1YGWA

Nmr structure of ribonuclease t1, 34 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Limits of NMR structure determination using variable target function calculations: ribonuclease T1, a case study.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 14
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ygwA00
1I2FA 1GOVA 2SARA 4J5GA 6GSPA 1BNJA 3D4AA 1RGCA 2F56A 1BNGA 3Q3FA 1RMSA 2BIRA 1RN4A 2BU4A 1T2IA 1UCJA 3AHSA 1FW7A 1LOVA 1RCLA 2KF5A 5HOHA 1SARA 1TRPA 1BNEA 1RSNA 1BSDA 2KF3A 1RCKA 1G02A 1DETA 1I2EA 1BU4A 1B2MA 2RNTA 1YVSA 3BIRA 3SYUA 3URPA 1JBTA 1BAOA 3GSPA 1I8VA 1BOXA 1X1UA 1BANA 1BRSA 1R4YA 2HOHA 4GSPA 1X1WA 1X1YA 1UCLA 3RNTA 1BRKA 1BRIA 1RGEA 1BIRA 2AAEA 7RNTA 4RNTA 1ZGXA 1BNIA 1JBRA 1C54A 4J5KA 1A2PA 3HOHA 4BIRA 1TRQA 1GMPA 1LNIA 1B2SA 4HAAA 1RHLA 1RGFA 1BUJA 1BSAA 1BNRA 1FUTA 2F5MA 1FZUA 1GOUA 1UCKA 1B2ZA 1GSPA 9RNTA 1JBSA 1B27A 1UCIA 1MGWA 1B2UA 1AQZA 1YNVX 1I0XA 1BRHA 4GHOA 1CH0A 1RN1A 1GMRA 1FUSA 1BRNL 1B2XA 1DE3A 2KF6A 1BSEA 3AGNA 5BU4A 1BSCA 1RNBA 2KF4A 1LRAA 2F5WA 3DH2A 5GSPA 1HZ1A 1I2GA 8RNTA 1GMQA 2GSPA 1GOYA 4HOHA 3KCHA 1RTUA 1B21A 1TTOA 1RDSA 1PY3A 1RGGA 2C4BA 1HYFA 1I3FA 1RGLA 4BU4A 2AADA 2F4YA 1BGSA 1PYLA 1B3SA 1B20A 1BSBA 1X1XA 3BU4A 7GSPA 1AY7A 2ZA4A 1LOWA 1I0VA 2KAAA 5BIRA 1RNTA 3D5GA 1BRJA 1RGAA 1LOYA 1BVIA 2RBIA 3AHWA 1I70A 1T2HA 6RNTA 1RLSA 3DGYA 1BRGA 3WHOA 3WR2A 1IYYA 3D5IA 3AGOA 1YGWA 1BNSA 1I3IA 1FYSA 3A5EA 5RNTA 1MGRA 1BNFA 1RGKA 1Q9EA 1RGHA
chains in the Genus database with same CATH superfamily
5G2GA 4J5GA 1GOVA 1FGOA 3D4AA 3D79A 1RGCA 2F56A 4LZIA 1BNGA 1Q42A 1W6GA 4N6UA 4WP5A 1RN4A 2GEYA 2ML5A 3AHSA 1RCLA 1CYVA 2O3OA 1VQ43 1TRPA 1CQSA 3SVAA 1BNEA 5LC7A 1JB4A 1RSNA 1BSDA 2B24B 1GD3A 1RCKA 2HMKB 1O7WB 2BMOB 1PFPA 3DGMA 1HU9A 3FF2A 5A0OB 5BVBA 1DVDA 3G6E3 1D6UA 2Z6BA 1HKXA 3MWZA 1NNVA 2HMOB 1GYBA 3KKGA 3V99A 2KXGA 1I8VA 2YX9A 1YJW3 3J7Yd 3UL5A 3I563 1BOXA 2HOHA 3CXC2 1VQK3 3GAXA 2Q07A 3JUNA 2XEPA 4Q53A 2W0QA 3GZYB 2QEX3 1BRKA 1LQMB 2UUGC 3CD63 2WOHA 3ER7A 3MG1A 3SEDA 7RNTA 4RNTA 1YIJ3 1IV7A 1ZGXA 2P38A 4XBTA 3NBRA 1K9M4 4J5KA 1C54A 3UJMA 3VF1A 1DMQA 2CIUA 3NBJA 5IEPA 1Q824 2WO0A 4K1VA 3CCM3 1Q7Y4 1LNIA 1Z1SA 1RGFA 3HK4A 1WMOA 3WOFB 1BUJA 5IERA 3JUPA 3MKIA 1MOLA 1V57A 4K61A 4KVHA 1JKGB 4EXRA 2Z7AA 3CNMA 1IVUA 4WWUC 5M1AA 1VQ73 3JUMA 1DMNA 1W6YA 2H0IA 1VQ83 2D1WA 4XM4A 3OWUA 5IG4A 1K28A 5IG0A 1B2ZA 1T3BA 4HM5B 1UDII 1US1A 3FSDA 2IUKA 3EBTA 4I4KA 1WQLB 3BNBA 4R1KA 1JBSA 1A67A 3S28A 2C11A 1TU5A 1YHQ3 2XGNA 3FZWA 3AMOA 1VQQA 3WA2X 1B2UA 2HMNB 3PCRA 2L4VA 5ELUA 2R4IA 1BRHA 1CH0A 4OK0A 5CXOA 4XB5A 1BUQA 3I553 1DYUA 3RDEA 3ZG5A 1PU4A 2ML6A 4HM3B 4MMXB 3LT9A 2L1SA 3EHCA 1YI23 2HMLB 1JZOA 2KRTA 1GMQA 3NQZA 3QK9A 4BTXA 1JKGA 2INXA 4ZM8A 3K9MC 1O7GB 5JBSA 1IT7A 1SJWA 3KCHA 3V98A 2B1XB 1GY6A 3FG4A 3G16A 3S29A 1RGGA 4JRFA 2P05A 2AADA 1BGSA 1PYLA 1FUWA 1B20A 1W5ZA 3EN1B 3JUOA 4LEHA 1S5AA 7STDA 3FG1A 4KT3B 4N3VA 4OUQA 1QVG2 1LQGC 3SOAA 4HM8B 1LOWA 3KSPA 2XR8B 2YFJB 4N6LA 1JN5A 2OTL3 3JUQA 3NUVA 4L8OA 1BRJA 5M18A 4RBNA 2CWUA 4IIAA 1TUHA 1T2HA 2RGQA 1RLSA 3PCSA 4XDWA 5G1KA 3MPHA 1IYYA 1MWSA 4HJLB 3S27A 3AGOA 2XF3A 5LC6A 1E3VA 3LOYA 2XSOB 2CWTA 1JB5A 2I9WA 5RNTA 1RRHA 1MGRA 1BNFA 1K41A 4WYKB 1AV4A 5BXQA 1D6ZA 5I97A 1I2FA 2SARA 3CCS3 4HM2B 2QGUA 1BNJA 2CFDA 5EVHA 1W2B2 3K7CA 3PZWA 2D42A 3MYTA 1FGQA 1TJDA 4HVNA 4HKVB 1W4NA 1W6CA 2ZDJA 1QAKA 5D83A 1N8QA 3NX0A 2CW9A 2CHCA 2F99A 3HIIA 4X2OA 3V92A 1IQ8A 1UGIA 2GXFA 2CG0A 2JDIH 3EN8A 1I2EA 3Q2PA 1FGMA 1BU4A 5KP1A 3BIRA 1ROVA 2XRXB 3BNCA 3HZPA 3Q1CA 3PXMA 5AIHA 1SPUA 3SYUA 3NV0A 1Q40B 2CC3A 2GBWB 1X1WA 3IMAB 4R9LA 4FMAA 3Q90A 4KFDA 1UCLA 3F7XA 1U8CB 3MG3A 1RGEA 4TX4A 2AAEA 1EG9B 3ALAA 1BNIA 3FF0A 5IG3A 1OHOA 1A2PA 3DY5A 3HOHA 3IPTA 4BIRA 1GY5A 5KP3A 1FUTA 3H3HA 3WMDA 3CNXA 4IT7A 1GOUA 1JV2B 4L8PA 1W02A 4DKIA 1ZO2A 1O7NB 1T5YA 3F9SA 2CX0A 9RNTA 1W2ZA 1UI7A 1B27A 3OX9A 1NB5I 5AI1A 1AQZA 4OVMA 4AKZA 3EC9A 1IVXA 5AYSC 3U97A 3GRDA 1R4CA 1VQN3 4LSOA 2IMJA 3HIGA 1BRNL 1VZZA 3D3LA 5BU4A 3PGBA 1BSCA 2HMMB 1QJGA 2KF4A 2F5WA 4N6NB 3KN4A 3DH2A 1HZ1A 4ORLA 8RNTA 4L7KA 1GOYA 3D9RA 3NBBA 3X42A 1IDPA 1FGTA 4HOHA 4HM7B 1RTUA 3UB1A 1RN7A 4HM6B 3O8YA 4NPBA 4PEJA 3MHEA 3FGYA 1VQO3 3KFQC 1RJOA 4BU4A 2XSHB 5AIFA 3FH1A 3LT8A 3CCV3 4KFFA 2W03A 5HGRA 1VQ53 2SBLA 3PYJA 1BSBA 1GS3A 3LXUX 2YFLB 2ZA4A 1YJN3 1Q864 5KP4A 1I0VA 4AEQA 2CFGA 2BT3A 2P0MA 2STDA 3OXAA 8CHOA 1V74A 3BNEA 3CC73 1O7MB 1IV9A 4MMZB 2KCDA 3D5GA 1A2VA 5ELJA 1RGAA 3MSOA 3RGAA 1LOYA 3TDGA 1BVIA 1W00A 2QIYA 4GL6A 3T0UA 1E97A 1I70A 4J9AA 6RNTA 3HX8A 4K90B 1Y4KA 3LTDA 2F86B 2H0GA 1A2KA 1N8R4 4O2HA 1L5GB 1F8NA 1UI8A 3DGNA 3B8LA 1YGWA 3IJEB 2CKFB 3CC43 1BNSA 1I3IA 3SXXA 4N6TA 3FKAA 2W56B 5CF1A 1OACA 1OPYA 1RGKA 1U5OA 2K54A 2GU1A 3LTBA 2FNQA 2MC8A 3BLZA 2BHMA 1SIIA 1YGEA 1TIJA 6GSPA 1LXEA 4LYLB 4G1MB 3Q3FA 1RMSA 2BIRA 1G0TA 1UCJA 3WOEB 4R4KA 2P0XA 1LOXA 2KF5A 1OCVA 1SARA 1TP6A 1JRQA 3N9HA 1UGHI 1G02A 2YFIB 1OGZA 5EEOA 2W2CA 3QRDA 3OW22 1V58A 2BNGA 3DGLA 5TGNA 4X2HA 1MWTA 4IPBA 2CFKA 1JBTA 4HZ9B 3GSPA 1IT8A 3STDA 2W56A 1TFKA 3E99A 1Q814 1K734 1X1UA 1BANA 1R4YA 2RSXA 1G96A 4GSPA 3B4OA 3OWYA 4FR9A 1VQM3 5FGOA 4RNZA 3G0KA 3RGRA 3G713 1BRIA 4LMIA 4FMBA 4ILFA 2MF7A 1TFOA 4EW5A 3I0YA 4BL3A 5IEOA 1JBRA 1C7HA 3LTCA 1TRQA 1B2SA 2LQVA 1RHLA 2Y74A 4HAAA 3LZAA 3OV4A 2HMJB 3K5TA 1AR0A 4MEIA 4RZMA 4HZBB 3T8NA 1ULIB 1BSAA 3DGOA 3EBYA 2K3DA 3DZLA 1QAFA 3CCE3 2E2TA 2F5MA 4R80A 5AEWB 1FZUA 2E2VA 1M1K4 1IU7A 3EJVA 3JVCA 4HYZA 1NB3I 2Y73A 1DVCA 1FA3A 4K1UA 4WHAA 4MJDA 3F7SA 2UGIA 1STFI 4WYKA 1MGWA 2M7OA 3CCU3 2OCTA 3EQQB 4N6V0 3G4S3 5STDA 2FGTA 2A15A 3S67A 1GMRA 1AVLA 2RFRA 1DE3A 3M8CA 3WODG 3AGNA 4R9KA 1KWIA 1RNBA 1LRAA 2GEXA 3LMLA 1IVWA 4STDA 2GSPA 5IG5A 3BNDA 1LVNA 1OGXA 3N8BA 1RDSA 1WTHA 3HI7A 2C4BA 3DXOA 1RGLA 2E2UA 4FCMA 1Q40A 1B3SA 1KC84 2H0HA 3X41A 2RCDA 3SOYA 1J2BA 1AVKA 4CDLA 1IK3A 5AIIA 1KSIA 1M1XB 5DRVA 1VQ63 2FXTA 5M19A 3CMA3 1QALA 1O7HB 4N6OB 3NQYA 1VQP3 5BIRA 2BMRB 3A76A 4HBRA 4BL2A 1OHPA 2IUJA 2K0MA 2W04A 4KZ1A 2OOVA 1RKYA 1NJI4 1ZX2A 1EQKA 4JF8A 2RBIA 3AHWA 2CX1A 2GBXB 1SIHA 3SX1A 1E3RA 3B4PA 3F8XA 3U1WA 3F8HA 3NHXA 3CU3A 5CF2A 4FCJA 3DGYA 3GZBA 1BRGA 3WHOA 5AIGA 1OHSA 3WR2A 1K8A4 2CH9A 2W9PA 1MWUA 1ISKA 1GD4A 4EV5A 1W7CA 5G1LA 3OWSA 1MNLA 1A90A 1CYUA 5IENA 3AMOB 4XBYA 3CME3 2J8XB 1RGHA 3H51A 2XGLA 3F40A 1YIT3 4O02B 2OQEA 1IQXA 1ULJB 1KQS2 3CCJ3 4U13A 3F14A 2W9QA 2BU4A 3DMCA 5EQLA 3GZRA 1T2IA 4H61A 4BTYA 4EYCA 4O8SA 1FW7A 1LOVA 5HOHA 4CPKA 3ZG0A 2LYXA 2KF3A 2ZL8A 3EB8A 3NM7A 3ROBA 1JNQA 1DETA 1Q7HA 4XDVA 4H3UA 3EE1A 1B2MA 1EUIC 1YVSA 2RNTA 5D81A 1IQYA 1EA2A 1NO3A 2IA7A 4FMCA 5AYRB 3URPA 2R41A 1BAOA 2PNCA 3EF8A 1VQL3 3SLUA 1BRSA 1UUVB 1D6YA 5D82A 2CFWA 1RRLA 2CWVA 2WGQA 1QVF2 1X1YA 3KSED 3VGNA 3RNTA 1STDA 1YJ93 1VQ93 1M904 1BIRA 3FG3A 4CJNA 3NM2A 3UL6A 4HM4B 1JN5B 2C10A 2BMQB 3X3ZA 2IY2A 1ROAA 2WGOA 3FCSB 2W6JH 3BB9A 1CEWI 2PZVA 1GMPA 1IVVA 4HM0B 4J8TA 4FMDA 2QA43 2XFTA 5IF6A 3LH4A 3S5CA 1BNRA 3ECFA 2Z76A 1NDOB 3MG2A 1UCKA 1ZS7A 3NXJA 1GSPA 3VSYA 4N6MA 3CCR3 4GB5A 3B7CA 2CK3H 3L0RA 4WFOA 1EKMA 3G8ZA 1EEJA 1UCIA 4HM1B 1OF5B 1JB2A 1NWWA 1YNVX 1I0XA 1LNHA 4FCZA 3KIIA 3DM8A 1UW1A 3GZXB 4GHOA 1RN1A 5AEUB 6STDA 5IW9A 1FUSA 3WA3A 1GY7A 1B2XA 4EC6A 2IYJA 3CPW2 2KF6A 1BSEA 2ZHXB 3X3XA 3WDGB 3CPOA 2GU3A 3PS8A 4LGQA 3K0ZA 3X3YA 5GSPA 3X40A 1I2GA 3LYGA 1JJ22 4NHFA 1WMPA 2Z77A 4EV2A 3N54B 1B21A 1DMMA 1TTOA 1S723 1O7PB 1PY3A 3DUKA 4I5QA 4BTWA 5JPUA 1N5PA 3KZTA 3NV0B 2P09A 1HYFA 1I3FA 4RNYA 4EBGA 3CC23 3ZFZA 2F4YA 2CFLA 2OTJ3 1ASKA 1KD14 1JZDA 3CCL3 1NU3A 1OF5A 1OUNA 2WOFA 2OOVC 1YVBI 1X1XA 3BU4A 2F98A 7GSPA 1AY7A 1OH0A 3LTAA 2BO9B 2KAAA 4KFEA 1W01A 3T8UA 2CG1A 3EX9A 2XFSA 1UUWB 1RNTA 1WMNA 2V1LA 5CK6A 4O3VA 4MMYB 1N9JA 1N9EA 2UX0A 5CLKA 1FGRA 3CCQ3 2OWPA 4QWTA 1SQWA 3GWRA 5FW5A 3D5IA 1QMAA 3KE7A 2OQEC 4NREA 1N5HA 3UNLA 1UUGB 2O9UX 4AKYA 2JQ5A 5JPPA 1FYSA 3A5EA 1M9GA 1WNHA 1MWRA 3K63A 5DREA 2XH9A 4CCVA 1Q9EA 3FLJA 4XBXA
chains in the Genus database with same CATH topology
1I2FA 1GOVA 2SARA 4J5GA 6GSPA 1BNJA 3D4AA 1RGCA 2F56A 1BNGA 3Q3FA 1RMSA 2BIRA 1RN4A 2BU4A 1T2IA 1UCJA 3AHSA 1FW7A 1LOVA 1RCLA 2KF5A 5HOHA 1SARA 1TRPA 1BNEA 1RSNA 1BSDA 2KF3A 1RCKA 1G02A 1DETA 1I2EA 1BU4A 1B2MA 2RNTA 1YVSA 3BIRA 3SYUA 3URPA 1JBTA 1BAOA 3GSPA 1I8VA 1BOXA 1X1UA 1BANA 1BRSA 1R4YA 2HOHA 4GSPA 1X1WA 1X1YA 1UCLA 3RNTA 1BRKA 1BRIA 1RGEA 1BIRA 2AAEA 7RNTA 4RNTA 1ZGXA 1BNIA 1JBRA 1C54A 4J5KA 1A2PA 3HOHA 4BIRA 1TRQA 1GMPA 1LNIA 1B2SA 4HAAA 1RHLA 1RGFA 1BUJA 1BSAA 1BNRA 1FUTA 2F5MA 1FZUA 1GOUA 1UCKA 1B2ZA 1GSPA 9RNTA 1JBSA 1B27A 1UCIA 1MGWA 1B2UA 1AQZA 1YNVX 1I0XA 1BRHA 4GHOA 1CH0A 1RN1A 1GMRA 1FUSA 1BRNL 1B2XA 1DE3A 2KF6A 1BSEA 3AGNA 5BU4A 1BSCA 1RNBA 2KF4A 1LRAA 2F5WA 3DH2A 5GSPA 1HZ1A 1I2GA 8RNTA 1GMQA 2GSPA 1GOYA 4HOHA 3KCHA 1RTUA 1B21A 1TTOA 1RDSA 1PY3A 1RGGA 2C4BA 1HYFA 1I3FA 1RGLA 4BU4A 2AADA 2F4YA 1BGSA 1PYLA 1B3SA 1B20A 1BSBA 1X1XA 3BU4A 7GSPA 1AY7A 2ZA4A 1LOWA 1I0VA 2KAAA 5BIRA 1RNTA 3D5GA 1BRJA 1RGAA 1LOYA 1BVIA 2RBIA 3AHWA 1I70A 1T2HA 6RNTA 1RLSA 3DGYA 1BRGA 3WHOA 3WR2A 1IYYA 3D5IA 3AGOA 1YGWA 1BNSA 1I3IA 1FYSA 3A5EA 5RNTA 1MGRA 1BNFA 1RGKA 1Q9EA 1RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2F A;  1GOV A;  2SAR A;  4J5G A;  6GSP A;  1BNJ A;  3D4A A;  1RGC A;  2F56 A;  1BNG A;  3Q3F A;  1RMS A;  2BIR A;  1RN4 A;  2BU4 A;  1T2I A;  1UCJ A;  3AHS A;  1FW7 A;  1LOV A;  1RCL A;  2KF5 A;  5HOH A;  1SAR A;  1TRP A;  1BNE A;  1RSN A;  1BSD A;  2KF3 A;  1RCK A;  1G02 A;  1DET A;  1I2E A;  1BU4 A;  1B2M A;  2RNT A;  1YVS A;  3BIR A;  3SYU A;  3URP A;  1JBT A;  1BAO A;  3GSP A;  1I8V A;  1BOX A;  1X1U A;  1BAN A;  1BRS A;  1R4Y A;  2HOH A;  4GSP A;  1X1W A;  1X1Y A;  1UCL A;  3RNT A;  1BRK A;  1BRI A;  1RGE A;  1BIR A;  2AAE A;  7RNT A;  4RNT A;  1ZGX A;  1BNI A;  1JBR A;  1C54 A;  4J5K A;  1A2P A;  3HOH A;  4BIR A;  1TRQ A;  1GMP A;  1LNI A;  1B2S A;  4HAA A;  1RHL A;  1RGF A;  1BUJ A;  1BSA A;  1BNR A;  1FUT A;  2F5M A;  1FZU A;  1GOU A;  1UCK A;  1B2Z A;  1GSP A;  9RNT A;  1JBS A;  1B27 A;  1UCI A;  1MGW A;  1B2U A;  1AQZ A;  1YNV X;  1I0X A;  1BRH A;  4GHO A;  1CH0 A;  1RN1 A;  1GMR A;  1FUS A;  1BRN L;  1B2X A;  1DE3 A;  2KF6 A;  1BSE A;  3AGN A;  5BU4 A;  1BSC A;  1RNB A;  2KF4 A;  1LRA A;  2F5W A;  3DH2 A;  5GSP A;  1HZ1 A;  1I2G A;  8RNT A;  1GMQ A;  2GSP A;  1GOY A;  4HOH A;  3KCH A;  1RTU A;  1B21 A;  1TTO A;  1RDS A;  1PY3 A;  1RGG A;  2C4B A;  1HYF A;  1I3F A;  1RGL A;  4BU4 A;  2AAD A;  2F4Y A;  1BGS A;  1PYL A;  1B3S A;  1B20 A;  1BSB A;  1X1X A;  3BU4 A;  7GSP A;  1AY7 A;  2ZA4 A;  1LOW A;  1I0V A;  2KAA A;  5BIR A;  1RNT A;  3D5G A;  1BRJ A;  1RGA A;  1LOY A;  1BVI A;  2RBI A;  3AHW A;  1I70 A;  1T2H A;  6RNT A;  1RLS A;  3DGY A;  1BRG A;  3WHO A;  3WR2 A;  1IYY A;  3D5I A;  3AGO A;  1YGW A;  1BNS A;  1I3I A;  1FYS A;  3A5E A;  5RNT A;  1MGR A;  1BNF A;  1RGK A;  1Q9E A;  1RGH A; 
#chains in the Genus database with same CATH topology
 5G2G A;  4J5G A;  1GOV A;  1FGO A;  3D4A A;  3D79 A;  1RGC A;  2F56 A;  4LZI A;  1BNG A;  1Q42 A;  1W6G A;  4N6U A;  4WP5 A;  1RN4 A;  2GEY A;  2ML5 A;  3AHS A;  1RCL A;  1CYV A;  2O3O A;  1VQ4 3;  1TRP A;  1CQS A;  3SVA A;  1BNE A;  5LC7 A;  1JB4 A;  1RSN A;  1BSD A;  2B24 B;  1GD3 A;  1RCK A;  2HMK B;  1O7W B;  2BMO B;  1PFP A;  3DGM A;  1HU9 A;  3FF2 A;  5A0O B;  5BVB A;  1DVD A;  3G6E 3;  1D6U A;  2Z6B A;  1HKX A;  3MWZ A;  1NNV A;  2HMO B;  1GYB A;  3KKG A;  3V99 A;  2KXG A;  1I8V A;  2YX9 A;  1YJW 3;  3J7Y d;  3UL5 A;  3I56 3;  1BOX A;  2HOH A;  3CXC 2;  1VQK 3;  3GAX A;  2Q07 A;  3JUN A;  2XEP A;  4Q53 A;  2W0Q A;  3GZY B;  2QEX 3;  1BRK A;  1LQM B;  2UUG C;  3CD6 3;  2WOH A;  3ER7 A;  3MG1 A;  3SED A;  7RNT A;  4RNT A;  1YIJ 3;  1IV7 A;  1ZGX A;  2P38 A;  4XBT A;  3NBR A;  1K9M 4;  4J5K A;  1C54 A;  3UJM A;  3VF1 A;  1DMQ A;  2CIU A;  3NBJ A;  5IEP A;  1Q82 4;  2WO0 A;  4K1V A;  3CCM 3;  1Q7Y 4;  1LNI A;  1Z1S A;  1RGF A;  3HK4 A;  1WMO A;  3WOF B;  1BUJ A;  5IER A;  3JUP A;  3MKI A;  1MOL A;  1V57 A;  4K61 A;  4KVH A;  1JKG B;  4EXR A;  2Z7A A;  3CNM A;  1IVU A;  4WWU C;  5M1A A;  1VQ7 3;  3JUM A;  1DMN A;  1W6Y A;  2H0I A;  1VQ8 3;  2D1W A;  4XM4 A;  3OWU A;  5IG4 A;  1K28 A;  5IG0 A;  1B2Z A;  1T3B A;  4HM5 B;  1UDI I;  1US1 A;  3FSD A;  2IUK A;  3EBT A;  4I4K A;  1WQL B;  3BNB A;  4R1K A;  1JBS A;  1A67 A;  3S28 A;  2C11 A;  1TU5 A;  1YHQ 3;  2XGN A;  3FZW A;  3AMO A;  1VQQ A;  3WA2 X;  1B2U A;  2HMN B;  3PCR A;  2L4V A;  5ELU A;  2R4I A;  1BRH A;  1CH0 A;  4OK0 A;  5CXO A;  4XB5 A;  1BUQ A;  3I55 3;  1DYU A;  3RDE A;  3ZG5 A;  1PU4 A;  2ML6 A;  4HM3 B;  4MMX B;  3LT9 A;  2L1S A;  3EHC A;  1YI2 3;  2HML B;  1JZO A;  2KRT A;  1GMQ A;  3NQZ A;  3QK9 A;  4BTX A;  1JKG A;  2INX A;  4ZM8 A;  3K9M C;  1O7G B;  5JBS A;  1IT7 A;  1SJW A;  3KCH A;  3V98 A;  2B1X B;  1GY6 A;  3FG4 A;  3G16 A;  3S29 A;  1RGG A;  4JRF A;  2P05 A;  2AAD A;  1BGS A;  1PYL A;  1FUW A;  1B20 A;  1W5Z A;  3EN1 B;  3JUO A;  4LEH A;  1S5A A;  7STD A;  3FG1 A;  4KT3 B;  4N3V A;  4OUQ A;  1QVG 2;  1LQG C;  3SOA A;  4HM8 B;  1LOW A;  3KSP A;  2XR8 B;  2YFJ B;  4N6L A;  1JN5 A;  2OTL 3;  3JUQ A;  3NUV A;  4L8O A;  1BRJ A;  5M18 A;  4RBN A;  2CWU A;  4IIA A;  1TUH A;  1T2H A;  2RGQ A;  1RLS A;  3PCS A;  4XDW A;  5G1K A;  3MPH A;  1IYY A;  1MWS A;  4HJL B;  3S27 A;  3AGO A;  2XF3 A;  5LC6 A;  1E3V A;  3LOY A;  2XSO B;  2CWT A;  1JB5 A;  2I9W A;  5RNT A;  1RRH A;  1MGR A;  1BNF A;  1K41 A;  4WYK B;  1AV4 A;  5BXQ A;  1D6Z A;  5I97 A;  1I2F A;  2SAR A;  3CCS 3;  4HM2 B;  2QGU A;  1BNJ A;  2CFD A;  5EVH A;  1W2B 2;  3K7C A;  3PZW A;  2D42 A;  3MYT A;  1FGQ A;  1TJD A;  4HVN A;  4HKV B;  1W4N A;  1W6C A;  2ZDJ A;  1QAK A;  5D83 A;  1N8Q A;  3NX0 A;  2CW9 A;  2CHC A;  2F99 A;  3HII A;  4X2O A;  3V92 A;  1IQ8 A;  1UGI A;  2GXF A;  2CG0 A;  2JDI H;  3EN8 A;  1I2E A;  3Q2P A;  1FGM A;  1BU4 A;  5KP1 A;  3BIR A;  1ROV A;  2XRX B;  3BNC A;  3HZP A;  3Q1C A;  3PXM A;  5AIH A;  1SPU A;  3SYU A;  3NV0 A;  1Q40 B;  2CC3 A;  2GBW B;  1X1W A;  3IMA B;  4R9L A;  4FMA A;  3Q90 A;  4KFD A;  1UCL A;  3F7X A;  1U8C B;  3MG3 A;  1RGE A;  4TX4 A;  2AAE A;  1EG9 B;  3ALA A;  1BNI A;  3FF0 A;  5IG3 A;  1OHO A;  1A2P A;  3DY5 A;  3HOH A;  3IPT A;  4BIR A;  1GY5 A;  5KP3 A;  1FUT A;  3H3H A;  3WMD A;  3CNX A;  4IT7 A;  1GOU A;  1JV2 B;  4L8P A;  1W02 A;  4DKI A;  1ZO2 A;  1O7N B;  1T5Y A;  3F9S A;  2CX0 A;  9RNT A;  1W2Z A;  1UI7 A;  1B27 A;  3OX9 A;  1NB5 I;  5AI1 A;  1AQZ A;  4OVM A;  4AKZ A;  3EC9 A;  1IVX A;  5AYS C;  3U97 A;  3GRD A;  1R4C A;  1VQN 3;  4LSO A;  2IMJ A;  3HIG A;  1BRN L;  1VZZ A;  3D3L A;  5BU4 A;  3PGB A;  1BSC A;  2HMM B;  1QJG A;  2KF4 A;  2F5W A;  4N6N B;  3KN4 A;  3DH2 A;  1HZ1 A;  4ORL A;  8RNT A;  4L7K A;  1GOY A;  3D9R A;  3NBB A;  3X42 A;  1IDP A;  1FGT A;  4HOH A;  4HM7 B;  1RTU A;  3UB1 A;  1RN7 A;  4HM6 B;  3O8Y A;  4NPB A;  4PEJ A;  3MHE A;  3FGY A;  1VQO 3;  3KFQ C;  1RJO A;  4BU4 A;  2XSH B;  5AIF A;  3FH1 A;  3LT8 A;  3CCV 3;  4KFF A;  2W03 A;  5HGR A;  1VQ5 3;  2SBL A;  3PYJ A;  1BSB A;  1GS3 A;  3LXU X;  2YFL B;  2ZA4 A;  1YJN 3;  1Q86 4;  5KP4 A;  1I0V A;  4AEQ A;  2CFG A;  2BT3 A;  2P0M A;  2STD A;  3OXA A;  8CHO A;  1V74 A;  3BNE A;  3CC7 3;  1O7M B;  1IV9 A;  4MMZ B;  2KCD A;  3D5G A;  1A2V A;  5ELJ A;  1RGA A;  3MSO A;  3RGA A;  1LOY A;  3TDG A;  1BVI A;  1W00 A;  2QIY A;  4GL6 A;  3T0U A;  1E97 A;  1I70 A;  4J9A A;  6RNT A;  3HX8 A;  4K90 B;  1Y4K A;  3LTD A;  2F86 B;  2H0G A;  1A2K A;  1N8R 4;  4O2H A;  1L5G B;  1F8N A;  1UI8 A;  3DGN A;  3B8L A;  1YGW A;  3IJE B;  2CKF B;  3CC4 3;  1BNS A;  1I3I A;  3SXX A;  4N6T A;  3FKA A;  2W56 B;  5CF1 A;  1OAC A;  1OPY A;  1RGK A;  1U5O A;  2K54 A;  2GU1 A;  3LTB A;  2FNQ A;  2MC8 A;  3BLZ A;  2BHM A;  1SII A;  1YGE A;  1TIJ A;  6GSP A;  1LXE A;  4LYL B;  4G1M B;  3Q3F A;  1RMS A;  2BIR A;  1G0T A;  1UCJ A;  3WOE B;  4R4K A;  2P0X A;  1LOX A;  2KF5 A;  1OCV A;  1SAR A;  1TP6 A;  1JRQ A;  3N9H A;  1UGH I;  1G02 A;  2YFI B;  1OGZ A;  5EEO A;  2W2C A;  3QRD A;  3OW2 2;  1V58 A;  2BNG A;  3DGL A;  5TGN A;  4X2H A;  1MWT A;  4IPB A;  2CFK A;  1JBT A;  4HZ9 B;  3GSP A;  1IT8 A;  3STD A;  2W56 A;  1TFK A;  3E99 A;  1Q81 4;  1K73 4;  1X1U A;  1BAN A;  1R4Y A;  2RSX A;  1G96 A;  4GSP A;  3B4O A;  3OWY A;  4FR9 A;  1VQM 3;  5FGO A;  4RNZ A;  3G0K A;  3RGR A;  3G71 3;  1BRI A;  4LMI A;  4FMB A;  4ILF A;  2MF7 A;  1TFO A;  4EW5 A;  3I0Y A;  4BL3 A;  5IEO A;  1JBR A;  1C7H A;  3LTC A;  1TRQ A;  1B2S A;  2LQV A;  1RHL A;  2Y74 A;  4HAA A;  3LZA A;  3OV4 A;  2HMJ B;  3K5T A;  1AR0 A;  4MEI A;  4RZM A;  4HZB B;  3T8N A;  1ULI B;  1BSA A;  3DGO A;  3EBY A;  2K3D A;  3DZL A;  1QAF A;  3CCE 3;  2E2T A;  2F5M A;  4R80 A;  5AEW B;  1FZU A;  2E2V A;  1M1K 4;  1IU7 A;  3EJV A;  3JVC A;  4HYZ A;  1NB3 I;  2Y73 A;  1DVC A;  1FA3 A;  4K1U A;  4WHA A;  4MJD A;  3F7S A;  2UGI A;  1STF I;  4WYK A;  1MGW A;  2M7O A;  3CCU 3;  2OCT A;  3EQQ B;  4N6V 0;  3G4S 3;  5STD A;  2FGT A;  2A15 A;  3S67 A;  1GMR A;  1AVL A;  2RFR A;  1DE3 A;  3M8C A;  3WOD G;  3AGN A;  4R9K A;  1KWI A;  1RNB A;  1LRA A;  2GEX A;  3LML A;  1IVW A;  4STD A;  2GSP A;  5IG5 A;  3BND A;  1LVN A;  1OGX A;  3N8B A;  1RDS A;  1WTH A;  3HI7 A;  2C4B A;  3DXO A;  1RGL A;  2E2U A;  4FCM A;  1Q40 A;  1B3S A;  1KC8 4;  2H0H A;  3X41 A;  2RCD A;  3SOY A;  1J2B A;  1AVK A;  4CDL A;  1IK3 A;  5AII A;  1KSI A;  1M1X B;  5DRV A;  1VQ6 3;  2FXT A;  5M19 A;  3CMA 3;  1QAL A;  1O7H B;  4N6O B;  3NQY A;  1VQP 3;  5BIR A;  2BMR B;  3A76 A;  4HBR A;  4BL2 A;  1OHP A;  2IUJ A;  2K0M A;  2W04 A;  4KZ1 A;  2OOV A;  1RKY A;  1NJI 4;  1ZX2 A;  1EQK A;  4JF8 A;  2RBI A;  3AHW A;  2CX1 A;  2GBX B;  1SIH A;  3SX1 A;  1E3R A;  3B4P A;  3F8X A;  3U1W A;  3F8H A;  3NHX A;  3CU3 A;  5CF2 A;  4FCJ A;  3DGY A;  3GZB A;  1BRG A;  3WHO A;  5AIG A;  1OHS A;  3WR2 A;  1K8A 4;  2CH9 A;  2W9P A;  1MWU A;  1ISK A;  1GD4 A;  4EV5 A;  1W7C A;  5G1L A;  3OWS A;  1MNL A;  1A90 A;  1CYU A;  5IEN A;  3AMO B;  4XBY A;  3CME 3;  2J8X B;  1RGH A;  3H51 A;  2XGL A;  3F40 A;  1YIT 3;  4O02 B;  2OQE A;  1IQX A;  1ULJ B;  1KQS 2;  3CCJ 3;  4U13 A;  3F14 A;  2W9Q A;  2BU4 A;  3DMC A;  5EQL A;  3GZR A;  1T2I A;  4H61 A;  4BTY A;  4EYC A;  4O8S A;  1FW7 A;  1LOV A;  5HOH A;  4CPK A;  3ZG0 A;  2LYX A;  2KF3 A;  2ZL8 A;  3EB8 A;  3NM7 A;  3ROB A;  1JNQ A;  1DET A;  1Q7H A;  4XDV A;  4H3U A;  3EE1 A;  1B2M A;  1EUI C;  1YVS A;  2RNT A;  5D81 A;  1IQY A;  1EA2 A;  1NO3 A;  2IA7 A;  4FMC A;  5AYR B;  3URP A;  2R41 A;  1BAO A;  2PNC A;  3EF8 A;  1VQL 3;  3SLU A;  1BRS A;  1UUV B;  1D6Y A;  5D82 A;  2CFW A;  1RRL A;  2CWV A;  2WGQ A;  1QVF 2;  1X1Y A;  3KSE D;  3VGN A;  3RNT A;  1STD A;  1YJ9 3;  1VQ9 3;  1M90 4;  1BIR A;  3FG3 A;  4CJN A;  3NM2 A;  3UL6 A;  4HM4 B;  1JN5 B;  2C10 A;  2BMQ B;  3X3Z A;  2IY2 A;  1ROA A;  2WGO A;  3FCS B;  2W6J H;  3BB9 A;  1CEW I;  2PZV A;  1GMP A;  1IVV A;  4HM0 B;  4J8T A;  4FMD A;  2QA4 3;  2XFT A;  5IF6 A;  3LH4 A;  3S5C A;  1BNR A;  3ECF A;  2Z76 A;  1NDO B;  3MG2 A;  1UCK A;  1ZS7 A;  3NXJ A;  1GSP A;  3VSY A;  4N6M A;  3CCR 3;  4GB5 A;  3B7C A;  2CK3 H;  3L0R A;  4WFO A;  1EKM A;  3G8Z A;  1EEJ A;  1UCI A;  4HM1 B;  1OF5 B;  1JB2 A;  1NWW A;  1YNV X;  1I0X A;  1LNH A;  4FCZ A;  3KII A;  3DM8 A;  1UW1 A;  3GZX B;  4GHO A;  1RN1 A;  5AEU B;  6STD A;  5IW9 A;  1FUS A;  3WA3 A;  1GY7 A;  1B2X A;  4EC6 A;  2IYJ A;  3CPW 2;  2KF6 A;  1BSE A;  2ZHX B;  3X3X A;  3WDG B;  3CPO A;  2GU3 A;  3PS8 A;  4LGQ A;  3K0Z A;  3X3Y A;  5GSP A;  3X40 A;  1I2G A;  3LYG A;  1JJ2 2;  4NHF A;  1WMP A;  2Z77 A;  4EV2 A;  3N54 B;  1B21 A;  1DMM A;  1TTO A;  1S72 3;  1O7P B;  1PY3 A;  3DUK A;  4I5Q A;  4BTW A;  5JPU A;  1N5P A;  3KZT A;  3NV0 B;  2P09 A;  1HYF A;  1I3F A;  4RNY A;  4EBG A;  3CC2 3;  3ZFZ A;  2F4Y A;  2CFL A;  2OTJ 3;  1ASK A;  1KD1 4;  1JZD A;  3CCL 3;  1NU3 A;  1OF5 A;  1OUN A;  2WOF A;  2OOV C;  1YVB I;  1X1X A;  3BU4 A;  2F98 A;  7GSP A;  1AY7 A;  1OH0 A;  3LTA A;  2BO9 B;  2KAA A;  4KFE A;  1W01 A;  3T8U A;  2CG1 A;  3EX9 A;  2XFS A;  1UUW B;  1RNT A;  1WMN A;  2V1L A;  5CK6 A;  4O3V A;  4MMY B;  1N9J A;  1N9E A;  2UX0 A;  5CLK A;  1FGR A;  3CCQ 3;  2OWP A;  4QWT A;  1SQW A;  3GWR A;  5FW5 A;  3D5I A;  1QMA A;  3KE7 A;  2OQE C;  4NRE A;  1N5H A;  3UNL A;  1UUG B;  2O9U X;  4AKY A;  2JQ5 A;  5JPP A;  1FYS A;  3A5E A;  1M9G A;  1WNH A;  1MWR A;  3K63 A;  5DRE A;  2XH9 A;  4CCV A;  1Q9E A;  3FLJ A;  4XBX A; 
#chains in the Genus database with same CATH homology
 1I2F A;  1GOV A;  2SAR A;  4J5G A;  6GSP A;  1BNJ A;  3D4A A;  1RGC A;  2F56 A;  1BNG A;  3Q3F A;  1RMS A;  2BIR A;  1RN4 A;  2BU4 A;  1T2I A;  1UCJ A;  3AHS A;  1FW7 A;  1LOV A;  1RCL A;  2KF5 A;  5HOH A;  1SAR A;  1TRP A;  1BNE A;  1RSN A;  1BSD A;  2KF3 A;  1RCK A;  1G02 A;  1DET A;  1I2E A;  1BU4 A;  1B2M A;  2RNT A;  1YVS A;  3BIR A;  3SYU A;  3URP A;  1JBT A;  1BAO A;  3GSP A;  1I8V A;  1BOX A;  1X1U A;  1BAN A;  1BRS A;  1R4Y A;  2HOH A;  4GSP A;  1X1W A;  1X1Y A;  1UCL A;  3RNT A;  1BRK A;  1BRI A;  1RGE A;  1BIR A;  2AAE A;  7RNT A;  4RNT A;  1ZGX A;  1BNI A;  1JBR A;  1C54 A;  4J5K A;  1A2P A;  3HOH A;  4BIR A;  1TRQ A;  1GMP A;  1LNI A;  1B2S A;  4HAA A;  1RHL A;  1RGF A;  1BUJ A;  1BSA A;  1BNR A;  1FUT A;  2F5M A;  1FZU A;  1GOU A;  1UCK A;  1B2Z A;  1GSP A;  9RNT A;  1JBS A;  1B27 A;  1UCI A;  1MGW A;  1B2U A;  1AQZ A;  1YNV X;  1I0X A;  1BRH A;  4GHO A;  1CH0 A;  1RN1 A;  1GMR A;  1FUS A;  1BRN L;  1B2X A;  1DE3 A;  2KF6 A;  1BSE A;  3AGN A;  5BU4 A;  1BSC A;  1RNB A;  2KF4 A;  1LRA A;  2F5W A;  3DH2 A;  5GSP A;  1HZ1 A;  1I2G A;  8RNT A;  1GMQ A;  2GSP A;  1GOY A;  4HOH A;  3KCH A;  1RTU A;  1B21 A;  1TTO A;  1RDS A;  1PY3 A;  1RGG A;  2C4B A;  1HYF A;  1I3F A;  1RGL A;  4BU4 A;  2AAD A;  2F4Y A;  1BGS A;  1PYL A;  1B3S A;  1B20 A;  1BSB A;  1X1X A;  3BU4 A;  7GSP A;  1AY7 A;  2ZA4 A;  1LOW A;  1I0V A;  2KAA A;  5BIR A;  1RNT A;  3D5G A;  1BRJ A;  1RGA A;  1LOY A;  1BVI A;  2RBI A;  3AHW A;  1I70 A;  1T2H A;  6RNT A;  1RLS A;  3DGY A;  1BRG A;  3WHO A;  3WR2 A;  1IYY A;  3D5I A;  3AGO A;  1YGW A;  1BNS A;  1I3I A;  1FYS A;  3A5E A;  5RNT A;  1MGR A;  1BNF A;  1RGK A;  1Q9E A;  1RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...