5CLKA

Crystal structure of sz348 in complex with s,s-cyclohexanediol
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
b'HHHHHHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal structure of SZ348 in complex with S,S-cyclohexanediol
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 45
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5clkA00
3MYTA 1NDOB 3GZBA 5CXOA 4XBXA 3OWUA 1ISKA 1STDA 3DXOA 3VSYA 2YFLB 3F40A 2QGUA 1IDPA 3RGAA 4HM6B 1EG9B 2BMRB 3MG1A 2HMLB 1QJGA 5IEOA 5AEWB 2RFRA 4IIAA 3FLJA 1ZO2A 3VGNA 3GZRA 3ECFA 1OGXA 5TGNA 3H51A 1TUHA 4L8OA 3M8CA 5IG3A 1TP6A 5IF6A 1NWWA 1ZX2A 4FCMA 3EJVA 5CLKA 3FGYA 3B4PA 3F14A 2OWPA 5AIGA 1W01A 4L8PA 4XB5A 5JPPA 4HM2B 1K41A 3BLZA 1ULIB 3B7CA 3EBYA 4PEJA 3E99A 3MSOA 5D83A 2IMJA 2HMKB 1CQSA 3G16A 2A15A 1JKGB 3F8HA 3FSDA 3GWRA 3MKIA 1DMNA 3KZTA 3JUNA 3JUOA 1UUWB 2Z7AA 3B8LA 6STDA 2QIYA 2STDA 4J8TA 4HM4B 2I9WA 1HKXA 4J9AA 5AI1A 2RCDA 3SOYA 2XSOB 4HJLB 4HM7B 5IENA 5IERA 2UX0A 4R1KA 2Z77A 1O7PB 5DREA 4FCJA 3HZPA 4RZMA 3CPOA 1QMAA 3GZYB 1JN5B 3MG3A 5FW5A 1JB2A 1SJWA 3GZXB 2INXA 3OWSA 2B24B 1OGZA 5CK6A 5AEUB 1OUNA 5KP1A 1O7GB 3NUVA 4HM0B 1Q40B 1U5OA 4HKVB 4XBYA 2BNGA 3H3HA 8CHOA 2W2CA 2YFIB 2CHCA 3EN1B 3FF0A 3T8NA 1OCVA 3EHCA 2GEYA 3ROBA 2XR8B 3OXAA 1JKGA 1JB5A 3EN8A 5HGRA 4LGQA 3SOAA 3NXJA 3DM8A 5G2GA 3NM2A 3WMDA 3D9RA 2XRXB 5STDA 4R9KA 2R4IA 3EQQB 1BUQA 5AIIA 4XM4A 1VZZA 3CU3A 3DMCA 3B4OA 3STDA 2K54A 3FH1A 1JN5A 1OHPA 1W00A 3EX9A 3IPTA 4I4KA 3K7CA 1OHSA 4K1VA 5KP3A 2GEXA 3KKGA 3JUPA 1ASKA 1Q42A 1Z1SA 1GS3A 3OWYA 3Q90A 4HZBB 1E3VA 1GY7A 4Q53A 4WP5A 3NBRA 1Q40A 2F99A 3G8ZA 3NHXA 4X2OA 1E97A 1OF5B 1DMMA 3FF2A 3F9SA 5BXQA 2HMMB 1OH0A 2F98A 3MG2A 4HVNA 2B1XB 4CDLA 3LZAA 4LMIA 5JPUA 4H3UA 5IG0A 1JB4A 1C7HA 4WYKB 4X2HA 4N3VA 2GBWB 2HMNB 5BVBA 1O7MB 4HM8B 1O7NB 2BMOB 3F7SA 1GY5A 3FZWA 2F86B 7STDA 1A2KA 5AIFA 1WQLB 3CNXA 1O7HB 4XDVA 4WWUC 2YFJB 1GY6A 4OVMA 1AR0A 3EC9A 5KP4A 1EA2A 3S5CA 5EVHA 3UNLA 5CF1A 2GBXB 3F8XA 3OX9A 3NV0B 3KSPA 5DRVA 2HMOB 5D82A 4OUQA 3T8UA 3DUKA 2Z76A 4MJDA 4GB5A 3OV4A 1OPYA 3HK4A 3F7XA 3JUQA 1W02A 1OHOA 4XDWA 3KE7A 1OF5A 3EF8A 4K1UA 5D81A 3BB9A 3MHEA 2HMJB 3G0KA 2JQ5A 3RGRA 2PZVA 4HM3B 4WYKA 4HM5B 1O7WB 2BMQB 4HM1B 5AIHA 4KVHA 3K0ZA 3A76A 4LEHA 3FKAA 3CNMA 2RGQA 3EBTA 3JUMA 4L7KA 4ORLA 3SEDA 5CF2A 4U13A 3GRDA 3I0YA 3ER7A 1ULJB 3HX8A 3LYGA 1UUVB 5IG4A 5IG5A 3DZLA 4HZ9B 2GXFA 1DMQA 1GYBA 3NV0A 5IEPA 2XSHB 3UJMA 4XBTA 4R9LA 1NU3A 1W6YA 1E3RA 4STDA 2CKFB 1S5AA
chains in the Genus database with same CATH superfamily
3MYTA 3LTCA 3QRDA 3AMOA 2OQEA 7GSPA 2SARA 1AY7A 3LTDA 2P0XA 1NDOB 2P0MA 3GZBA 5CXOA 4XBXA 3UL5A 1KWIA 3OWUA 3T0UA 3V92A 3NBJA 1ISKA 4H61A 1STDA 1IT7A 1BUJA 3U1WA 4HYZA 2WOHA 3DXOA 2CG0A 1UI7A 1AVKA 2YFLB 3F40A 3L0RA 3VSYA 2KF4A 1GMRA 2QGUA 1IDPA 3RGAA 4HM6B 1EG9B 2BMRB 4HOHA 2AADA 3MG1A 5G1LA 1S723 2OCTA 1QALA 3Q3FA 1D6ZA 2HMLB 1QJGA 5IEOA 4EXRA 3NQZA 3J7Yd 1Q814 2OOVC 1FGMA 2P05A 1TTOA 1AV4A 5LC7A 1I0VA 5AEWB 1Y4KA 1KC84 2RFRA 1B2UA 1NB3I 1KQS2 5GSPA 2MC8A 1A90A 1GD4A 2KAAA 2ZA4A 4CPKA 1VQ73 1LRAA 1SIHA 4IIAA 4BU4A 4EW5A 3FLJA 2H0IA 5EQLA 1UDII 1WTHA 1ZO2A 3RNTA 2P38A 3VGNA 3GZRA 3ECFA 1OGXA 1T3BA 1TU5A 5FGOA 1YVSA 3H51A 1TUHA 4L8OA 5TGNA 2P09A 1UUGB 3M8CA 5IG3A 3X3XA 1TP6A 1IVVA 1JV2B 4GL6A 1YGEA 5IF6A 3OW22 3ZFZA 3D3LA 4MEIA 1NWWA 1ZX2A 4FCMA 4NHFA 3EJVA 1FGTA 4FMAA 3AHSA 5CLKA 1VQP3 1BOXA 3FGYA 3KN4A 3U97A 3B4PA 1I2FA 3F14A 1DVCA 2OWPA 3NX0A 3LTBA 5AIGA 1W01A 1KSIA 4L8PA 4XB5A 3FCSB 3MPHA 5JPPA 4HM2B 4BL2A 3TDGA 1K41A 4HAAA 3BLZA 4EC6A 1ULIB 1BRSA 1B2ZA 1D6UA 3MWZA 3B7CA 3EBYA 3S28A 4PEJA 1BRJA 1GD3A 4N6NB 3E99A 3ZG5A 4N6V0 3MSOA 5D83A 2QA43 1N8QA 2IMJA 3BNDA 3N9HA 4J5KA 2HMKB 1IQYA 3X42A 1CQSA 3EB8A 1CEWI 3G16A 1YHQ3 1ROVA 2A15A 1JKGB 3F8HA 3FSDA 3GWRA 2CWTA 1GSPA 2BHMA 1SARA 1T2HA 2CIUA 3MKIA 3WA3A 1BIRA 1DMNA 3KZTA 3AGOA 3JUNA 2XGLA 1M904 1TRPA 3JUOA 1UUWB 3NM7A 1LXEA 2Z7AA 4R4KA 2RSXA 1BRHA 3B8LA 1HYFA 1FUTA 6STDA 1JZDA 2QIYA 2STDA 3ALAA 3CCM3 4I5QA 4J8TA 3SVAA 4HM4B 1UGHI 3CC23 2I9WA 4EV5A 1BRKA 1HKXA 4J9AA 2RNTA 2KF3A 4IPBA 2RCDA 3EE1A 5AI1A 2XSOB 1W6GA 5LC6A 3SOYA 4HJLB 2W9QA 1HU9A 1TJDA 3N8BA 4HM7B 1WMNA 3DH2A 5IENA 5IERA 2OTL3 2UX0A 1TFKA 2D42A 4FMDA 4MMZB 3URPA 3K63A 3CME3 1YJ93 3LT9A 1A67A 2OTJ3 1J2BA 2GSPA 1RGHA 4R1KA 1UCKA 1K734 2Z77A 1O7PB 1LOYA 5DREA 4FCJA 4BTYA 4IT7A 3S67A 3HZPA 3DGYA 3HIGA 1BSBA 2F5MA 4RZMA 3CPOA 6GSPA 3CMA3 1QMAA 1VQ63 1VQ43 3GZYB 1JN5B 2WGQA 3MG3A 5FW5A 1X1XA 1JB2A 3SXXA 3PS8A 1YI23 5EEOA 1V58A 2ZL8A 1C54A 5HOHA 1SJWA 1BSCA 3GZXB 3UL6A 2OQEC 2INXA 1LQMB 2JDIH 2L4VA 3AGNA 1V74A 1G96A 2K0MA 1F8NA 1N5HA 4ZM8A 1RCKA 2GU3A 1JZOA 3DGNA 3LH4A 3OWSA 3AHWA 2B24B 4TX4A 1N5PA 1IV7A 4MMYB 2W04A 4K90B 5ELUA 2KCDA 1OGZA 2GU1A 2O9UX 2C11A 2CFKA 3O8YA 5CK6A 1GOUA 1RNTA 4OK0A 5AEUB 1OUNA 1UW1A 5KP1A 1O7GB 1IT8A 2XGNA 3NUVA 1RJOA 1EKMA 1M1XB 3BU4A 4HM0B 3UB1A 3G713 1Q40B 1QVF2 1EQKA 1WMPA 2IYJA 1JBSA 1MWRA 4WHAA 1BNIA 5G1KA 2E2TA 1RLSA 3CCS3 1LOVA 3CXC2 1RMSA 1U5OA 4K61A 4GSPA 1BNRA 1PFPA 4HKVB 2CFGA 4XBYA 1I3IA 2CFLA 3X3ZA 3CCJ3 2BNGA 2CX0A 5ELJA 3H3HA 1FYSA 2IUJA 2ML6A 8CHOA 3CCR3 1BAOA 2W2CA 4BTWA 3HIIA 2YFIB 1RKYA 2R41A 1HZ1A 6RNTA 3BNBA 1UGIA 2CHCA 3EN1B 3FF0A 3T8NA 1OCVA 3EHCA 1AQZA 2C4BA 2GEYA 3ROBA 1Q864 4MMXB 2XR8B 1YIT3 1FA3A 1MGWA 3OXAA 1JKGA 3ZG0A 1JB5A 2CWVA 1BU4A 3EN8A 1PY3A 1RGAA 5HGRA 4QWTA 1K9M4 2CW9A 2K3DA 4LGQA 3SOAA 3NXJA 3DM8A 9RNTA 1NB5I 5G2GA 1Q824 3PGBA 3NM2A 1MWUA 1NO3A 4RNYA 3X3YA 1TRQA 1R4CA 3WMDA 3D9RA 1BRIA 2BT3A 2FGTA 2XRXB 5STDA 4EYCA 1A2PA 2R4IA 4R9KA 3X41A 1LOWA 1B20A 4DKIA 3EQQB 1Q7HA 1RN1A 1BUQA 2RBIA 5AIIA 2W56B 5AYRB 1RRHA 2Y74A 2PNCA 3DGMA 3V99A 1IVXA 3PCRA 3BIRA 3LTAA 4AKYA 3PYJA 1GMPA 1GMQA 4XM4A 1I3FA 3G6E3 3CCV3 3D79A 1VQ93 1VZZA 4LSOA 3S27A 1VQQA 3CU3A 4WFOA 3WR2A 4BIRA 3DMCA 1NNVA 4CJNA 3B4OA 3STDA 2K54A 1QAFA 2ZDJA 3IMAB 2KXGA 3FH1A 5M18A 1JN5A 1OHPA 1W00A 3EX9A 3DY5A 3IPTA 4AEQA 1I0XA 4I4KA 2D1WA 2M7OA 2QEX3 3K7CA 3FG1A 2SBLA 4FMBA 1OHSA 1JRQA 3A5EA 4K1VA 5KP3A 1WMOA 1BRGA 2GEXA 3KKGA 5M1AA 3D4AA 3JUPA 1ASKA 2WGOA 3KFQC 4FR9A 1VQ83 1MWTA 2XF3A 1Q42A 2CG1A 1V57A 1RGLA 3IJEB 3CC73 4KFEA 1Z1SA 4KFFA 1M1K4 1GS3A 3D5GA 3SX1A 3OWYA 2H0HA 3HOHA 1LNHA 3Q90A 4HZBB 1W6CA 1B2XA 1E3VA 1GY7A 1I2EA 4Q53A 4WP5A 3CPW2 1STFI 3NBRA 1Q40A 2F99A 1VQ53 1FW7A 1RGGA 1ROAA 2XFTA 1FGOA 1IQ8A 3G8ZA 3NHXA 4X2OA 1BNSA 1E97A 4LZIA 1FUSA 1BSAA 1OF5B 1RDSA 4N6TA 1DMMA 3FF2A 2H0GA 2LYXA 3F9SA 1RSNA 3CC43 5BXQA 2BU4A 2HMMB 1JBRA 4RBNA 1FGQA 1A2VA 1K28A 3CCE3 4N6UA 4G1MB 3VF1A 3DGLA 1OH0A 2F98A 1LQGC 3MG2A 4HVNA 2B1XB 4O3VA 1K8A4 1ZGXA 4CDLA 1I70A 5A0OB 3LZAA 4LMIA 5JPUA 1B3SA 3NQYA 1X1UA 1R4YA 4H3UA 4N6LA 5IG0A 1JB4A 3RDEA 3GAXA 2CFWA 2KRTA 4R80A 1PU4A 5BIRA 1C7HA 1CYUA 2E2VA 1KD14 4WYKB 5I97A 4BTXA 4X2HA 4KFDA 1B2SA 2GBWB 2HMNB 4N3VA 1QAKA 1FUWA 2F56A 3LMLA 1TFOA 2C10A 5BVBA 1B21A 1O7MB 1O7NB 4HM8B 1X1WA 2W0QA 2UUGC 2BMOB 3F7SA 2W56A 3SLUA 1BGSA 1GY5A 1SPUA 4FCZA 4HBRA 1G02A 1M9GA 2CH9A 3FZWA 1BNGA 2F86B 3NBBA 1A2KA 1I8VA 5AIFA 1SQWA 7STDA 3FG3A 1RGCA 3V98A 1WQLB 2Y73A 3KIIA 3CNXA 1Q7Y4 1IU7A 3WA2X 1NJI4 1O7HB 1OACA 1YNVX 3HI7A 1X1YA 2ML5A 4XDVA 1BNEA 3BNEA 1RTUA 4WWUC 2CFDA 3I563 1BNJA 2YFJB 1GY6A 2W9PA 1AR0A 4OVMA 2E2UA 2IY2A 3CCL3 3EC9A 4JRFA 5KP4A 5RNTA 4N6MA 1UCIA 1CH0A 1EA2A 1VQL3 1UI8A 4NREA 3S5CA 2HOHA 1MOLA 5EVHA 1IVWA 3UNLA 2CC3A 2GBXB 5CF1A 3F8XA 1QVG2 3OX9A 4O8SA 1WNHA 1BSEA 2AAEA 1SIIA 3FG4A 3PCSA 1DE3A 2F4YA 2WOFA 3NV0B 1YVBI 3KSPA 2OOVA 1MWSA 1IK3A 2ZHXB 1MGRA 1GOVA 2HMOB 5D82A 5DRVA 1RGKA 3WOEB 1UCJA 3S29A 1GOYA 4OUQA 3T8UA 3DUKA 2KF6A 1RCLA 2Z76A 4MJDA 1ZS7A 1B2MA 1LNIA 3BNCA 4GB5A 4CCVA 2XEPA 3OV4A 1OPYA 3HK4A 3AMOB 2LQVA 3F7XA 3WHOA 1YIJ3 1BRNL 1RGFA 2KF5A 5IW9A 3JUQA 1W02A 3JVCA 1N8R4 4LYLB 3SYUA 1OHOA 4XDWA 3KE7A 3N54B 3Q1CA 1OF5A 3GSPA 3EF8A 4K1UA 4N6OB 4AKZA 8RNTA 3PZWA 1YJW3 1RRLA 1L5GB 1N9JA 4J5GA 5D81A 3WODG 1I2GA 3G4S3 3LXUX 7RNTA 1BVIA 3BB9A 3K9MC 1RN4A 3MHEA 3DGOA 4GHOA 1VQO3 2IUKA 1EUIC 1B27A 1D6YA 2HMJB 2MF7A 2UGIA 3LT8A 3G0KA 1W5ZA 1JJ22 1BSDA 2BO9B 3KSED 1TIJA 2JQ5A 3RGRA 1IYYA 1EEJA 2PZVA 2W6JH 4KT3B 3D5IA 4RNTA 4HM3B 4NPBA 4WYKA 4HM5B 4BL3A 1VQN3 1U8CB 1JBTA 1O7WB 1VQK3 4EV2A 1IQXA 1FZUA 2BMQB 3LOYA 4HM1B 5AIHA 1RHLA 4KVHA 1IVUA 1LVNA 3X40A 1US1A 2XH9A 1W2B2 1T2IA 2CWUA 3Q2PA 1JNQA 2CK3H 3KCHA 1N9EA 3K0ZA 1IV9A 3A76A 4O2HA 4LEHA 3FKAA 2W03A 3CCQ3 1AVLA 1DETA 3QK9A 1RGEA 3CNMA 1UCLA 2RGQA 3EBTA 3JUMA 4L7KA 1BNFA 4ORLA 3SEDA 1T5YA 3K5TA 5CF2A 2CX1A 2Q07A 4U13A 1LOXA 4ILFA 3WDGB 4KZ1A 3GRDA 5JBSA 5AYSC 3I0YA 3ER7A 2YX9A 3I553 1ULJB 1VQM3 2V1LA 1FGRA 1UUVB 3HX8A 3LYGA 4EBGA 5IG4A 5IG5A 2IA7A 2J8XB 3DZLA 3PXMA 4HZ9B 3CCU3 3CD63 1DYUA 1W2ZA 2L1SA 1BANA 2O3OA 2F5WA 1MNLA 2GXFA 2WO0A 3WOFB 1G0TA 1Q9EA 1DMQA 2FNQA 4JF8A 2XFSA 1GYBA 3NV0A 5IEPA 5M19A 2FXTA 1DVDA 2XSHB 4RNZA 1CYVA 1YGWA 3UJMA 4XBTA 4FMCA 4R9LA 1YJN3 2BIRA 1NU3A 1W6YA 1W7CA 2Z6BA 1W4NA 1RNBA 4O02B 1E3RA 1PYLA 1RN7A 4STDA 2CKFB 1S5AA 5BU4A
chains in the Genus database with same CATH topology
3MYTA 3LTCA 3QRDA 3AMOA 2OQEA 3LTDA 2P0XA 1NDOB 2P0MA 3GZBA 5CXOA 4XBXA 3UL5A 1KWIA 3OWUA 3T0UA 3V92A 3NBJA 1ISKA 4H61A 1STDA 1IT7A 3U1WA 4HYZA 2WOHA 3DXOA 2CG0A 1UI7A 1AVKA 2YFLB 3F40A 3L0RA 3VSYA 2QGUA 1IDPA 3RGAA 4HM6B 1EG9B 2BMRB 3MG1A 1S723 2OCTA 1QALA 1D6ZA 2HMLB 1QJGA 5IEOA 4EXRA 3NQZA 3J7Yd 1Q814 2OOVC 1FGMA 2P05A 1AV4A 5LC7A 5AEWB 1Y4KA 1KC84 2RFRA 1NB3I 1KQS2 2MC8A 1A90A 1GD4A 1VQ73 1SIHA 4IIAA 3FLJA 5EQLA 1WTHA 1ZO2A 2P38A 3VGNA 3GZRA 3ECFA 1OGXA 1TU5A 5FGOA 5TGNA 3H51A 1TUHA 4L8OA 2P09A 3M8CA 5IG3A 3X3XA 1TP6A 1IVVA 1JV2B 4GL6A 1YGEA 5IF6A 3OW22 3D3LA 4MEIA 1NWWA 1ZX2A 4FCMA 4NHFA 3EJVA 1FGTA 4FMAA 5CLKA 1VQP3 3FGYA 3KN4A 3U97A 3B4PA 3F14A 1DVCA 2OWPA 3NX0A 3LTBA 5AIGA 1W01A 1KSIA 4L8PA 4XB5A 3FCSB 3MPHA 5JPPA 4HM2B 3TDGA 1K41A 4EC6A 3BLZA 1ULIB 1D6UA 3MWZA 3B7CA 3EBYA 3S28A 4PEJA 1GD3A 4N6NB 3E99A 4N6V0 3MSOA 5D83A 2QA43 1N8QA 2IMJA 3BNDA 3N9HA 2HMKB 1IQYA 3X42A 1CQSA 3EB8A 1CEWI 3G16A 1YHQ3 1ROVA 2A15A 1JKGB 3F8HA 3FSDA 3GWRA 2CWTA 2BHMA 2CIUA 4JF8A 3MKIA 3WA3A 1DMNA 3KZTA 3JUNA 2OTL3 2XGLA 1M904 3NM7A 3JUOA 1UUWB 4R4KA 1LXEA 2Z7AA 2RSXA 3B8LA 6STDA 3CCM3 2QIYA 2STDA 3ALAA 4J8TA 3SVAA 4HM4B 3CC23 2I9WA 4EV5A 1HKXA 4J9AA 4IPBA 2RCDA 3EE1A 5AI1A 2XSOB 1W6GA 5LC6A 3SOYA 4HJLB 2W9QA 1HU9A 3N8BA 4HM7B 1WMNA 5IENA 5IERA 2UX0A 1TFKA 2D42A 4FMDA 4MMZB 3CME3 3K63A 1YJ93 1A67A 3LT9A 2OTJ3 1J2BA 4R1KA 1K734 2Z77A 1O7PB 5DREA 4FCJA 4BTYA 4IT7A 3S67A 3HZPA 3HIGA 4RZMA 3CPOA 3CMA3 1QMAA 1VQ63 1VQ43 3GZYB 1JN5B 2WGQA 3MG3A 5FW5A 3SXXA 1JB2A 3PS8A 1YI23 5EEOA 2ZL8A 1SJWA 3GZXB 3UL6A 2OQEC 2INXA 2L4VA 2JDIH 4ZM8A 1V74A 1G96A 2K0MA 1F8NA 1N5HA 2GU3A 3DGNA 3LH4A 3OWSA 2B24B 4TX4A 1N5PA 1IV7A 4MMYB 4K90B 5ELUA 2KCDA 1OGZA 2GU1A 2O9UX 2C11A 2CFKA 3O8YA 5CK6A 4OK0A 5AEUB 1OUNA 1UW1A 5KP1A 1O7GB 1IT8A 2XGNA 3NUVA 1RJOA 1EKMA 1M1XB 4HM0B 3UB1A 3G713 1QVF2 1Q40B 1EQKA 1WMPA 4WHAA 2E2TA 3CCS3 3CXC2 1U5OA 4K61A 1PFPA 4HKVB 2CFGA 4XBYA 3X3ZA 2CFLA 3CCJ3 2BNGA 5ELJA 3H3HA 2IUJA 2ML6A 8CHOA 3CCR3 4BTWA 2W2CA 1RKYA 3HIIA 2YFIB 3BNBA 2CHCA 3EN1B 3FF0A 3T8NA 1OCVA 3EHCA 2GEYA 3ROBA 1Q864 4MMXB 2XR8B 1YIT3 1FA3A 3OXAA 1JKGA 1JB5A 2CWVA 3EN8A 5HGRA 1K9M4 4QWTA 2CW9A 4LGQA 3SOAA 3NXJA 3DM8A 1NB5I 5G2GA 1Q824 3PGBA 3NM2A 1NO3A 4RNYA 3X3YA 1R4CA 3WMDA 3D9RA 2BT3A 2FGTA 2XRXB 5STDA 4EYCA 4R9KA 2R4IA 3X41A 3EQQB 1BUQA 5AIIA 2W56B 5AYRB 1RRHA 2Y74A 2PNCA 3DGMA 3V99A 1IVXA 3PCRA 3LTAA 4AKYA 3PYJA 4XM4A 3CCV3 1VQ93 3G6E3 1VZZA 4LSOA 3S27A 3CU3A 4WFOA 3DMCA 3B4OA 3STDA 2K54A 1QAFA 2ZDJA 3IMAB 2KXGA 3FH1A 1JN5A 1OHPA 1W00A 3EX9A 3DY5A 3IPTA 4AEQA 4I4KA 2D1WA 2M7OA 2QEX3 3K7CA 3FG1A 2SBLA 4FMBA 1OHSA 1JRQA 4K1VA 5KP3A 1WMOA 2GEXA 3KKGA 3JUPA 1ASKA 2WGOA 3KFQC 4FR9A 1VQ83 2XF3A 1Q42A 2CG1A 3IJEB 3CC73 4KFEA 1Z1SA 4KFFA 1M1K4 1GS3A 3SX1A 3OWYA 3Q90A 4HZBB 1LNHA 1W6CA 1E3VA 1GY7A 4Q53A 4WP5A 3CPW2 1STFI 3NBRA 1Q40A 2F99A 1VQ53 1ROAA 2XFTA 1FGOA 1IQ8A 3G8ZA 3NHXA 4X2OA 4LZIA 1E97A 1OF5B 4N6TA 1DMMA 3FF2A 2LYXA 3F9SA 3CC43 5BXQA 2HMMB 4RBNA 1FGQA 1A2VA 1K28A 3CCE3 4N6UA 4G1MB 3VF1A 3DGLA 1OH0A 2F98A 3MG2A 4HVNA 2B1XB 4O3VA 1K8A4 4CDLA 5A0OB 3LZAA 4LMIA 5JPUA 3NQYA 4H3UA 4N6LA 5IG0A 1JB4A 3RDEA 3GAXA 2CFWA 2KRTA 4R80A 1PU4A 1C7HA 1CYUA 2E2VA 1KD14 4WYKB 5I97A 4BTXA 4X2HA 4KFDA 2GBWB 2HMNB 4N3VA 1FUWA 1QAKA 3LMLA 1TFOA 2C10A 5BVBA 1O7MB 4HM8B 1O7NB 2W0QA 2BMOB 3F7SA 2W56A 3SLUA 1GY5A 1SPUA 4FCZA 4HBRA 1M9GA 2CH9A 3FZWA 2F86B 3NBBA 1A2KA 5AIFA 7STDA 1SQWA 3FG3A 3V98A 1WQLB 2Y73A 3KIIA 3CNXA 1Q7Y4 1IU7A 3WA2X 1NJI4 1O7HB 1OACA 3HI7A 2ML5A 4XDVA 3BNEA 4WWUC 2CFDA 3I563 2YFJB 1GY6A 2W9PA 1AR0A 4OVMA 2E2UA 3CCL3 3EC9A 4JRFA 5KP4A 4N6MA 1EA2A 1VQL3 1UI8A 4NREA 3S5CA 1MOLA 5EVHA 1IVWA 3UNLA 2CC3A 2GBXB 5CF1A 3F8XA 1QVG2 3OX9A 4O8SA 1WNHA 1SIIA 3FG4A 3PCSA 2WOFA 3NV0B 1YVBI 3KSPA 2OOVA 1RN7A 1IK3A 5DRVA 2HMOB 5D82A 3WOEB 3S29A 4OUQA 3T8UA 3DUKA 2Z76A 4MJDA 4GB5A 3BNCA 4CCVA 2XEPA 3OV4A 1OPYA 3HK4A 3AMOB 2LQVA 3F7XA 1YIJ3 5IW9A 3JUQA 1W02A 3JVCA 1N8R4 1OHOA 4XDWA 3KE7A 3N54B 3Q1CA 1OF5A 3EF8A 4K1UA 4N6OB 4AKZA 3PZWA 1YJW3 1RRLA 1L5GB 1N9JA 5D81A 3WODG 3G4S3 3LXUX 3BB9A 3K9MC 3MHEA 1VQO3 3DGOA 2IUKA 1D6YA 2HMJB 2MF7A 3LT8A 3G0KA 1W5ZA 1JJ22 2BO9B 3KSED 1TIJA 2JQ5A 3RGRA 2PZVA 2W6JH 4HM3B 4WYKA 4HM5B 1VQN3 1U8CB 1O7WB 1VQK3 4EV2A 1IQXA 2BMQB 3LOYA 4HM1B 5AIHA 4KVHA 1IVUA 1LVNA 3X40A 1US1A 2XH9A 1W2B2 2CWUA 3Q2PA 1JNQA 2CK3H 1N9EA 3K0ZA 1IV9A 3A76A 4O2HA 4LEHA 3FKAA 2W03A 3CCQ3 1AVLA 3QK9A 3CNMA 2RGQA 3EBTA 3JUMA 4L7KA 4ORLA 3SEDA 1T5YA 3K5TA 5CF2A 2Q07A 4U13A 1LOXA 3WDGB 4KZ1A 3GRDA 5JBSA 5AYSC 3I0YA 3ER7A 2YX9A 3I553 1ULJB 1VQM3 2V1LA 1FGRA 1UUVB 3HX8A 3LYGA 4EBGA 5IG4A 5IG5A 2IA7A 3DZLA 3PXMA 4HZ9B 3CCU3 3CD63 1DYUA 1W2ZA 2O3OA 1MNLA 2GXFA 2WO0A 3WOFB 1DMQA 2FNQA 2XFSA 1GYBA 3NV0A 5IEPA 2FXTA 1DVDA 2XSHB 4RNZA 1CYVA 3UJMA 4XBTA 4FMCA 4R9LA 1YJN3 1NU3A 1W6YA 1W7CA 2Z6BA 1W4NA 4O02B 1E3RA 4STDA 2W04A 2CKFB 1S5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYT A;  1NDO B;  3GZB A;  5CXO A;  4XBX A;  3OWU A;  1ISK A;  1STD A;  3DXO A;  3VSY A;  2YFL B;  3F40 A;  2QGU A;  1IDP A;  3RGA A;  4HM6 B;  1EG9 B;  2BMR B;  3MG1 A;  2HML B;  1QJG A;  5IEO A;  5AEW B;  2RFR A;  4IIA A;  3FLJ A;  1ZO2 A;  3VGN A;  3GZR A;  3ECF A;  1OGX A;  5TGN A;  3H51 A;  1TUH A;  4L8O A;  3M8C A;  5IG3 A;  1TP6 A;  5IF6 A;  1NWW A;  1ZX2 A;  4FCM A;  3EJV A;  5CLK A;  3FGY A;  3B4P A;  3F14 A;  2OWP A;  5AIG A;  1W01 A;  4L8P A;  4XB5 A;  5JPP A;  4HM2 B;  1K41 A;  3BLZ A;  1ULI B;  3B7C A;  3EBY A;  4PEJ A;  3E99 A;  3MSO A;  5D83 A;  2IMJ A;  2HMK B;  1CQS A;  3G16 A;  2A15 A;  1JKG B;  3F8H A;  3FSD A;  3GWR A;  3MKI A;  1DMN A;  3KZT A;  3JUN A;  3JUO A;  1UUW B;  2Z7A A;  3B8L A;  6STD A;  2QIY A;  2STD A;  4J8T A;  4HM4 B;  2I9W A;  1HKX A;  4J9A A;  5AI1 A;  2RCD A;  3SOY A;  2XSO B;  4HJL B;  4HM7 B;  5IEN A;  5IER A;  2UX0 A;  4R1K A;  2Z77 A;  1O7P B;  5DRE A;  4FCJ A;  3HZP A;  4RZM A;  3CPO A;  1QMA A;  3GZY B;  1JN5 B;  3MG3 A;  5FW5 A;  1JB2 A;  1SJW A;  3GZX B;  2INX A;  3OWS A;  2B24 B;  1OGZ A;  5CK6 A;  5AEU B;  1OUN A;  5KP1 A;  1O7G B;  3NUV A;  4HM0 B;  1Q40 B;  1U5O A;  4HKV B;  4XBY A;  2BNG A;  3H3H A;  8CHO A;  2W2C A;  2YFI B;  2CHC A;  3EN1 B;  3FF0 A;  3T8N A;  1OCV A;  3EHC A;  2GEY A;  3ROB A;  2XR8 B;  3OXA A;  1JKG A;  1JB5 A;  3EN8 A;  5HGR A;  4LGQ A;  3SOA A;  3NXJ A;  3DM8 A;  5G2G A;  3NM2 A;  3WMD A;  3D9R A;  2XRX B;  5STD A;  4R9K A;  2R4I A;  3EQQ B;  1BUQ A;  5AII A;  4XM4 A;  1VZZ A;  3CU3 A;  3DMC A;  3B4O A;  3STD A;  2K54 A;  3FH1 A;  1JN5 A;  1OHP A;  1W00 A;  3EX9 A;  3IPT A;  4I4K A;  3K7C A;  1OHS A;  4K1V A;  5KP3 A;  2GEX A;  3KKG A;  3JUP A;  1ASK A;  1Q42 A;  1Z1S A;  1GS3 A;  3OWY A;  3Q90 A;  4HZB B;  1E3V A;  1GY7 A;  4Q53 A;  4WP5 A;  3NBR A;  1Q40 A;  2F99 A;  3G8Z A;  3NHX A;  4X2O A;  1E97 A;  1OF5 B;  1DMM A;  3FF2 A;  3F9S A;  5BXQ A;  2HMM B;  1OH0 A;  2F98 A;  3MG2 A;  4HVN A;  2B1X B;  4CDL A;  3LZA A;  4LMI A;  5JPU A;  4H3U A;  5IG0 A;  1JB4 A;  1C7H A;  4WYK B;  4X2H A;  4N3V A;  2GBW B;  2HMN B;  5BVB A;  1O7M B;  4HM8 B;  1O7N B;  2BMO B;  3F7S A;  1GY5 A;  3FZW A;  2F86 B;  7STD A;  1A2K A;  5AIF A;  1WQL B;  3CNX A;  1O7H B;  4XDV A;  4WWU C;  2YFJ B;  1GY6 A;  4OVM A;  1AR0 A;  3EC9 A;  5KP4 A;  1EA2 A;  3S5C A;  5EVH A;  3UNL A;  5CF1 A;  2GBX B;  3F8X A;  3OX9 A;  3NV0 B;  3KSP A;  5DRV A;  2HMO B;  5D82 A;  4OUQ A;  3T8U A;  3DUK A;  2Z76 A;  4MJD A;  4GB5 A;  3OV4 A;  1OPY A;  3HK4 A;  3F7X A;  3JUQ A;  1W02 A;  1OHO A;  4XDW A;  3KE7 A;  1OF5 A;  3EF8 A;  4K1U A;  5D81 A;  3BB9 A;  3MHE A;  2HMJ B;  3G0K A;  2JQ5 A;  3RGR A;  2PZV A;  4HM3 B;  4WYK A;  4HM5 B;  1O7W B;  2BMQ B;  4HM1 B;  5AIH A;  4KVH A;  3K0Z A;  3A76 A;  4LEH A;  3FKA A;  3CNM A;  2RGQ A;  3EBT A;  3JUM A;  4L7K A;  4ORL A;  3SED A;  5CF2 A;  4U13 A;  3GRD A;  3I0Y A;  3ER7 A;  1ULJ B;  3HX8 A;  3LYG A;  1UUV B;  5IG4 A;  5IG5 A;  3DZL A;  4HZ9 B;  2GXF A;  1DMQ A;  1GYB A;  3NV0 A;  5IEP A;  2XSH B;  3UJM A;  4XBT A;  4R9L A;  1NU3 A;  1W6Y A;  1E3R A;  4STD A;  2CKF B;  1S5A A; 
#chains in the Genus database with same CATH topology
 3MYT A;  3LTC A;  3QRD A;  3AMO A;  2OQE A;  7GSP A;  2SAR A;  1AY7 A;  3LTD A;  2P0X A;  1NDO B;  2P0M A;  3GZB A;  5CXO A;  4XBX A;  3UL5 A;  1KWI A;  3OWU A;  3T0U A;  3V92 A;  3NBJ A;  1ISK A;  4H61 A;  1STD A;  1IT7 A;  1BUJ A;  3U1W A;  4HYZ A;  2WOH A;  3DXO A;  2CG0 A;  1UI7 A;  1AVK A;  2YFL B;  3F40 A;  3L0R A;  3VSY A;  2KF4 A;  1GMR A;  2QGU A;  1IDP A;  3RGA A;  4HM6 B;  1EG9 B;  2BMR B;  4HOH A;  2AAD A;  3MG1 A;  5G1L A;  1S72 3;  2OCT A;  1QAL A;  3Q3F A;  1D6Z A;  2HML B;  1QJG A;  5IEO A;  4EXR A;  3NQZ A;  3J7Y d;  1Q81 4;  2OOV C;  1FGM A;  2P05 A;  1TTO A;  1AV4 A;  5LC7 A;  1I0V A;  5AEW B;  1Y4K A;  1KC8 4;  2RFR A;  1B2U A;  1NB3 I;  1KQS 2;  5GSP A;  2MC8 A;  1A90 A;  1GD4 A;  2KAA A;  2ZA4 A;  4CPK A;  1VQ7 3;  1LRA A;  1SIH A;  4IIA A;  4BU4 A;  4EW5 A;  3FLJ A;  2H0I A;  5EQL A;  1UDI I;  1WTH A;  1ZO2 A;  3RNT A;  2P38 A;  3VGN A;  3GZR A;  3ECF A;  1OGX A;  1T3B A;  1TU5 A;  5FGO A;  1YVS A;  3H51 A;  1TUH A;  4L8O A;  5TGN A;  2P09 A;  1UUG B;  3M8C A;  5IG3 A;  3X3X A;  1TP6 A;  1IVV A;  1JV2 B;  4GL6 A;  1YGE A;  5IF6 A;  3OW2 2;  3ZFZ A;  3D3L A;  4MEI A;  1NWW A;  1ZX2 A;  4FCM A;  4NHF A;  3EJV A;  1FGT A;  4FMA A;  3AHS A;  5CLK A;  1VQP 3;  1BOX A;  3FGY A;  3KN4 A;  3U97 A;  3B4P A;  1I2F A;  3F14 A;  1DVC A;  2OWP A;  3NX0 A;  3LTB A;  5AIG A;  1W01 A;  1KSI A;  4L8P A;  4XB5 A;  3FCS B;  3MPH A;  5JPP A;  4HM2 B;  4BL2 A;  3TDG A;  1K41 A;  4HAA A;  3BLZ A;  4EC6 A;  1ULI B;  1BRS A;  1B2Z A;  1D6U A;  3MWZ A;  3B7C A;  3EBY A;  3S28 A;  4PEJ A;  1BRJ A;  1GD3 A;  4N6N B;  3E99 A;  3ZG5 A;  4N6V 0;  3MSO A;  5D83 A;  2QA4 3;  1N8Q A;  2IMJ A;  3BND A;  3N9H A;  4J5K A;  2HMK B;  1IQY A;  3X42 A;  1CQS A;  3EB8 A;  1CEW I;  3G16 A;  1YHQ 3;  1ROV A;  2A15 A;  1JKG B;  3F8H A;  3FSD A;  3GWR A;  2CWT A;  1GSP A;  2BHM A;  1SAR A;  1T2H A;  2CIU A;  3MKI A;  3WA3 A;  1BIR A;  1DMN A;  3KZT A;  3AGO A;  3JUN A;  2XGL A;  1M90 4;  1TRP A;  3JUO A;  1UUW B;  3NM7 A;  1LXE A;  2Z7A A;  4R4K A;  2RSX A;  1BRH A;  3B8L A;  1HYF A;  1FUT A;  6STD A;  1JZD A;  2QIY A;  2STD A;  3ALA A;  3CCM 3;  4I5Q A;  4J8T A;  3SVA A;  4HM4 B;  1UGH I;  3CC2 3;  2I9W A;  4EV5 A;  1BRK A;  1HKX A;  4J9A A;  2RNT A;  2KF3 A;  4IPB A;  2RCD A;  3EE1 A;  5AI1 A;  2XSO B;  1W6G A;  5LC6 A;  3SOY A;  4HJL B;  2W9Q A;  1HU9 A;  1TJD A;  3N8B A;  4HM7 B;  1WMN A;  3DH2 A;  5IEN A;  5IER A;  2OTL 3;  2UX0 A;  1TFK A;  2D42 A;  4FMD A;  4MMZ B;  3URP A;  3K63 A;  3CME 3;  1YJ9 3;  3LT9 A;  1A67 A;  2OTJ 3;  1J2B A;  2GSP A;  1RGH A;  4R1K A;  1UCK A;  1K73 4;  2Z77 A;  1O7P B;  1LOY A;  5DRE A;  4FCJ A;  4BTY A;  4IT7 A;  3S67 A;  3HZP A;  3DGY A;  3HIG A;  1BSB A;  2F5M A;  4RZM A;  3CPO A;  6GSP A;  3CMA 3;  1QMA A;  1VQ6 3;  1VQ4 3;  3GZY B;  1JN5 B;  2WGQ A;  3MG3 A;  5FW5 A;  1X1X A;  1JB2 A;  3SXX A;  3PS8 A;  1YI2 3;  5EEO A;  1V58 A;  2ZL8 A;  1C54 A;  5HOH A;  1SJW A;  1BSC A;  3GZX B;  3UL6 A;  2OQE C;  2INX A;  1LQM B;  2JDI H;  2L4V A;  3AGN A;  1V74 A;  1G96 A;  2K0M A;  1F8N A;  1N5H A;  4ZM8 A;  1RCK A;  2GU3 A;  1JZO A;  3DGN A;  3LH4 A;  3OWS A;  3AHW A;  2B24 B;  4TX4 A;  1N5P A;  1IV7 A;  4MMY B;  2W04 A;  4K90 B;  5ELU A;  2KCD A;  1OGZ A;  2GU1 A;  2O9U X;  2C11 A;  2CFK A;  3O8Y A;  5CK6 A;  1GOU A;  1RNT A;  4OK0 A;  5AEU B;  1OUN A;  1UW1 A;  5KP1 A;  1O7G B;  1IT8 A;  2XGN A;  3NUV A;  1RJO A;  1EKM A;  1M1X B;  3BU4 A;  4HM0 B;  3UB1 A;  3G71 3;  1Q40 B;  1QVF 2;  1EQK A;  1WMP A;  2IYJ A;  1JBS A;  1MWR A;  4WHA A;  1BNI A;  5G1K A;  2E2T A;  1RLS A;  3CCS 3;  1LOV A;  3CXC 2;  1RMS A;  1U5O A;  4K61 A;  4GSP A;  1BNR A;  1PFP A;  4HKV B;  2CFG A;  4XBY A;  1I3I A;  2CFL A;  3X3Z A;  3CCJ 3;  2BNG A;  2CX0 A;  5ELJ A;  3H3H A;  1FYS A;  2IUJ A;  2ML6 A;  8CHO A;  3CCR 3;  1BAO A;  2W2C A;  4BTW A;  3HII A;  2YFI B;  1RKY A;  2R41 A;  1HZ1 A;  6RNT A;  3BNB A;  1UGI A;  2CHC A;  3EN1 B;  3FF0 A;  3T8N A;  1OCV A;  3EHC A;  1AQZ A;  2C4B A;  2GEY A;  3ROB A;  1Q86 4;  4MMX B;  2XR8 B;  1YIT 3;  1FA3 A;  1MGW A;  3OXA A;  1JKG A;  3ZG0 A;  1JB5 A;  2CWV A;  1BU4 A;  3EN8 A;  1PY3 A;  1RGA A;  5HGR A;  4QWT A;  1K9M 4;  2CW9 A;  2K3D A;  4LGQ A;  3SOA A;  3NXJ A;  3DM8 A;  9RNT A;  1NB5 I;  5G2G A;  1Q82 4;  3PGB A;  3NM2 A;  1MWU A;  1NO3 A;  4RNY A;  3X3Y A;  1TRQ A;  1R4C A;  3WMD A;  3D9R A;  1BRI A;  2BT3 A;  2FGT A;  2XRX B;  5STD A;  4EYC A;  1A2P A;  2R4I A;  4R9K A;  3X41 A;  1LOW A;  1B20 A;  4DKI A;  3EQQ B;  1Q7H A;  1RN1 A;  1BUQ A;  2RBI A;  5AII A;  2W56 B;  5AYR B;  1RRH A;  2Y74 A;  2PNC A;  3DGM A;  3V99 A;  1IVX A;  3PCR A;  3BIR A;  3LTA A;  4AKY A;  3PYJ A;  1GMP A;  1GMQ A;  4XM4 A;  1I3F A;  3G6E 3;  3CCV 3;  3D79 A;  1VQ9 3;  1VZZ A;  4LSO A;  3S27 A;  1VQQ A;  3CU3 A;  4WFO A;  3WR2 A;  4BIR A;  3DMC A;  1NNV A;  4CJN A;  3B4O A;  3STD A;  2K54 A;  1QAF A;  2ZDJ A;  3IMA B;  2KXG A;  3FH1 A;  5M18 A;  1JN5 A;  1OHP A;  1W00 A;  3EX9 A;  3DY5 A;  3IPT A;  4AEQ A;  1I0X A;  4I4K A;  2D1W A;  2M7O A;  2QEX 3;  3K7C A;  3FG1 A;  2SBL A;  4FMB A;  1OHS A;  1JRQ A;  3A5E A;  4K1V A;  5KP3 A;  1WMO A;  1BRG A;  2GEX A;  3KKG A;  5M1A A;  3D4A A;  3JUP A;  1ASK A;  2WGO A;  3KFQ C;  4FR9 A;  1VQ8 3;  1MWT A;  2XF3 A;  1Q42 A;  2CG1 A;  1V57 A;  1RGL A;  3IJE B;  3CC7 3;  4KFE A;  1Z1S A;  4KFF A;  1M1K 4;  1GS3 A;  3D5G A;  3SX1 A;  3OWY A;  2H0H A;  3HOH A;  1LNH A;  3Q90 A;  4HZB B;  1W6C A;  1B2X A;  1E3V A;  1GY7 A;  1I2E A;  4Q53 A;  4WP5 A;  3CPW 2;  1STF I;  3NBR A;  1Q40 A;  2F99 A;  1VQ5 3;  1FW7 A;  1RGG A;  1ROA A;  2XFT A;  1FGO A;  1IQ8 A;  3G8Z A;  3NHX A;  4X2O A;  1BNS A;  1E97 A;  4LZI A;  1FUS A;  1BSA A;  1OF5 B;  1RDS A;  4N6T A;  1DMM A;  3FF2 A;  2H0G A;  2LYX A;  3F9S A;  1RSN A;  3CC4 3;  5BXQ A;  2BU4 A;  2HMM B;  1JBR A;  4RBN A;  1FGQ A;  1A2V A;  1K28 A;  3CCE 3;  4N6U A;  4G1M B;  3VF1 A;  3DGL A;  1OH0 A;  2F98 A;  1LQG C;  3MG2 A;  4HVN A;  2B1X B;  4O3V A;  1K8A 4;  1ZGX A;  4CDL A;  1I70 A;  5A0O B;  3LZA A;  4LMI A;  5JPU A;  1B3S A;  3NQY A;  1X1U A;  1R4Y A;  4H3U A;  4N6L A;  5IG0 A;  1JB4 A;  3RDE A;  3GAX A;  2CFW A;  2KRT A;  4R80 A;  1PU4 A;  5BIR A;  1C7H A;  1CYU A;  2E2V A;  1KD1 4;  4WYK B;  5I97 A;  4BTX A;  4X2H A;  4KFD A;  1B2S A;  2GBW B;  2HMN B;  4N3V A;  1QAK A;  1FUW A;  2F56 A;  3LML A;  1TFO A;  2C10 A;  5BVB A;  1B21 A;  1O7M B;  1O7N B;  4HM8 B;  1X1W A;  2W0Q A;  2UUG C;  2BMO B;  3F7S A;  2W56 A;  3SLU A;  1BGS A;  1GY5 A;  1SPU A;  4FCZ A;  4HBR A;  1G02 A;  1M9G A;  2CH9 A;  3FZW A;  1BNG A;  2F86 B;  3NBB A;  1A2K A;  1I8V A;  5AIF A;  1SQW A;  7STD A;  3FG3 A;  1RGC A;  3V98 A;  1WQL B;  2Y73 A;  3KII A;  3CNX A;  1Q7Y 4;  1IU7 A;  3WA2 X;  1NJI 4;  1O7H B;  1OAC A;  1YNV X;  3HI7 A;  1X1Y A;  2ML5 A;  4XDV A;  1BNE A;  3BNE A;  1RTU A;  4WWU C;  2CFD A;  3I56 3;  1BNJ A;  2YFJ B;  1GY6 A;  2W9P A;  1AR0 A;  4OVM A;  2E2U A;  2IY2 A;  3CCL 3;  3EC9 A;  4JRF A;  5KP4 A;  5RNT A;  4N6M A;  1UCI A;  1CH0 A;  1EA2 A;  1VQL 3;  1UI8 A;  4NRE A;  3S5C A;  2HOH A;  1MOL A;  5EVH A;  1IVW A;  3UNL A;  2CC3 A;  2GBX B;  5CF1 A;  3F8X A;  1QVG 2;  3OX9 A;  4O8S A;  1WNH A;  1BSE A;  2AAE A;  1SII A;  3FG4 A;  3PCS A;  1DE3 A;  2F4Y A;  2WOF A;  3NV0 B;  1YVB I;  3KSP A;  2OOV A;  1MWS A;  1IK3 A;  2ZHX B;  1MGR A;  1GOV A;  2HMO B;  5D82 A;  5DRV A;  1RGK A;  3WOE B;  1UCJ A;  3S29 A;  1GOY A;  4OUQ A;  3T8U A;  3DUK A;  2KF6 A;  1RCL A;  2Z76 A;  4MJD A;  1ZS7 A;  1B2M A;  1LNI A;  3BNC A;  4GB5 A;  4CCV A;  2XEP A;  3OV4 A;  1OPY A;  3HK4 A;  3AMO B;  2LQV A;  3F7X A;  3WHO A;  1YIJ 3;  1BRN L;  1RGF A;  2KF5 A;  5IW9 A;  3JUQ A;  1W02 A;  3JVC A;  1N8R 4;  4LYL B;  3SYU A;  1OHO A;  4XDW A;  3KE7 A;  3N54 B;  3Q1C A;  1OF5 A;  3GSP A;  3EF8 A;  4K1U A;  4N6O B;  4AKZ A;  8RNT A;  3PZW A;  1YJW 3;  1RRL A;  1L5G B;  1N9J A;  4J5G A;  5D81 A;  3WOD G;  1I2G A;  3G4S 3;  3LXU X;  7RNT A;  1BVI A;  3BB9 A;  3K9M C;  1RN4 A;  3MHE A;  3DGO A;  4GHO A;  1VQO 3;  2IUK A;  1EUI C;  1B27 A;  1D6Y A;  2HMJ B;  2MF7 A;  2UGI A;  3LT8 A;  3G0K A;  1W5Z A;  1JJ2 2;  1BSD A;  2BO9 B;  3KSE D;  1TIJ A;  2JQ5 A;  3RGR A;  1IYY A;  1EEJ A;  2PZV A;  2W6J H;  4KT3 B;  3D5I A;  4RNT A;  4HM3 B;  4NPB A;  4WYK A;  4HM5 B;  4BL3 A;  1VQN 3;  1U8C B;  1JBT A;  1O7W B;  1VQK 3;  4EV2 A;  1IQX A;  1FZU A;  2BMQ B;  3LOY A;  4HM1 B;  5AIH A;  1RHL A;  4KVH A;  1IVU A;  1LVN A;  3X40 A;  1US1 A;  2XH9 A;  1W2B 2;  1T2I A;  2CWU A;  3Q2P A;  1JNQ A;  2CK3 H;  3KCH A;  1N9E A;  3K0Z A;  1IV9 A;  3A76 A;  4O2H A;  4LEH A;  3FKA A;  2W03 A;  3CCQ 3;  1AVL A;  1DET A;  3QK9 A;  1RGE A;  3CNM A;  1UCL A;  2RGQ A;  3EBT A;  3JUM A;  4L7K A;  1BNF A;  4ORL A;  3SED A;  1T5Y A;  3K5T A;  5CF2 A;  2CX1 A;  2Q07 A;  4U13 A;  1LOX A;  4ILF A;  3WDG B;  4KZ1 A;  3GRD A;  5JBS A;  5AYS C;  3I0Y A;  3ER7 A;  2YX9 A;  3I55 3;  1ULJ B;  1VQM 3;  2V1L A;  1FGR A;  1UUV B;  3HX8 A;  3LYG A;  4EBG A;  5IG4 A;  5IG5 A;  2IA7 A;  2J8X B;  3DZL A;  3PXM A;  4HZ9 B;  3CCU 3;  3CD6 3;  1DYU A;  1W2Z A;  2L1S A;  1BAN A;  2O3O A;  2F5W A;  1MNL A;  2GXF A;  2WO0 A;  3WOF B;  1G0T A;  1Q9E A;  1DMQ A;  2FNQ A;  4JF8 A;  2XFS A;  1GYB A;  3NV0 A;  5IEP A;  5M19 A;  2FXT A;  1DVD A;  2XSH B;  4RNZ A;  1CYV A;  1YGW A;  3UJM A;  4XBT A;  4FMC A;  4R9L A;  1YJN 3;  2BIR A;  1NU3 A;  1W6Y A;  1W7C A;  2Z6B A;  1W4N A;  1RNB A;  4O02 B;  1E3R A;  1PYL A;  1RN7 A;  4STD A;  2CKF B;  1S5A A;  5BU4 A; 
#chains in the Genus database with same CATH homology
 3MYT A;  3LTC A;  3QRD A;  3AMO A;  2OQE A;  3LTD A;  2P0X A;  1NDO B;  2P0M A;  3GZB A;  5CXO A;  4XBX A;  3UL5 A;  1KWI A;  3OWU A;  3T0U A;  3V92 A;  3NBJ A;  1ISK A;  4H61 A;  1STD A;  1IT7 A;  3U1W A;  4HYZ A;  2WOH A;  3DXO A;  2CG0 A;  1UI7 A;  1AVK A;  2YFL B;  3F40 A;  3L0R A;  3VSY A;  2QGU A;  1IDP A;  3RGA A;  4HM6 B;  1EG9 B;  2BMR B;  3MG1 A;  1S72 3;  2OCT A;  1QAL A;  1D6Z A;  2HML B;  1QJG A;  5IEO A;  4EXR A;  3NQZ A;  3J7Y d;  1Q81 4;  2OOV C;  1FGM A;  2P05 A;  1AV4 A;  5LC7 A;  5AEW B;  1Y4K A;  1KC8 4;  2RFR A;  1NB3 I;  1KQS 2;  2MC8 A;  1A90 A;  1GD4 A;  1VQ7 3;  1SIH A;  4IIA A;  3FLJ A;  5EQL A;  1WTH A;  1ZO2 A;  2P38 A;  3VGN A;  3GZR A;  3ECF A;  1OGX A;  1TU5 A;  5FGO A;  5TGN A;  3H51 A;  1TUH A;  4L8O A;  2P09 A;  3M8C A;  5IG3 A;  3X3X A;  1TP6 A;  1IVV A;  1JV2 B;  4GL6 A;  1YGE A;  5IF6 A;  3OW2 2;  3D3L A;  4MEI A;  1NWW A;  1ZX2 A;  4FCM A;  4NHF A;  3EJV A;  1FGT A;  4FMA A;  5CLK A;  1VQP 3;  3FGY A;  3KN4 A;  3U97 A;  3B4P A;  3F14 A;  1DVC A;  2OWP A;  3NX0 A;  3LTB A;  5AIG A;  1W01 A;  1KSI A;  4L8P A;  4XB5 A;  3FCS B;  3MPH A;  5JPP A;  4HM2 B;  3TDG A;  1K41 A;  4EC6 A;  3BLZ A;  1ULI B;  1D6U A;  3MWZ A;  3B7C A;  3EBY A;  3S28 A;  4PEJ A;  1GD3 A;  4N6N B;  3E99 A;  4N6V 0;  3MSO A;  5D83 A;  2QA4 3;  1N8Q A;  2IMJ A;  3BND A;  3N9H A;  2HMK B;  1IQY A;  3X42 A;  1CQS A;  3EB8 A;  1CEW I;  3G16 A;  1YHQ 3;  1ROV A;  2A15 A;  1JKG B;  3F8H A;  3FSD A;  3GWR A;  2CWT A;  2BHM A;  2CIU A;  4JF8 A;  3MKI A;  3WA3 A;  1DMN A;  3KZT A;  3JUN A;  2OTL 3;  2XGL A;  1M90 4;  3NM7 A;  3JUO A;  1UUW B;  4R4K A;  1LXE A;  2Z7A A;  2RSX A;  3B8L A;  6STD A;  3CCM 3;  2QIY A;  2STD A;  3ALA A;  4J8T A;  3SVA A;  4HM4 B;  3CC2 3;  2I9W A;  4EV5 A;  1HKX A;  4J9A A;  4IPB A;  2RCD A;  3EE1 A;  5AI1 A;  2XSO B;  1W6G A;  5LC6 A;  3SOY A;  4HJL B;  2W9Q A;  1HU9 A;  3N8B A;  4HM7 B;  1WMN A;  5IEN A;  5IER A;  2UX0 A;  1TFK A;  2D42 A;  4FMD A;  4MMZ B;  3CME 3;  3K63 A;  1YJ9 3;  1A67 A;  3LT9 A;  2OTJ 3;  1J2B A;  4R1K A;  1K73 4;  2Z77 A;  1O7P B;  5DRE A;  4FCJ A;  4BTY A;  4IT7 A;  3S67 A;  3HZP A;  3HIG A;  4RZM A;  3CPO A;  3CMA 3;  1QMA A;  1VQ6 3;  1VQ4 3;  3GZY B;  1JN5 B;  2WGQ A;  3MG3 A;  5FW5 A;  3SXX A;  1JB2 A;  3PS8 A;  1YI2 3;  5EEO A;  2ZL8 A;  1SJW A;  3GZX B;  3UL6 A;  2OQE C;  2INX A;  2L4V A;  2JDI H;  4ZM8 A;  1V74 A;  1G96 A;  2K0M A;  1F8N A;  1N5H A;  2GU3 A;  3DGN A;  3LH4 A;  3OWS A;  2B24 B;  4TX4 A;  1N5P A;  1IV7 A;  4MMY B;  4K90 B;  5ELU A;  2KCD A;  1OGZ A;  2GU1 A;  2O9U X;  2C11 A;  2CFK A;  3O8Y A;  5CK6 A;  4OK0 A;  5AEU B;  1OUN A;  1UW1 A;  5KP1 A;  1O7G B;  1IT8 A;  2XGN A;  3NUV A;  1RJO A;  1EKM A;  1M1X B;  4HM0 B;  3UB1 A;  3G71 3;  1QVF 2;  1Q40 B;  1EQK A;  1WMP A;  4WHA A;  2E2T A;  3CCS 3;  3CXC 2;  1U5O A;  4K61 A;  1PFP A;  4HKV B;  2CFG A;  4XBY A;  3X3Z A;  2CFL A;  3CCJ 3;  2BNG A;  5ELJ A;  3H3H A;  2IUJ A;  2ML6 A;  8CHO A;  3CCR 3;  4BTW A;  2W2C A;  1RKY A;  3HII A;  2YFI B;  3BNB A;  2CHC A;  3EN1 B;  3FF0 A;  3T8N A;  1OCV A;  3EHC A;  2GEY A;  3ROB A;  1Q86 4;  4MMX B;  2XR8 B;  1YIT 3;  1FA3 A;  3OXA A;  1JKG A;  1JB5 A;  2CWV A;  3EN8 A;  5HGR A;  1K9M 4;  4QWT A;  2CW9 A;  4LGQ A;  3SOA A;  3NXJ A;  3DM8 A;  1NB5 I;  5G2G A;  1Q82 4;  3PGB A;  3NM2 A;  1NO3 A;  4RNY A;  3X3Y A;  1R4C A;  3WMD A;  3D9R A;  2BT3 A;  2FGT A;  2XRX B;  5STD A;  4EYC A;  4R9K A;  2R4I A;  3X41 A;  3EQQ B;  1BUQ A;  5AII A;  2W56 B;  5AYR B;  1RRH A;  2Y74 A;  2PNC A;  3DGM A;  3V99 A;  1IVX A;  3PCR A;  3LTA A;  4AKY A;  3PYJ A;  4XM4 A;  3CCV 3;  1VQ9 3;  3G6E 3;  1VZZ A;  4LSO A;  3S27 A;  3CU3 A;  4WFO A;  3DMC A;  3B4O A;  3STD A;  2K54 A;  1QAF A;  2ZDJ A;  3IMA B;  2KXG A;  3FH1 A;  1JN5 A;  1OHP A;  1W00 A;  3EX9 A;  3DY5 A;  3IPT A;  4AEQ A;  4I4K A;  2D1W A;  2M7O A;  2QEX 3;  3K7C A;  3FG1 A;  2SBL A;  4FMB A;  1OHS A;  1JRQ A;  4K1V A;  5KP3 A;  1WMO A;  2GEX A;  3KKG A;  3JUP A;  1ASK A;  2WGO A;  3KFQ C;  4FR9 A;  1VQ8 3;  2XF3 A;  1Q42 A;  2CG1 A;  3IJE B;  3CC7 3;  4KFE A;  1Z1S A;  4KFF A;  1M1K 4;  1GS3 A;  3SX1 A;  3OWY A;  3Q90 A;  4HZB B;  1LNH A;  1W6C A;  1E3V A;  1GY7 A;  4Q53 A;  4WP5 A;  3CPW 2;  1STF I;  3NBR A;  1Q40 A;  2F99 A;  1VQ5 3;  1ROA A;  2XFT A;  1FGO A;  1IQ8 A;  3G8Z A;  3NHX A;  4X2O A;  4LZI A;  1E97 A;  1OF5 B;  4N6T A;  1DMM A;  3FF2 A;  2LYX A;  3F9S A;  3CC4 3;  5BXQ A;  2HMM B;  4RBN A;  1FGQ A;  1A2V A;  1K28 A;  3CCE 3;  4N6U A;  4G1M B;  3VF1 A;  3DGL A;  1OH0 A;  2F98 A;  3MG2 A;  4HVN A;  2B1X B;  4O3V A;  1K8A 4;  4CDL A;  5A0O B;  3LZA A;  4LMI A;  5JPU A;  3NQY A;  4H3U A;  4N6L A;  5IG0 A;  1JB4 A;  3RDE A;  3GAX A;  2CFW A;  2KRT A;  4R80 A;  1PU4 A;  1C7H A;  1CYU A;  2E2V A;  1KD1 4;  4WYK B;  5I97 A;  4BTX A;  4X2H A;  4KFD A;  2GBW B;  2HMN B;  4N3V A;  1FUW A;  1QAK A;  3LML A;  1TFO A;  2C10 A;  5BVB A;  1O7M B;  4HM8 B;  1O7N B;  2W0Q A;  2BMO B;  3F7S A;  2W56 A;  3SLU A;  1GY5 A;  1SPU A;  4FCZ A;  4HBR A;  1M9G A;  2CH9 A;  3FZW A;  2F86 B;  3NBB A;  1A2K A;  5AIF A;  7STD A;  1SQW A;  3FG3 A;  3V98 A;  1WQL B;  2Y73 A;  3KII A;  3CNX A;  1Q7Y 4;  1IU7 A;  3WA2 X;  1NJI 4;  1O7H B;  1OAC A;  3HI7 A;  2ML5 A;  4XDV A;  3BNE A;  4WWU C;  2CFD A;  3I56 3;  2YFJ B;  1GY6 A;  2W9P A;  1AR0 A;  4OVM A;  2E2U A;  3CCL 3;  3EC9 A;  4JRF A;  5KP4 A;  4N6M A;  1EA2 A;  1VQL 3;  1UI8 A;  4NRE A;  3S5C A;  1MOL A;  5EVH A;  1IVW A;  3UNL A;  2CC3 A;  2GBX B;  5CF1 A;  3F8X A;  1QVG 2;  3OX9 A;  4O8S A;  1WNH A;  1SII A;  3FG4 A;  3PCS A;  2WOF A;  3NV0 B;  1YVB I;  3KSP A;  2OOV A;  1RN7 A;  1IK3 A;  5DRV A;  2HMO B;  5D82 A;  3WOE B;  3S29 A;  4OUQ A;  3T8U A;  3DUK A;  2Z76 A;  4MJD A;  4GB5 A;  3BNC A;  4CCV A;  2XEP A;  3OV4 A;  1OPY A;  3HK4 A;  3AMO B;  2LQV A;  3F7X A;  1YIJ 3;  5IW9 A;  3JUQ A;  1W02 A;  3JVC A;  1N8R 4;  1OHO A;  4XDW A;  3KE7 A;  3N54 B;  3Q1C A;  1OF5 A;  3EF8 A;  4K1U A;  4N6O B;  4AKZ A;  3PZW A;  1YJW 3;  1RRL A;  1L5G B;  1N9J A;  5D81 A;  3WOD G;  3G4S 3;  3LXU X;  3BB9 A;  3K9M C;  3MHE A;  1VQO 3;  3DGO A;  2IUK A;  1D6Y A;  2HMJ B;  2MF7 A;  3LT8 A;  3G0K A;  1W5Z A;  1JJ2 2;  2BO9 B;  3KSE D;  1TIJ A;  2JQ5 A;  3RGR A;  2PZV A;  2W6J H;  4HM3 B;  4WYK A;  4HM5 B;  1VQN 3;  1U8C B;  1O7W B;  1VQK 3;  4EV2 A;  1IQX A;  2BMQ B;  3LOY A;  4HM1 B;  5AIH A;  4KVH A;  1IVU A;  1LVN A;  3X40 A;  1US1 A;  2XH9 A;  1W2B 2;  2CWU A;  3Q2P A;  1JNQ A;  2CK3 H;  1N9E A;  3K0Z A;  1IV9 A;  3A76 A;  4O2H A;  4LEH A;  3FKA A;  2W03 A;  3CCQ 3;  1AVL A;  3QK9 A;  3CNM A;  2RGQ A;  3EBT A;  3JUM A;  4L7K A;  4ORL A;  3SED A;  1T5Y A;  3K5T A;  5CF2 A;  2Q07 A;  4U13 A;  1LOX A;  3WDG B;  4KZ1 A;  3GRD A;  5JBS A;  5AYS C;  3I0Y A;  3ER7 A;  2YX9 A;  3I55 3;  1ULJ B;  1VQM 3;  2V1L A;  1FGR A;  1UUV B;  3HX8 A;  3LYG A;  4EBG A;  5IG4 A;  5IG5 A;  2IA7 A;  3DZL A;  3PXM A;  4HZ9 B;  3CCU 3;  3CD6 3;  1DYU A;  1W2Z A;  2O3O A;  1MNL A;  2GXF A;  2WO0 A;  3WOF B;  1DMQ A;  2FNQ A;  2XFS A;  1GYB A;  3NV0 A;  5IEP A;  2FXT A;  1DVD A;  2XSH B;  4RNZ A;  1CYV A;  3UJM A;  4XBT A;  4FMC A;  4R9L A;  1YJN 3;  1NU3 A;  1W6Y A;  1W7C A;  2Z6B A;  1W4N A;  4O02 B;  1E3R A;  4STD A;  2W04 A;  2CKF B;  1S5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...