W B;  2AAD A;  2CG0 A;  2L1S A;  3LTB A;  4HM2 B;  4WFO A;  1UCK A;  1Z1S A;  4ILF A;  1VQN 3;  1UGH I;  1BRN L;  5STD A;  3IMA B;  1I2G A;  1RGF A;  3CNX A;  1BRG A;  3LZA A;  1FGQ A;  1MWR A;  1W6Y A;  1TFK A;  2E2T A;  3GRD A;  1NWW A;  3MG1 A;  1OF5 B;  3JVC A;  1BNR A;  1KWI A;  2KCD A;  3NUV A;  1AY7 A;  5CLK A;  1OCV A;  3ROB A;  1EG9 B;  1GY5 A;  1MWS A;  2OOV A;  4EC6 A;  2IY2 A;  4KFE A;  5JBS A;  3J7Y d;  1AR0 A;  3CMA 3;  1B2M A;  4TX4 A;  1YI2 3;  4GL6 A;  5IG5 A;  3URP A;  3NBB A;  1BNG A;  1O7M B;  1BNF A;  3NX0 A;  1LXE A;  2FNQ A;  3UJM A;  3OW2 2;  4G1M B;  1LNH A;  4FCZ A;  1IQX A;  4HVN A;  4O8S A;  1TFO A;  3CCQ 3;  3H3H A;  1ULI B;  4XBY A;  1G02 A;  1YGE A;  3DUK A;  1BSA A;  2IA7 A;  2XH9 A;  4HAA A;  4N3V A;  4NHF A;  3B7C A;  5FW5 A;  2ZHX B;  5IG0 A;  2GXF A;  1E3V A;  2YX9 A;  3A5E A;  1EUI C;  1RRL A;  1STF I;  4LSO A;  3RGA A;  3CXC 2;  2P09 A;  1I3I A;  1N9J A;  1Q7Y 4;  3EHC A;  3EC9 A;  1RLS A;  2GU1 A;  1UCL A;  3UNL A;  1IVU A;  5GSP A;  4JF8 A;  4EV5 A;  1SJW A;  2KF3 A;  3WOF B;  5IEN A;  1W00 A;  1B20 A;  3KKG A;  3N9H A;  2HMO B;  1JB4 A;  2UGI A;  3GAX A;  3HIG A;  3KSP A;  3T8U A;  1I0X A;  4CDL A;  1FYS A;  4DKI A;  1EKM A;  2SBL A;  1CQS A;  1OF5 A;  1X1X A;  1GY7 A;  4BL2 A;  1QAL A;  1IV9 A;  5BXQ A;  3EF8 A;  1RGG A;  4RBN A;  1K8A 4;  2ML6 A;  1NU3 A;  1ULJ B;  1JRQ A;  1SQW A;  1LOV A;  1X1Y A;  1GY6 A;  4K1V A;  1FGO A;  4Q53 A;  5G1L A;  3S27 A;  1BAN A;  4I5Q A;  2BT3 A;  1EEJ A;  1O7P B;  2XR8 B;  1W4N A;  3KZT A;  4J9A A;  3DH2 A;  1VZZ A;  5D82 A;  3S28 A;  2XGL A;  3PXM A;  3DZL A;  4RZM A;  2MF7 A;  1WQL B;  1G0T A;  2BNG A;  3WA2 X;  2QIY A;  5AIF A;  5BVB A;  1FGM A;  4LEH A;  1X1U A;  2ZL8 A;  4HJL B;  2W2C A;  4FMC A;  3SVA A;  4RNY A;  5AII A;  1MNL A;  5AIG A;  3BNB A;  4WWU C;  5BU4 A;  2O9U X;  2W6J H;  1M1X B;  3X3X A;  4K61 A;  5FGO A;  4CPK A;  1AVK A;  3V92 A;  4KZ1 A;  4NPB A;  1RDS A;  2XFS A;  1KQS 2;  2BMO B;  1NO3 A;  1FGR A;  3K0Z A;  4K90 B;  4XDW A;  5IEO A;  2D1W A;  4BL3 A;  4HOH A;  4OK0 A;  2STD A;  4KFD A;  3BND A;  4CJN A;  2C10 A;  5EVH A;  1TP6 A;  4OVM A;  5LC6 A;  1FUT A;  1K9M 4;  3F8H A;  3DY5 A;  1RN7 A;  4H3U A;  3AHW A;  5EEO A;  2XSH B;  1VQ7 3;  3KN4 A;  1RN1 A;  2CIU A;  1RGK A;  2P0X A;  3EB8 A;  4FMA A;  2BU4 A;  1RTU A;  2CX0 A;  3FSD A;  3HOH A;  2P05 A;  4GHO A;  3CCS 3;  1NB3 I;  4HM6 B;  3S5C A;  1NB5 I;  1GD4 A;  1OHO A;  3M8C A;  1JNQ A;  1HKX A;  1B21 A;  1QJG A;  3EN1 B;  3PS8 A;  3KFQ C;  1ROA A;  5M19 A;  3CC7 3;  4MMY B;  3N54 B;  3NQY A;  4HZ9 B;  4WYK B;  3CCM 3;  3QK9 A;  1BNI A;  2IYJ A;  5CF2 A;  1VQ8 3;  4XM4 A;  1W2B 2;  1BRJ A;  2KRT A;  4XDV A;  3ZG0 A;  1JJ2 2;  4N6N B;  1R4Y A;  3FF0 A;  3JUQ A;  5I97 A;  1SAR A;  1LVN A;  4FR9 A;  3WDG B;  3D79 A;  2Q07 A;  4ZM8 A;  3FG1 A;  1M90 4;  1VQ5 3;  1DMN A;  4J8T A;  3LML A;  3IJE B;  3KSE D;  3NXJ A;  5M18 A;  2RSX A;  1MWT A;  3CCJ 3;  1YJW 3;  1U8C B;  2ZA4 A;  4OUQ A;  3QRD A;  3V98 A;  1F8N A;  2HMJ B;  3CPW 2;  3CCU 3;  2XSO B;  1GYB A;  1JB5 A;  3GWR A;  3CD6 3;  2CK3 H;  1JBT A;  3I55 3;  1BNJ A;  1DMQ A;  3EJV A;  1G96 A;  1RGC A;  2YFL B;  1UCJ A;  1BSC A;  1TRP A;  2XFT A;  1L5G B;  2KXG A;  1VQM 3;  3N8B A;  3OWU A;  1GSP A;  3B4O A;  7GSP A;  2RBI A;  1OPY A;  1PU4 A;  3CME 3;  3UL5 A;  4IT7 A;  1DE3 A;  2CWT A;  2JDI H;  1VQ6 3;  4R80 A;  1W6C A;  3U97 A;  4XB5 A;  4HKV B;  1I0V A;  2YFJ B;  1TIJ A;  8RNT A;  1VQQ A;  1B2X A;  3OWY A;  1I2E A;  2BIR A;  3DGO A;  3X3Z A;  1D6Z A;  1UGI A;  3EE1 A;  4WYK A;  3NM7 A;  4R4K A;  1SII A;  1AQZ A;  1FZU A;  1O7G B;  3F9S A;  1ASK A;  3FF2 A;  4HM0 B;  1KC8 4;  1Q81 4;  1BUQ A;  1CH0 A;  3MYT A;  3NHX A;  3LH4 A;  4HM5 B;  5M1A A;  5AYR B;  5JPP A;  2INX A;  2CHC A;  1I2F A;  1JBS A;  1LQG C;  2CFG A;  1FUW A;  3S29 A;  2CWV A;  3FGY A;  3MKI A;  1LRA A;  3D4A A;  3FG3 A;  1YIT 3;  1ZO2 A;  1NJI 4;  3JUN A;  1US1 A;  1IU7 A;  4H61 A;  4X2O A;  3T0U A;  4EW5 A;  1IT8 A;  3OV4 A;  5JPU A;  3FG4 A;  2HOH A;  3RDE A;  3K63 A;  3S67 A;  3FZW A;  2F5M A;  3GZB A;  4HM3 B;  2QGU A;  3ER7 A;  3X40 A;  3CCR 3;  4N6L A;  1TJD A;  3DGN A;  4BTY A;  2HMN B;  2A15 A;  2Y73 A;  3PYJ A;  4I4K A;  2K0M A;  1B2U A;  2SAR A;  3JUM A;  5BIR A;  3I56 3;  2QA4 3;  1A67 A;  1HYF A;  2H0G A;  1YJN 3;  3F7X A;  1VQO 3;  1RCK A;  1D6U A;  1K73 4;  2C11 A;  2W9Q A;  3SOY A;  3HZP A;  3NM2 A;  1MGW A;  1D6Y A;  3LOY A;  4HYZ A;  3STD A;  5IF6 A;  1MOL A;  2BO9 B;  1W02 A;  2HMM B;  2WOH A;  2B1X B;  1K41 A;  4MMZ B;  3WA3 A;  2MC8 A;  1UUW B;  2RGQ A;  3BNC A;  3DGM A;  1GMQ A;  1CYV A;  3DGL A;  3SX1 A;  1S72 3;  1RSN A;  3OXA A;  4HM4 B;  3UB1 A;  3OX9 A;  1V57 A;  1WNH A;  4N6M A;  3AMO A;  4L8P A;  2PNC A;  3B4P A;  3DMC A;  1RGL A;  3G8Z A;  1BVI A;  1E3R A;  1CYU A;  3CCV 3;  1TRQ A;  1O7N B;  3AGN A;  1N5H A;  1MWU A;  1JKG B;  1W2Z A;  1HU9 A;  4J5G A;  4O3V A;  1HZ1 A;  5D81 A;  1BIR A;  3FKA A;  1RGA A;  3HK4 A;  1BGS A;  4RNZ A;  4CCV A;  1PFP A;  4HBR A;  1TU5 A;  1B2S A;  2Z6B A;  4O2H A;  2Y74 A;  2ZDJ A;  3F40 A;  2CX1 A;  1YHQ 3;  1LOW A;  1BRS A;  1GMR A;  1QMA A;  3ZG5 A;  1RKY A;  4XBX A;  1M9G A;  2O3O A;  4RNT A;  2RNT A;  5KP4 A;  1BOX A;  3H51 A;  3SYU A;  3PCR A;  1J2B A;  3PCS A;  3G71 3;  1RJO A;  1I3F A;  2RCD A;  3A76 A;  3BIR A;  2W04 A;  1FW7 A;  1A90 A;  1BRI A;  2PZV A;  1RHL A;  2HMK B;  1BU4 A; 
#chains in the Genus database with same CATH homology
 1LNI A;  3GSP A;  1BNJ A;  1G02 A;  2KF6 A;  1RGC A;  1RMS A;  1BSA A;  1BSC A;  1TRP A;  1UCJ A;  1PY3 A;  3AHS A;  4HAA A;  2F4Y A;  1GSP A;  7GSP A;  2RBI A;  3A5E A;  1DE3 A;  1BSB A;  1GOU A;  1I3I A;  1A2P A;  1RCL A;  4BIR A;  1B2Z A;  1I0V A;  1RLS A;  1UCL A;  8RNT A;  1B2X A;  5RNT A;  1I2E A;  5GSP A;  2BIR A;  1YGW A;  2KF3 A;  1TTO A;  1UCI A;  1B20 A;  1GMP A;  1AQZ A;  1FZU A;  1RNB A;  1YNV X;  1I0X A;  1CH0 A;  1FYS A;  1X1X A;  1B3S A;  6RNT A;  1RGG A;  1RGH A;  1I2F A;  1JBS A;  1BSD A;  1ZGX A;  2F5W A;  1X1Y A;  1LOV A;  1LRA A;  3D4A A;  2AAE A;  1BAN A;  3Q3F A;  1GOY A;  1JBR A;  3DH2 A;  2HOH A;  6GSP A;  2F5M A;  1I8V A;  9RNT A;  3KCH A;  5HOH A;  1X1U A;  4J5K A;  1B27 A;  1MGR A;  1FUS A;  7RNT A;  1I70 A;  5BIR A;  3DGY A;  1Q9E A;  1B2U A;  2SAR A;  5BU4 A;  1HYF A;  3D5G A;  3RNT A;  1RCK A;  1BAO A;  1RDS A;  1BUJ A;  1MGW A;  4HOH A;  4GSP A;  1LOY A;  2KAA A;  1FUT A;  3D5I A;  1BNS A;  3AHW A;  1GMQ A;  1RN1 A;  1RSN A;  1RGK A;  3WR2 A;  4GHO A;  1PYL A;  1RTU A;  2BU4 A;  1T2H A;  3HOH A;  3AGO A;  2F56 A;  1T2I A;  2KF4 A;  3WHO A;  1IYY A;  1BRH A;  1BSE A;  1YVS A;  2KF5 A;  1B21 A;  1RGL A;  1BVI A;  1C54 A;  1X1W A;  2C4B A;  1GOV A;  1DET A;  1TRQ A;  2AAD A;  2GSP A;  3AGN A;  1BRK A;  1BNE A;  1UCK A;  4J5G A;  1BNI A;  1HZ1 A;  3BU4 A;  1BRN L;  1BIR A;  1I2G A;  1RGA A;  1BGS A;  1BRG A;  1RGF A;  1BRJ A;  1RGE A;  1B2S A;  1RNT A;  1BNR A;  1R4Y A;  1AY7 A;  1SAR A;  1LOW A;  1BRS A;  1GMR A;  4BU4 A;  1B2M A;  1RN4 A;  4RNT A;  2RNT A;  2ZA4 A;  1BOX A;  3SYU A;  3URP A;  1BNG A;  3BIR A;  1I3F A;  1BNF A;  1FW7 A;  1BRI A;  1RHL A;  1BU4 A;  1JBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...