5CLKA

Crystal structure of sz348 in complex with s,s-cyclohexanediol
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
HHHHHHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal structure of SZ348 in complex with S,S-cyclohexanediol
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 45
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5clkA00
2A15A 2RFRA 2BMOB 1GYBA 5IF6A 2XSHB 3DMCA 3UNLA 3FZWA 4L7KA 4LMIA 3GZXB 2K54A 1EA2A 2B1XB 2QIYA 1JN5A 4X2OA 4FCJA 5BVBA 1E3VA 3F7XA 2XRXB 3EC9A 3VGNA 2RCDA 3OXAA 3FH1A 3ROBA 5KP1A 3OX9A 3FF0A 1IDPA 4HM4B 3WMDA 3K0ZA 1E97A 3A76A 4XB5A 5CF1A 1ULJB 3DM8A 3I0YA 4HZBB 4I4KA 4XDVA 3B4OA 3BLZA 3ECFA 4XBXA 1NDOB 1TUHA 3JUMA 3E99A 5G2GA 3DZLA 4CDLA 4STDA 1Q40B 1DMNA 4L8OA 4K1VA 3DUKA 3CU3A 3GRDA 6STDA 1OF5B 3UJMA 5IEOA 3JUQA 1DMMA 4LEHA 3D9RA 4HM8B 1O7HB 3HK4A 1A2KA 3T8NA 1JN5B 2BNGA 2HMMB 3FLJA 3F8HA 3GZYB 1STDA 4IIAA 5IG3A 3LZAA 5CF2A 3JUNA 3KZTA 3IPTA 5AIIA 5AIFA 4R1KA 1ISKA 3CNMA 5DRVA 2HMLB 1ZX2A 3RGRA 4LGQA 3NXJA 3CNXA 3NHXA 4XBYA 3NBRA 2HMJB 3ER7A 4WYKA 5AIGA 5D83A 3VSYA 5D81A 1GS3A 3MHEA 3MYTA 1O7WB 5IG5A 3EF8A 1WQLB 3F9SA 1S5AA 1O7GB 1JKGB 3OWSA 4HM3B 2BMRB 3KE7A 5STDA 4PEJA 1JB4A 3BB9A 1O7NB 3NV0A 1QJGA 3EN1B 1NU3A 4HM0B 2GBWB 2YFIB 4HJLB 3F40A 3RGAA 2OWPA 2GBXB 2BMQB 3GWRA 4XM4A 1OUNA 4Q53A 1OCVA 1HKXA 1VZZA 5CLKA 1DMQA 3H51A 1JKGA 4ORLA 2PZVA 1O7MB 5AIHA 5KP3A 3FSDA 5HGRA 4OVMA 2GEYA 4WYKB 3SOYA 2HMNB 1ZO2A 2JQ5A 3EHCA 1U5OA 8CHOA 1GY6A 1JB5A 3SEDA 4WWUC 4HM7B 1GY7A 1W00A 3FF2A 4HM1B 1OHPA 2GXFA 3NV0B 1UUVB 1AR0A 1NWWA 4GB5A 2W2CA 4FCMA 3G16A 4J9AA 4WP5A 2B24B 1OGXA 4HM5B 3MG3A 2HMOB 2I9WA 2XR8B 3KSPA 1W6YA 3M8CA 3EBYA 1UUWB 4MJDA 5IENA 3F7SA 3B8LA 3NM2A 2CKFB 4OUQA 3HZPA 3OWUA 4R9LA 2INXA 2IMJA 3EJVA 3CPOA 5TGNA 2STDA 2YFJB 1E3RA 3KKGA 5AEWB 3G8ZA 4XDWA 2CHCA 1SJWA 7STDA 2QGUA 5KP4A 3MSOA 1O7PB 2R4IA 2Z76A 2F98A 4HVNA 3T8UA 1BUQA 5AI1A 2RGQA 5JPPA 1GY5A 4N3VA 3B7CA 1K41A 3DXOA 3MKIA 2Z77A 5IERA 1TP6A 4U13A 3GZRA 5FW5A 3FKAA 3K7CA 2YFLB 1OGZA 4HKVB 3HX8A 3MG2A 1EG9B 3FGYA 5IG4A 5IG0A 1ASKA 3Q90A 3EX9A 4HM6B 1OPYA 5DREA 4X2HA 1CQSA 5JPUA 5IEPA 4RZMA 4R9KA 1OHOA 3B4PA 1OHSA 1JB2A 3F8XA 1Q42A 3STDA 3S5CA 3H3HA 3EN8A 1W02A 4H3UA 3MG1A 4K1UA 2UX0A 2HMKB 2XSOB 1OH0A 1Z1SA 2F99A 3LYGA 2F86B 5CXOA 1W01A 3SOAA 3NUVA 4HZ9B 4XBTA 4KVHA 3GZBA 3OWYA 4L8PA 5BXQA 1Q40A 3F14A 2Z7AA 5CK6A 3EBTA 5D82A 3EQQB 1QMAA 1C7HA 3G0KA 5AEUB 4J8TA 5EVHA 3JUOA 3OV4A 2GEXA 1ULIB 1OF5A 4HM2B 3JUPA
chains in the Genus database with same CATH superfamily
1BRHA 2A15A 2RFRA 1BAOA 1CEWI 1I0XA 2BMOB 4MEIA 3HI7A 1GYBA 4KZ1A 5IF6A 3O8YA 4ZM8A 2XSHB 3HOHA 3DMCA 3PGBA 3UNLA 3FZWA 3KN4A 4L7KA 4LMIA 3WR2A 3GZXB 2K54A 3WA3A 1RLSA 1BRIA 1RNBA 1EA2A 2B1XB 1T5YA 2QIYA 3ALAA 1LQGC 3G6E3 1JN5A 2E2VA 3DGYA 3AGNA 4X2OA 2F56A 3X3ZA 2SBLA 4FCJA 5BVBA 1E3VA 3F7XA 1IVXA 2XRXB 3EC9A 3DH2A 3NQYA 3VGNA 1HZ1A 1JZOA 4ILFA 2RCDA 3OXAA 3S67A 2P0MA 2OCTA 3FH1A 3ROBA 5KP1A 3OX9A 3U97A 3FF0A 1T3BA 3D4AA 3LMLA 1IDPA 4HM4B 3DY5A 2C10A 3WMDA 1YI23 3X40A 3D5GA 3CME3 1GD3A 4GSPA 3K0ZA 1BRSA 1LOVA 4JRFA 1R4YA 2CFDA 1E97A 2XFTA 1EKMA 3A76A 4XB5A 4J5KA 3CCU3 5CF1A 1ULJB 4EV5A 1N8QA 4CPKA 3DM8A 5G1KA 1WTHA 3I0YA 1RGCA 4HZBB 3N9HA 2OQEA 4I4KA 3EB8A 3WOEB 1B2XA 2LQVA 4XDVA 1YVBI 1IK3A 2XFSA 1W2ZA 4WFOA 1RKYA 3B4OA 2CWUA 4MMYB 2F4YA 3D3LA 2W03A 3LXUX 3BLZA 1VQO3 1IT7A 2F5WA 2WOFA 2W6JH 3ECFA 4XBXA 3SVAA 4MMZB 1NDOB 1G96A 1TUHA 1LQMB 4K90B 2OOVA 3WOFB 1SIHA 3EE1A 1HYFA 1LOXA 5LC7A 1C54A 3JUMA 3E99A 4LYLB 5G2GA 4RNZA 3DZLA 1MWSA 1UUGB 4CDLA 5RNTA 4G1MB 1LOYA 1LOWA 1YNVX 4STDA 1Q40B 3Q3FA 4R80A 4BU4A 1DMNA 4L8OA 1US1A 3PZWA 4K1VA 3DUKA 1S723 1Q864 3CU3A 3GRDA 3WODG 1NB5I 6STDA 2CFWA 2XGLA 3CC43 1OF5B 3DGMA 1A2PA 3UJMA 3PXMA 5IEOA 1UI7A 3RNTA 1V57A 3JUQA 3UL6A 1DMMA 3CC23 2OQEC 2OTJ3 2CWTA 1BNEA 4LEHA 1GOYA 3D9RA 1BOXA 3SXXA 1MWRA 4HM8B 1N9EA 3T0UA 1RTUA 3V98A 3WA2X 3IMAB 3CCM3 1BU4A 1O7HB 3HK4A 1A2KA 3NX0A 4O8SA 3CCE3 1MWTA 3T8NA 1JN5B 1JRQA 3LTDA 2BNGA 2HMMB 3FLJA 2XF3A 3WHOA 3F8HA 1M904 3GZYB 3S29A 1STDA 1GOVA 2OOVC 1UGHI 1IU7A 4IIAA 5IG3A 3LZAA 1KD14 5CF2A 3JUNA 3KZTA 3IPTA 4AEQA 5AIIA 1RN4A 3CCS3 1UW1A 1RGKA 4LSOA 5LC6A 5AIFA 2KCDA 3GSPA 1GMPA 2P0XA 4R1KA 1VQ63 3CCQ3 2ML6A 3V92A 2JDIH 1MOLA 2R41A 2ZL8A 3CNMA 5DRVA 5I97A 1ISKA 1TTOA 1R4CA 2HMLB 4I5QA 4IPBA 1JBSA 1SIIA 4EC6A 1T2IA 1WMNA 2H0GA 2KF5A 1N8R4 1VQ83 1B20A 1ZX2A 5AYSC 3RGRA 7RNTA 4R4KA 4LGQA 3NXJA 1QVF2 3CNXA 3NHXA 4XBYA 2IUKA 3CD63 3J7Yd 3CCR3 3NBRA 2HMJB 3ER7A 1UCJA 4WYKA 5AIGA 2CFGA 1RGLA 3X3YA 1A67A 5D83A 2OTL3 1X1XA 2KAAA 1NNVA 1GMRA 3L0RA 4DKIA 3VSYA 2Q07A 2RSXA 1L5GB 2XGNA 2W04A 4HBRA 5D81A 1Q7HA 1IQ8A 1GS3A 1HU9A 3MHEA 3MYTA 3FG1A 1O7WB 5IG5A 1YJW3 3SX1A 4O2HA 3EF8A 1WQLB 3F9SA 5M18A 1S5AA 1BANA 1JKGB 1O7GB 3OWSA 1X1YA 4EXRA 4HM3B 1KSIA 1I8VA 2H0HA 1X1UA 3PCSA 4NHFA 2BMRB 3KE7A 1IV9A 5STDA 5BIRA 4PEJA 3CMA3 2CC3A 4HOHA 1K8A4 1JB4A 1N5HA 3BB9A 4FMDA 3SYUA 1YIJ3 1O7NB 2V1LA 3NV0A 3I553 1JBRA 2D42A 3K63A 1QJGA 3K5TA 1DVDA 3EN1B 3NM7A 1PYLA 1QVG2 1MWUA 1NU3A 2SARA 1AV4A 4RNYA 1FGRA 3TDGA 1N9JA 3CCV3 1LXEA 4HM0B 1TU5A 2CIUA 3AHSA 4BIRA 1YGWA 2WGOA 1I2EA 3KCHA 4AKYA 2F5MA 3GAXA 1BSAA 1GSPA 1BRGA 2AAEA 2GBWB 3HIGA 1VQM3 3X3XA 2YFIB 4HJLB 1YVSA 2UUGC 3F40A 4H61A 3RGAA 2OWPA 3K9MC 2GBXB 2CW9A 2BMQB 3GWRA 2FGTA 2L1SA 3BNEA 4BTXA 4XM4A 1OUNA 5GSPA 4Q53A 1FGMA 5M1AA 3JUPA 1OCVA 1VQQA 1JJ22 1PY3A 5ELUA 3N8BA 4IT7A 1IYYA 3KSED 1WMPA 1HKXA 2O3OA 1A2VA 1EQKA 1LRAA 2CH9A 1AY7A 1VZZA 1IVUA 2FXTA 4LZIA 4BTWA 1TFKA 5CLKA 2UGIA 3U1WA 1Y4KA 1DMQA 4K61A 3H51A 4HAAA 1JKGA 3BNCA 4ORLA 2FNQA 2PZVA 2W0QA 2KF3A 3N54B 1BRJA 1O7MB 5AIHA 1QAFA 1WMOA 3Q2PA 1BRNL 1FGTA 3DGNA 5KP3A 3FSDA 5HGRA 1Q9EA 1RCKA 1B2UA 2H0IA 1SQWA 2Y73A 3LOYA 1I0VA 2P38A 4FMBA 6GSPA 5IW9A 1DE3A 4OVMA 3CPW2 5G1LA 2GEYA 1KQS2 4WYKB 1BGSA 1OACA 3SOYA 4BL2A 3LH4A 2ZDJA 2K0MA 1PU4A 2HMNB 1B21A 1ZO2A 2JQ5A 2WO0A 2XH9A 5M19A 1UCKA 4BTYA 2ML5A 1YJ93 1Q7Y4 2KF6A 1B27A 1FUSA 1JNQA 1M9GA 1BRKA 3EHCA 3FG4A 4CCVA 1G0TA 1U5OA 1GD4A 1CH0A 3D5IA 1AVKA 2BO9B 8CHOA 1VQP3 2WGQA 1GY6A 1JB5A 1LVNA 4EYCA 1V58A 3CCJ3 1FW7A 1V74A 3SEDA 2E2UA 1I2GA 1FA3A 1QAKA 4WWUC 2RNTA 2Y74A 4HM7B 3LTBA 1GY7A 3ZG5A 1BIRA 1W00A 1YGEA 2GU3A 1TRPA 3FF2A 3CCL3 4HM1B 1RMSA 1OHPA 3A5EA 2GXFA 4BL3A 1BNRA 3NV0B 1PFPA 1UUVB 3AGOA 1B2ZA 1AR0A 3D79A 1NWWA 2WOHA 4GB5A 2W2CA 1JZDA 3AHWA 1W6GA 4FCMA 3I563 1BUJA 3PYJA 1VQ73 3G16A 4J9AA 4WP5A 9RNTA 2B24B 1OGXA 3JVCA 4HM5B 2BU4A 3MG3A 1DYUA 1YIT3 1VQ53 1UI8A 2HMOB 2I9WA 8RNTA 2XR8B 1RSNA 3KSPA 1MNLA 1BNGA 1W6YA 3M8CA 3EBYA 3G713 4EBGA 1UUWB 4MJDA 5IENA 3F7SA 1A90A 3B8LA 3NM2A 2CG0A 1Q814 2CKFB 1RNTA 4OUQA 3Q1CA 3HZPA 1AVLA 4N6OB 1RHLA 2P05A 3OWUA 3PCRA 3CC73 4R9LA 3QK9A 4N6LA 2LYXA 2W56B 2IY2A 2INXA 1B3SA 2IMJA 3EJVA 1TJDA 3CPOA 5TGNA 2STDA 2YFJB 1E3RA 2CX0A 3KKGA 4KFEA 4N6V0 4TX4A 5AEWB 1X1WA 4RBNA 3G8ZA 4XDWA 1FGQA 1CYVA 2K3DA 1VQ43 2CHCA 1SJWA 2MC8A 7STDA 2IA7A 5ELJA 1STFI 2QGUA 1BNFA 3URPA 1D6UA 1ZS7A 2E2TA 1RGGA 3MSOA 5KP4A 1VQN3 1VQ93 1O7PB 3RDEA 3NBBA 2R4IA 3FG3A 1AQZA 1GMQA 2Z76A 2F98A 4HVNA 3T8UA 1BUQA 4FCZA 1IQXA 5AI1A 1TRQA 2GSPA 1RGEA 2RGQA 4KFFA 1UCLA 3S28A 2GU1A 1FUWA 1IQYA 5JPPA 1GY5A 3HIIA 1RGAA 3KFQC 5AYRB 3WDGB 4N3VA 5A0OB 2BIRA 1I3FA 3B7CA 5FGOA 3DGOA 1I2FA 2IUJA 1K41A 2Z6BA 1BNIA 2KXGA 4NPBA 2C4BA 2YX9A 1BSCA 1RJOA 3DXOA 2CG1A 3MKIA 3QRDA 2W9PA 2CWVA 2Z77A 4N6TA 5IERA 2AADA 2QA43 3SLUA 1RN7A 5HOHA 1TP6A 1SARA 1VQK3 4FR9A 5EEOA 1BVIA 3CXC2 1KC84 1BNSA 4U13A 1D6ZA 4QWTA 1W5ZA 1U8CB 6RNTA 2W56A 1DETA 1WNHA 4FMCA 2XEPA 3GZRA 4N6MA 5FW5A 1NO3A 2HOHA 1FUTA 2J8XB 2CFLA 3FKAA 1M1K4 3ZG0A 2P09A 1BSBA 2YFLB 3K7CA 5JBSA 1OGZA 4GL6A 1N5PA 4HKVB 1MGWA 3FCSB 3VF1A 3HX8A 3MG2A 1RN1A 1EG9B 3FGYA 5IG4A 1QALA 5IG0A 1BSEA 1ASKA 3Q90A 3EX9A 1K28A 3AMOB 1EEJA 3PS8A 3MPHA 1RRLA 3BIRA 1G02A 4GHOA 2D1WA 1RDSA 3BNDA 4HM6B 1OPYA 3BNBA 5DREA 4X2HA 2PNCA 3DGLA 1CQSA 4NREA 5JPUA 1W6CA 5IEPA 1D6YA 4HYZA 1ZGXA 1BNJA 3NBJA 4RZMA 2C11A 1EUIC 1JV2B 4JF8A 1OHOA 4N6UA 1B2SA 1OHSA 2M7OA 3B4PA 3BU4A 4R9KA 1NB3I 1BSDA 1JB2A 3F8XA 2CFKA 1KWIA 1M1XB 3X42A 3NQZA 1Q42A 3STDA 3X41A 1ROVA 1UCIA 2BT3A 1RRHA 3UB1A 1F8NA 3S5CA 1FZUA 3H3HA 5BU4A 1RCLA 1LNIA 2ZHXB 1JBTA 1TIJA 3EN8A 1J2BA 2ZA4A 4N6NB 1W02A 4KFDA 1MGRA 4H3UA 2W9QA 1K734 3MG1A 1IVWA 3LT9A 4K1UA 2UX0A 2HMKB 2XSOB 1ROAA 1OH0A 1Z1SA 2F99A 2KF4A 3LYGA 5EQLA 1K9M4 2O9UX 3IJEB 1VQL3 1I70A 4AKZA 1UDII 1Q824 2F86B 4EW5A 4EV2A 2KRTA 5CXOA 4RNTA 1W01A 1TFOA 3SOAA 4J5GA 1CYUA 3NUVA 1LNHA 3AMOA 2CK3H 1W2B2 1W4NA 2CX1A 1UGIA 4HZ9B 2QEX3 1NJI4 4XBTA 1RGFA 3OW22 4KVHA 3UL5A 1RGHA 1IV7A 3GZBA 3G4S3 1B2MA 1DVCA 1W7CA 4KT3B 7GSPA 3MWZA 3OWYA 4L8PA 4MMXB 1YJN3 5BXQA 1YHQ3 4FMAA 3LTAA 1Q40A 1SPUA 2RBIA 3F14A 2Z7AA 4O02B 1GOUA 1FGOA 4WHAA 4OK0A 5CK6A 3S27A 3EBTA 5D82A 4O3VA 1IVVA 3LT8A 3EQQB 2L4VA 1T2HA 1QMAA 1C7HA 3G0KA 3KIIA 1IT8A 4CJNA 5AEUB 4J8TA 3ZFZA 5EVHA 3JUOA 3OV4A 2GEXA 1ULIB 1FYSA 1I3IA 2IYJA 3V99A 1OF5A 2MF7A 4HM2B 3LTCA 2BHMA
chains in the Genus database with same CATH topology
2A15A 2RFRA 1CEWI 2BMOB 4MEIA 3HI7A 1GYBA 4KZ1A 5IF6A 3O8YA 4ZM8A 2XSHB 3DMCA 3PGBA 3UNLA 3FZWA 3KN4A 4L7KA 4LMIA 3GZXB 2K54A 3WA3A 1EA2A 2B1XB 1T5YA 2QIYA 3ALAA 3G6E3 1JN5A 2E2VA 4X2OA 3X3ZA 2SBLA 4FCJA 5BVBA 1E3VA 3F7XA 1IVXA 2XRXB 3EC9A 3NQYA 3VGNA 2RCDA 3OXAA 3S67A 2P0MA 2OCTA 3FH1A 3ROBA 5KP1A 3OX9A 3U97A 3FF0A 3LMLA 1IDPA 4HM4B 3DY5A 2C10A 3WMDA 1YI23 3X40A 3CME3 1GD3A 4JRFA 3K0ZA 2CFDA 1E97A 2XFTA 1EKMA 3A76A 4XB5A 3CCU3 5CF1A 1ULJB 4EV5A 1N8QA 3DM8A 1WTHA 3I0YA 4HZBB 2OQEA 3N9HA 4I4KA 3EB8A 3WOEB 2LQVA 4XDVA 1YVBI 1IK3A 2XFSA 1W2ZA 4WFOA 1RKYA 3B4OA 2CWUA 4MMYB 3D3LA 2W03A 3LXUX 3BLZA 1VQO3 1IT7A 2WOFA 2W6JH 3ECFA 4XBXA 3SVAA 4MMZB 1NDOB 1G96A 1TUHA 4K90B 2OOVA 3WOFB 1SIHA 3EE1A 1LOXA 5LC7A 3JUMA 3E99A 5G2GA 4RNZA 3DZLA 4CDLA 4G1MB 4STDA 1Q40B 4R80A 1DMNA 4L8OA 1US1A 3PZWA 4K1VA 3DUKA 1S723 1Q864 3CU3A 3GRDA 3WODG 1NB5I 6STDA 2CFWA 2XGLA 3CC43 1OF5B 3DGMA 3UJMA 3PXMA 5IEOA 1UI7A 3JUQA 3UL6A 1DMMA 3CC23 2OQEC 2OTJ3 2CWTA 4LEHA 3D9RA 3SXXA 3T0UA 4HM8B 1N9EA 3WA2X 3CCM3 3V98A 3IMAB 1O7HB 3HK4A 1A2KA 3NX0A 4O8SA 3CCE3 3T8NA 1JN5B 1JRQA 3LTDA 2BNGA 2HMMB 3FLJA 2XF3A 3F8HA 1M904 3GZYB 3S29A 1STDA 2OOVC 4IIAA 5IG3A 1IU7A 1KD14 3LZAA 5CF2A 3JUNA 3KZTA 3IPTA 4AEQA 5AIIA 3CCS3 1UW1A 4LSOA 5LC6A 5AIFA 2KCDA 2P0XA 4R1KA 1VQ63 3CCQ3 2ML6A 3V92A 2JDIH 1MOLA 3CNMA 2ZL8A 5DRVA 5I97A 1ISKA 1R4CA 2HMLB 4IPBA 1SIIA 4EC6A 1WMNA 1N8R4 1VQ83 1ZX2A 5AYSC 3RGRA 4R4KA 4LGQA 3NXJA 1QVF2 3CNXA 3NHXA 4XBYA 2IUKA 3CD63 3J7Yd 3CCR3 3NBRA 2HMJB 3ER7A 4WYKA 1A67A 5AIGA 2CFGA 3X3YA 5D83A 2OTL3 3L0RA 3VSYA 2Q07A 2RSXA 1L5GB 2XGNA 2W04A 4HBRA 5D81A 1IQ8A 1GS3A 1HU9A 3MHEA 3MYTA 3FG1A 1O7WB 5IG5A 1YJW3 3SX1A 4O2HA 3EF8A 1WQLB 3F9SA 1S5AA 1JKGB 1O7GB 3OWSA 4EXRA 4HM3B 1KSIA 3PCSA 4NHFA 2BMRB 3KE7A 1IV9A 5STDA 4PEJA 3CMA3 2CC3A 1K8A4 1JB4A 1N5HA 3BB9A 4FMDA 1YIJ3 1O7NB 2V1LA 3NV0A 3I553 2D42A 3K63A 1QJGA 3K5TA 1DVDA 3EN1B 3NM7A 1QVG2 1NU3A 1AV4A 4RNYA 1FGRA 3TDGA 1N9JA 3CCV3 1LXEA 4HM0B 1TU5A 2CIUA 2WGOA 4AKYA 3GAXA 3HIGA 1VQM3 2GBWB 3X3XA 2YFIB 4HJLB 3F40A 3RGAA 4H61A 2OWPA 3K9MC 2GBXB 2CW9A 2BMQB 3GWRA 2FGTA 4BTXA 3BNEA 4XM4A 1OUNA 4Q53A 1FGMA 3JUPA 1OCVA 1JJ22 5ELUA 3N8BA 4IT7A 3KSED 1WMPA 1HKXA 2O3OA 1A2VA 1EQKA 2CH9A 2FXTA 1VZZA 1IVUA 4LZIA 4BTWA 1TFKA 5CLKA 3U1WA 1Y4KA 1DMQA 4K61A 3H51A 1JKGA 3BNCA 4ORLA 2FNQA 2PZVA 2W0QA 3N54B 1O7MB 5AIHA 1QAFA 1WMOA 3Q2PA 1FGTA 3DGNA 5KP3A 3FSDA 5HGRA 2Y73A 1SQWA 3LOYA 4FMBA 2P38A 5IW9A 4OVMA 3CPW2 1KQS2 2GEYA 4WYKB 3SOYA 1OACA 3LH4A 2ZDJA 2K0MA 1PU4A 2HMNB 1ZO2A 2JQ5A 2WO0A 2XH9A 4BTYA 2ML5A 1YJ93 1Q7Y4 1M9GA 1JNQA 3EHCA 3FG4A 4CCVA 1U5OA 1GD4A 8CHOA 1AVKA 2BO9B 1VQP3 2WGQA 1GY6A 1JB5A 1LVNA 4EYCA 3CCJ3 1V74A 3SEDA 2E2UA 1FA3A 1QAKA 4WWUC 2Y74A 4HM7B 3LTBA 1GY7A 1W00A 1YGEA 2GU3A 3FF2A 3CCL3 4HM1B 1OHPA 2GXFA 3NV0B 1PFPA 1UUVB 1AR0A 1NWWA 2WOHA 4GB5A 2W2CA 1W6GA 4FCMA 3I563 3PYJA 1VQ73 3G16A 4J9AA 4WP5A 2B24B 1OGXA 3JVCA 4HM5B 3MG3A 1DYUA 1YIT3 1VQ53 1UI8A 2HMOB 2I9WA 2XR8B 3KSPA 1MNLA 1W6YA 3M8CA 3EBYA 3G713 4EBGA 1UUWB 4MJDA 5IENA 3F7SA 1A90A 3B8LA 3NM2A 2CG0A 1Q814 2CKFB 4OUQA 3Q1CA 3HZPA 1AVLA 4N6OB 3OWUA 2P05A 3PCRA 3CC73 4R9LA 3QK9A 4N6LA 2LYXA 2W56B 2INXA 2IMJA 3EJVA 3CPOA 5TGNA 2STDA 2YFJB 1E3RA 3KKGA 4KFEA 4N6V0 4TX4A 5AEWB 4RBNA 3G8ZA 4XDWA 1FGQA 1CYVA 1VQ43 2CHCA 1SJWA 2MC8A 7STDA 2IA7A 5ELJA 1STFI 2QGUA 1D6UA 2E2TA 5KP4A 3MSOA 1VQN3 1VQ93 1O7PB 3RDEA 3NBBA 2R4IA 3FG3A 2Z76A 2F98A 4HVNA 3T8UA 1BUQA 4FCZA 1IQXA 5AI1A 3S28A 4KFFA 2RGQA 2GU1A 1FUWA 1IQYA 5JPPA 1GY5A 3HIIA 3WDGB 3KFQC 5AYRB 4N3VA 5A0OB 3B7CA 5FGOA 3DGOA 2IUJA 1K41A 2Z6BA 2KXGA 2YX9A 1RJOA 3DXOA 2CG1A 3MKIA 3QRDA 2W9PA 2CWVA 2Z77A 4N6TA 5IERA 3SLUA 1RN7A 1TP6A 1VQK3 4FR9A 5EEOA 3CXC2 1KC84 4U13A 1D6ZA 4QWTA 1W5ZA 1U8CB 2W56A 1WNHA 4FMCA 2XEPA 3GZRA 4N6MA 5FW5A 1NO3A 3FKAA 2CFLA 1M1K4 2P09A 3K7CA 2YFLB 5JBSA 1OGZA 4GL6A 1N5PA 4HKVB 3FCSB 3VF1A 3HX8A 3MG2A 1EG9B 3FGYA 5IG4A 1QALA 5IG0A 1ASKA 3Q90A 3EX9A 1K28A 3AMOB 3PS8A 3MPHA 1RRLA 2D1WA 3BNDA 4HM6B 1OPYA 3BNBA 5DREA 4X2HA 2PNCA 3DGLA 1CQSA 4NREA 5JPUA 1W6CA 5IEPA 1D6YA 4HYZA 3NBJA 4RZMA 2C11A 1JV2B 4JF8A 1OHOA 4N6UA 3B4PA 1OHSA 2M7OA 4R9KA 2QA43 1NB3I 1JB2A 3F8XA 2CFKA 1KWIA 1M1XB 3X42A 3NQZA 1Q42A 3STDA 3X41A 1ROVA 2BT3A 1RRHA 3UB1A 1F8NA 3S5CA 3H3HA 1TIJA 3EN8A 1J2BA 4N6NB 1W02A 4KFDA 4H3UA 2W9QA 1K734 3MG1A 1IVWA 3LT9A 4K1UA 2UX0A 2HMKB 2XSOB 1ROAA 1OH0A 1Z1SA 2F99A 5EQLA 3LYGA 1K9M4 2O9UX 3IJEB 1VQL3 4AKZA 1Q824 2F86B 4EV2A 2KRTA 5CXOA 1W01A 1TFOA 3SOAA 1CYUA 3NUVA 1LNHA 3AMOA 2CK3H 1W2B2 1W4NA 1NJI4 4HZ9B 2QEX3 4XBTA 3OW22 4KVHA 3UL5A 1IV7A 3GZBA 3G4S3 1DVCA 1W7CA 3MWZA 3OWYA 4L8PA 4MMXB 1YJN3 5BXQA 1YHQ3 4FMAA 3LTAA 1Q40A 1SPUA 3F14A 2Z7AA 4O02B 4WHAA 1FGOA 5CK6A 4OK0A 3S27A 3EBTA 5D82A 4O3VA 1IVVA 3LT8A 3EQQB 2L4VA 3KIIA 1QMAA 1C7HA 3G0KA 1IT8A 5AEUB 4J8TA 5EVHA 3JUOA 3OV4A 2GEXA 1ULIB 3V99A 1OF5A 2MF7A 4HM2B 3LTCA 2BHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A15 A;  2RFR A;  2BMO B;  1GYB A;  5IF6 A;  2XSH B;  3DMC A;  3UNL A;  3FZW A;  4L7K A;  4LMI A;  3GZX B;  2K54 A;  1EA2 A;  2B1X B;  2QIY A;  1JN5 A;  4X2O A;  4FCJ A;  5BVB A;  1E3V A;  3F7X A;  2XRX B;  3EC9 A;  3VGN A;  2RCD A;  3OXA A;  3FH1 A;  3ROB A;  5KP1 A;  3OX9 A;  3FF0 A;  1IDP A;  4HM4 B;  3WMD A;  3K0Z A;  1E97 A;  3A76 A;  4XB5 A;  5CF1 A;  1ULJ B;  3DM8 A;  3I0Y A;  4HZB B;  4I4K A;  4XDV A;  3B4O A;  3BLZ A;  3ECF A;  4XBX A;  1NDO B;  1TUH A;  3JUM A;  3E99 A;  5G2G A;  3DZL A;  4CDL A;  4STD A;  1Q40 B;  1DMN A;  4L8O A;  4K1V A;  3DUK A;  3CU3 A;  3GRD A;  6STD A;  1OF5 B;  3UJM A;  5IEO A;  3JUQ A;  1DMM A;  4LEH A;  3D9R A;  4HM8 B;  1O7H B;  3HK4 A;  1A2K A;  3T8N A;  1JN5 B;  2BNG A;  2HMM B;  3FLJ A;  3F8H A;  3GZY B;  1STD A;  4IIA A;  5IG3 A;  3LZA A;  5CF2 A;  3JUN A;  3KZT A;  3IPT A;  5AII A;  5AIF A;  4R1K A;  1ISK A;  3CNM A;  5DRV A;  2HML B;  1ZX2 A;  3RGR A;  4LGQ A;  3NXJ A;  3CNX A;  3NHX A;  4XBY A;  3NBR A;  2HMJ B;  3ER7 A;  4WYK A;  5AIG A;  5D83 A;  3VSY A;  5D81 A;  1GS3 A;  3MHE A;  3MYT A;  1O7W B;  5IG5 A;  3EF8 A;  1WQL B;  3F9S A;  1S5A A;  1O7G B;  1JKG B;  3OWS A;  4HM3 B;  2BMR B;  3KE7 A;  5STD A;  4PEJ A;  1JB4 A;  3BB9 A;  1O7N B;  3NV0 A;  1QJG A;  3EN1 B;  1NU3 A;  4HM0 B;  2GBW B;  2YFI B;  4HJL B;  3F40 A;  3RGA A;  2OWP A;  2GBX B;  2BMQ B;  3GWR A;  4XM4 A;  1OUN A;  4Q53 A;  1OCV A;  1HKX A;  1VZZ A;  5CLK A;  1DMQ A;  3H51 A;  1JKG A;  4ORL A;  2PZV A;  1O7M B;  5AIH A;  5KP3 A;  3FSD A;  5HGR A;  4OVM A;  2GEY A;  4WYK B;  3SOY A;  2HMN B;  1ZO2 A;  2JQ5 A;  3EHC A;  1U5O A;  8CHO A;  1GY6 A;  1JB5 A;  3SED A;  4WWU C;  4HM7 B;  1GY7 A;  1W00 A;  3FF2 A;  4HM1 B;  1OHP A;  2GXF A;  3NV0 B;  1UUV B;  1AR0 A;  1NWW A;  4GB5 A;  2W2C A;  4FCM A;  3G16 A;  4J9A A;  4WP5 A;  2B24 B;  1OGX A;  4HM5 B;  3MG3 A;  2HMO B;  2I9W A;  2XR8 B;  3KSP A;  1W6Y A;  3M8C A;  3EBY A;  1UUW B;  4MJD A;  5IEN A;  3F7S A;  3B8L A;  3NM2 A;  2CKF B;  4OUQ A;  3HZP A;  3OWU A;  4R9L A;  2INX A;  2IMJ A;  3EJV A;  3CPO A;  5TGN A;  2STD A;  2YFJ B;  1E3R A;  3KKG A;  5AEW B;  3G8Z A;  4XDW A;  2CHC A;  1SJW A;  7STD A;  2QGU A;  5KP4 A;  3MSO A;  1O7P B;  2R4I A;  2Z76 A;  2F98 A;  4HVN A;  3T8U A;  1BUQ A;  5AI1 A;  2RGQ A;  5JPP A;  1GY5 A;  4N3V A;  3B7C A;  1K41 A;  3DXO A;  3MKI A;  2Z77 A;  5IER A;  1TP6 A;  4U13 A;  3GZR A;  5FW5 A;  3FKA A;  3K7C A;  2YFL B;  1OGZ A;  4HKV B;  3HX8 A;  3MG2 A;  1EG9 B;  3FGY A;  5IG4 A;  5IG0 A;  1ASK A;  3Q90 A;  3EX9 A;  4HM6 B;  1OPY A;  5DRE A;  4X2H A;  1CQS A;  5JPU A;  5IEP A;  4RZM A;  4R9K A;  1OHO A;  3B4P A;  1OHS A;  1JB2 A;  3F8X A;  1Q42 A;  3STD A;  3S5C A;  3H3H A;  3EN8 A;  1W02 A;  4H3U A;  3MG1 A;  4K1U A;  2UX0 A;  2HMK B;  2XSO B;  1OH0 A;  1Z1S A;  2F99 A;  3LYG A;  2F86 B;  5CXO A;  1W01 A;  3SOA A;  3NUV A;  4HZ9 B;  4XBT A;  4KVH A;  3GZB A;  3OWY A;  4L8P A;  5BXQ A;  1Q40 A;  3F14 A;  2Z7A A;  5CK6 A;  3EBT A;  5D82 A;  3EQQ B;  1QMA A;  1C7H A;  3G0K A;  5AEU B;  4J8T A;  5EVH A;  3JUO A;  3OV4 A;  2GEX A;  1ULI B;  1OF5 A;  4HM2 B;  3JUP A; 
#chains in the Genus database with same CATH topology
 1BRH A;  2A15 A;  2RFR A;  1BAO A;  1CEW I;  1I0X A;  2BMO B;  4MEI A;  3HI7 A;  1GYB A;  4KZ1 A;  5IF6 A;  3O8Y A;  4ZM8 A;  2XSH B;  3HOH A;  3DMC A;  3PGB A;  3UNL A;  3FZW A;  3KN4 A;  4L7K A;  4LMI A;  3WR2 A;  3GZX B;  2K54 A;  3WA3 A;  1RLS A;  1BRI A;  1RNB A;  1EA2 A;  2B1X B;  1T5Y A;  2QIY A;  3ALA A;  1LQG C;  3G6E 3;  1JN5 A;  2E2V A;  3DGY A;  3AGN A;  4X2O A;  2F56 A;  3X3Z A;  2SBL A;  4FCJ A;  5BVB A;  1E3V A;  3F7X A;  1IVX A;  2XRX B;  3EC9 A;  3DH2 A;  3NQY A;  3VGN A;  1HZ1 A;  1JZO A;  4ILF A;  2RCD A;  3OXA A;  3S67 A;  2P0M A;  2OCT A;  3FH1 A;  3ROB A;  5KP1 A;  3OX9 A;  3U97 A;  3FF0 A;  1T3B A;  3D4A A;  3LML A;  1IDP A;  4HM4 B;  3DY5 A;  2C10 A;  3WMD A;  1YI2 3;  3X40 A;  3D5G A;  3CME 3;  1GD3 A;  4GSP A;  3K0Z A;  1BRS A;  1LOV A;  4JRF A;  1R4Y A;  2CFD A;  1E97 A;  2XFT A;  1EKM A;  3A76 A;  4XB5 A;  4J5K A;  3CCU 3;  5CF1 A;  1ULJ B;  4EV5 A;  1N8Q A;  4CPK A;  3DM8 A;  5G1K A;  1WTH A;  3I0Y A;  1RGC A;  4HZB B;  3N9H A;  2OQE A;  4I4K A;  3EB8 A;  3WOE B;  1B2X A;  2LQV A;  4XDV A;  1YVB I;  1IK3 A;  2XFS A;  1W2Z A;  4WFO A;  1RKY A;  3B4O A;  2CWU A;  4MMY B;  2F4Y A;  3D3L A;  2W03 A;  3LXU X;  3BLZ A;  1VQO 3;  1IT7 A;  2F5W A;  2WOF A;  2W6J H;  3ECF A;  4XBX A;  3SVA A;  4MMZ B;  1NDO B;  1G96 A;  1TUH A;  1LQM B;  4K90 B;  2OOV A;  3WOF B;  1SIH A;  3EE1 A;  1HYF A;  1LOX A;  5LC7 A;  1C54 A;  3JUM A;  3E99 A;  4LYL B;  5G2G A;  4RNZ A;  3DZL A;  1MWS A;  1UUG B;  4CDL A;  5RNT A;  4G1M B;  1LOY A;  1LOW A;  1YNV X;  4STD A;  1Q40 B;  3Q3F A;  4R80 A;  4BU4 A;  1DMN A;  4L8O A;  1US1 A;  3PZW A;  4K1V A;  3DUK A;  1S72 3;  1Q86 4;  3CU3 A;  3GRD A;  3WOD G;  1NB5 I;  6STD A;  2CFW A;  2XGL A;  3CC4 3;  1OF5 B;  3DGM A;  1A2P A;  3UJM A;  3PXM A;  5IEO A;  1UI7 A;  3RNT A;  1V57 A;  3JUQ A;  3UL6 A;  1DMM A;  3CC2 3;  2OQE C;  2OTJ 3;  2CWT A;  1BNE A;  4LEH A;  1GOY A;  3D9R A;  1BOX A;  3SXX A;  1MWR A;  4HM8 B;  1N9E A;  3T0U A;  1RTU A;  3V98 A;  3WA2 X;  3IMA B;  3CCM 3;  1BU4 A;  1O7H B;  3HK4 A;  1A2K A;  3NX0 A;  4O8S A;  3CCE 3;  1MWT A;  3T8N A;  1JN5 B;  1JRQ A;  3LTD A;  2BNG A;  2HMM B;  3FLJ A;  2XF3 A;  3WHO A;  3F8H A;  1M90 4;  3GZY B;  3S29 A;  1STD A;  1GOV A;  2OOV C;  1UGH I;  1IU7 A;  4IIA A;  5IG3 A;  3LZA A;  1KD1 4;  5CF2 A;  3JUN A;  3KZT A;  3IPT A;  4AEQ A;  5AII A;  1RN4 A;  3CCS 3;  1UW1 A;  1RGK A;  4LSO A;  5LC6 A;  5AIF A;  2KCD A;  3GSP A;  1GMP A;  2P0X A;  4R1K A;  1VQ6 3;  3CCQ 3;  2ML6 A;  3V92 A;  2JDI H;  1MOL A;  2R41 A;  2ZL8 A;  3CNM A;  5DRV A;  5I97 A;  1ISK A;  1TTO A;  1R4C A;  2HML B;  4I5Q A;  4IPB A;  1JBS A;  1SII A;  4EC6 A;  1T2I A;  1WMN A;  2H0G A;  2KF5 A;  1N8R 4;  1VQ8 3;  1B20 A;  1ZX2 A;  5AYS C;  3RGR A;  7RNT A;  4R4K A;  4LGQ A;  3NXJ A;  1QVF 2;  3CNX A;  3NHX A;  4XBY A;  2IUK A;  3CD6 3;  3J7Y d;  3CCR 3;  3NBR A;  2HMJ B;  3ER7 A;  1UCJ A;  4WYK A;  5AIG A;  2CFG A;  1RGL A;  3X3Y A;  1A67 A;  5D83 A;  2OTL 3;  1X1X A;  2KAA A;  1NNV A;  1GMR A;  3L0R A;  4DKI A;  3VSY A;  2Q07 A;  2RSX A;  1L5G B;  2XGN A;  2W04 A;  4HBR A;  5D81 A;  1Q7H A;  1IQ8 A;  1GS3 A;  1HU9 A;  3MHE A;  3MYT A;  3FG1 A;  1O7W B;  5IG5 A;  1YJW 3;  3SX1 A;  4O2H A;  3EF8 A;  1WQL B;  3F9S A;  5M18 A;  1S5A A;  1BAN A;  1JKG B;  1O7G B;  3OWS A;  1X1Y A;  4EXR A;  4HM3 B;  1KSI A;  1I8V A;  2H0H A;  1X1U A;  3PCS A;  4NHF A;  2BMR B;  3KE7 A;  1IV9 A;  5STD A;  5BIR A;  4PEJ A;  3CMA 3;  2CC3 A;  4HOH A;  1K8A 4;  1JB4 A;  1N5H A;  3BB9 A;  4FMD A;  3SYU A;  1YIJ 3;  1O7N B;  2V1L A;  3NV0 A;  3I55 3;  1JBR A;  2D42 A;  3K63 A;  1QJG A;  3K5T A;  1DVD A;  3EN1 B;  3NM7 A;  1PYL A;  1QVG 2;  1MWU A;  1NU3 A;  2SAR A;  1AV4 A;  4RNY A;  1FGR A;  3TDG A;  1N9J A;  3CCV 3;  1LXE A;  4HM0 B;  1TU5 A;  2CIU A;  3AHS A;  4BIR A;  1YGW A;  2WGO A;  1I2E A;  3KCH A;  4AKY A;  2F5M A;  3GAX A;  1BSA A;  1GSP A;  1BRG A;  2AAE A;  2GBW B;  3HIG A;  1VQM 3;  3X3X A;  2YFI B;  4HJL B;  1YVS A;  2UUG C;  3F40 A;  4H61 A;  3RGA A;  2OWP A;  3K9M C;  2GBX B;  2CW9 A;  2BMQ B;  3GWR A;  2FGT A;  2L1S A;  3BNE A;  4BTX A;  4XM4 A;  1OUN A;  5GSP A;  4Q53 A;  1FGM A;  5M1A A;  3JUP A;  1OCV A;  1VQQ A;  1JJ2 2;  1PY3 A;  5ELU A;  3N8B A;  4IT7 A;  1IYY A;  3KSE D;  1WMP A;  1HKX A;  2O3O A;  1A2V A;  1EQK A;  1LRA A;  2CH9 A;  1AY7 A;  1VZZ A;  1IVU A;  2FXT A;  4LZI A;  4BTW A;  1TFK A;  5CLK A;  2UGI A;  3U1W A;  1Y4K A;  1DMQ A;  4K61 A;  3H51 A;  4HAA A;  1JKG A;  3BNC A;  4ORL A;  2FNQ A;  2PZV A;  2W0Q A;  2KF3 A;  3N54 B;  1BRJ A;  1O7M B;  5AIH A;  1QAF A;  1WMO A;  3Q2P A;  1BRN L;  1FGT A;  3DGN A;  5KP3 A;  3FSD A;  5HGR A;  1Q9E A;  1RCK A;  1B2U A;  2H0I A;  1SQW A;  2Y73 A;  3LOY A;  1I0V A;  2P38 A;  4FMB A;  6GSP A;  5IW9 A;  1DE3 A;  4OVM A;  3CPW 2;  5G1L A;  2GEY A;  1KQS 2;  4WYK B;  1BGS A;  1OAC A;  3SOY A;  4BL2 A;  3LH4 A;  2ZDJ A;  2K0M A;  1PU4 A;  2HMN B;  1B21 A;  1ZO2 A;  2JQ5 A;  2WO0 A;  2XH9 A;  5M19 A;  1UCK A;  4BTY A;  2ML5 A;  1YJ9 3;  1Q7Y 4;  2KF6 A;  1B27 A;  1FUS A;  1JNQ A;  1M9G A;  1BRK A;  3EHC A;  3FG4 A;  4CCV A;  1G0T A;  1U5O A;  1GD4 A;  1CH0 A;  3D5I A;  1AVK A;  2BO9 B;  8CHO A;  1VQP 3;  2WGQ A;  1GY6 A;  1JB5 A;  1LVN A;  4EYC A;  1V58 A;  3CCJ 3;  1FW7 A;  1V74 A;  3SED A;  2E2U A;  1I2G A;  1FA3 A;  1QAK A;  4WWU C;  2RNT A;  2Y74 A;  4HM7 B;  3LTB A;  1GY7 A;  3ZG5 A;  1BIR A;  1W00 A;  1YGE A;  2GU3 A;  1TRP A;  3FF2 A;  3CCL 3;  4HM1 B;  1RMS A;  1OHP A;  3A5E A;  2GXF A;  4BL3 A;  1BNR A;  3NV0 B;  1PFP A;  1UUV B;  3AGO A;  1B2Z A;  1AR0 A;  3D79 A;  1NWW A;  2WOH A;  4GB5 A;  2W2C A;  1JZD A;  3AHW A;  1W6G A;  4FCM A;  3I56 3;  1BUJ A;  3PYJ A;  1VQ7 3;  3G16 A;  4J9A A;  4WP5 A;  9RNT A;  2B24 B;  1OGX A;  3JVC A;  4HM5 B;  2BU4 A;  3MG3 A;  1DYU A;  1YIT 3;  1VQ5 3;  1UI8 A;  2HMO B;  2I9W A;  8RNT A;  2XR8 B;  1RSN A;  3KSP A;  1MNL A;  1BNG A;  1W6Y A;  3M8C A;  3EBY A;  3G71 3;  4EBG A;  1UUW B;  4MJD A;  5IEN A;  3F7S A;  1A90 A;  3B8L A;  3NM2 A;  2CG0 A;  1Q81 4;  2CKF B;  1RNT A;  4OUQ A;  3Q1C A;  3HZP A;  1AVL A;  4N6O B;  1RHL A;  2P05 A;  3OWU A;  3PCR A;  3CC7 3;  4R9L A;  3QK9 A;  4N6L A;  2LYX A;  2W56 B;  2IY2 A;  2INX A;  1B3S A;  2IMJ A;  3EJV A;  1TJD A;  3CPO A;  5TGN A;  2STD A;  2YFJ B;  1E3R A;  2CX0 A;  3KKG A;  4KFE A;  4N6V 0;  4TX4 A;  5AEW B;  1X1W A;  4RBN A;  3G8Z A;  4XDW A;  1FGQ A;  1CYV A;  2K3D A;  1VQ4 3;  2CHC A;  1SJW A;  2MC8 A;  7STD A;  2IA7 A;  5ELJ A;  1STF I;  2QGU A;  1BNF A;  3URP A;  1D6U A;  1ZS7 A;  2E2T A;  1RGG A;  3MSO A;  5KP4 A;  1VQN 3;  1VQ9 3;  1O7P B;  3RDE A;  3NBB A;  2R4I A;  3FG3 A;  1AQZ A;  1GMQ A;  2Z76 A;  2F98 A;  4HVN A;  3T8U A;  1BUQ A;  4FCZ A;  1IQX A;  5AI1 A;  1TRQ A;  2GSP A;  1RGE A;  2RGQ A;  4KFF A;  1UCL A;  3S28 A;  2GU1 A;  1FUW A;  1IQY A;  5JPP A;  1GY5 A;  3HII A;  1RGA A;  3KFQ C;  5AYR B;  3WDG B;  4N3V A;  5A0O B;  2BIR A;  1I3F A;  3B7C A;  5FGO A;  3DGO A;  1I2F A;  2IUJ A;  1K41 A;  2Z6B A;  1BNI A;  2KXG A;  4NPB A;  2C4B A;  2YX9 A;  1BSC A;  1RJO A;  3DXO A;  2CG1 A;  3MKI A;  3QRD A;  2W9P A;  2CWV A;  2Z77 A;  4N6T A;  5IER A;  2AAD A;  2QA4 3;  3SLU A;  1RN7 A;  5HOH A;  1TP6 A;  1SAR A;  1VQK 3;  4FR9 A;  5EEO A;  1BVI A;  3CXC 2;  1KC8 4;  1BNS A;  4U13 A;  1D6Z A;  4QWT A;  1W5Z A;  1U8C B;  6RNT A;  2W56 A;  1DET A;  1WNH A;  4FMC A;  2XEP A;  3GZR A;  4N6M A;  5FW5 A;  1NO3 A;  2HOH A;  1FUT A;  2J8X B;  2CFL A;  3FKA A;  1M1K 4;  3ZG0 A;  2P09 A;  1BSB A;  2YFL B;  3K7C A;  5JBS A;  1OGZ A;  4GL6 A;  1N5P A;  4HKV B;  1MGW A;  3FCS B;  3VF1 A;  3HX8 A;  3MG2 A;  1RN1 A;  1EG9 B;  3FGY A;  5IG4 A;  1QAL A;  5IG0 A;  1BSE A;  1ASK A;  3Q90 A;  3EX9 A;  1K28 A;  3AMO B;  1EEJ A;  3PS8 A;  3MPH A;  1RRL A;  3BIR A;  1G02 A;  4GHO A;  2D1W A;  1RDS A;  3BND A;  4HM6 B;  1OPY A;  3BNB A;  5DRE A;  4X2H A;  2PNC A;  3DGL A;  1CQS A;  4NRE A;  5JPU A;  1W6C A;  5IEP A;  1D6Y A;  4HYZ A;  1ZGX A;  1BNJ A;  3NBJ A;  4RZM A;  2C11 A;  1EUI C;  1JV2 B;  4JF8 A;  1OHO A;  4N6U A;  1B2S A;  1OHS A;  2M7O A;  3B4P A;  3BU4 A;  4R9K A;  1NB3 I;  1BSD A;  1JB2 A;  3F8X A;  2CFK A;  1KWI A;  1M1X B;  3X42 A;  3NQZ A;  1Q42 A;  3STD A;  3X41 A;  1ROV A;  1UCI A;  2BT3 A;  1RRH A;  3UB1 A;  1F8N A;  3S5C A;  1FZU A;  3H3H A;  5BU4 A;  1RCL A;  1LNI A;  2ZHX B;  1JBT A;  1TIJ A;  3EN8 A;  1J2B A;  2ZA4 A;  4N6N B;  1W02 A;  4KFD A;  1MGR A;  4H3U A;  2W9Q A;  1K73 4;  3MG1 A;  1IVW A;  3LT9 A;  4K1U A;  2UX0 A;  2HMK B;  2XSO B;  1ROA A;  1OH0 A;  1Z1S A;  2F99 A;  2KF4 A;  3LYG A;  5EQL A;  1K9M 4;  2O9U X;  3IJE B;  1VQL 3;  1I70 A;  4AKZ A;  1UDI I;  1Q82 4;  2F86 B;  4EW5 A;  4EV2 A;  2KRT A;  5CXO A;  4RNT A;  1W01 A;  1TFO A;  3SOA A;  4J5G A;  1CYU A;  3NUV A;  1LNH A;  3AMO A;  2CK3 H;  1W2B 2;  1W4N A;  2CX1 A;  1UGI A;  4HZ9 B;  2QEX 3;  1NJI 4;  4XBT A;  1RGF A;  3OW2 2;  4KVH A;  3UL5 A;  1RGH A;  1IV7 A;  3GZB A;  3G4S 3;  1B2M A;  1DVC A;  1W7C A;  4KT3 B;  7GSP A;  3MWZ A;  3OWY A;  4L8P A;  4MMX B;  1YJN 3;  5BXQ A;  1YHQ 3;  4FMA A;  3LTA A;  1Q40 A;  1SPU A;  2RBI A;  3F14 A;  2Z7A A;  4O02 B;  1GOU A;  1FGO A;  4WHA A;  4OK0 A;  5CK6 A;  3S27 A;  3EBT A;  5D82 A;  4O3V A;  1IVV A;  3LT8 A;  3EQQ B;  2L4V A;  1T2H A;  1QMA A;  1C7H A;  3G0K A;  3KII A;  1IT8 A;  4CJN A;  5AEU B;  4J8T A;  3ZFZ A;  5EVH A;  3JUO A;  3OV4 A;  2GEX A;  1ULI B;  1FYS A;  1I3I A;  2IYJ A;  3V99 A;  1OF5 A;  2MF7 A;  4HM2 B;  3LTC A;  2BHM A; 
#chains in the Genus database with same CATH homology
 2A15 A;  2RFR A;  1CEW I;  2BMO B;  4MEI A;  3HI7 A;  1GYB A;  4KZ1 A;  5IF6 A;  3O8Y A;  4ZM8 A;  2XSH B;  3DMC A;  3PGB A;  3UNL A;  3FZW A;  3KN4 A;  4L7K A;  4LMI A;  3GZX B;  2K54 A;  3WA3 A;  1EA2 A;  2B1X B;  1T5Y A;  2QIY A;  3ALA A;  3G6E 3;  1JN5 A;  2E2V A;  4X2O A;  3X3Z A;  2SBL A;  4FCJ A;  5BVB A;  1E3V A;  3F7X A;  1IVX A;  2XRX B;  3EC9 A;  3NQY A;  3VGN A;  2RCD A;  3OXA A;  3S67 A;  2P0M A;  2OCT A;  3FH1 A;  3ROB A;  5KP1 A;  3OX9 A;  3U97 A;  3FF0 A;  3LML A;  1IDP A;  4HM4 B;  3DY5 A;  2C10 A;  3WMD A;  1YI2 3;  3X40 A;  3CME 3;  1GD3 A;  4JRF A;  3K0Z A;  2CFD A;  1E97 A;  2XFT A;  1EKM A;  3A76 A;  4XB5 A;  3CCU 3;  5CF1 A;  1ULJ B;  4EV5 A;  1N8Q A;  3DM8 A;  1WTH A;  3I0Y A;  4HZB B;  2OQE A;  3N9H A;  4I4K A;  3EB8 A;  3WOE B;  2LQV A;  4XDV A;  1YVB I;  1IK3 A;  2XFS A;  1W2Z A;  4WFO A;  1RKY A;  3B4O A;  2CWU A;  4MMY B;  3D3L A;  2W03 A;  3LXU X;  3BLZ A;  1VQO 3;  1IT7 A;  2WOF A;  2W6J H;  3ECF A;  4XBX A;  3SVA A;  4MMZ B;  1NDO B;  1G96 A;  1TUH A;  4K90 B;  2OOV A;  3WOF B;  1SIH A;  3EE1 A;  1LOX A;  5LC7 A;  3JUM A;  3E99 A;  5G2G A;  4RNZ A;  3DZL A;  4CDL A;  4G1M B;  4STD A;  1Q40 B;  4R80 A;  1DMN A;  4L8O A;  1US1 A;  3PZW A;  4K1V A;  3DUK A;  1S72 3;  1Q86 4;  3CU3 A;  3GRD A;  3WOD G;  1NB5 I;  6STD A;  2CFW A;  2XGL A;  3CC4 3;  1OF5 B;  3DGM A;  3UJM A;  3PXM A;  5IEO A;  1UI7 A;  3JUQ A;  3UL6 A;  1DMM A;  3CC2 3;  2OQE C;  2OTJ 3;  2CWT A;  4LEH A;  3D9R A;  3SXX A;  3T0U A;  4HM8 B;  1N9E A;  3WA2 X;  3CCM 3;  3V98 A;  3IMA B;  1O7H B;  3HK4 A;  1A2K A;  3NX0 A;  4O8S A;  3CCE 3;  3T8N A;  1JN5 B;  1JRQ A;  3LTD A;  2BNG A;  2HMM B;  3FLJ A;  2XF3 A;  3F8H A;  1M90 4;  3GZY B;  3S29 A;  1STD A;  2OOV C;  4IIA A;  5IG3 A;  1IU7 A;  1KD1 4;  3LZA A;  5CF2 A;  3JUN A;  3KZT A;  3IPT A;  4AEQ A;  5AII A;  3CCS 3;  1UW1 A;  4LSO A;  5LC6 A;  5AIF A;  2KCD A;  2P0X A;  4R1K A;  1VQ6 3;  3CCQ 3;  2ML6 A;  3V92 A;  2JDI H;  1MOL A;  3CNM A;  2ZL8 A;  5DRV A;  5I97 A;  1ISK A;  1R4C A;  2HML B;  4IPB A;  1SII A;  4EC6 A;  1WMN A;  1N8R 4;  1VQ8 3;  1ZX2 A;  5AYS C;  3RGR A;  4R4K A;  4LGQ A;  3NXJ A;  1QVF 2;  3CNX A;  3NHX A;  4XBY A;  2IUK A;  3CD6 3;  3J7Y d;  3CCR 3;  3NBR A;  2HMJ B;  3ER7 A;  4WYK A;  1A67 A;  5AIG A;  2CFG A;  3X3Y A;  5D83 A;  2OTL 3;  3L0R A;  3VSY A;  2Q07 A;  2RSX A;  1L5G B;  2XGN A;  2W04 A;  4HBR A;  5D81 A;  1IQ8 A;  1GS3 A;  1HU9 A;  3MHE A;  3MYT A;  3FG1 A;  1O7W B;  5IG5 A;  1YJW 3;  3SX1 A;  4O2H A;  3EF8 A;  1WQL B;  3F9S A;  1S5A A;  1JKG B;  1O7G B;  3OWS A;  4EXR A;  4HM3 B;  1KSI A;  3PCS A;  4NHF A;  2BMR B;  3KE7 A;  1IV9 A;  5STD A;  4PEJ A;  3CMA 3;  2CC3 A;  1K8A 4;  1JB4 A;  1N5H A;  3BB9 A;  4FMD A;  1YIJ 3;  1O7N B;  2V1L A;  3NV0 A;  3I55 3;  2D42 A;  3K63 A;  1QJG A;  3K5T A;  1DVD A;  3EN1 B;  3NM7 A;  1QVG 2;  1NU3 A;  1AV4 A;  4RNY A;  1FGR A;  3TDG A;  1N9J A;  3CCV 3;  1LXE A;  4HM0 B;  1TU5 A;  2CIU A;  2WGO A;  4AKY A;  3GAX A;  3HIG A;  1VQM 3;  2GBW B;  3X3X A;  2YFI B;  4HJL B;  3F40 A;  3RGA A;  4H61 A;  2OWP A;  3K9M C;  2GBX B;  2CW9 A;  2BMQ B;  3GWR A;  2FGT A;  4BTX A;  3BNE A;  4XM4 A;  1OUN A;  4Q53 A;  1FGM A;  3JUP A;  1OCV A;  1JJ2 2;  5ELU A;  3N8B A;  4IT7 A;  3KSE D;  1WMP A;  1HKX A;  2O3O A;  1A2V A;  1EQK A;  2CH9 A;  2FXT A;  1VZZ A;  1IVU A;  4LZI A;  4BTW A;  1TFK A;  5CLK A;  3U1W A;  1Y4K A;  1DMQ A;  4K61 A;  3H51 A;  1JKG A;  3BNC A;  4ORL A;  2FNQ A;  2PZV A;  2W0Q A;  3N54 B;  1O7M B;  5AIH A;  1QAF A;  1WMO A;  3Q2P A;  1FGT A;  3DGN A;  5KP3 A;  3FSD A;  5HGR A;  2Y73 A;  1SQW A;  3LOY A;  4FMB A;  2P38 A;  5IW9 A;  4OVM A;  3CPW 2;  1KQS 2;  2GEY A;  4WYK B;  3SOY A;  1OAC A;  3LH4 A;  2ZDJ A;  2K0M A;  1PU4 A;  2HMN B;  1ZO2 A;  2JQ5 A;  2WO0 A;  2XH9 A;  4BTY A;  2ML5 A;  1YJ9 3;  1Q7Y 4;  1M9G A;  1JNQ A;  3EHC A;  3FG4 A;  4CCV A;  1U5O A;  1GD4 A;  8CHO A;  1AVK A;  2BO9 B;  1VQP 3;  2WGQ A;  1GY6 A;  1JB5 A;  1LVN A;  4EYC A;  3CCJ 3;  1V74 A;  3SED A;  2E2U A;  1FA3 A;  1QAK A;  4WWU C;  2Y74 A;  4HM7 B;  3LTB A;  1GY7 A;  1W00 A;  1YGE A;  2GU3 A;  3FF2 A;  3CCL 3;  4HM1 B;  1OHP A;  2GXF A;  3NV0 B;  1PFP A;  1UUV B;  1AR0 A;  1NWW A;  2WOH A;  4GB5 A;  2W2C A;  1W6G A;  4FCM A;  3I56 3;  3PYJ A;  1VQ7 3;  3G16 A;  4J9A A;  4WP5 A;  2B24 B;  1OGX A;  3JVC A;  4HM5 B;  3MG3 A;  1DYU A;  1YIT 3;  1VQ5 3;  1UI8 A;  2HMO B;  2I9W A;  2XR8 B;  3KSP A;  1MNL A;  1W6Y A;  3M8C A;  3EBY A;  3G71 3;  4EBG A;  1UUW B;  4MJD A;  5IEN A;  3F7S A;  1A90 A;  3B8L A;  3NM2 A;  2CG0 A;  1Q81 4;  2CKF B;  4OUQ A;  3Q1C A;  3HZP A;  1AVL A;  4N6O B;  3OWU A;  2P05 A;  3PCR A;  3CC7 3;  4R9L A;  3QK9 A;  4N6L A;  2LYX A;  2W56 B;  2INX A;  2IMJ A;  3EJV A;  3CPO A;  5TGN A;  2STD A;  2YFJ B;  1E3R A;  3KKG A;  4KFE A;  4N6V 0;  4TX4 A;  5AEW B;  4RBN A;  3G8Z A;  4XDW A;  1FGQ A;  1CYV A;  1VQ4 3;  2CHC A;  1SJW A;  2MC8 A;  7STD A;  2IA7 A;  5ELJ A;  1STF I;  2QGU A;  1D6U A;  2E2T A;  5KP4 A;  3MSO A;  1VQN 3;  1VQ9 3;  1O7P B;  3RDE A;  3NBB A;  2R4I A;  3FG3 A;  2Z76 A;  2F98 A;  4HVN A;  3T8U A;  1BUQ A;  4FCZ A;  1IQX A;  5AI1 A;  3S28 A;  4KFF A;  2RGQ A;  2GU1 A;  1FUW A;  1IQY A;  5JPP A;  1GY5 A;  3HII A;  3WDG B;  3KFQ C;  5AYR B;  4N3V A;  5A0O B;  3B7C A;  5FGO A;  3DGO A;  2IUJ A;  1K41 A;  2Z6B A;  2KXG A;  2YX9 A;  1RJO A;  3DXO A;  2CG1 A;  3MKI A;  3QRD A;  2W9P A;  2CWV A;  2Z77 A;  4N6T A;  5IER A;  3SLU A;  1RN7 A;  1TP6 A;  1VQK 3;  4FR9 A;  5EEO A;  3CXC 2;  1KC8 4;  4U13 A;  1D6Z A;  4QWT A;  1W5Z A;  1U8C B;  2W56 A;  1WNH A;  4FMC A;  2XEP A;  3GZR A;  4N6M A;  5FW5 A;  1NO3 A;  3FKA A;  2CFL A;  1M1K 4;  2P09 A;  3K7C A;  2YFL B;  5JBS A;  1OGZ A;  4GL6 A;  1N5P A;  4HKV B;  3FCS B;  3VF1 A;  3HX8 A;  3MG2 A;  1EG9 B;  3FGY A;  5IG4 A;  1QAL A;  5IG0 A;  1ASK A;  3Q90 A;  3EX9 A;  1K28 A;  3AMO B;  3PS8 A;  3MPH A;  1RRL A;  2D1W A;  3BND A;  4HM6 B;  1OPY A;  3BNB A;  5DRE A;  4X2H A;  2PNC A;  3DGL A;  1CQS A;  4NRE A;  5JPU A;  1W6C A;  5IEP A;  1D6Y A;  4HYZ A;  3NBJ A;  4RZM A;  2C11 A;  1JV2 B;  4JF8 A;  1OHO A;  4N6U A;  3B4P A;  1OHS A;  2M7O A;  4R9K A;  2QA4 3;  1NB3 I;  1JB2 A;  3F8X A;  2CFK A;  1KWI A;  1M1X B;  3X42 A;  3NQZ A;  1Q42 A;  3STD A;  3X41 A;  1ROV A;  2BT3 A;  1RRH A;  3UB1 A;  1F8N A;  3S5C A;  3H3H A;  1TIJ A;  3EN8 A;  1J2B A;  4N6N B;  1W02 A;  4KFD A;  4H3U A;  2W9Q A;  1K73 4;  3MG1 A;  1IVW A;  3LT9 A;  4K1U A;  2UX0 A;  2HMK B;  2XSO B;  1ROA A;  1OH0 A;  1Z1S A;  2F99 A;  5EQL A;  3LYG A;  1K9M 4;  2O9U X;  3IJE B;  1VQL 3;  4AKZ A;  1Q82 4;  2F86 B;  4EV2 A;  2KRT A;  5CXO A;  1W01 A;  1TFO A;  3SOA A;  1CYU A;  3NUV A;  1LNH A;  3AMO A;  2CK3 H;  1W2B 2;  1W4N A;  1NJI 4;  4HZ9 B;  2QEX 3;  4XBT A;  3OW2 2;  4KVH A;  3UL5 A;  1IV7 A;  3GZB A;  3G4S 3;  1DVC A;  1W7C A;  3MWZ A;  3OWY A;  4L8P A;  4MMX B;  1YJN 3;  5BXQ A;  1YHQ 3;  4FMA A;  3LTA A;  1Q40 A;  1SPU A;  3F14 A;  2Z7A A;  4O02 B;  4WHA A;  1FGO A;  5CK6 A;  4OK0 A;  3S27 A;  3EBT A;  5D82 A;  4O3V A;  1IVV A;  3LT8 A;  3EQQ B;  2L4V A;  3KII A;  1QMA A;  1C7H A;  3G0K A;  1IT8 A;  5AEU B;  4J8T A;  5EVH A;  3JUO A;  3OV4 A;  2GEX A;  1ULI B;  3V99 A;  1OF5 A;  2MF7 A;  4HM2 B;  3LTC A;  2BHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...