5CLKA

Crystal structure of sz348 in complex with s,s-cyclohexanediol
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
HHHHHHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal structure of SZ348 in complex with S,S-cyclohexanediol
rcsb
source organism Rhodococcus erythropolis
total genus 45
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5clkA00
4HKVB 2GEXA 1OHPA 3GZRA 1ZO2A 3LYGA 1BUQA 3EC9A 2HMLB 5IENA 2Z7AA 4N3VA 4PEJA 5CF1A 2BMRB 5CXOA 5BXQA 2BMQB 1Q40A 3CU3A 4LGQA 3DXOA 1NWWA 4J8TA 4HM1B 5CF2A 3NUVA 1S5AA 1ASKA 1K41A 4OUQA 4XBXA 1GY7A 4RZMA 1JB2A 1O7PB 5AEUB 3RGRA 1O7MB 4STDA 1ULIB 5G2GA 4FCJA 1DMMA 3JUPA 7STDA 2HMMB 1E3VA 3MG2A 5D83A 4KVHA 3NM2A 3IPTA 5KP4A 2CHCA 2B24B 2RCDA 1VZZA 3JUNA 2XSOB 3KE7A 5CK6A 1QJGA 1OUNA 1ZX2A 2QGUA 3FSDA 5DRVA 4HZ9B 2YFLB 4WYKB 1O7HB 1ULJB 3FLJA 3FZWA 3FF0A 4L8OA 1OGZA 4WYKA 3JUOA 2HMKB 5FW5A 4I4KA 3S5CA 5IG0A 2Z77A 3SEDA 1C7HA 5AIGA 1A2KA 3CPOA 1OPYA 2YFIB 4K1UA 5IF6A 1JKGA 3RGAA 2GBWB 3GZYB 1UUVB 3DMCA 3VGNA 3CNXA 3F14A 2XRXB 1UUWB 3GZBA 1Q40B 3OWSA 1SJWA 1EG9B 2W2CA 4HM3B 2GXFA 3GRDA 3EQQB 4GB5A 3LZAA 4XB5A 4XBTA 1HKXA 4H3UA 2B1XB 1W02A 3F40A 4XDWA 4HM8B 2XR8B 2I9WA 1W00A 2QIYA 2YFJB 3G0KA 5BVBA 2RGQA 1AR0A 2BMOB 2STDA 3HX8A 3STDA 1ISKA 1NU3A 3ER7A 3EF8A 3F8HA 3SOAA 4CDLA 2HMOB 1TUHA 3CNMA 4ORLA 4LMIA 3B8LA 2K54A 4Q53A 3H3HA 5IG4A 2GBXB 3ROBA 1IDPA 3MSOA 2F86B 3FKAA 5IG5A 4R1KA 5AI1A 3I0YA 4L8PA 3KSPA 2R4IA 5AEWB 3EN8A 3G8ZA 3ECFA 8CHOA 2Z76A 3MKIA 3EN1B 2HMJB 4HVNA 3Q90A 1OF5A 4LEHA 3EHCA 4HM0B 3EX9A 5DREA 1JKGB 1STDA 3SOYA 1OGXA 3NHXA 1O7GB 3B4OA 3T8UA 5AIIA 1WQLB 4XM4A 1GS3A 3BB9A 3F9SA 3H51A 3DM8A 3MHEA 3FH1A 3KKGA 2UX0A 3UNLA 3JUQA 1U5OA 5D82A 3BLZA 3EBTA 5JPUA 1Z1SA 1JB4A 1JN5B 2HMNB 2F98A 2PZVA 4HM2B 2BNGA 1OHSA 1QMAA 1DMQA 1JN5A 3F7SA 4IIAA 4FCMA 1GY5A 3B7CA 3OX9A 3OWYA 3OV4A 1W6YA 5TGNA 2RFRA 4MJDA 4XDVA 3MG1A 1EA2A 3M8CA 4K1VA 1E3RA 3HK4A 5IERA 1OH0A 5KP3A 1W01A 4R9LA 3GZXB 4OVMA 4HM5B 2INXA 3F8XA 5AIHA 5AIFA 3EBYA 3DZLA 3EJVA 3B4PA 3K0ZA 3VSYA 4WP5A 3D9RA 3NXJA 4HM6B 1Q42A 3G16A 4R9KA 3MG3A 3NBRA 5IG3A 1OHOA 1NDOB 3DUKA 4J9AA 5IEPA 5JPPA 1TP6A 3E99A 5EVHA 3T8NA 4X2HA 1OF5B 3A76A 4HZBB 3UJMA 4HJLB 3KZTA 3F7XA 5STDA 3OXAA 3OWUA 2JQ5A 5KP1A 1O7WB 5CLKA 2XSHB 1DMNA 1JB5A 4L7KA 3K7CA 2IMJA 2A15A 1GY6A 1CQSA 3NV0B 4HM7B 1O7NB 2GEYA 4U13A 5IEOA 1GYBA 3MYTA 3HZPA 3WMDA 2F99A 3NV0A 5HGRA 2CKFB 3FGYA 3GWRA 1E97A 4XBYA 5D81A 4WWUC 4X2OA 6STDA 2OWPA 1OCVA 3FF2A 3JUMA 4HM4B
chains in the Genus database with same CATH superfamily
1BANA 2CWUA 2WOFA 4JF8A 3BNDA 1BUJA 4HKVB 2GU1A 2OTJ3 3BU4A 1NJI4 3PXMA 4BTXA 2GEXA 2JDIH 1OHPA 3GZRA 1ZO2A 3LYGA 4GHOA 3EC9A 2HMLB 4QWTA 3WOFB 2ML5A 3WODG 3A5EA 4KFEA 1JV2B 1RGEA 4MEIA 5IENA 2Z7AA 4N3VA 3D5IA 3CC23 4PEJA 5I97A 3LT8A 3PYJA 4MMXB 5BU4A 5CF1A 2BMRB 4EC6A 1VQM3 1BRJA 3AHWA 1SARA 3HOHA 5CXOA 1BSCA 2BMQB 5BXQA 1IV7A 1CYVA 1RRLA 2F56A 2BU4A 2KAAA 1Q40A 3CU3A 1VQ53 4LGQA 3DXOA 2BT3A 3K63A 3UB1A 3EE1A 4N6TA 3L0RA 1KWIA 1NWWA 1YIJ3 3NBJA 4J8TA 2K0MA 3CCJ3 4HM1B 1BSEA 5CF2A 1BRHA 1RMSA 1JZDA 3LXUX 3NUVA 3AGNA 1S5AA 1ASKA 1U8CB 1K41A 1LXEA 2E2UA 4BIRA 4OUQA 1D6ZA 1RN4A 1Q7Y4 4XBXA 1VQ63 1GY7A 4G1MB 4RZMA 1JB2A 1O7PB 1B27A 5AEUB 3RGRA 1O7MB 4STDA 1ULIB 2R41A 1IQXA 2UUGC 4FCJA 4R4KA 5G2GA 6RNTA 1W2B2 1DMMA 1BNJA 4RBNA 3JUPA 3CCE3 1N8R4 4EW5A 1GD4A 2CFKA 7STDA 1HU9A 2HMMB 4GL6A 1YNVX 1E3VA 4BU4A 1RGAA 2O9UX 3MG2A 3D5GA 5D83A 2CC3A 4KVHA 2AAEA 3NM2A 4N6V0 2XGNA 3IPTA 5KP4A 1V57A 2CHCA 1JZOA 2B24B 3FG1A 1V58A 2RCDA 1VZZA 3RDEA 3DGOA 3JUNA 2XSOB 4NHFA 2KXGA 3KE7A 2ZL8A 3Q1CA 1I2FA 5CK6A 2XH9A 1QJGA 3K5TA 1OUNA 1RGHA 5BIRA 1ZX2A 2KF6A 2Y73A 3BNCA 1R4YA 2QGUA 3SX1A 2OTL3 3FSDA 3K9MC 5DRVA 4FMDA 1I70A 3PS8A 1Q7HA 4HZ9B 4HBRA 1W5ZA 2YFLB 1RCKA 1KSIA 4WYKB 1O7HB 5FGOA 8RNTA 2P38A 1ULJB 1DVCA 1QAKA 3FLJA 1B2MA 1I2EA 3KCHA 3AGOA 1FW7A 4MMYB 3FZWA 3FF0A 3X3ZA 4L8OA 1OGZA 4WYKA 2CK3H 3CCL3 3FG3A 1YIT3 1VQ83 2ML6A 3O8YA 3JUOA 2HMKB 4K90B 5FW5A 4I4KA 1GOYA 3UL5A 2WGOA 3S5CA 1UW1A 3IJEB 5IG0A 2Z77A 3SEDA 4IPBA 1N8QA 4RNYA 3WA3A 2MC8A 1C7HA 5AIGA 3CPW2 1L5GB 1A2KA 3LH4A 1JBTA 2H0IA 1FUWA 2KF4A 1S723 3CPOA 4J5GA 1B20A 2SBLA 1OPYA 2YFIB 4K1UA 1CH0A 3S67A 4AKZA 3UL6A 3MPHA 1VQ93 5IF6A 3FCSB 2P09A 1JKGA 1RN1A 3RGAA 2W03A 2CFDA 1QALA 3DH2A 2GBWB 4KFDA 5G1LA 2HOHA 3GZYB 3CME3 1UGIA 3WHOA 3SVAA 4KT3B 2E2TA 1UUVB 1MWRA 1VQ73 1YGWA 3WA2X 1LOYA 3PCRA 3DMCA 3VGNA 3KN4A 3CNXA 3F14A 2XRXB 1UUWB 1AVLA 3LOYA 2O3OA 2WOHA 3TDGA 3GZBA 1IT7A 5M19A 3HI7A 5A0OB 1Q40B 1RN7A 3HIIA 1SJWA 3OWSA 4KZ1A 1EG9B 5M1AA 2OOVA 2C4BA 2W2CA 6GSPA 5EQLA 1Q814 2IA7A 2F5MA 1YGEA 1AV4A 2M7OA 1W6CA 1UUGB 1BNRA 3I553 4HM3B 1BNIA 2GXFA 3GRDA 2CX1A 3EQQB 4GB5A 3LZAA 1EEJA 1MWUA 4XBTA 4XB5A 5LC6A 1LNIA 3LTBA 3J7Yd 1T2HA 5M18A 1RGFA 2P0MA 1D6UA 3LMLA 3N54B 1B2ZA 1M1K4 1HKXA 1FGRA 3BNEA 4FR9A 4H3UA 2B1XB 1HZ1A 1W02A 4N6LA 3QRDA 1FGQA 3F40A 4XDWA 1TFKA 4HM8B 9RNTA 2XR8B 1GMQA 2CFGA 2KF3A 2XFTA 2I9WA 3I563 1W00A 2QIYA 2ZDJA 1MNLA 1AVKA 2YFJB 1STFI 1ZS7A 3G0KA 3CD63 3Q2PA 3LTAA 1IU7A 4TX4A 5BVBA 4H61A 1NB5I 2RGQA 1VQ43 1RLSA 1TFOA 2RBIA 1AR0A 2BMOB 2SARA 1T3BA 2STDA 1FGTA 3HX8A 4K61A 3STDA 1KC84 1YJW3 2L4VA 1NU3A 1ISKA 3BNBA 3LT9A 1I3IA 1ROAA 4ZM8A 3JVCA 5LC7A 3ER7A 1LOXA 1A2VA 3EF8A 3F8HA 2C11A 3D3LA 2IYJA 1LRAA 1QAFA 3SXXA 4O2HA 3X41A 4HAAA 1VQQA 4MMZB 3FG4A 1Q864 1ZGXA 3RNTA 4N6UA 1RCLA 1IQ8A 3SOAA 1GMPA 1RGGA 1IT8A 1CEWI 1N9JA 4CDLA 2HMOB 1K28A 1BGSA 1JBRA 4FMCA 1N5HA 1TUHA 1JBSA 1DVDA 1HYFA 1MWTA 2OQEC 1BIRA 4RNZA 1BUQA 2KCDA 4GSPA 3G713 1BNFA 1Y4KA 3CNMA 4ORLA 4LMIA 1I2GA 1BRSA 3B8LA 2K54A 2CFWA 4EBGA 3CXC2 1C54A 4Q53A 3H3HA 2FNQA 5IG4A 2GBXB 3U1WA 1I8VA 3ROBA 1W6GA 1IDPA 3MSOA 2F86B 3FKAA 1JJ22 4RNTA 5IG5A 3NM7A 4LSOA 4R1KA 1UCKA 1RHLA 1F8NA 3EB8A 5AI1A 1BRKA 2KRTA 1TTOA 3DGMA 1FZUA 1GOVA 5AYSC 5HOHA 5IW9A 2FXTA 1N5PA 1WMOA 3I0YA 4L8PA 3ZFZA 1SPUA 3AHSA 3KSPA 3X42A 2R4IA 5AEWB 3EN8A 3G8ZA 1YHQ3 1PYLA 1UI7A 2F4YA 2YX9A 3ECFA 8CHOA 4CCVA 3CCM3 1GSPA 2Z76A 1IVVA 3MKIA 1EKMA 4EV5A 1VQN3 2D42A 3EN1B 1OACA 2HMJB 3Q90A 4HVNA 1RRHA 1OF5A 2Z6BA 3V99A 4LEHA 4HYZA 3EHCA 1B2SA 2P05A 1LOVA 4CJNA 4HM0B 1IVUA 2LYXA 3EX9A 2BIRA 3PZWA 1WTHA 5DREA 1JKGB 4FMBA 1Q9EA 1STDA 1PU4A 3SOYA 1OGXA 1TRPA 3AMOA 1BSAA 1YI23 1ROVA 1R4CA 3NHXA 3WDGB 1AY7A 2UGIA 1O7GB 5ELJA 4NPBA 1X1UA 1B21A 1X1WA 2Y74A 3B4OA 4OK0A 1I3FA 2FGTA 3T8UA 2CG1A 2RNTA 1NB3I 3CMA3 4O3VA 5AIIA 3T0UA 1WQLB 1RNBA 1FUTA 1DYUA 3PCSA 3X3XA 2QA43 1RGKA 4XM4A 2XGLA 1GS3A 3BB9A 2XFSA 3F9SA 3H51A 1A67A 3DM8A 3MHEA 2WO0A 1QVF2 3LTDA 1RDSA 3FH1A 3KKGA 2H0GA 2OCTA 2UX0A 5GSPA 3SLUA 3UNLA 3JUQA 1U5OA 5D82A 3BLZA 3NQZA 3PGBA 2CWTA 1IVWA 3EBTA 3X3YA 5JPUA 1I0XA 1Z1SA 1JB4A 1JN5B 1BOXA 1TJDA 2HMNB 4IT7A 2QEX3 2BHMA 2F98A 2PZVA 2W04A 2KF5A 4HM2B 3MWZA 1K734 1BVIA 3N9HA 2BNGA 2H0HA 1FA3A 3ALAA 1UDII 4ILFA 1OHSA 1BU4A 1WMPA 1D6YA 1QMAA 1DMQA 1JN5A 2WGQA 2D1WA 1RKYA 2E2VA 3CCV3 2AADA 1JRQA 3F7SA 3IMAB 2PNCA 3CCU3 4IIAA 4FCMA 1GY5A 1UCJA 2CG0A 3B7CA 1FUSA 4BTWA 3OX9A 1FGMA 4AEQA 2LQVA 1FYSA 4N6MA 3S28A 3OWYA 3S29A 3OV4A 1W6YA 1BNEA 5TGNA 2RFRA 4MJDA 1M904 4XDVA 3MG1A 4EXRA 7RNTA 1EA2A 1T2IA 1VQO3 3M8CA 1E3RA 4K1VA 1BRNL 1VQP3 3HK4A 5IERA 1OH0A 3HIGA 4HOHA 2W6JH 1SIIA 4JRFA 5KP3A 1W01A 3G6E3 5ELUA 4R9LA 3GZXB 1MOLA 1TU5A 4OVMA 2CFLA 4WFOA 1GOUA 1MGRA 1DE3A 4KFFA 1PY3A 4EYCA 2C10A 2INXA 4HM5B 2V1LA 3F8XA 1BNGA 2J8XB 5AIHA 5AIFA 2GU3A 2F5WA 3D4AA 3EBYA 4AKYA 3N8BA 3DZLA 1YJN3 4LZIA 3EJVA 1IVXA 1WMNA 3QK9A 1SQWA 1EQKA 3B4PA 3K0ZA 3LTCA 1UCIA 1YVSA 3VSYA 4WP5A 1M1XB 5G1KA 3D9RA 1V74A 3NXJA 5RNTA 3DGNA 4HM6B 1W2ZA 1Q42A 2Q07A 1US1A 3G16A 3WOEB 3ZG0A 1A2PA 4R9KA 3MG3A 1IK3A 4BL3A 1X1YA 1Q824 3NBRA 1M9GA 2W9QA 1OHOA 1TIJA 1RSNA 5IG3A 4J5KA 5EEOA 1B2UA 1NDOB 3NX0A 4N6NB 2CIUA 1BNSA 3DUKA 5JBSA 3VF1A 4J9AA 5IEPA 3DGLA 1W7CA 1UGHI 5JPPA 1TP6A 4EV2A 3E99A 2XF3A 1A90A 3URPA 1RGLA 5EVHA 1JNQA 1QVG2 1DETA 3KFQC 3T8NA 1BRGA 1MWSA 1OF5B 1X1XA 3A76A 4HZBB 4O02B 4X2HA 1MGWA 1UCLA 3DGYA 3V98A 4FCZA 3UJMA 1CYUA 4HJLB 1YVBI 3KZTA 1KD14 4BTYA 3F7XA 4O8SA 1BAOA 1IYYA 1LNHA 1EUIC 4I5QA 1LVNA 1GD3A 2CX0A 3NQYA 5STDA 1T5YA 3CC73 1J2BA 1RGCA 3OXAA 2IUKA 2ZHXB 3OWUA 3S27A 2JQ5A 3KSED 1LOWA 1AQZA 1O7WB 3AMOB 1LQGC 1BSDA 3D79A 3NBBA 3WR2A 5KP1A 2OQEA 5CLKA 1B2XA 2IY2A 1FGOA 1NO3A 2W0QA 2XSHB 1RNTA 1DMNA 2W56B 1JB5A 5AYRB 1IQYA 4L7KA 3CC43 2RSXA 2IMJA 1BSBA 2ZA4A 3K7CA 1G96A 2A15A 1SIHA 1GY6A 2GSPA 3CCS3 1CQSA 3G4S3 2BO9B 3BIRA 2OOVC 3NV0B 4HM7B 3OW22 1KQS2 1O7NB 1RTUA 3SYUA 2GEYA 4U13A 5IEOA 2W56A 4NREA 1WNHA 4N6OB 3CCQ3 3ZG5A 1IV9A 3KIIA 4LYLB 3V92A 1GYBA 3MYTA 1VQL3 2XEPA 1PFPA 2L1SA 4CPKA 3HZPA 3WMDA 4BL2A 2F99A 3NV0A 2MF7A 1B3SA 5HGRA 3CCR3 2CKFB 3FGYA 3GWRA 1E97A 2W9PA 1NNVA 2CWVA 4XBYA 5D81A 7GSPA 3DY5A 1K8A4 1UI8A 1RJOA 3GAXA 1BRIA 1I0VA 1TRQA 4WWUC 4X2OA 1N9EA 6STDA 2IUJA 2OWPA 1K9M4 1G02A 1OCVA 3U97A 3Q3FA 4DKIA 3X40A 4FMAA 1GMRA 3FF2A 3GSPA 3JUMA 4R80A 2CW9A 1LQMB 1VQK3 2CH9A 2P0XA 4WHAA 2K3DA 1G0TA 4HM4B 1YJ93 1W4NA
chains in the Genus database with same CATH topology
2WOFA 2CWUA 4JF8A 3BNDA 4HKVB 2GU1A 2OTJ3 1NJI4 3PXMA 4BTXA 2GEXA 2JDIH 1OHPA 3GZRA 1ZO2A 3LYGA 4QWTA 3EC9A 2HMLB 4ZM8A 3WOFB 2ML5A 3WODG 4KFEA 5IENA 1JV2B 4MEIA 2Z7AA 4N3VA 3CC23 4PEJA 5I97A 3LT8A 3PYJA 4MMXB 5CF1A 2BMRB 4EC6A 1VQM3 5CXOA 5BXQA 2BMQB 1IV7A 1CYVA 1RRLA 1Q40A 3CU3A 1VQ53 4LGQA 3DXOA 2BT3A 3K63A 3UB1A 3EE1A 4N6TA 3L0RA 1KWIA 1NWWA 1YIJ3 3NBJA 4J8TA 2K0MA 3CCJ3 4HM1B 5CF2A 3LXUX 3NUVA 1S5AA 1ASKA 1U8CB 1K41A 1LXEA 2E2UA 4OUQA 1D6ZA 1Q7Y4 1VQ63 4XBXA 1GY7A 4G1MB 4RZMA 1JB2A 1O7PB 5AEUB 3RGRA 1O7MB 4STDA 1ULIB 1IQXA 5G2GA 4FCJA 4R4KA 1W2B2 1DMMA 4RBNA 3JUPA 3CCE3 1N8R4 1GD4A 2CFKA 7STDA 1HU9A 2HMMB 4GL6A 1E3VA 2O9UX 3MG2A 5D83A 2CC3A 4KVHA 3NM2A 4N6V0 2XGNA 3IPTA 5KP4A 2CHCA 2B24B 3FG1A 2RCDA 1VZZA 3RDEA 3DGOA 3JUNA 2XSOB 4NHFA 2KXGA 3KE7A 2ZL8A 3Q1CA 5CK6A 2XH9A 1QJGA 3K5TA 1OUNA 1ZX2A 2Y73A 3BNCA 3SX1A 2QGUA 2OTL3 3FSDA 3K9MC 5DRVA 4FMDA 3PS8A 4HZ9B 4HBRA 1W5ZA 2YFLB 1KSIA 4WYKB 1O7HB 5FGOA 2P38A 1ULJB 1DVCA 1QAKA 3FLJA 4MMYB 3FZWA 3FF0A 3X3ZA 4L8OA 1OGZA 4WYKA 2CK3H 3CCL3 3FG3A 1YIT3 1VQ83 2ML6A 3O8YA 3JUOA 2HMKB 4K90B 5FW5A 4I4KA 3UL5A 2WGOA 3S5CA 1UW1A 3IJEB 5IG0A 2Z77A 3SEDA 4IPBA 1N8QA 4RNYA 3WA3A 2MC8A 1C7HA 5AIGA 3CPW2 1L5GB 1A2KA 3LH4A 1FUWA 1S723 3CPOA 2SBLA 1OPYA 2YFIB 4K1UA 3S67A 4AKZA 3UL6A 3MPHA 1VQ93 5IF6A 3FCSB 2P09A 1JKGA 3RGAA 2W03A 2CFDA 1QALA 4KFDA 2GBWB 3GZYB 3CME3 3SVAA 2E2TA 1UUVB 1VQ73 3WA2X 3PCRA 3DMCA 3VGNA 3KN4A 3CNXA 3F14A 2XRXB 1UUWB 1AVLA 3LOYA 2O3OA 2WOHA 3TDGA 3GZBA 1IT7A 3HI7A 5A0OB 1Q40B 1RN7A 3HIIA 1SJWA 3OWSA 4KZ1A 1EG9B 2OOVA 2W2CA 1Q814 5EQLA 2IA7A 1YGEA 1AV4A 2M7OA 1W6CA 3I553 4HM3B 2GXFA 3GRDA 3EQQB 4GB5A 3LZAA 4XB5A 4XBTA 5LC6A 3LTBA 3J7Yd 3N54B 2P0MA 1D6UA 3LMLA 1M1K4 1HKXA 1FGRA 3BNEA 4FR9A 4H3UA 2B1XB 1W02A 4N6LA 3QRDA 1FGQA 3F40A 4XDWA 1TFKA 4HM8B 2XR8B 2CFGA 2XFTA 2I9WA 3I563 1W00A 2QIYA 2ZDJA 1MNLA 1AVKA 2YFJB 1STFI 3G0KA 3CD63 3Q2PA 3LTAA 1IU7A 4TX4A 5BVBA 4H61A 1NB5I 2RGQA 1VQ43 1TFOA 1AR0A 2BMOB 2STDA 3HX8A 4K61A 1FGTA 3STDA 1KC84 1ISKA 1YJW3 2L4VA 1NU3A 3BNBA 3LT9A 1ROAA 3JVCA 5LC7A 3ER7A 1LOXA 1A2VA 3EF8A 3F8HA 2C11A 3D3LA 1QAFA 3SXXA 4O2HA 3X41A 4MMZB 3FG4A 1Q864 4N6UA 1IQ8A 3SOAA 1IT8A 1CEWI 1N9JA 4CDLA 2HMOB 1K28A 4FMCA 1N5HA 1TUHA 1DVDA 2OQEC 4RNZA 1BUQA 2KCDA 3G713 1Y4KA 3CNMA 4ORLA 4LMIA 3B8LA 3CXC2 2K54A 2CFWA 4EBGA 4Q53A 3H3HA 2FNQA 5IG4A 2GBXB 3U1WA 3ROBA 1W6GA 1IDPA 3MSOA 2F86B 3FKAA 1JJ22 5IG5A 3NM7A 4LSOA 4R1KA 1F8NA 3EB8A 5AI1A 2KRTA 3CC73 3DGMA 5AYSC 5IW9A 2FXTA 1N5PA 1WMOA 3I0YA 4L8PA 1SPUA 3X42A 3KSPA 2R4IA 5AEWB 3EN8A 3G8ZA 1YHQ3 1UI7A 2YX9A 3ECFA 8CHOA 4CCVA 3CCM3 4EV5A 2Z76A 1IVVA 3MKIA 1EKMA 1VQN3 2D42A 3EN1B 1OACA 2HMJB 3Q90A 4HVNA 1RRHA 1OF5A 2Z6BA 3V99A 4LEHA 4HYZA 3EHCA 2P05A 4HM0B 1IVUA 2LYXA 3EX9A 3PZWA 1WTHA 5DREA 1JKGB 4FMBA 1STDA 1PU4A 3SOYA 1OGXA 3AMOA 1YI23 1ROVA 1R4CA 3NHXA 3WDGB 1O7GB 5ELJA 2Y74A 3B4OA 4OK0A 2FGTA 3T8UA 2CG1A 1NB3I 3CMA3 4O3VA 5AIIA 3T0UA 1WQLB 2QA43 1DYUA 3PCSA 3X3XA 4XM4A 2XGLA 1GS3A 3BB9A 2XFSA 3F9SA 3H51A 1A67A 3DM8A 3MHEA 2WO0A 1QVF2 3LTDA 3FH1A 3KKGA 2OCTA 2UX0A 3SLUA 3UNLA 3JUQA 1U5OA 5D82A 3BLZA 3NQZA 3PGBA 2CWTA 1IVWA 3EBTA 3X3YA 5JPUA 1Z1SA 1JB4A 1JN5B 2HMNB 4IT7A 2QEX3 2BHMA 2F98A 2PZVA 2W04A 4HM2B 1K734 3MWZA 3N9HA 2BNGA 1FA3A 3ALAA 1OHSA 1WMPA 1D6YA 1QMAA 1DMQA 1JN5A 2WGQA 2D1WA 1RKYA 2E2VA 3CCV3 1JRQA 3F7SA 3IMAB 2PNCA 3CCU3 4IIAA 4FCMA 1GY5A 2CG0A 3B7CA 4BTWA 3OX9A 1FGMA 4AEQA 2LQVA 4N6MA 3S28A 3OWYA 3S29A 3OV4A 1W6YA 5TGNA 2RFRA 4MJDA 1M904 4XDVA 3MG1A 4EXRA 1EA2A 1VQO3 3M8CA 1E3RA 4K1VA 1VQP3 3HK4A 5IERA 1OH0A 3HIGA 4JRFA 2W6JH 1SIIA 5KP3A 1W01A 3G6E3 5ELUA 4R9LA 3GZXB 1MOLA 1TU5A 4OVMA 2CFLA 4WFOA 4KFFA 4EYCA 2C10A 2INXA 4HM5B 2V1LA 3F8XA 5AIHA 5AIFA 2GU3A 3EBYA 4AKYA 3N8BA 3DZLA 1YJN3 4LZIA 3EJVA 1IVXA 1WMNA 3QK9A 1SQWA 1EQKA 3B4PA 3K0ZA 3LTCA 3VSYA 4WP5A 1M1XB 3D9RA 1V74A 3NXJA 3DGNA 4HM6B 1W2ZA 1Q42A 2Q07A 1US1A 3G16A 3WOEB 4R9KA 3MG3A 1IK3A 1Q824 3NBRA 1M9GA 2W9QA 1OHOA 1TIJA 5IG3A 5EEOA 1NDOB 4N6NB 3NX0A 2CIUA 3DUKA 5JBSA 3VF1A 4J9AA 5IEPA 3DGLA 1W7CA 5JPPA 1TP6A 4EV2A 3E99A 2XF3A 1A90A 5EVHA 1JNQA 1QVG2 3KFQC 3T8NA 4X2HA 1OF5B 3A76A 4HZBB 4O02B 3V98A 4FCZA 3UJMA 1CYUA 4HJLB 1YVBI 3KZTA 1KD14 4BTYA 3F7XA 4O8SA 1LNHA 1LVNA 1GD3A 3NQYA 5STDA 1T5YA 1J2BA 3OXAA 2IUKA 3OWUA 3S27A 2JQ5A 3KSED 3NBBA 5KP1A 1O7WB 3AMOB 2OQEA 5CLKA 1FGOA 2XSHB 2W0QA 1NO3A 1DMNA 2W56B 1JB5A 5AYRB 1IQYA 4L7KA 3CC43 2RSXA 2IMJA 3K7CA 1G96A 2A15A 1SIHA 1GY6A 3CCS3 1CQSA 3G4S3 2BO9B 2OOVC 3NV0B 4HM7B 3OW22 1KQS2 1O7NB 2GEYA 4U13A 5IEOA 2W56A 4NREA 1WNHA 4N6OB 3CCQ3 1IV9A 3KIIA 3V92A 1VQL3 1GYBA 3MYTA 2XEPA 1PFPA 3HZPA 3WMDA 2F99A 3NV0A 2MF7A 5HGRA 3CCR3 2CKFB 3FGYA 3GWRA 1E97A 2W9PA 4XBYA 2CWVA 5D81A 1K8A4 3DY5A 1UI8A 1RJOA 3GAXA 4WWUC 4X2OA 1N9EA 6STDA 2IUJA 2OWPA 1K9M4 1OCVA 3U97A 3X40A 4FMAA 3FF2A 3JUMA 4R80A 2CW9A 1VQK3 2CH9A 2P0XA 4WHAA 4HM4B 1YJ93 1W4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKV B;  2GEX A;  1OHP A;  3GZR A;  1ZO2 A;  3LYG A;  1BUQ A;  3EC9 A;  2HML B;  5IEN A;  2Z7A A;  4N3V A;  4PEJ A;  5CF1 A;  2BMR B;  5CXO A;  5BXQ A;  2BMQ B;  1Q40 A;  3CU3 A;  4LGQ A;  3DXO A;  1NWW A;  4J8T A;  4HM1 B;  5CF2 A;  3NUV A;  1S5A A;  1ASK A;  1K41 A;  4OUQ A;  4XBX A;  1GY7 A;  4RZM A;  1JB2 A;  1O7P B;  5AEU B;  3RGR A;  1O7M B;  4STD A;  1ULI B;  5G2G A;  4FCJ A;  1DMM A;  3JUP A;  7STD A;  2HMM B;  1E3V A;  3MG2 A;  5D83 A;  4KVH A;  3NM2 A;  3IPT A;  5KP4 A;  2CHC A;  2B24 B;  2RCD A;  1VZZ A;  3JUN A;  2XSO B;  3KE7 A;  5CK6 A;  1QJG A;  1OUN A;  1ZX2 A;  2QGU A;  3FSD A;  5DRV A;  4HZ9 B;  2YFL B;  4WYK B;  1O7H B;  1ULJ B;  3FLJ A;  3FZW A;  3FF0 A;  4L8O A;  1OGZ A;  4WYK A;  3JUO A;  2HMK B;  5FW5 A;  4I4K A;  3S5C A;  5IG0 A;  2Z77 A;  3SED A;  1C7H A;  5AIG A;  1A2K A;  3CPO A;  1OPY A;  2YFI B;  4K1U A;  5IF6 A;  1JKG A;  3RGA A;  2GBW B;  3GZY B;  1UUV B;  3DMC A;  3VGN A;  3CNX A;  3F14 A;  2XRX B;  1UUW B;  3GZB A;  1Q40 B;  3OWS A;  1SJW A;  1EG9 B;  2W2C A;  4HM3 B;  2GXF A;  3GRD A;  3EQQ B;  4GB5 A;  3LZA A;  4XB5 A;  4XBT A;  1HKX A;  4H3U A;  2B1X B;  1W02 A;  3F40 A;  4XDW A;  4HM8 B;  2XR8 B;  2I9W A;  1W00 A;  2QIY A;  2YFJ B;  3G0K A;  5BVB A;  2RGQ A;  1AR0 A;  2BMO B;  2STD A;  3HX8 A;  3STD A;  1ISK A;  1NU3 A;  3ER7 A;  3EF8 A;  3F8H A;  3SOA A;  4CDL A;  2HMO B;  1TUH A;  3CNM A;  4ORL A;  4LMI A;  3B8L A;  2K54 A;  4Q53 A;  3H3H A;  5IG4 A;  2GBX B;  3ROB A;  1IDP A;  3MSO A;  2F86 B;  3FKA A;  5IG5 A;  4R1K A;  5AI1 A;  3I0Y A;  4L8P A;  3KSP A;  2R4I A;  5AEW B;  3EN8 A;  3G8Z A;  3ECF A;  8CHO A;  2Z76 A;  3MKI A;  3EN1 B;  2HMJ B;  4HVN A;  3Q90 A;  1OF5 A;  4LEH A;  3EHC A;  4HM0 B;  3EX9 A;  5DRE A;  1JKG B;  1STD A;  3SOY A;  1OGX A;  3NHX A;  1O7G B;  3B4O A;  3T8U A;  5AII A;  1WQL B;  4XM4 A;  1GS3 A;  3BB9 A;  3F9S A;  3H51 A;  3DM8 A;  3MHE A;  3FH1 A;  3KKG A;  2UX0 A;  3UNL A;  3JUQ A;  1U5O A;  5D82 A;  3BLZ A;  3EBT A;  5JPU A;  1Z1S A;  1JB4 A;  1JN5 B;  2HMN B;  2F98 A;  2PZV A;  4HM2 B;  2BNG A;  1OHS A;  1QMA A;  1DMQ A;  1JN5 A;  3F7S A;  4IIA A;  4FCM A;  1GY5 A;  3B7C A;  3OX9 A;  3OWY A;  3OV4 A;  1W6Y A;  5TGN A;  2RFR A;  4MJD A;  4XDV A;  3MG1 A;  1EA2 A;  3M8C A;  4K1V A;  1E3R A;  3HK4 A;  5IER A;  1OH0 A;  5KP3 A;  1W01 A;  4R9L A;  3GZX B;  4OVM A;  4HM5 B;  2INX A;  3F8X A;  5AIH A;  5AIF A;  3EBY A;  3DZL A;  3EJV A;  3B4P A;  3K0Z A;  3VSY A;  4WP5 A;  3D9R A;  3NXJ A;  4HM6 B;  1Q42 A;  3G16 A;  4R9K A;  3MG3 A;  3NBR A;  5IG3 A;  1OHO A;  1NDO B;  3DUK A;  4J9A A;  5IEP A;  5JPP A;  1TP6 A;  3E99 A;  5EVH A;  3T8N A;  4X2H A;  1OF5 B;  3A76 A;  4HZB B;  3UJM A;  4HJL B;  3KZT A;  3F7X A;  5STD A;  3OXA A;  3OWU A;  2JQ5 A;  5KP1 A;  1O7W B;  5CLK A;  2XSH B;  1DMN A;  1JB5 A;  4L7K A;  3K7C A;  2IMJ A;  2A15 A;  1GY6 A;  1CQS A;  3NV0 B;  4HM7 B;  1O7N B;  2GEY A;  4U13 A;  5IEO A;  1GYB A;  3MYT A;  3HZP A;  3WMD A;  2F99 A;  3NV0 A;  5HGR A;  2CKF B;  3FGY A;  3GWR A;  1E97 A;  4XBY A;  5D81 A;  4WWU C;  4X2O A;  6STD A;  2OWP A;  1OCV A;  3FF2 A;  3JUM A;  4HM4 B; 
#chains in the Genus database with same CATH topology
 1BAN A;  2CWU A;  2WOF A;  4JF8 A;  3BND A;  1BUJ A;  4HKV B;  2GU1 A;  2OTJ 3;  3BU4 A;  1NJI 4;  3PXM A;  4BTX A;  2GEX A;  2JDI H;  1OHP A;  3GZR A;  1ZO2 A;  3LYG A;  4GHO A;  3EC9 A;  2HML B;  4QWT A;  3WOF B;  2ML5 A;  3WOD G;  3A5E A;  4KFE A;  1JV2 B;  1RGE A;  4MEI A;  5IEN A;  2Z7A A;  4N3V A;  3D5I A;  3CC2 3;  4PEJ A;  5I97 A;  3LT8 A;  3PYJ A;  4MMX B;  5BU4 A;  5CF1 A;  2BMR B;  4EC6 A;  1VQM 3;  1BRJ A;  3AHW A;  1SAR A;  3HOH A;  5CXO A;  1BSC A;  2BMQ B;  5BXQ A;  1IV7 A;  1CYV A;  1RRL A;  2F56 A;  2BU4 A;  2KAA A;  1Q40 A;  3CU3 A;  1VQ5 3;  4LGQ A;  3DXO A;  2BT3 A;  3K63 A;  3UB1 A;  3EE1 A;  4N6T A;  3L0R A;  1KWI A;  1NWW A;  1YIJ 3;  3NBJ A;  4J8T A;  2K0M A;  3CCJ 3;  4HM1 B;  1BSE A;  5CF2 A;  1BRH A;  1RMS A;  1JZD A;  3LXU X;  3NUV A;  3AGN A;  1S5A A;  1ASK A;  1U8C B;  1K41 A;  1LXE A;  2E2U A;  4BIR A;  4OUQ A;  1D6Z A;  1RN4 A;  1Q7Y 4;  4XBX A;  1VQ6 3;  1GY7 A;  4G1M B;  4RZM A;  1JB2 A;  1O7P B;  1B27 A;  5AEU B;  3RGR A;  1O7M B;  4STD A;  1ULI B;  2R41 A;  1IQX A;  2UUG C;  4FCJ A;  4R4K A;  5G2G A;  6RNT A;  1W2B 2;  1DMM A;  1BNJ A;  4RBN A;  3JUP A;  3CCE 3;  1N8R 4;  4EW5 A;  1GD4 A;  2CFK A;  7STD A;  1HU9 A;  2HMM B;  4GL6 A;  1YNV X;  1E3V A;  4BU4 A;  1RGA A;  2O9U X;  3MG2 A;  3D5G A;  5D83 A;  2CC3 A;  4KVH A;  2AAE A;  3NM2 A;  4N6V 0;  2XGN A;  3IPT A;  5KP4 A;  1V57 A;  2CHC A;  1JZO A;  2B24 B;  3FG1 A;  1V58 A;  2RCD A;  1VZZ A;  3RDE A;  3DGO A;  3JUN A;  2XSO B;  4NHF A;  2KXG A;  3KE7 A;  2ZL8 A;  3Q1C A;  1I2F A;  5CK6 A;  2XH9 A;  1QJG A;  3K5T A;  1OUN A;  1RGH A;  5BIR A;  1ZX2 A;  2KF6 A;  2Y73 A;  3BNC A;  1R4Y A;  2QGU A;  3SX1 A;  2OTL 3;  3FSD A;  3K9M C;  5DRV A;  4FMD A;  1I70 A;  3PS8 A;  1Q7H A;  4HZ9 B;  4HBR A;  1W5Z A;  2YFL B;  1RCK A;  1KSI A;  4WYK B;  1O7H B;  5FGO A;  8RNT A;  2P38 A;  1ULJ B;  1DVC A;  1QAK A;  3FLJ A;  1B2M A;  1I2E A;  3KCH A;  3AGO A;  1FW7 A;  4MMY B;  3FZW A;  3FF0 A;  3X3Z A;  4L8O A;  1OGZ A;  4WYK A;  2CK3 H;  3CCL 3;  3FG3 A;  1YIT 3;  1VQ8 3;  2ML6 A;  3O8Y A;  3JUO A;  2HMK B;  4K90 B;  5FW5 A;  4I4K A;  1GOY A;  3UL5 A;  2WGO A;  3S5C A;  1UW1 A;  3IJE B;  5IG0 A;  2Z77 A;  3SED A;  4IPB A;  1N8Q A;  4RNY A;  3WA3 A;  2MC8 A;  1C7H A;  5AIG A;  3CPW 2;  1L5G B;  1A2K A;  3LH4 A;  1JBT A;  2H0I A;  1FUW A;  2KF4 A;  1S72 3;  3CPO A;  4J5G A;  1B20 A;  2SBL A;  1OPY A;  2YFI B;  4K1U A;  1CH0 A;  3S67 A;  4AKZ A;  3UL6 A;  3MPH A;  1VQ9 3;  5IF6 A;  3FCS B;  2P09 A;  1JKG A;  1RN1 A;  3RGA A;  2W03 A;  2CFD A;  1QAL A;  3DH2 A;  2GBW B;  4KFD A;  5G1L A;  2HOH A;  3GZY B;  3CME 3;  1UGI A;  3WHO A;  3SVA A;  4KT3 B;  2E2T A;  1UUV B;  1MWR A;  1VQ7 3;  1YGW A;  3WA2 X;  1LOY A;  3PCR A;  3DMC A;  3VGN A;  3KN4 A;  3CNX A;  3F14 A;  2XRX B;  1UUW B;  1AVL A;  3LOY A;  2O3O A;  2WOH A;  3TDG A;  3GZB A;  1IT7 A;  5M19 A;  3HI7 A;  5A0O B;  1Q40 B;  1RN7 A;  3HII A;  1SJW A;  3OWS A;  4KZ1 A;  1EG9 B;  5M1A A;  2OOV A;  2C4B A;  2W2C A;  6GSP A;  5EQL A;  1Q81 4;  2IA7 A;  2F5M A;  1YGE A;  1AV4 A;  2M7O A;  1W6C A;  1UUG B;  1BNR A;  3I55 3;  4HM3 B;  1BNI A;  2GXF A;  3GRD A;  2CX1 A;  3EQQ B;  4GB5 A;  3LZA A;  1EEJ A;  1MWU A;  4XBT A;  4XB5 A;  5LC6 A;  1LNI A;  3LTB A;  3J7Y d;  1T2H A;  5M18 A;  1RGF A;  2P0M A;  1D6U A;  3LML A;  3N54 B;  1B2Z A;  1M1K 4;  1HKX A;  1FGR A;  3BNE A;  4FR9 A;  4H3U A;  2B1X B;  1HZ1 A;  1W02 A;  4N6L A;  3QRD A;  1FGQ A;  3F40 A;  4XDW A;  1TFK A;  4HM8 B;  9RNT A;  2XR8 B;  1GMQ A;  2CFG A;  2KF3 A;  2XFT A;  2I9W A;  3I56 3;  1W00 A;  2QIY A;  2ZDJ A;  1MNL A;  1AVK A;  2YFJ B;  1STF I;  1ZS7 A;  3G0K A;  3CD6 3;  3Q2P A;  3LTA A;  1IU7 A;  4TX4 A;  5BVB A;  4H61 A;  1NB5 I;  2RGQ A;  1VQ4 3;  1RLS A;  1TFO A;  2RBI A;  1AR0 A;  2BMO B;  2SAR A;  1T3B A;  2STD A;  1FGT A;  3HX8 A;  4K61 A;  3STD A;  1KC8 4;  1YJW 3;  2L4V A;  1NU3 A;  1ISK A;  3BNB A;  3LT9 A;  1I3I A;  1ROA A;  4ZM8 A;  3JVC A;  5LC7 A;  3ER7 A;  1LOX A;  1A2V A;  3EF8 A;  3F8H A;  2C11 A;  3D3L A;  2IYJ A;  1LRA A;  1QAF A;  3SXX A;  4O2H A;  3X41 A;  4HAA A;  1VQQ A;  4MMZ B;  3FG4 A;  1Q86 4;  1ZGX A;  3RNT A;  4N6U A;  1RCL A;  1IQ8 A;  3SOA A;  1GMP A;  1RGG A;  1IT8 A;  1CEW I;  1N9J A;  4CDL A;  2HMO B;  1K28 A;  1BGS A;  1JBR A;  4FMC A;  1N5H A;  1TUH A;  1JBS A;  1DVD A;  1HYF A;  1MWT A;  2OQE C;  1BIR A;  4RNZ A;  1BUQ A;  2KCD A;  4GSP A;  3G71 3;  1BNF A;  1Y4K A;  3CNM A;  4ORL A;  4LMI A;  1I2G A;  1BRS A;  3B8L A;  2K54 A;  2CFW A;  4EBG A;  3CXC 2;  1C54 A;  4Q53 A;  3H3H A;  2FNQ A;  5IG4 A;  2GBX B;  3U1W A;  1I8V A;  3ROB A;  1W6G A;  1IDP A;  3MSO A;  2F86 B;  3FKA A;  1JJ2 2;  4RNT A;  5IG5 A;  3NM7 A;  4LSO A;  4R1K A;  1UCK A;  1RHL A;  1F8N A;  3EB8 A;  5AI1 A;  1BRK A;  2KRT A;  1TTO A;  3DGM A;  1FZU A;  1GOV A;  5AYS C;  5HOH A;  5IW9 A;  2FXT A;  1N5P A;  1WMO A;  3I0Y A;  4L8P A;  3ZFZ A;  1SPU A;  3AHS A;  3KSP A;  3X42 A;  2R4I A;  5AEW B;  3EN8 A;  3G8Z A;  1YHQ 3;  1PYL A;  1UI7 A;  2F4Y A;  2YX9 A;  3ECF A;  8CHO A;  4CCV A;  3CCM 3;  1GSP A;  2Z76 A;  1IVV A;  3MKI A;  1EKM A;  4EV5 A;  1VQN 3;  2D42 A;  3EN1 B;  1OAC A;  2HMJ B;  3Q90 A;  4HVN A;  1RRH A;  1OF5 A;  2Z6B A;  3V99 A;  4LEH A;  4HYZ A;  3EHC A;  1B2S A;  2P05 A;  1LOV A;  4CJN A;  4HM0 B;  1IVU A;  2LYX A;  3EX9 A;  2BIR A;  3PZW A;  1WTH A;  5DRE A;  1JKG B;  4FMB A;  1Q9E A;  1STD A;  1PU4 A;  3SOY A;  1OGX A;  1TRP A;  3AMO A;  1BSA A;  1YI2 3;  1ROV A;  1R4C A;  3NHX A;  3WDG B;  1AY7 A;  2UGI A;  1O7G B;  5ELJ A;  4NPB A;  1X1U A;  1B21 A;  1X1W A;  2Y74 A;  3B4O A;  4OK0 A;  1I3F A;  2FGT A;  3T8U A;  2CG1 A;  2RNT A;  1NB3 I;  3CMA 3;  4O3V A;  5AII A;  3T0U A;  1WQL B;  1RNB A;  1FUT A;  1DYU A;  3PCS A;  3X3X A;  2QA4 3;  1RGK A;  4XM4 A;  2XGL A;  1GS3 A;  3BB9 A;  2XFS A;  3F9S A;  3H51 A;  1A67 A;  3DM8 A;  3MHE A;  2WO0 A;  1QVF 2;  3LTD A;  1RDS A;  3FH1 A;  3KKG A;  2H0G A;  2OCT A;  2UX0 A;  5GSP A;  3SLU A;  3UNL A;  3JUQ A;  1U5O A;  5D82 A;  3BLZ A;  3NQZ A;  3PGB A;  2CWT A;  1IVW A;  3EBT A;  3X3Y A;  5JPU A;  1I0X A;  1Z1S A;  1JB4 A;  1JN5 B;  1BOX A;  1TJD A;  2HMN B;  4IT7 A;  2QEX 3;  2BHM A;  2F98 A;  2PZV A;  2W04 A;  2KF5 A;  4HM2 B;  3MWZ A;  1K73 4;  1BVI A;  3N9H A;  2BNG A;  2H0H A;  1FA3 A;  3ALA A;  1UDI I;  4ILF A;  1OHS A;  1BU4 A;  1WMP A;  1D6Y A;  1QMA A;  1DMQ A;  1JN5 A;  2WGQ A;  2D1W A;  1RKY A;  2E2V A;  3CCV 3;  2AAD A;  1JRQ A;  3F7S A;  3IMA B;  2PNC A;  3CCU 3;  4IIA A;  4FCM A;  1GY5 A;  1UCJ A;  2CG0 A;  3B7C A;  1FUS A;  4BTW A;  3OX9 A;  1FGM A;  4AEQ A;  2LQV A;  1FYS A;  4N6M A;  3S28 A;  3OWY A;  3S29 A;  3OV4 A;  1W6Y A;  1BNE A;  5TGN A;  2RFR A;  4MJD A;  1M90 4;  4XDV A;  3MG1 A;  4EXR A;  7RNT A;  1EA2 A;  1T2I A;  1VQO 3;  3M8C A;  1E3R A;  4K1V A;  1BRN L;  1VQP 3;  3HK4 A;  5IER A;  1OH0 A;  3HIG A;  4HOH A;  2W6J H;  1SII A;  4JRF A;  5KP3 A;  1W01 A;  3G6E 3;  5ELU A;  4R9L A;  3GZX B;  1MOL A;  1TU5 A;  4OVM A;  2CFL A;  4WFO A;  1GOU A;  1MGR A;  1DE3 A;  4KFF A;  1PY3 A;  4EYC A;  2C10 A;  2INX A;  4HM5 B;  2V1L A;  3F8X A;  1BNG A;  2J8X B;  5AIH A;  5AIF A;  2GU3 A;  2F5W A;  3D4A A;  3EBY A;  4AKY A;  3N8B A;  3DZL A;  1YJN 3;  4LZI A;  3EJV A;  1IVX A;  1WMN A;  3QK9 A;  1SQW A;  1EQK A;  3B4P A;  3K0Z A;  3LTC A;  1UCI A;  1YVS A;  3VSY A;  4WP5 A;  1M1X B;  5G1K A;  3D9R A;  1V74 A;  3NXJ A;  5RNT A;  3DGN A;  4HM6 B;  1W2Z A;  1Q42 A;  2Q07 A;  1US1 A;  3G16 A;  3WOE B;  3ZG0 A;  1A2P A;  4R9K A;  3MG3 A;  1IK3 A;  4BL3 A;  1X1Y A;  1Q82 4;  3NBR A;  1M9G A;  2W9Q A;  1OHO A;  1TIJ A;  1RSN A;  5IG3 A;  4J5K A;  5EEO A;  1B2U A;  1NDO B;  3NX0 A;  4N6N B;  2CIU A;  1BNS A;  3DUK A;  5JBS A;  3VF1 A;  4J9A A;  5IEP A;  3DGL A;  1W7C A;  1UGH I;  5JPP A;  1TP6 A;  4EV2 A;  3E99 A;  2XF3 A;  1A90 A;  3URP A;  1RGL A;  5EVH A;  1JNQ A;  1QVG 2;  1DET A;  3KFQ C;  3T8N A;  1BRG A;  1MWS A;  1OF5 B;  1X1X A;  3A76 A;  4HZB B;  4O02 B;  4X2H A;  1MGW A;  1UCL A;  3DGY A;  3V98 A;  4FCZ A;  3UJM A;  1CYU A;  4HJL B;  1YVB I;  3KZT A;  1KD1 4;  4BTY A;  3F7X A;  4O8S A;  1BAO A;  1IYY A;  1LNH A;  1EUI C;  4I5Q A;  1LVN A;  1GD3 A;  2CX0 A;  3NQY A;  5STD A;  1T5Y A;  3CC7 3;  1J2B A;  1RGC A;  3OXA A;  2IUK A;  2ZHX B;  3OWU A;  3S27 A;  2JQ5 A;  3KSE D;  1LOW A;  1AQZ A;  1O7W B;  3AMO B;  1LQG C;  1BSD A;  3D79 A;  3NBB A;  3WR2 A;  5KP1 A;  2OQE A;  5CLK A;  1B2X A;  2IY2 A;  1FGO A;  1NO3 A;  2W0Q A;  2XSH B;  1RNT A;  1DMN A;  2W56 B;  1JB5 A;  5AYR B;  1IQY A;  4L7K A;  3CC4 3;  2RSX A;  2IMJ A;  1BSB A;  2ZA4 A;  3K7C A;  1G96 A;  2A15 A;  1SIH A;  1GY6 A;  2GSP A;  3CCS 3;  1CQS A;  3G4S 3;  2BO9 B;  3BIR A;  2OOV C;  3NV0 B;  4HM7 B;  3OW2 2;  1KQS 2;  1O7N B;  1RTU A;  3SYU A;  2GEY A;  4U13 A;  5IEO A;  2W56 A;  4NRE A;  1WNH A;  4N6O B;  3CCQ 3;  3ZG5 A;  1IV9 A;  3KII A;  4LYL B;  3V92 A;  1GYB A;  3MYT A;  1VQL 3;  2XEP A;  1PFP A;  2L1S A;  4CPK A;  3HZP A;  3WMD A;  4BL2 A;  2F99 A;  3NV0 A;  2MF7 A;  1B3S A;  5HGR A;  3CCR 3;  2CKF B;  3FGY A;  3GWR A;  1E97 A;  2W9P A;  1NNV A;  2CWV A;  4XBY A;  5D81 A;  7GSP A;  3DY5 A;  1K8A 4;  1UI8 A;  1RJO A;  3GAX A;  1BRI A;  1I0V A;  1TRQ A;  4WWU C;  4X2O A;  1N9E A;  6STD A;  2IUJ A;  2OWP A;  1K9M 4;  1G02 A;  1OCV A;  3U97 A;  3Q3F A;  4DKI A;  3X40 A;  4FMA A;  1GMR A;  3FF2 A;  3GSP A;  3JUM A;  4R80 A;  2CW9 A;  1LQM B;  1VQK 3;  2CH9 A;  2P0X A;  4WHA A;  2K3D A;  1G0T A;  4HM4 B;  1YJ9 3;  1W4N A; 
#chains in the Genus database with same CATH homology
 2WOF A;  2CWU A;  4JF8 A;  3BND A;  4HKV B;  2GU1 A;  2OTJ 3;  1NJI 4;  3PXM A;  4BTX A;  2GEX A;  2JDI H;  1OHP A;  3GZR A;  1ZO2 A;  3LYG A;  4QWT A;  3EC9 A;  2HML B;  4ZM8 A;  3WOF B;  2ML5 A;  3WOD G;  4KFE A;  5IEN A;  1JV2 B;  4MEI A;  2Z7A A;  4N3V A;  3CC2 3;  4PEJ A;  5I97 A;  3LT8 A;  3PYJ A;  4MMX B;  5CF1 A;  2BMR B;  4EC6 A;  1VQM 3;  5CXO A;  5BXQ A;  2BMQ B;  1IV7 A;  1CYV A;  1RRL A;  1Q40 A;  3CU3 A;  1VQ5 3;  4LGQ A;  3DXO A;  2BT3 A;  3K63 A;  3UB1 A;  3EE1 A;  4N6T A;  3L0R A;  1KWI A;  1NWW A;  1YIJ 3;  3NBJ A;  4J8T A;  2K0M A;  3CCJ 3;  4HM1 B;  5CF2 A;  3LXU X;  3NUV A;  1S5A A;  1ASK A;  1U8C B;  1K41 A;  1LXE A;  2E2U A;  4OUQ A;  1D6Z A;  1Q7Y 4;  1VQ6 3;  4XBX A;  1GY7 A;  4G1M B;  4RZM A;  1JB2 A;  1O7P B;  5AEU B;  3RGR A;  1O7M B;  4STD A;  1ULI B;  1IQX A;  5G2G A;  4FCJ A;  4R4K A;  1W2B 2;  1DMM A;  4RBN A;  3JUP A;  3CCE 3;  1N8R 4;  1GD4 A;  2CFK A;  7STD A;  1HU9 A;  2HMM B;  4GL6 A;  1E3V A;  2O9U X;  3MG2 A;  5D83 A;  2CC3 A;  4KVH A;  3NM2 A;  4N6V 0;  2XGN A;  3IPT A;  5KP4 A;  2CHC A;  2B24 B;  3FG1 A;  2RCD A;  1VZZ A;  3RDE A;  3DGO A;  3JUN A;  2XSO B;  4NHF A;  2KXG A;  3KE7 A;  2ZL8 A;  3Q1C A;  5CK6 A;  2XH9 A;  1QJG A;  3K5T A;  1OUN A;  1ZX2 A;  2Y73 A;  3BNC A;  3SX1 A;  2QGU A;  2OTL 3;  3FSD A;  3K9M C;  5DRV A;  4FMD A;  3PS8 A;  4HZ9 B;  4HBR A;  1W5Z A;  2YFL B;  1KSI A;  4WYK B;  1O7H B;  5FGO A;  2P38 A;  1ULJ B;  1DVC A;  1QAK A;  3FLJ A;  4MMY B;  3FZW A;  3FF0 A;  3X3Z A;  4L8O A;  1OGZ A;  4WYK A;  2CK3 H;  3CCL 3;  3FG3 A;  1YIT 3;  1VQ8 3;  2ML6 A;  3O8Y A;  3JUO A;  2HMK B;  4K90 B;  5FW5 A;  4I4K A;  3UL5 A;  2WGO A;  3S5C A;  1UW1 A;  3IJE B;  5IG0 A;  2Z77 A;  3SED A;  4IPB A;  1N8Q A;  4RNY A;  3WA3 A;  2MC8 A;  1C7H A;  5AIG A;  3CPW 2;  1L5G B;  1A2K A;  3LH4 A;  1FUW A;  1S72 3;  3CPO A;  2SBL A;  1OPY A;  2YFI B;  4K1U A;  3S67 A;  4AKZ A;  3UL6 A;  3MPH A;  1VQ9 3;  5IF6 A;  3FCS B;  2P09 A;  1JKG A;  3RGA A;  2W03 A;  2CFD A;  1QAL A;  4KFD A;  2GBW B;  3GZY B;  3CME 3;  3SVA A;  2E2T A;  1UUV B;  1VQ7 3;  3WA2 X;  3PCR A;  3DMC A;  3VGN A;  3KN4 A;  3CNX A;  3F14 A;  2XRX B;  1UUW B;  1AVL A;  3LOY A;  2O3O A;  2WOH A;  3TDG A;  3GZB A;  1IT7 A;  3HI7 A;  5A0O B;  1Q40 B;  1RN7 A;  3HII A;  1SJW A;  3OWS A;  4KZ1 A;  1EG9 B;  2OOV A;  2W2C A;  1Q81 4;  5EQL A;  2IA7 A;  1YGE A;  1AV4 A;  2M7O A;  1W6C A;  3I55 3;  4HM3 B;  2GXF A;  3GRD A;  3EQQ B;  4GB5 A;  3LZA A;  4XB5 A;  4XBT A;  5LC6 A;  3LTB A;  3J7Y d;  3N54 B;  2P0M A;  1D6U A;  3LML A;  1M1K 4;  1HKX A;  1FGR A;  3BNE A;  4FR9 A;  4H3U A;  2B1X B;  1W02 A;  4N6L A;  3QRD A;  1FGQ A;  3F40 A;  4XDW A;  1TFK A;  4HM8 B;  2XR8 B;  2CFG A;  2XFT A;  2I9W A;  3I56 3;  1W00 A;  2QIY A;  2ZDJ A;  1MNL A;  1AVK A;  2YFJ B;  1STF I;  3G0K A;  3CD6 3;  3Q2P A;  3LTA A;  1IU7 A;  4TX4 A;  5BVB A;  4H61 A;  1NB5 I;  2RGQ A;  1VQ4 3;  1TFO A;  1AR0 A;  2BMO B;  2STD A;  3HX8 A;  4K61 A;  1FGT A;  3STD A;  1KC8 4;  1ISK A;  1YJW 3;  2L4V A;  1NU3 A;  3BNB A;  3LT9 A;  1ROA A;  3JVC A;  5LC7 A;  3ER7 A;  1LOX A;  1A2V A;  3EF8 A;  3F8H A;  2C11 A;  3D3L A;  1QAF A;  3SXX A;  4O2H A;  3X41 A;  4MMZ B;  3FG4 A;  1Q86 4;  4N6U A;  1IQ8 A;  3SOA A;  1IT8 A;  1CEW I;  1N9J A;  4CDL A;  2HMO B;  1K28 A;  4FMC A;  1N5H A;  1TUH A;  1DVD A;  2OQE C;  4RNZ A;  1BUQ A;  2KCD A;  3G71 3;  1Y4K A;  3CNM A;  4ORL A;  4LMI A;  3B8L A;  3CXC 2;  2K54 A;  2CFW A;  4EBG A;  4Q53 A;  3H3H A;  2FNQ A;  5IG4 A;  2GBX B;  3U1W A;  3ROB A;  1W6G A;  1IDP A;  3MSO A;  2F86 B;  3FKA A;  1JJ2 2;  5IG5 A;  3NM7 A;  4LSO A;  4R1K A;  1F8N A;  3EB8 A;  5AI1 A;  2KRT A;  3CC7 3;  3DGM A;  5AYS C;  5IW9 A;  2FXT A;  1N5P A;  1WMO A;  3I0Y A;  4L8P A;  1SPU A;  3X42 A;  3KSP A;  2R4I A;  5AEW B;  3EN8 A;  3G8Z A;  1YHQ 3;  1UI7 A;  2YX9 A;  3ECF A;  8CHO A;  4CCV A;  3CCM 3;  4EV5 A;  2Z76 A;  1IVV A;  3MKI A;  1EKM A;  1VQN 3;  2D42 A;  3EN1 B;  1OAC A;  2HMJ B;  3Q90 A;  4HVN A;  1RRH A;  1OF5 A;  2Z6B A;  3V99 A;  4LEH A;  4HYZ A;  3EHC A;  2P05 A;  4HM0 B;  1IVU A;  2LYX A;  3EX9 A;  3PZW A;  1WTH A;  5DRE A;  1JKG B;  4FMB A;  1STD A;  1PU4 A;  3SOY A;  1OGX A;  3AMO A;  1YI2 3;  1ROV A;  1R4C A;  3NHX A;  3WDG B;  1O7G B;  5ELJ A;  2Y74 A;  3B4O A;  4OK0 A;  2FGT A;  3T8U A;  2CG1 A;  1NB3 I;  3CMA 3;  4O3V A;  5AII A;  3T0U A;  1WQL B;  2QA4 3;  1DYU A;  3PCS A;  3X3X A;  4XM4 A;  2XGL A;  1GS3 A;  3BB9 A;  2XFS A;  3F9S A;  3H51 A;  1A67 A;  3DM8 A;  3MHE A;  2WO0 A;  1QVF 2;  3LTD A;  3FH1 A;  3KKG A;  2OCT A;  2UX0 A;  3SLU A;  3UNL A;  3JUQ A;  1U5O A;  5D82 A;  3BLZ A;  3NQZ A;  3PGB A;  2CWT A;  1IVW A;  3EBT A;  3X3Y A;  5JPU A;  1Z1S A;  1JB4 A;  1JN5 B;  2HMN B;  4IT7 A;  2QEX 3;  2BHM A;  2F98 A;  2PZV A;  2W04 A;  4HM2 B;  1K73 4;  3MWZ A;  3N9H A;  2BNG A;  1FA3 A;  3ALA A;  1OHS A;  1WMP A;  1D6Y A;  1QMA A;  1DMQ A;  1JN5 A;  2WGQ A;  2D1W A;  1RKY A;  2E2V A;  3CCV 3;  1JRQ A;  3F7S A;  3IMA B;  2PNC A;  3CCU 3;  4IIA A;  4FCM A;  1GY5 A;  2CG0 A;  3B7C A;  4BTW A;  3OX9 A;  1FGM A;  4AEQ A;  2LQV A;  4N6M A;  3S28 A;  3OWY A;  3S29 A;  3OV4 A;  1W6Y A;  5TGN A;  2RFR A;  4MJD A;  1M90 4;  4XDV A;  3MG1 A;  4EXR A;  1EA2 A;  1VQO 3;  3M8C A;  1E3R A;  4K1V A;  1VQP 3;  3HK4 A;  5IER A;  1OH0 A;  3HIG A;  4JRF A;  2W6J H;  1SII A;  5KP3 A;  1W01 A;  3G6E 3;  5ELU A;  4R9L A;  3GZX B;  1MOL A;  1TU5 A;  4OVM A;  2CFL A;  4WFO A;  4KFF A;  4EYC A;  2C10 A;  2INX A;  4HM5 B;  2V1L A;  3F8X A;  5AIH A;  5AIF A;  2GU3 A;  3EBY A;  4AKY A;  3N8B A;  3DZL A;  1YJN 3;  4LZI A;  3EJV A;  1IVX A;  1WMN A;  3QK9 A;  1SQW A;  1EQK A;  3B4P A;  3K0Z A;  3LTC A;  3VSY A;  4WP5 A;  1M1X B;  3D9R A;  1V74 A;  3NXJ A;  3DGN A;  4HM6 B;  1W2Z A;  1Q42 A;  2Q07 A;  1US1 A;  3G16 A;  3WOE B;  4R9K A;  3MG3 A;  1IK3 A;  1Q82 4;  3NBR A;  1M9G A;  2W9Q A;  1OHO A;  1TIJ A;  5IG3 A;  5EEO A;  1NDO B;  4N6N B;  3NX0 A;  2CIU A;  3DUK A;  5JBS A;  3VF1 A;  4J9A A;  5IEP A;  3DGL A;  1W7C A;  5JPP A;  1TP6 A;  4EV2 A;  3E99 A;  2XF3 A;  1A90 A;  5EVH A;  1JNQ A;  1QVG 2;  3KFQ C;  3T8N A;  4X2H A;  1OF5 B;  3A76 A;  4HZB B;  4O02 B;  3V98 A;  4FCZ A;  3UJM A;  1CYU A;  4HJL B;  1YVB I;  3KZT A;  1KD1 4;  4BTY A;  3F7X A;  4O8S A;  1LNH A;  1LVN A;  1GD3 A;  3NQY A;  5STD A;  1T5Y A;  1J2B A;  3OXA A;  2IUK A;  3OWU A;  3S27 A;  2JQ5 A;  3KSE D;  3NBB A;  5KP1 A;  1O7W B;  3AMO B;  2OQE A;  5CLK A;  1FGO A;  2XSH B;  2W0Q A;  1NO3 A;  1DMN A;  2W56 B;  1JB5 A;  5AYR B;  1IQY A;  4L7K A;  3CC4 3;  2RSX A;  2IMJ A;  3K7C A;  1G96 A;  2A15 A;  1SIH A;  1GY6 A;  3CCS 3;  1CQS A;  3G4S 3;  2BO9 B;  2OOV C;  3NV0 B;  4HM7 B;  3OW2 2;  1KQS 2;  1O7N B;  2GEY A;  4U13 A;  5IEO A;  2W56 A;  4NRE A;  1WNH A;  4N6O B;  3CCQ 3;  1IV9 A;  3KII A;  3V92 A;  1VQL 3;  1GYB A;  3MYT A;  2XEP A;  1PFP A;  3HZP A;  3WMD A;  2F99 A;  3NV0 A;  2MF7 A;  5HGR A;  3CCR 3;  2CKF B;  3FGY A;  3GWR A;  1E97 A;  2W9P A;  4XBY A;  2CWV A;  5D81 A;  1K8A 4;  3DY5 A;  1UI8 A;  1RJO A;  3GAX A;  4WWU C;  4X2O A;  1N9E A;  6STD A;  2IUJ A;  2OWP A;  1K9M 4;  1OCV A;  3U97 A;  3X40 A;  4FMA A;  3FF2 A;  3JUM A;  4R80 A;  2CW9 A;  1VQK 3;  2CH9 A;  2P0X A;  4WHA A;  4HM4 B;  1YJ9 3;  1W4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...